2F6GA

Benm effector binding domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
216
Chain Sequence
KTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Distinct Effector-binding Sites Enable Synergistic Transcriptional Activation by BenM, a LysR-type Regulator.
pubmed doi rcsb
source organism Acinetobacter baylyi
molecule tags Transcription
total genus 65
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f6gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f6gA02
3U72A 3VLVA 3G7WA 3PMVA 2RF1A 2VD2A 4FJPA 1PDAA 3E4RA 4YB6A 1B1XA 1BTJA 2QMWA 3S9NC 4XKNA 4GIZA 3MJNA 3FGSA 3FV1A 3TTNA 4YB7A 4YKIA 3OOAA 1MY3A 4NWCA 3KG2A 4X9TA 1N84A 4M1VA 2AIXA 3KSXA 3MBPA 4DLDA 4NF5A 5AA2A 2HZKA 4EF2A 2Q8JA 2P0SA 3IJXB 1N04A 4RYAA 5I58B 4LVQA 4RK9A 1UTBA 2PT2A 3HHGA 2UVIA 3UK4A 1PB9A 5I2NA 2FA7A 1O7TA 1MXUA 1Q35A 2GFEA 2F7BA 2DWJA 2DSFA 4DZ1A 1Q1KA 4C1TA 1B0LA 5B7DA 4NF8A 1I69A 5FHMA 1QULA 1NNTA 4PETA 4F3GA 1M5FA 1HSLA 5F7VA 3N6TA 4X1BA 4KR5A 4NEDA 4IO3A 4R74A 2Y7WA 1UQWA 4P11A 3U94A 1N7WA 1NNPA 4ISUA 1OLAA 2DVCA 2DXRA 4C1UA 3QK6A 2DXYA 1GR2A 1EZOA 2QPQA 3KFMA 3T9HB 2VP1A 2H25A 3CIJA 4G68A 3C9HA 3TQWA 2CMOA 4H8JA 4G4PA 4ZEFA 1Y3QA 4ELOA 3B6TA 3V89B 2I6EA 3CFXA 1J1NA 4G8MA 5CMMA 4XXUA 4P0IA 2FYIA 4ELQA 2QSXA 5BWJA 2ZMBA 1I6BA 1JEUA 3VLWA 2GHBA 3C36A 2DVZA 3K6UA 3HV1A 3FATA 3SEXA 3N26A 2GHAA 2XX8A 2Y7RA 2O51A 3PPPA 4PFYA 2PMSA 4ESXA 2HEUA 1YCJA 3CSBA 4O3BA 3MP1A 1I6QA 2RINA 4TQUQ 3QYTA 3UP9A 4QFNA 2Q89A 4GXAA 4ZEBA 4YKJA 2R6GE 1A8FA 3Q28A 1FQAA 4IY6A 4HW8A 4HS7A 4R73A 3AXFA 4EUOA 3O28A 1VR5A 3OO8A 2OWSA 3IAZA 3LC8A 4LQ5A 4IO7A 1ANFA 1Y20A 4OETA 2DYXA 2H99A 2I4CA 3V8XB 4ONYA 3PPNA 1VFDA 5I2NB 1B4ZA 3IX1A 4OERA 1ZTYA 4DXUA 5L9OA 3KN3A 4ELPA 3SEVA 3MVZA 5H8NA 4LA9A 1US5A 3KN8A 4F19A 3PMWA 3OELA 3E9XA 4IB2A 4FE8A 4F1UA 2ZYKA 4KI0E 4YU0A 3VVDA 3UORA 3HO7A 3ODBA 1FQCA 3EPEA 1B5JA 4QFPA 1Y3PA 2DE2A 5H8QA 3K1MA 1SBPA 4G8NA 4NE4A 1HSJA 2AL5A 5DTBA 1R1NA 1USYH 3CG1A 5JK4A 4DXCA 4GOTA 2QRYA 5H8FB 1D9YA 1SI1A 4F31B 3C35A 3JV9A 4H6DA 1OLCA 2ESNA 3R6UA 2B3BA 4RA1A 2VOZA 4JB7A 5CBSA 1WVJA 1SW1A 1AMFA 2V93A 3TQLA 3MAMA 3TKDA 1ELJA 3B7DA 4YB5A 1OVTA 5ITOA 3CI8A 4GF8A 3DP6A 2RCBA 4H67A 5I2KA 1POY1 1SQYA 5ELVA 1Y4TA 4JSOA 3K2DA 4UA8A 4MLVA 4H5FA 2O69A 1OIBA 3FJGA 1LBCA 3G3GA 1DTZA 4GQOA 3MP6A 3TUSA 5H8HA 4EQ7A 1I6AA 4LUBA 3FXUA 5AA1A 4U1ZA 4LP2B 3RQTA 2NXOA 4F29A 2XXIA 4ZECA 1XC1A 2F36A 1ATGA 1FQDA 4Z0IA 4GL0A 3O6HA 4AQ4A 1UTHB 3W9VA 2A5TB 2PBWA 3ILUB 4JDFA 1B3EA 1P1NA 3ZKKA 2HZLA 1B51A 1MPBA 1MQIA 4U21A 3B6QA 4U22A 1S9TA 4F18A 4OESA 3RPWA 3N6UA 2OJTA 4XKQA 1M5DA 3OSQA 3TELA 1FQFA 4FECA 4NF6B 2HXWA 2I0CA 4JSDA 2Q2CA 4RK2A 5DYHA 3RT8A 4ZE9A 3R7XA 4JXIA 1LFIA 2O7UA 4GFRA 5KDTA 3VDFA 5TPAA 4MBPA 5JEIA 1WDNA 4OENA 2ZYMA 3T66A 5A5XA 2I48A 1MY1A 4YAHX 4FATA 4PE5B 4OFJA 2OK2A 3H4ZA 3CSGA 1LLSA 2ZNTA 2G29A 3TCFA 3PUWE 3Q29A 4R72A 3S4UA 3IR1A 3K01A 3K6VA 2RC8A 1MXZA 4BLAA 1PEBA 2Q88A 5DEXA 4JWYA 1R9LA 1MG1A 4DXBA 1TT1A 3KSJA 1NMUA 4JWXA 4GD5A 2OZZA 1MH4A 2H9BA 2R71A 3PPQA 2I3VA 3KZGA 4OEVA 3JYRA 2UVJA 3UGWA 3PV0E 3L6GA 4GWOA 2F7AA 3RT6B 3CFZA 3TFLA 1URSA 4ZZAA 2Y7IA 1SW4A 1DTGA 4POWA 3T22A 3H6WA 1XVYA 3QAXA 3N5LA 2H5YA 3IORA 4KCDA 4KCCA 1O64A 4GL8A 1MQDA 1BKAA 4O3CA 4OXVA 4R6HA 3SEWA 2FNCA 4C0RA 1XOCA 1EH3A 3THIA 1ZLQA 3USDA 1XHYA 2PYYA 4I1DA 2YPNA 2UVHA 3IK6B 4QFLA 1POTA 1BLFA 4KFQA 1XVXA 2VHAA 2I49A 4NF4A 1FTOA 2DWAA 3W9WA 2NWJA 2E0SA 3HPIA 3C31A 3RNNA 4F2QA 5KCJA 5HPQA 1B1HA 1LCFA 2HFBA 4XTCQ 4K3FA 3BFTA 1H43A 1LAXA 2W7YA 4DIGA 1JW1A 1IUDA 2HAVA 4PQJA 3LSLA 4R6KA 1Z7NE 5I57B 2Q2AA 1MDQA 1SI0A 5I56B 3MVWA 4N13A 1A54A 5KDTB 3E3KA 3M8UA 3KGCA 5AA4B 4ELRA 2Y7KA 3PMXA 2QL3A 1DMBA 3PGFA 1MXWA 3GBAA 3DP8A 3T9VA 4NWDA 5HM4B 3PD9A 3EF7A 1O63A 3N94A 3RN8A 4RPNA 4QFOA 2B65A 2UYEA 5DVIA 4F3SA 1FTJA 1AL3A 4H5GA 4EQ9A 3H3GA 4MFIA 4OFLA 3MP8A 1MXXA 4R75A 5DEXB 1MY0A 2QS3A 3CVGA 3M3FA 3OEKA 2RC9A 3MC2A 3T93B 2OBGA 3BFUA 3GXAA 4YMBA 1GVCA 5TU0A 2IA4A 3A3UA 3T9XB 1QUJA 2I0BA 1VE4A 4EXLA 3OXNA 3F11A 1MQGA 1H44A 2XX9A 3KBRA 4H0WA 3FVKA 3K0VA 1OQHA 2I4BA 3QIMA 4F1VA 4ESWA 4OQOA 1SDXA 1IXIA 2O6AA 2Y84A 3HN0A 1FW0A 4LQ2A 1B7ZA 2G93A 5EHSA 2F6PA 3PUYE 1TFAA 4NF5B 5AA2B 1HSEA 2O7IA 4O3AA 1B58A 1LSTA 2HQ0A 3C33A 1B5IA 1B3LA 4JBZA 5DVFA 1IQ7A 1UTBB 3PPRA 2P2AA 1B5HA 1OVBA 4DE8A 3QXMA 2XXWA 1MDP1 1DSNA 5K2XA 3VV5A 2NOOA 2VD3A 5CRYA 1D4NA 2AL4A 4Q8RA 3R26A 3IB2A 4U23A 1IXCA 2O68A 4NF8B 1P99A 4FIMA 1LFGA 3S2VA 1JW4A 3QUJA 4IY5A 4NTLA 2ALUA 3O66A 3S9EA 2ONRA 4KPTA 4IO5A 1P1UA 4FEBA 3VFJA 1JW5A 5I84A 3KJTA 1FQEA 3C32A 3TTKA 4KYSA 3VE1B 2NVUB 3TEPA 3VVEA 1QW0A 1FCKA 1MPDA 4IO6A 4G68B 3VVFA 1RYXA 4OYVA 1RKMA 5H8SA 5TP9A 2HAUA 3PD8A 3B6WA 3H06B 3M3LA 3U92A 4QRZA 3HCQA 1EZPA 3O29A 1N76A 3JZJA 3PU5A 2I3WA 3BKIB 1XT8A 1B05A 4WEDA 3TCHA 1B32A 5ITPA 2XXTA 3U8QA 3U93A 2GH9A 5FHNA 2DS9A 1MM6A 2X7PA 4ZE8A 3A3CA 4IGTA 1B7UA 4GRKA 4YICA 4KYEA 1R6ZA 5EHMA 4WXJA 3UA8A 5ISUA 4BDOA 1II5A 3UN6A 3FUZA 5AA3A 4ZEDA 3OO7A 5B70A 2V25A 1R9QA 3D4GA 1Y4CA 3LSFB 3G3IA 1ZBMA 1LAGE 3SEUA 2F97A 1MPCA 3FJMA 4H8IA 1M5EA 5AA2D 2F35A 3FIRA 2AYSA 1PB8A 4FAJA 4ZZEA 5L9MA 1QUIA 4X48A 3MZBA 1USYE 4DCXA 4RY1A 1QKBA 3TPAA 5M2VA 1CB6A 5ICQA 1BIYA 1NNFA 2XD2A 3KJ7A 1A7LA 3E13X 5H8NB 1T0KA 1B2HA 4QHQA 1A8EA 3IO4A 5I58A 3KOSA 5ICTA 1SVXB 3K1NA 3SKPA 1Z7ME 4RXLA 4TLLB 4H1XA 1QKAA 5L8DA 4ZS9A 2ZNUA 5EYFA 2XXUA 1GTKA 3ZSFA 4I62A 3KN7A 1A55A 3W15C 4BDNA 5H8QB 3PUZE 1AOVA 2CZLA 3K02A 3K1PA 4OEUA 3RGYA 3TZAA 3MPKA 3LUYA 1XS5A 2WKYA 5DVJA 3IO6A 4F2OA 1YAEA 3EHSA 1OQGA 3IB1A 4EXKA 1YTVA 1PBPA 3LBSA 3A09A 3IJOB 2ONKE 4Z7EA 1YPNA 1QJMA 1JVYA 1NH8A 2XXRA 1N0TA 2THIA 1CE2A 1GGGA 1FTKA 2XHDA 2Z22A 3SDFA 4E0WA 1OMPA 1ZJLA 4YZZA 2Z8EA 2D5WA 1IXGA 2ANJA 3T96B 2H4IA 1FTMA 2P1SA 1RYOA 1DPPA 2F8DA 2Z8DA 5I2KB 1TXFA 2B3FA 1MY4A 3CG3A 4F3BA 5AE4A 4YMAA 4U4SA 2DE4A 2DP8A 3O6IA 4F22A 2UVGA 3EQ1A 3BBRA 1N3WA 4YKKA 5CMKA 2DOJA 3I6VA 4G77A 1B3GA 4MH5A 5H8HB 4N6PA 3TTMA 4PFWA 3FASA 4XIGQ 4BDQA 2ZNSA 2A5SA 1F9BA 4R6YA 1QUKA 1SYIA 4OWDA 4MLQA 4N07A 2Q9TA 2PVUA 3IL1B 1AH5A 3WAEA 3ILTB 4LONB 5F1QA 3GLBA 3IOTA 3U1OA 1QVSA 4Q30B 2KLFA 2V3QA 2REGA 3CR9A 1KWHA 4EDPA 1LB9A 4P0GA 5FTIA 4AB5A 3H03A 3G3HA 3OSRA 4PFTA 1NKXA 4EQBA 1Y1MA 3ECRA 3MW0A 4R9GA 3OEMA 3ZS6A 4BDRA 4FEDA 4LATA 4LZ5A 3IOWA 4L17A 3I5OA 1B46A 2ZXTA 3FJ7A 1H76A 3IB0A 4ND9A 1D9VA 1DOTA 4IO4A 1AIVA 1PBQA 4QFKA 2ONSA 2H98A 1MQJA 1NL5A 4WEPA 5TPAB 4ECFA 4F1YA 3QSLA 1MRPA 5A5XB 1LB8A 2QS4A 2OCUA 4U1OA 3TODA 2M8CA 4THIA 2V3UA 1NNKA 1N3XA 5CC2A 3CRBA 1MQHA 3M3KA 5K2YA 1WODA 2Y7PA 3MQ9A 1ZMGA 1UIUA 1ZIUA 1MY2A 5I59A 1VFEA 2O1MA 4U4XA 1JNFA 3H6UA 3OO9A 1B6HA 2ZYNA 1JEVA 1US4A 3H7MA 4R9FA 1M5BA 3MPLA 2XXYA 1SYHA 3RY3A 4JWOA 2OLBA 2XD3A 5HBCA 4ZEKA 3SEYA 1B7HA 4R2FA 5H8FA 3H6TA 1B0HA 2RC7A 3TDJA 3ONMA 1MXYA 3TTRA 3VXCA 3OENA 2F6GA 4G8HA 3RLFE 4AB6A 3KEIA 4KYDA 2RCAA 3FD3A 3C4MA 1PC3A 3T9UA 3S9MC 5KZTA 3OD7A 3QUFA 2IEEA 3LR1A 5FHOA 3FXRA 2F7CA 4QSCA 4NF4B 5FTHA 2V3TA 3EN3A 3FXQA 3MVYA 4OMBA 5L9SA 2R9JA 2Z8FA 3D4CA 1ZKBA 3TMGA 3LSWA 1B4HA 1PB7A 2X26A 3HSTA 3GZGA 5KCJB 1B3FA 4H65A 3V83A 4GXSB 3K6WA 2DWIA 3WAFA 2X7QA 2XXXA 4OVJA 4Q5TA 4YKPA 4FORA 3DP4A 3EHTA 1LAHE 2XX7A 5CMCA 1EZ9A 4M4GA 3MZ9A 1UTHA 3TAJA 2A5TA 3KOTA 3O97A 5LOMA 1IEJA 1MM7A 3Q25A 1B9JA 1L5TA 1MH3A 4OTEA 1N7XA 2XXHA 3SERA 1D3KA 3K00A 3G3KA 4GVOA 3DLNA 3OO6A 2QS2A 3GBBA 3PUVE 4NMYA 4E0XA 3G3JA 1P1QA 3L6HA 3HHFA 4TLMB 2QS1A 1S50A 3FV2A 5CMBA 1NH7A 1Y3NA 4NF6A 5I59B 2XXPA 4Q0CA 3OMBA 2HCAA 2E1SA 4X1DA 4EF1A 1BP5A 5BUUA 5JTYA 3Q27A 3LSXA 2BJJX 2I58A 3ZKLA 1DPEA 1P1OA 5IKBA 1LBBA 3SETA 4BDLA 4KHZE 4LZ7A 3DM0A 3RTFB 1A99A 2D21A 1FTLA 3Q26A 4RNSA 3H6VA 2F5XA 3TTLA 4HCWA 2O84X 3I3VA 4IO2A 4IGRA 2O1LA 2V84A 3FVGA 1IXHA 5CI5A 1MXVA 4KD5A 3FZVA 1A40A 3EHUA 1JQFA 2F78A 4OHNA 4KQPA 1S7YA 1VSOA 4ZEIA 3C34A 4GLIA 1UIVA 2LAOA 4DCYA 2XXVA 2D3IA 4G68C 2ZYOA 2PT1A 4I9DA 2QMXA 1JETA 1EU8A 3V5AA 1FQBA 1GV8A 5IAIA 4MF3A 4UACA 4F3PA 4R2BA 3FVNA 3IOVA 3PUXE 3RTWB 4HTGA 1IITA 3VLUA 1SD3A 3DELB 2ABHA 5CBRA 3K6XA 3TYHA 4LZ8A 3O9PA 3SESA 1Y1ZA 2YJPA 1TFDA 1B40A 4HCYA 3PPOA 4TOZA 4DDDA 2Z23A 3TCGA 4G2ZA 3O6GA 4F39A 1LAFE 4QF9A 5CM6A 4RPOA 1SW5A 2DQVA 4BDMA 2GRVA 5TP9B 3MWBA 3UIFA 3FVOA 4QSDA 4ZDMA 3MZ1A 2NUVA 2XXQA 2F34A 2QJEA 5I57A 3VXBA 1URDA 3RUMA 3P7IA 5I56A 4OFOA 3MVXA 5JTYB 3CFLA 4QSEA 5AA4A 2PX1A 4RJZA 1LCTA 1IZ1A 4WKMA 1M5CA 3IOUA 5DT6A 1H3DA 1JVXA 4XKPA 1NFTA 1URGA 2VGQA 4POXA 1TWYA 1LFHA 1IIWA 2YLNA 3K4UA 5J1DA 1Y9UA 4XKRA 1B52A 1MS7A 2RKMA 2UYFA 4I8CA 3G3FA 4U2RA 2DE3A 4OZ9A 4PFUA 4PP0A 1P1WA 1H45A 2REJA 3O2AA 2UXAA 3MUQA 1B3HA 2OWTA 1LGBC 1ZU0A 1SW2A 2DWHA 3S9LC
chains in the Genus database with same CATH superfamily
3U72A 3VLVA 3G7WA 3PMVA 2RF1A 2CZHA 2VD2A 4FJPA 2P3NA 1PDAA 3E4RA 4YB6A 1B1XA 1BTJA 2QMWA 3S9NC 4XKNA 4GIZA 3MJNA 3FGSA 1FPKA 3FV1A 4FBPA 4GBWA 3TTNA 4YB7A 4YKIA 3OOAA 1MY3A 4PF8A 4NWCA 3KG2A 4X9TA 1N84A 4M1VA 4XEQA 2AIXA 4O7IA 3KSXA 3BIHA 3MBPA 4DLDA 4NF5A 1FPIA 5AA2A 2HZKA 4EF2A 2Q8JA 2P0SA 3IJXB 1N04A 4RYAA 4HXVA 3CHGA 5I58B 4LVQA 4RK9A 1UTBA 2PT2A 3HHGA 4PGPA 2UVIA 2WYKA 3UK4A 1PB9A 5I2NA 2FA7A 1O7TA 1MXUA 1Q35A 1NV4A 2GFEA 2F7BA 2DWJA 2DSFA 4DZ1A 2PFYA 1Q1KA 4C1TA 1NUYA 1B0LA 5B7DA 4NF8A 1NV0A 1I69A 5FHMA 1QULA 1NNTA 4PETA 4F3GA 2KQZA 1M5FA 1HSLA 5F7VA 3N6TA 4X1BA 4KR5A 4P3LA 2PFZA 4NEDA 4IO3A 4R74A 2Y7WA 2CZKA 1UQWA 4P11A 3U94A 1KZ8A 1N7WA 2VPOA 1NNPA 4ISUA 1OLAA 1FTAA 2DVCA 2DXRA 4C1UA 3QK6A 2DXYA 4N6KA 1GR2A 1EZOA 2QPQA 3KFMA 3T9HB 2VP1A 1EYIA 2H25A 3CIJA 5A5LA 4G68A 3C9HA 3TQWA 2CMOA 4H8JA 4G4PA 4ZEFA 1Y3QA 4KXPA 4ELOA 3B6TA 3V89B 2I6EA 3CFXA 1J1NA 4G8MA 2F3BA 5CMMA 4XXUA 4P0IA 2FYIA 4ELQA 2QSXA 5BWJA 2ZMBA 3LV0A 1I6BA 1JEUA 3VLWA 2GHBA 3C36A 2DVZA 3K6UA 3HV1A 3FATA 3SEXA 3N26A 2GHAA 2XX8A 2Y7RA 2O51A 1NV5A 3PPPA 4PFYA 2PMSA 4NQ8A 4ESXA 4NAPA 4XFEA 2HEUA 1YCJA 3CSBA 4O3BA 1G0IA 1IMFA 3MP1A 1I6QA 1FPFA 2RINA 4TQUQ 3QYTA 3UP9A 4QFNA 2Q89A 4GXAA 4ZEBA 4YKJA 2R6GE 1A8FA 3B50A 3Q28A 4LN5A 1FQAA 4IY6A 4HW8A 4HS7A 4R73A 3AXFA 4EUOA 3O28A 1VR5A 3OO8A 2OWSA 3IAZA 3LC8A 4LQ5A 4IO7A 1ANFA 1Y20A 4OETA 2DYXA 2H99A 2I4CA 2FIXA 3V8XB 4ONYA 3PPNA 1VFDA 5I2NB 4NGUA 1B4ZA 2Q74A 3IX1A 4UABA 4OERA 1ZTYA 5I3SA 4DXUA 5L9OA 3KN3A 4ELPA 3SEVA 3MVZA 5H8NA 4LA9A 1FJ9A 1SPIA 2L5VA 1US5A 3KN8A 4F19A 3PMWA 3OELA 3E9XA 4IB2A 4FE8A 4F1UA 2ZYKA 4KI0E 3QMFA 4YU0A 3VVDA 3UORA 3HO7A 3ODBA 1FQCA 3EPEA 1B5JA 4N15A 4QFPA 2B4MA 1Y3PA 2DE2A 4PF6A 5H8QA 3K1MA 1SBPA 4G8NA 1NV3A 4IR8A 4NE4A 1RDYA 1HSJA 2AL5A 5DTBA 1R1NA 1USYH 2XWVA 3CG1A 2HPGA 5JK4A 2MKZA 4DXCA 5IM2A 4GOTA 2QRYA 5H8FB 4MCOA 4P9KA 1D9YA 1SI1A 4F31B 3C35A 3JV9A 4H6DA 1OLCA 2ESNA 2CZIA 3R6UA 2B3BA 4RA1A 2VOZA 4JB7A 5CBSA 1WVJA 1SW1A 1AMFA 2V93A 3TQLA 3MAMA 3TKDA 1ELJA 3B7DA 4MEVA 4GWWA 4YB5A 1IMDA 1OVTA 5ITOA 3CI8A 4GF8A 3DP6A 2RCBA 4DI4B 2OX3A 4H67A 4MX6A 2ZZVA 5I2KA 1POY1 1SQYA 1BK4A 5ELVA 1Y4TA 4JSOA 3K2DA 4OVQA 4UA8A 4MLVA 5ESYA 4H5FA 2O69A 1OIBA 3FJGA 1LBCA 3G3GA 1RDXA 1DTZA 4GQOA 3MP6A 3TUSA 5H8HA 4EQ7A 1IMEA 1I6AA 4LUBA 2WYPA 3FXUA 5AA1A 4U1ZA 4LP2B 3RQTA 2NXOA 4F29A 2XXIA 4ZECA 1XC1A 2F36A 1ATGA 1FQDA 4I3YA 4PDDA 4Z0IA 4GL0A 3O6HA 4AQ4A 4P47A 1UTHB 4GWSA 3W9VA 2A5TB 1YYZA 4OA4A 2PBWA 3ILUB 4P1EA 4JDFA 1B3EA 1P1NA 3ZKKA 2HZLA 1JP4A 1B51A 1MPBA 1MQIA 4U21A 1IMAA 1LBVA 3B6QA 4U22A 5ET8A 1S9TA 4F18A 4NN3A 4OESA 3RPWA 3N6UA 5IZZA 2OJTA 2QFLA 4XKQA 1M5DA 3OSQA 3TELA 1FQFA 3NOHA 2FBPA 4FECA 4NF6B 2CEXA 4MNPA 2HXWA 4N4UA 2I0CA 4JSDA 2Q2CA 4RK2A 5DYHA 3RT8A 4ZE9A 3R7XA 4JXIA 4XF5A 1LFIA 2O7UA 4GFRA 5KDTA 3VDFA 5TPAA 4MBPA 5JEIA 1WDNA 4OENA 5EYGA 2ZYMA 1FPLA 3T66A 5A5XA 2I48A 1MY1A 4YAHX 4FATA 4PE5B 4OFJA 2OK2A 3H4ZA 3CSGA 4MAGA 3MSTA 1NUWA 1LLSA 2ZNTA 2G29A 1LBZA 3TCFA 5IZ3B 3PUWE 3Q29A 4R72A 3S4UA 3SZPA 3IR1A 3K01A 3K6VA 2RC8A 4N17A 1MXZA 4BLAA 1PEBA 2Q88A 5DEXA 2R8TA 4JWYA 4N6DA 1R9LA 1MG1A 4DXBA 1TT1A 1FPEA 3KSJA 1NMUA 4N8YA 4JWXA 4GD5A 2OZZA 1MH4A 2H9BA 2R71A 4O7MA 2FIEA 3PPQA 2I3VA 3KZGA 4OEVA 1AWBA 3JYRA 2UVJA 3UGWA 3PV0E 3L6GA 4GWOA 2F7AA 3RT6B 3CFZA 3TFLA 1URSA 4ZZAA 2Y7IA 2XA5A 4I40A 3E78A 1SW4A 1DTGA 4POWA 3T22A 3H6WA 1XVYA 3QAXA 3N5LA 2H5YA 3IORA 4KCDA 4QBAA 4KCCA 1O64A 4GL8A 4PTKA 1MQDA 1BKAA 4O3CA 4OXVA 4R6HA 3SEWA 2FNCA 4C0RA 1XOCA 1EH3A 3THIA 1ZLQA 3USDA 1XHYA 2PYYA 4I1DA 2YPNA 2UVHA 3IK6B 4QFLA 2WEFA 1POTA 1BLFA 4KFQA 1XVXA 2VHAA 2I49A 4NF4A 1FTOA 2DWAA 3W9WA 2NWJA 2E0SA 2VT5A 3HPIA 3C31A 3RNNA 4F2QA 5KCJA 5HPQA 1B1HA 1LCFA 2HFBA 4XTCQ 4K3FA 3BFTA 1H43A 1Q9DA 4NF0A 1LAXA 2W7YA 4DIGA 2KR0A 1JW1A 1IUDA 2WBDA 2HAVA 4PQJA 3LSLA 4R6KA 1Z7NE 5I57B 2Q2AA 4GX4A 1MDQA 1SI0A 5I56B 5EQ9A 3MVWA 4N13A 1A54A 1CNQA 5KDTB 3E3KA 3M8UA 2JJKA 3KGCA 5AA4B 4ELRA 2Y7KA 3PMXA 2QL3A 1DMBA 3PGFA 1MXWA 5EYHA 3GBAA 1LBYA 3DP8A 3T9VA 4NWDA 5HM4B 3PD9A 3EF7A 1O63A 4HE1A 3N94A 3RN8A 4RPNA 4QFOA 4HE0A 2B65A 2UYEA 5DVIA 4F3SA 1FTJA 4O8MA 1AL3A 4H5GA 4EQ9A 3H3GA 1K9ZA 4MFIA 4OFLA 3MP8A 1FBEA 1MXXA 3KBZA 4R75A 5DEXB 1MY0A 2QS3A 3CVGA 3M3FA 3OEKA 2RC9A 3MC2A 3T93B 2OBGA 3BFUA 3GXAA 4YMBA 1DBZA 1GVCA 5TU0A 1K9YA 2IA4A 3A3UA 3T9XB 1QUJA 4NHBA 4NG7A 1FSAA 2I0BA 1VE4A 4EXLA 1EYJA 3OXNA 3F11A 3MYUA 1MQGA 1H44A 2XX9A 3KBRA 4H0WA 3FVKA 3FBPA 3K0VA 1OQHA 2I4BA 3QIMA 4F1VA 4ESWA 4PFBA 2ZZXA 4GBVA 4OQOA 1SDXA 1IXIA 2O6AA 1IMBA 4QXDA 2Y84A 3HN0A 1FW0A 4LQ2A 1B7ZA 2G93A 5EHSA 2F6PA 3PUYE 1TFAA 4NF5B 5AA2B 1HSEA 2O7IA 4O3AA 1B58A 1LSTA 2HQ0A 3C33A 1B5IA 1B3LA 4JBZA 4PFIA 1IQ7A 1UTBB 5DVFA 1NUXA 3PPRA 2P2AA 1FBPA 1B5HA 1OVBA 4DE8A 3QXMA 2XXWA 1MDP1 4OVTA 1DSNA 5K2XA 1VDWA 3VV5A 2NOOA 2VD3A 5CRYA 1D4NA 2AL4A 4Q8RA 3R26A 2WBBA 3IB2A 4U23A 4NF8B 1IXCA 2O68A 4G61A 1P99A 4FIMA 1LFGA 3S2VA 1JW4A 3QUJA 4IY5A 4NTLA 2ALUA 3O66A 3S9EA 2ONRA 4KPTA 4IO5A 1P1UA 4FEBA 3VFJA 1JW5A 5I84A 3KJTA 4OVSA 1FQEA 3C32A 3TTKA 4KYSA 3VE1B 2NVUB 3TEPA 3VVEA 1QW0A 1FCKA 1MPDA 4IO6A 4GWZA 4G68B 4PAKA 5T3JA 3VVFA 1RYXA 4JVIA 4JVDA 4OYVA 3D1RA 1RKMA 5H8SA 4P56A 5TP9A 2HAUA 3PD8A 2BJIA 3B6WA 3H06B 3M3LA 3U92A 2XWOA 4QRZA 2XXKA 3HCQA 1EZPA 4MNIA 3O29A 1N76A 2QVUA 3JZJA 1EYKA 3PU5A 2I3WA 3BKIB 2PCRA 1XT8A 1B05A 4WEDA 3TCHA 1B32A 5ITPA 2XXTA 3GYYA 4AS5A 3U8QA 3U93A 2GH9A 5FHNA 2DS9A 2Q8MA 1MM6A 2X7PA 4ZE8A 3A3CA 3E79A 4IGTA 1INPA 1B7UA 4GRKA 1LEVA 4YICA 4KYEA 1R6ZA 5EHMA 5DW8A 1FRPA 4WXJA 3UA8A 5ISUA 4BDOA 1II5A 3UN6A 3FUZA 3IFCA 5AA3A 4ZEDA 3OO7A 4PBHA 5B70A 2V25A 1FPBA 1R9QA 3D4GA 4PC9A 1Y4CA 3LSFB 3G3IA 1ZBMA 1LAGE 3SEUA 2F97A 1MPCA 3FJMA 4H8IA 1M5EA 5AA2D 4OANA 2F35A 3FIRA 2AYSA 1PB8A 4FAJA 4ZZEA 2Y5KA 5L9MA 1QUIA 4DI3D 1D9QA 5IGAA 1NUZA 4X48A 3MZBA 1USYE 4DCXA 4OVRA 4RY1A 1QKBA 3TPAA 5M2VA 1CB6A 5ICQA 1BIYA 1NNFA 2XD2A 3KJ7A 5EQ7A 1A7LA 3E13X 5H8NB 1T0KA 2HXRA 3RPLA 1B2HA 4QHQA 1A8EA 4N91A 3IO4A 1FPJA 5I58A 3KOSA 5ICTA 3A29A 1SVXB 3K1NA 3SKPA 1Z7ME 4RXLA 4TLLB 3HFUA 5ET7A 4H1XA 1QKAA 3KC1A 5L8DA 4ZS9A 2ZNUA 5EYFA 2XXUA 1GTKA 3ZSFA 4I62A 3KN7A 1A55A 3W15C 4BDNA 5H8QB 3PUZE 1AOVA 2CZLA 3K02A 3K1PA 4OEUA 3RGYA 3TZAA 3MPKA 3LUYA 5ET6A 1LBWA 1XS5A 2WKYA 5DVJA 3IO6A 4F2OA 1YAEA 3EHSA 1OQGA 3IB1A 4EXKA 1YTVA 1PBPA 4MJOA 3RYDA 3LBSA 3A09A 3IJOB 4GWXA 2ONKE 4Z7EA 1YPNA 1QJMA 1JVYA 1NH8A 4GWYA 2XXRA 1N0TA 2THIA 1CE2A 1GGGA 1FTKA 2XHDA 4H45A 2Z22A 3SDFA 4E0WA 1OMPA 1ZJLA 4YZZA 2Z8EA 2D5WA 4N8GA 1IXGA 2ANJA 3T96B 2V4CA 2H4IA 1FTMA 2P1SA 1RYOA 1IMCA 1DPPA 2F8DA 2Z8DA 5I2KB 1TXFA 2B3FA 1MY4A 3CG3A 4F3BA 5AE4A 4YMAA 4U4SA 2Y5LA 2DE4A 2DP8A 3O6IA 4F22A 2UVGA 5EQAA 3EQ1A 3BBRA 1N3WA 4YKKA 5CMKA 4MHFA 2DOJA 3I6VA 3PTYA 4G77A 1B3GA 4MH5A 5H8HB 4N6PA 3TTMA 4PFWA 3FASA 4XIGQ 4BDQA 2ZNSA 2A5SA 1F9BA 4R6YA 1QUKA 1SYIA 4OWDA 4MLQA 4N07A 2Q9TA 2PVUA 3IL1B 1AH5A 3WAEA 3ILTB 4LONB 5F1QA 3GLBA 1FPGA 3IOTA 4MMPA 3U1OA 1QVSA 4Q30B 2KLFA 2V3QA 2REGA 2QVVA 1QGXA 3CR9A 3RPLB 1KWHA 4EDPA 1LB9A 4P0GA 5FTIA 4AB5A 3H03A 3G3HA 1FBCA 3OSRA 4PFTA 2HHMA 1NKXA 4EQBA 1Y1MA 3ECRA 3MW0A 4R9GA 3OEMA 3ZS6A 4BDRA 4FEDA 3KC0A 4LATA 4LZ5A 1NV2A 3IOWA 4L17A 1YXIA 1B46A 3I5OA 2ZXTA 3FJ7A 1H76A 3IB0A 4ND9A 1D9VA 1DOTA 4IO4A 1AIVA 1NV7A 2ZZWA 4P1LA 1PBQA 4QFKA 2ONSA 2H98A 1MQJA 1NL5A 2P3VA 3T0JA 4WEPA 5TPAB 3T1BA 4GWUA 4ECFA 1FPDA 4F1YA 3QSLA 1MRPA 5A5XB 1LB8A 2QS4A 2OCUA 4U1OA 3TODA 2M8CA 4THIA 4GX6A 2V3UA 1NNKA 1N3XA 5CC2A 4PGNA 3CRBA 5I7IA 1MQHA 3M3KA 5K2YA 1WODA 4PCDA 3U65A 2Y7PA 3MQ9A 1ZMGA 1UIUA 1ZIUA 1MY2A 5I59A 1YZ0A 1VFEA 2O1MA 4U4XA 1JNFA 3H6UA 3OO9A 1B6HA 1NV1A 2ZYNA 1JEVA 1US4A 3H7MA 4R9FA 1M5BA 3MPLA 1XI6A 2XXYA 1LBXA 1FBGA 1SYHA 3RY3A 4JWOA 2OLBA 2XD3A 5HBCA 2WX9A 4ZEKA 3SEYA 1B7HA 4R2FA 5H8FA 3H6TA 1B0HA 4PFRA 3IFAA 2RC7A 3TDJA 3ONMA 1MXYA 3TTRA 3VXCA 3OENA 2F6GA 4G8HA 3RLFE 4AB6A 3KEIA 4KYDA 2RCAA 3FD3A 3C4MA 1PC3A 2VPNA 3T9UA 4NX1A 5KZTA 3S9MC 3OD7A 3QUFA 1FBHA 2IEEA 3LR1A 5FHOA 3FXRA 2F7CA 4QSCA 4NF4B 5FTHA 2V3TA 3EN3A 3FXQA 3MVYA 4OMBA 5L9SA 2R9JA 2Z8FA 3D4CA 1ZKBA 3TMGA 3LSWA 5ET5A 1B4HA 1PB7A 2X26A 3HSTA 4PE3A 3GZGA 5KCJB 1B3FA 4H65A 3V83A 4GXSB 3K6WA 2DWIA 4JVCA 3WAFA 2X7QA 2XXXA 4OVJA 4Q5TA 4YKPA 4FORA 3DP4A 3EHTA 1LAHE 2XX7A 5CMCA 1EZ9A 4M4GA 3MZ9A 1UTHA 2B4LA 3TAJA 2A5TA 3KOTA 3O97A 3BIGA 5LOMA 1IEJA 1MM7A 5EQ8A 3Q25A 1B9JA 1L5TA 1MH3A 4OTEA 1N7XA 1FBDA 1FBFA 2XXHA 3SERA 1D3KA 3K00A 3G3KA 4OVPA 1NV6A 3ISPA 4GVOA 3DLNA 3OO6A 2QS2A 2OWZA 1G0HA 3GBBA 3PUVE 5I5PA 4NMYA 4E0XA 3G3JA 1P1QA 3L6HA 1KA0A 3HHFA 4TLMB 2QS1A 1S50A 3FV2A 5CMBA 1NH7A 1Y3NA 4NF6A 5I59B 2XXPA 4Q0CA 3OMBA 2HCAA 2E1SA 4X1DA 4EF1A 1BP5A 5BUUA 5JTYA 1RDZA 5FBPA 3Q27A 3LSXA 2BJJX 2I58A 3ZKLA 1DPEA 1P1OA 5IKBA 2F3DA 1LBBA 3ROJA 3SETA 4BDLA 4KHZE 4LZ7A 5F24A 3DM0A 3RTFB 5J16A 1A99A 2D21A 3LUZA 1DK4A 1FTLA 3Q26A 5IZ3A 4PAIA 2CEYA 4RNSA 4HE2A 3H6VA 2F5XA 3TTLA 4HCWA 1FJ6A 4O94A 5LDZA 4I3EA 2O84X 4PBQA 3I3VA 4IO2A 4X8RA 4N81A 4IGRA 2O1LA 4PDHA 2V84A 3FVGA 1IXHA 5CI5A 1MXVA 4KD5A 3FZVA 1A40A 3EHUA 1JQFA 2F78A 4OHNA 4KQPA 2GQ1A 1S7YA 4X04A 1VSOA 3FXBA 1NI9A 4ZEIA 1KA1A 4MNCA 3C34A 4GLIA 1UIVA 2LAOA 4DCYA 2DDKA 2XXVA 2D3IA 4G68C 2ZYOA 2PT1A 4I9DA 2QMXA 1JETA 1EU8A 3V5AA 4P8BA 1FQBA 1GV8A 5IAIA 4MF3A 4UACA 4F3PA 4R2BA 3FVNA 3IOVA 3PUXE 3RTWB 4HTGA 1IITA 3VLUA 1SD3A 3DELB 2ABHA 3B8BA 5LTCA 5IZ1A 5CBRA 3K6XA 3TYHA 4LZ8A 3O9PA 3SESA 1Y1ZA 2YJPA 1TFDA 1B40A 4HCYA 3PPOA 4TOZA 4DDDA 2Z23A 3TCGA 4G2ZA 3O6GA 4GX3A 4F39A 1LAFE 4QF9A 5CM6A 4RPOA 1SW5A 2DQVA 4BDMA 2GRVA 5TP9B 3MWBA 3UIFA 3FVOA 4QSDA 4ZDMA 3MZ1A 2NUVA 2XXQA 2F34A 2QJEA 5I57A 3VXBA 1URDA 2XWIA 3RUMA 3P7IA 5I56A 4OFOA 1DCUA 3MVXA 5JTYB 2XWKA 3CFLA 4QSEA 5AA4A 2PX1A 4RJZA 1LCTA 1IZ1A 4AS4A 2QVRA 4H46A 4WKMA 1M5CA 3IOUA 5DT6A 1H3DA 1JVXA 4XKPA 1NFTA 1URGA 2VGQA 4POXA 1TWYA 1LFHA 1IIWA 2YLNA 2FHYA 3K4UA 5J1DA 1Y9UA 4XKRA 1B52A 2FVZA 1MS7A 4MIJA 2RKMA 2UYFA 4I8CA 4PAFA 3G3FA 4U2RA 2DE3A 4OZ9A 4PFUA 4PP0A 1P1WA 3EKIA 1H45A 2REJA 3O2AA 2UXAA 3MUQA 1B3HA 2OWTA 1LGBC 1ZU0A 1SW2A 2DWHA 3S9LC
chains in the Genus database with same CATH topology
3U72A 3VLVA 3G7WA 3PMVA 2RF1A 2VD2A 4FJPA 1PDAA 3E4RA 4YB6A 1B1XA 1BTJA 2QMWA 3S9NC 4XKNA 4GIZA 3MJNA 3FGSA 3FV1A 3TTNA 4YB7A 4YKIA 3OOAA 1MY3A 4NWCA 3KG2A 4X9TA 1N84A 4M1VA 2AIXA 3KSXA 3MBPA 4DLDA 4NF5A 5AA2A 2HZKA 4EF2A 2Q8JA 2P0SA 3IJXB 1N04A 4RYAA 5I58B 4LVQA 4RK9A 1UTBA 2PT2A 3HHGA 2UVIA 3UK4A 1PB9A 5I2NA 2FA7A 1O7TA 1MXUA 1Q35A 2GFEA 2F7BA 2DWJA 2DSFA 4DZ1A 1Q1KA 4C1TA 1B0LA 5B7DA 4NF8A 1I69A 5FHMA 1QULA 1NNTA 4PETA 4F3GA 1M5FA 1HSLA 5F7VA 3N6TA 4X1BA 4KR5A 4NEDA 4IO3A 4R74A 2Y7WA 1UQWA 4P11A 3U94A 1N7WA 1NNPA 4ISUA 1OLAA 2DVCA 2DXRA 4C1UA 3QK6A 2DXYA 1GR2A 1EZOA 2QPQA 3KFMA 3T9HB 2VP1A 2H25A 3CIJA 4G68A 3C9HA 3TQWA 2CMOA 4H8JA 4G4PA 4ZEFA 1Y3QA 4ELOA 3B6TA 3V89B 2I6EA 3CFXA 1J1NA 4G8MA 5CMMA 4XXUA 4P0IA 2FYIA 4ELQA 2QSXA 5BWJA 2ZMBA 1I6BA 1JEUA 3VLWA 2GHBA 3C36A 2DVZA 3K6UA 3HV1A 3FATA 3SEXA 3N26A 2GHAA 2XX8A 2Y7RA 2O51A 3PPPA 4PFYA 2PMSA 4ESXA 2HEUA 1YCJA 3CSBA 4O3BA 3MP1A 1I6QA 2RINA 4TQUQ 3QYTA 3UP9A 4QFNA 2Q89A 4GXAA 4ZEBA 4YKJA 2R6GE 1A8FA 3Q28A 1FQAA 4IY6A 4HW8A 4HS7A 4R73A 3AXFA 4EUOA 3O28A 1VR5A 3OO8A 2OWSA 3IAZA 3LC8A 4LQ5A 4IO7A 1ANFA 1Y20A 4OETA 2DYXA 2H99A 2I4CA 3V8XB 4ONYA 3PPNA 1VFDA 5I2NB 1B4ZA 3IX1A 4OERA 1ZTYA 4DXUA 5L9OA 3KN3A 4ELPA 3SEVA 3MVZA 5H8NA 4LA9A 1US5A 3KN8A 4F19A 3PMWA 3OELA 3E9XA 4IB2A 4FE8A 4F1UA 2ZYKA 4KI0E 4YU0A 3VVDA 3UORA 3HO7A 3ODBA 1FQCA 3EPEA 1B5JA 4QFPA 1Y3PA 2DE2A 5H8QA 3K1MA 1SBPA 4G8NA 4NE4A 1HSJA 2AL5A 5DTBA 1R1NA 1USYH 3CG1A 5JK4A 4DXCA 4GOTA 2QRYA 5H8FB 1D9YA 1SI1A 4F31B 3C35A 3JV9A 4H6DA 1OLCA 2ESNA 3R6UA 2B3BA 4RA1A 2VOZA 4JB7A 5CBSA 1WVJA 1SW1A 1AMFA 2V93A 3TQLA 3MAMA 3TKDA 1ELJA 3B7DA 4YB5A 1OVTA 5ITOA 3CI8A 4GF8A 3DP6A 2RCBA 4H67A 5I2KA 1POY1 1SQYA 5ELVA 1Y4TA 4JSOA 3K2DA 4UA8A 4MLVA 4H5FA 2O69A 1OIBA 3FJGA 1LBCA 3G3GA 1DTZA 4GQOA 3MP6A 3TUSA 5H8HA 4EQ7A 1I6AA 4LUBA 3FXUA 5AA1A 4U1ZA 4LP2B 3RQTA 2NXOA 4F29A 2XXIA 4ZECA 1XC1A 2F36A 1ATGA 1FQDA 4Z0IA 4GL0A 3O6HA 4AQ4A 1UTHB 3W9VA 2A5TB 2PBWA 3ILUB 4JDFA 1B3EA 1P1NA 3ZKKA 2HZLA 1B51A 1MPBA 1MQIA 4U21A 3B6QA 4U22A 1S9TA 4F18A 4OESA 3RPWA 3N6UA 2OJTA 4XKQA 1M5DA 3OSQA 3TELA 1FQFA 4FECA 4NF6B 2HXWA 2I0CA 4JSDA 2Q2CA 4RK2A 5DYHA 3RT8A 4ZE9A 3R7XA 4JXIA 1LFIA 2O7UA 4GFRA 5KDTA 3VDFA 5TPAA 4MBPA 5JEIA 1WDNA 4OENA 2ZYMA 3T66A 5A5XA 2I48A 1MY1A 4YAHX 4FATA 4PE5B 4OFJA 2OK2A 3H4ZA 3CSGA 1LLSA 2ZNTA 2G29A 3TCFA 3PUWE 3Q29A 4R72A 3S4UA 3IR1A 3K01A 3K6VA 2RC8A 1MXZA 4BLAA 1PEBA 2Q88A 5DEXA 4JWYA 1R9LA 1MG1A 4DXBA 1TT1A 3KSJA 1NMUA 4JWXA 4GD5A 2OZZA 1MH4A 2H9BA 2R71A 3PPQA 2I3VA 3KZGA 4OEVA 3JYRA 2UVJA 3UGWA 3PV0E 3L6GA 4GWOA 2F7AA 3RT6B 3CFZA 3TFLA 1URSA 4ZZAA 2Y7IA 1SW4A 1DTGA 4POWA 3T22A 3H6WA 1XVYA 3QAXA 3N5LA 2H5YA 3IORA 4KCDA 4KCCA 1O64A 4GL8A 1MQDA 1BKAA 4O3CA 4OXVA 4R6HA 3SEWA 2FNCA 4C0RA 1XOCA 1EH3A 3THIA 1ZLQA 3USDA 1XHYA 2PYYA 4I1DA 2YPNA 2UVHA 3IK6B 4QFLA 1POTA 1BLFA 4KFQA 1XVXA 2VHAA 2I49A 4NF4A 1FTOA 2DWAA 3W9WA 2NWJA 2E0SA 3HPIA 3C31A 3RNNA 4F2QA 5KCJA 5HPQA 1B1HA 1LCFA 2HFBA 4XTCQ 4K3FA 3BFTA 1H43A 1LAXA 2W7YA 4DIGA 1JW1A 1IUDA 2HAVA 4PQJA 3LSLA 4R6KA 1Z7NE 5I57B 2Q2AA 1MDQA 1SI0A 5I56B 3MVWA 4N13A 1A54A 5KDTB 3E3KA 3M8UA 3KGCA 5AA4B 4ELRA 2Y7KA 3PMXA 2QL3A 1DMBA 3PGFA 1MXWA 3GBAA 3DP8A 3T9VA 4NWDA 5HM4B 3PD9A 3EF7A 1O63A 3N94A 3RN8A 4RPNA 4QFOA 2B65A 2UYEA 5DVIA 4F3SA 1FTJA 1AL3A 4H5GA 4EQ9A 3H3GA 4MFIA 4OFLA 3MP8A 1MXXA 4R75A 5DEXB 1MY0A 2QS3A 3CVGA 3M3FA 3OEKA 2RC9A 3MC2A 3T93B 2OBGA 3BFUA 3GXAA 4YMBA 1GVCA 5TU0A 2IA4A 3A3UA 3T9XB 1QUJA 2I0BA 1VE4A 4EXLA 3OXNA 3F11A 1MQGA 1H44A 2XX9A 3KBRA 4H0WA 3FVKA 3K0VA 1OQHA 2I4BA 3QIMA 4F1VA 4ESWA 4OQOA 1SDXA 1IXIA 2O6AA 2Y84A 3HN0A 1FW0A 4LQ2A 1B7ZA 2G93A 5EHSA 2F6PA 3PUYE 1TFAA 4NF5B 5AA2B 1HSEA 2O7IA 4O3AA 1B58A 1LSTA 2HQ0A 3C33A 1B5IA 1B3LA 4JBZA 5DVFA 1IQ7A 1UTBB 3PPRA 2P2AA 1B5HA 1OVBA 4DE8A 3QXMA 2XXWA 1MDP1 1DSNA 5K2XA 3VV5A 2NOOA 2VD3A 5CRYA 1D4NA 2AL4A 4Q8RA 3R26A 3IB2A 4U23A 1IXCA 2O68A 4NF8B 1P99A 4FIMA 1LFGA 3S2VA 1JW4A 3QUJA 4IY5A 4NTLA 2ALUA 3O66A 3S9EA 2ONRA 4KPTA 4IO5A 1P1UA 4FEBA 3VFJA 1JW5A 5I84A 3KJTA 1FQEA 3C32A 3TTKA 4KYSA 3VE1B 2NVUB 3TEPA 3VVEA 1QW0A 1FCKA 1MPDA 4IO6A 4G68B 3VVFA 1RYXA 4OYVA 1RKMA 5H8SA 5TP9A 2HAUA 3PD8A 3B6WA 3H06B 3M3LA 3U92A 4QRZA 3HCQA 1EZPA 3O29A 1N76A 3JZJA 3PU5A 2I3WA 3BKIB 1XT8A 1B05A 4WEDA 3TCHA 1B32A 5ITPA 2XXTA 3U8QA 3U93A 2GH9A 5FHNA 2DS9A 1MM6A 2X7PA 4ZE8A 3A3CA 4IGTA 1B7UA 4GRKA 4YICA 4KYEA 1R6ZA 5EHMA 4WXJA 3UA8A 5ISUA 4BDOA 1II5A 3UN6A 3FUZA 5AA3A 4ZEDA 3OO7A 5B70A 2V25A 1R9QA 3D4GA 1Y4CA 3LSFB 3G3IA 1ZBMA 1LAGE 3SEUA 2F97A 1MPCA 3FJMA 4H8IA 1M5EA 5AA2D 2F35A 3FIRA 2AYSA 1PB8A 4FAJA 4ZZEA 5L9MA 1QUIA 4X48A 3MZBA 1USYE 4DCXA 4RY1A 1QKBA 3TPAA 5M2VA 1CB6A 5ICQA 1BIYA 1NNFA 2XD2A 3KJ7A 1A7LA 3E13X 5H8NB 1T0KA 1B2HA 4QHQA 1A8EA 3IO4A 5I58A 3KOSA 5ICTA 1SVXB 3K1NA 3SKPA 1Z7ME 4RXLA 4TLLB 4H1XA 1QKAA 5L8DA 4ZS9A 2ZNUA 5EYFA 2XXUA 1GTKA 3ZSFA 4I62A 3KN7A 1A55A 3W15C 4BDNA 5H8QB 3PUZE 1AOVA 2CZLA 3K02A 3K1PA 4OEUA 3RGYA 3TZAA 3MPKA 3LUYA 1XS5A 2WKYA 5DVJA 3IO6A 4F2OA 1YAEA 3EHSA 1OQGA 3IB1A 4EXKA 1YTVA 1PBPA 3LBSA 3A09A 3IJOB 2ONKE 4Z7EA 1YPNA 1QJMA 1JVYA 1NH8A 2XXRA 1N0TA 2THIA 1CE2A 1GGGA 1FTKA 2XHDA 2Z22A 3SDFA 4E0WA 1OMPA 1ZJLA 4YZZA 2Z8EA 2D5WA 1IXGA 2ANJA 3T96B 2H4IA 1FTMA 2P1SA 1RYOA 1DPPA 2F8DA 2Z8DA 5I2KB 1TXFA 2B3FA 1MY4A 3CG3A 4F3BA 5AE4A 4YMAA 4U4SA 2DE4A 2DP8A 3O6IA 4F22A 2UVGA 3EQ1A 3BBRA 1N3WA 4YKKA 5CMKA 2DOJA 3I6VA 4G77A 1B3GA 4MH5A 5H8HB 4N6PA 3TTMA 4PFWA 3FASA 4XIGQ 4BDQA 2ZNSA 2A5SA 1F9BA 4R6YA 1QUKA 1SYIA 4OWDA 4MLQA 4N07A 2Q9TA 2PVUA 3IL1B 1AH5A 3WAEA 3ILTB 4LONB 5F1QA 3GLBA 3IOTA 3U1OA 1QVSA 4Q30B 2KLFA 2V3QA 2REGA 3CR9A 1KWHA 4EDPA 1LB9A 4P0GA 5FTIA 4AB5A 3H03A 3G3HA 3OSRA 4PFTA 1NKXA 4EQBA 1Y1MA 3ECRA 3MW0A 4R9GA 3OEMA 3ZS6A 4BDRA 4FEDA 4LATA 4LZ5A 3IOWA 4L17A 3I5OA 1B46A 2ZXTA 3FJ7A 1H76A 3IB0A 4ND9A 1D9VA 1DOTA 4IO4A 1AIVA 1PBQA 4QFKA 2ONSA 2H98A 1MQJA 1NL5A 4WEPA 5TPAB 4ECFA 4F1YA 3QSLA 1MRPA 5A5XB 1LB8A 2QS4A 2OCUA 4U1OA 3TODA 2M8CA 4THIA 2V3UA 1NNKA 1N3XA 5CC2A 3CRBA 1MQHA 3M3KA 5K2YA 1WODA 2Y7PA 3MQ9A 1ZMGA 1UIUA 1ZIUA 1MY2A 5I59A 1VFEA 2O1MA 4U4XA 1JNFA 3H6UA 3OO9A 1B6HA 2ZYNA 1JEVA 1US4A 3H7MA 4R9FA 1M5BA 3MPLA 2XXYA 1SYHA 3RY3A 4JWOA 2OLBA 2XD3A 5HBCA 4ZEKA 3SEYA 1B7HA 4R2FA 5H8FA 3H6TA 1B0HA 2RC7A 3TDJA 3ONMA 1MXYA 3TTRA 3VXCA 3OENA 2F6GA 4G8HA 3RLFE 4AB6A 3KEIA 4KYDA 2RCAA 3FD3A 3C4MA 1PC3A 3T9UA 3S9MC 5KZTA 3OD7A 3QUFA 2IEEA 3LR1A 5FHOA 3FXRA 2F7CA 4QSCA 4NF4B 5FTHA 2V3TA 3EN3A 3FXQA 3MVYA 4OMBA 5L9SA 2R9JA 2Z8FA 3D4CA 1ZKBA 3TMGA 3LSWA 1B4HA 1PB7A 2X26A 3HSTA 3GZGA 5KCJB 1B3FA 4H65A 3V83A 4GXSB 3K6WA 2DWIA 3WAFA 2X7QA 2XXXA 4OVJA 4Q5TA 4YKPA 4FORA 3DP4A 3EHTA 1LAHE 2XX7A 5CMCA 1EZ9A 4M4GA 3MZ9A 1UTHA 3TAJA 2A5TA 3KOTA 3O97A 5LOMA 1IEJA 1MM7A 3Q25A 1B9JA 1L5TA 1MH3A 4OTEA 1N7XA 2XXHA 3SERA 1D3KA 3K00A 3G3KA 4GVOA 3DLNA 3OO6A 2QS2A 3GBBA 3PUVE 4NMYA 4E0XA 3G3JA 1P1QA 3L6HA 3HHFA 4TLMB 2QS1A 1S50A 3FV2A 5CMBA 1NH7A 1Y3NA 4NF6A 5I59B 2XXPA 4Q0CA 3OMBA 2HCAA 2E1SA 4X1DA 4EF1A 1BP5A 5BUUA 5JTYA 3Q27A 3LSXA 2BJJX 2I58A 3ZKLA 1DPEA 1P1OA 5IKBA 1LBBA 3SETA 4BDLA 4KHZE 4LZ7A 3DM0A 3RTFB 1A99A 2D21A 1FTLA 3Q26A 4RNSA 3H6VA 2F5XA 3TTLA 4HCWA 2O84X 3I3VA 4IO2A 4IGRA 2O1LA 2V84A 3FVGA 1IXHA 5CI5A 1MXVA 4KD5A 3FZVA 1A40A 3EHUA 1JQFA 2F78A 4OHNA 4KQPA 1S7YA 1VSOA 4ZEIA 3C34A 4GLIA 1UIVA 2LAOA 4DCYA 2XXVA 2D3IA 4G68C 2ZYOA 2PT1A 4I9DA 2QMXA 1JETA 1EU8A 3V5AA 1FQBA 1GV8A 5IAIA 4MF3A 4UACA 4F3PA 4R2BA 3FVNA 3IOVA 3PUXE 3RTWB 4HTGA 1IITA 3VLUA 1SD3A 3DELB 2ABHA 5CBRA 3K6XA 3TYHA 4LZ8A 3O9PA 3SESA 1Y1ZA 2YJPA 1TFDA 1B40A 4HCYA 3PPOA 4TOZA 4DDDA 2Z23A 3TCGA 4G2ZA 3O6GA 4F39A 1LAFE 4QF9A 5CM6A 4RPOA 1SW5A 2DQVA 4BDMA 2GRVA 5TP9B 3MWBA 3UIFA 3FVOA 4QSDA 4ZDMA 3MZ1A 2NUVA 2XXQA 2F34A 2QJEA 5I57A 3VXBA 1URDA 3RUMA 3P7IA 5I56A 4OFOA 3MVXA 5JTYB 3CFLA 4QSEA 5AA4A 2PX1A 4RJZA 1LCTA 1IZ1A 4WKMA 1M5CA 3IOUA 5DT6A 1H3DA 1JVXA 4XKPA 1NFTA 1URGA 2VGQA 4POXA 1TWYA 1LFHA 1IIWA 2YLNA 3K4UA 5J1DA 1Y9UA 4XKRA 1B52A 1MS7A 2RKMA 2UYFA 4I8CA 3G3FA 4U2RA 2DE3A 4OZ9A 4PFUA 4PP0A 1P1WA 1H45A 2REJA 3O2AA 2UXAA 3MUQA 1B3HA 2OWTA 1LGBC 1ZU0A 1SW2A 2DWHA 3S9LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U72 A;  3VLV A;  3G7W A;  3PMV A;  2RF1 A;  2VD2 A;  4FJP A;  1PDA A;  3E4R A;  4YB6 A;  1B1X A;  1BTJ A;  2QMW A;  3S9N C;  4XKN A;  4GIZ A;  3MJN A;  3FGS A;  3FV1 A;  3TTN A;  4YB7 A;  4YKI A;  3OOA A;  1MY3 A;  4NWC A;  3KG2 A;  4X9T A;  1N84 A;  4M1V A;  2AIX A;  3KSX A;  3MBP A;  4DLD A;  4NF5 A;  5AA2 A;  2HZK A;  4EF2 A;  2Q8J A;  2P0S A;  3IJX B;  1N04 A;  4RYA A;  5I58 B;  4LVQ A;  4RK9 A;  1UTB A;  2PT2 A;  3HHG A;  2UVI A;  3UK4 A;  1PB9 A;  5I2N A;  2FA7 A;  1O7T A;  1MXU A;  1Q35 A;  2GFE A;  2F7B A;  2DWJ A;  2DSF A;  4DZ1 A;  1Q1K A;  4C1T A;  1B0L A;  5B7D A;  4NF8 A;  1I69 A;  5FHM A;  1QUL A;  1NNT A;  4PET A;  4F3G A;  1M5F A;  1HSL A;  5F7V A;  3N6T A;  4X1B A;  4KR5 A;  4NED A;  4IO3 A;  4R74 A;  2Y7W A;  1UQW A;  4P11 A;  3U94 A;  1N7W A;  1NNP A;  4ISU A;  1OLA A;  2DVC A;  2DXR A;  4C1U A;  3QK6 A;  2DXY A;  1GR2 A;  1EZO A;  2QPQ A;  3KFM A;  3T9H B;  2VP1 A;  2H25 A;  3CIJ A;  4G68 A;  3C9H A;  3TQW A;  2CMO A;  4H8J A;  4G4P A;  4ZEF A;  1Y3Q A;  4ELO A;  3B6T A;  3V89 B;  2I6E A;  3CFX A;  1J1N A;  4G8M A;  5CMM A;  4XXU A;  4P0I A;  2FYI A;  4ELQ A;  2QSX A;  5BWJ A;  2ZMB A;  1I6B A;  1JEU A;  3VLW A;  2GHB A;  3C36 A;  2DVZ A;  3K6U A;  3HV1 A;  3FAT A;  3SEX A;  3N26 A;  2GHA A;  2XX8 A;  2Y7R A;  2O51 A;  3PPP A;  4PFY A;  2PMS A;  4ESX A;  2HEU A;  1YCJ A;  3CSB A;  4O3B A;  3MP1 A;  1I6Q A;  2RIN A;  4TQU Q;  3QYT A;  3UP9 A;  4QFN A;  2Q89 A;  4GXA A;  4ZEB A;  4YKJ A;  2R6G E;  1A8F A;  3Q28 A;  1FQA A;  4IY6 A;  4HW8 A;  4HS7 A;  4R73 A;  3AXF A;  4EUO A;  3O28 A;  1VR5 A;  3OO8 A;  2OWS A;  3IAZ A;  3LC8 A;  4LQ5 A;  4IO7 A;  1ANF A;  1Y20 A;  4OET A;  2DYX A;  2H99 A;  2I4C A;  3V8X B;  4ONY A;  3PPN A;  1VFD A;  5I2N B;  1B4Z A;  3IX1 A;  4OER A;  1ZTY A;  4DXU A;  5L9O A;  3KN3 A;  4ELP A;  3SEV A;  3MVZ A;  5H8N A;  4LA9 A;  1US5 A;  3KN8 A;  4F19 A;  3PMW A;  3OEL A;  3E9X A;  4IB2 A;  4FE8 A;  4F1U A;  2ZYK A;  4KI0 E;  4YU0 A;  3VVD A;  3UOR A;  3HO7 A;  3ODB A;  1FQC A;  3EPE A;  1B5J A;  4QFP A;  1Y3P A;  2DE2 A;  5H8Q A;  3K1M A;  1SBP A;  4G8N A;  4NE4 A;  1HSJ A;  2AL5 A;  5DTB A;  1R1N A;  1USY H;  3CG1 A;  5JK4 A;  4DXC A;  4GOT A;  2QRY A;  5H8F B;  1D9Y A;  1SI1 A;  4F31 B;  3C35 A;  3JV9 A;  4H6D A;  1OLC A;  2ESN A;  3R6U A;  2B3B A;  4RA1 A;  2VOZ A;  4JB7 A;  5CBS A;  1WVJ A;  1SW1 A;  1AMF A;  2V93 A;  3TQL A;  3MAM A;  3TKD A;  1ELJ A;  3B7D A;  4YB5 A;  1OVT A;  5ITO A;  3CI8 A;  4GF8 A;  3DP6 A;  2RCB A;  4H67 A;  5I2K A;  1POY 1;  1SQY A;  5ELV A;  1Y4T A;  4JSO A;  3K2D A;  4UA8 A;  4MLV A;  4H5F A;  2O69 A;  1OIB A;  3FJG A;  1LBC A;  3G3G A;  1DTZ A;  4GQO A;  3MP6 A;  3TUS A;  5H8H A;  4EQ7 A;  1I6A A;  4LUB A;  3FXU A;  5AA1 A;  4U1Z A;  4LP2 B;  3RQT A;  2NXO A;  4F29 A;  2XXI A;  4ZEC A;  1XC1 A;  2F36 A;  1ATG A;  1FQD A;  4Z0I A;  4GL0 A;  3O6H A;  4AQ4 A;  1UTH B;  3W9V A;  2A5T B;  2PBW A;  3ILU B;  4JDF A;  1B3E A;  1P1N A;  3ZKK A;  2HZL A;  1B51 A;  1MPB A;  1MQI A;  4U21 A;  3B6Q A;  4U22 A;  1S9T A;  4F18 A;  4OES A;  3RPW A;  3N6U A;  2OJT A;  4XKQ A;  1M5D A;  3OSQ A;  3TEL A;  1FQF A;  4FEC A;  4NF6 B;  2HXW A;  2I0C A;  4JSD A;  2Q2C A;  4RK2 A;  5DYH A;  3RT8 A;  4ZE9 A;  3R7X A;  4JXI A;  1LFI A;  2O7U A;  4GFR A;  5KDT A;  3VDF A;  5TPA A;  4MBP A;  5JEI A;  1WDN A;  4OEN A;  2ZYM A;  3T66 A;  5A5X A;  2I48 A;  1MY1 A;  4YAH X;  4FAT A;  4PE5 B;  4OFJ A;  2OK2 A;  3H4Z A;  3CSG A;  1LLS A;  2ZNT A;  2G29 A;  3TCF A;  3PUW E;  3Q29 A;  4R72 A;  3S4U A;  3IR1 A;  3K01 A;  3K6V A;  2RC8 A;  1MXZ A;  4BLA A;  1PEB A;  2Q88 A;  5DEX A;  4JWY A;  1R9L A;  1MG1 A;  4DXB A;  1TT1 A;  3KSJ A;  1NMU A;  4JWX A;  4GD5 A;  2OZZ A;  1MH4 A;  2H9B A;  2R71 A;  3PPQ A;  2I3V A;  3KZG A;  4OEV A;  3JYR A;  2UVJ A;  3UGW A;  3PV0 E;  3L6G A;  4GWO A;  2F7A A;  3RT6 B;  3CFZ A;  3TFL A;  1URS A;  4ZZA A;  2Y7I A;  1SW4 A;  1DTG A;  4POW A;  3T22 A;  3H6W A;  1XVY A;  3QAX A;  3N5L A;  2H5Y A;  3IOR A;  4KCD A;  4KCC A;  1O64 A;  4GL8 A;  1MQD A;  1BKA A;  4O3C A;  4OXV A;  4R6H A;  3SEW A;  2FNC A;  4C0R A;  1XOC A;  1EH3 A;  3THI A;  1ZLQ A;  3USD A;  1XHY A;  2PYY A;  4I1D A;  2YPN A;  2UVH A;  3IK6 B;  4QFL A;  1POT A;  1BLF A;  4KFQ A;  1XVX A;  2VHA A;  2I49 A;  4NF4 A;  1FTO A;  2DWA A;  3W9W A;  2NWJ A;  2E0S A;  3HPI A;  3C31 A;  3RNN A;  4F2Q A;  5KCJ A;  5HPQ A;  1B1H A;  1LCF A;  2HFB A;  4XTC Q;  4K3F A;  3BFT A;  1H43 A;  1LAX A;  2W7Y A;  4DIG A;  1JW1 A;  1IUD A;  2HAV A;  4PQJ A;  3LSL A;  4R6K A;  1Z7N E;  5I57 B;  2Q2A A;  1MDQ A;  1SI0 A;  5I56 B;  3MVW A;  4N13 A;  1A54 A;  5KDT B;  3E3K A;  3M8U A;  3KGC A;  5AA4 B;  4ELR A;  2Y7K A;  3PMX A;  2QL3 A;  1DMB A;  3PGF A;  1MXW A;  3GBA A;  3DP8 A;  3T9V A;  4NWD A;  5HM4 B;  3PD9 A;  3EF7 A;  1O63 A;  3N94 A;  3RN8 A;  4RPN A;  4QFO A;  2B65 A;  2UYE A;  5DVI A;  4F3S A;  1FTJ A;  1AL3 A;  4H5G A;  4EQ9 A;  3H3G A;  4MFI A;  4OFL A;  3MP8 A;  1MXX A;  4R75 A;  5DEX B;  1MY0 A;  2QS3 A;  3CVG A;  3M3F A;  3OEK A;  2RC9 A;  3MC2 A;  3T93 B;  2OBG A;  3BFU A;  3GXA A;  4YMB A;  1GVC A;  5TU0 A;  2IA4 A;  3A3U A;  3T9X B;  1QUJ A;  2I0B A;  1VE4 A;  4EXL A;  3OXN A;  3F11 A;  1MQG A;  1H44 A;  2XX9 A;  3KBR A;  4H0W A;  3FVK A;  3K0V A;  1OQH A;  2I4B A;  3QIM A;  4F1V A;  4ESW A;  4OQO A;  1SDX A;  1IXI A;  2O6A A;  2Y84 A;  3HN0 A;  1FW0 A;  4LQ2 A;  1B7Z A;  2G93 A;  5EHS A;  2F6P A;  3PUY E;  1TFA A;  4NF5 B;  5AA2 B;  1HSE A;  2O7I A;  4O3A A;  1B58 A;  1LST A;  2HQ0 A;  3C33 A;  1B5I A;  1B3L A;  4JBZ A;  5DVF A;  1IQ7 A;  1UTB B;  3PPR A;  2P2A A;  1B5H A;  1OVB A;  4DE8 A;  3QXM A;  2XXW A;  1MDP 1;  1DSN A;  5K2X A;  3VV5 A;  2NOO A;  2VD3 A;  5CRY A;  1D4N A;  2AL4 A;  4Q8R A;  3R26 A;  3IB2 A;  4U23 A;  1IXC A;  2O68 A;  4NF8 B;  1P99 A;  4FIM A;  1LFG A;  3S2V A;  1JW4 A;  3QUJ A;  4IY5 A;  4NTL A;  2ALU A;  3O66 A;  3S9E A;  2ONR A;  4KPT A;  4IO5 A;  1P1U A;  4FEB A;  3VFJ A;  1JW5 A;  5I84 A;  3KJT A;  1FQE A;  3C32 A;  3TTK A;  4KYS A;  3VE1 B;  2NVU B;  3TEP A;  3VVE A;  1QW0 A;  1FCK A;  1MPD A;  4IO6 A;  4G68 B;  3VVF A;  1RYX A;  4OYV A;  1RKM A;  5H8S A;  5TP9 A;  2HAU A;  3PD8 A;  3B6W A;  3H06 B;  3M3L A;  3U92 A;  4QRZ A;  3HCQ A;  1EZP A;  3O29 A;  1N76 A;  3JZJ A;  3PU5 A;  2I3W A;  3BKI B;  1XT8 A;  1B05 A;  4WED A;  3TCH A;  1B32 A;  5ITP A;  2XXT A;  3U8Q A;  3U93 A;  2GH9 A;  5FHN A;  2DS9 A;  1MM6 A;  2X7P A;  4ZE8 A;  3A3C A;  4IGT A;  1B7U A;  4GRK A;  4YIC A;  4KYE A;  1R6Z A;  5EHM A;  4WXJ A;  3UA8 A;  5ISU A;  4BDO A;  1II5 A;  3UN6 A;  3FUZ A;  5AA3 A;  4ZED A;  3OO7 A;  5B70 A;  2V25 A;  1R9Q A;  3D4G A;  1Y4C A;  3LSF B;  3G3I A;  1ZBM A;  1LAG E;  3SEU A;  2F97 A;  1MPC A;  3FJM A;  4H8I A;  1M5E A;  5AA2 D;  2F35 A;  3FIR A;  2AYS A;  1PB8 A;  4FAJ A;  4ZZE A;  5L9M A;  1QUI A;  4X48 A;  3MZB A;  1USY E;  4DCX A;  4RY1 A;  1QKB A;  3TPA A;  5M2V A;  1CB6 A;  5ICQ A;  1BIY A;  1NNF A;  2XD2 A;  3KJ7 A;  1A7L A;  3E13 X;  5H8N B;  1T0K A;  1B2H A;  4QHQ A;  1A8E A;  3IO4 A;  5I58 A;  3KOS A;  5ICT A;  1SVX B;  3K1N A;  3SKP A;  1Z7M E;  4RXL A;  4TLL B;  4H1X A;  1QKA A;  5L8D A;  4ZS9 A;  2ZNU A;  5EYF A;  2XXU A;  1GTK A;  3ZSF A;  4I62 A;  3KN7 A;  1A55 A;  3W15 C;  4BDN A;  5H8Q B;  3PUZ E;  1AOV A;  2CZL A;  3K02 A;  3K1P A;  4OEU A;  3RGY A;  3TZA A;  3MPK A;  3LUY A;  1XS5 A;  2WKY A;  5DVJ A;  3IO6 A;  4F2O A;  1YAE A;  3EHS A;  1OQG A;  3IB1 A;  4EXK A;  1YTV A;  1PBP A;  3LBS A;  3A09 A;  3IJO B;  2ONK E;  4Z7E A;  1YPN A;  1QJM A;  1JVY A;  1NH8 A;  2XXR A;  1N0T A;  2THI A;  1CE2 A;  1GGG A;  1FTK A;  2XHD A;  2Z22 A;  3SDF A;  4E0W A;  1OMP A;  1ZJL A;  4YZZ A;  2Z8E A;  2D5W A;  1IXG A;  2ANJ A;  3T96 B;  2H4I A;  1FTM A;  2P1S A;  1RYO A;  1DPP A;  2F8D A;  2Z8D A;  5I2K B;  1TXF A;  2B3F A;  1MY4 A;  3CG3 A;  4F3B A;  5AE4 A;  4YMA A;  4U4S A;  2DE4 A;  2DP8 A;  3O6I A;  4F22 A;  2UVG A;  3EQ1 A;  3BBR A;  1N3W A;  4YKK A;  5CMK A;  2DOJ A;  3I6V A;  4G77 A;  1B3G A;  4MH5 A;  5H8H B;  4N6P A;  3TTM A;  4PFW A;  3FAS A;  4XIG Q;  4BDQ A;  2ZNS A;  2A5S A;  1F9B A;  4R6Y A;  1QUK A;  1SYI A;  4OWD A;  4MLQ A;  4N07 A;  2Q9T A;  2PVU A;  3IL1 B;  1AH5 A;  3WAE A;  3ILT B;  4LON B;  5F1Q A;  3GLB A;  3IOT A;  3U1O A;  1QVS A;  4Q30 B;  2KLF A;  2V3Q A;  2REG A;  3CR9 A;  1KWH A;  4EDP A;  1LB9 A;  4P0G A;  5FTI A;  4AB5 A;  3H03 A;  3G3H A;  3OSR A;  4PFT A;  1NKX A;  4EQB A;  1Y1M A;  3ECR A;  3MW0 A;  4R9G A;  3OEM A;  3ZS6 A;  4BDR A;  4FED A;  4LAT A;  4LZ5 A;  3IOW A;  4L17 A;  3I5O A;  1B46 A;  2ZXT A;  3FJ7 A;  1H76 A;  3IB0 A;  4ND9 A;  1D9V A;  1DOT A;  4IO4 A;  1AIV A;  1PBQ A;  4QFK A;  2ONS A;  2H98 A;  1MQJ A;  1NL5 A;  4WEP A;  5TPA B;  4ECF A;  4F1Y A;  3QSL A;  1MRP A;  5A5X B;  1LB8 A;  2QS4 A;  2OCU A;  4U1O A;  3TOD A;  2M8C A;  4THI A;  2V3U A;  1NNK A;  1N3X A;  5CC2 A;  3CRB A;  1MQH A;  3M3K A;  5K2Y A;  1WOD A;  2Y7P A;  3MQ9 A;  1ZMG A;  1UIU A;  1ZIU A;  1MY2 A;  5I59 A;  1VFE A;  2O1M A;  4U4X A;  1JNF A;  3H6U A;  3OO9 A;  1B6H A;  2ZYN A;  1JEV A;  1US4 A;  3H7M A;  4R9F A;  1M5B A;  3MPL A;  2XXY A;  1SYH A;  3RY3 A;  4JWO A;  2OLB A;  2XD3 A;  5HBC A;  4ZEK A;  3SEY A;  1B7H A;  4R2F A;  5H8F A;  3H6T A;  1B0H A;  2RC7 A;  3TDJ A;  3ONM A;  1MXY A;  3TTR A;  3VXC A;  3OEN A;  2F6G A;  4G8H A;  3RLF E;  4AB6 A;  3KEI A;  4KYD A;  2RCA A;  3FD3 A;  3C4M A;  1PC3 A;  3T9U A;  3S9M C;  5KZT A;  3OD7 A;  3QUF A;  2IEE A;  3LR1 A;  5FHO A;  3FXR A;  2F7C A;  4QSC A;  4NF4 B;  5FTH A;  2V3T A;  3EN3 A;  3FXQ A;  3MVY A;  4OMB A;  5L9S A;  2R9J A;  2Z8F A;  3D4C A;  1ZKB A;  3TMG A;  3LSW A;  1B4H A;  1PB7 A;  2X26 A;  3HST A;  3GZG A;  5KCJ B;  1B3F A;  4H65 A;  3V83 A;  4GXS B;  3K6W A;  2DWI A;  3WAF A;  2X7Q A;  2XXX A;  4OVJ A;  4Q5T A;  4YKP A;  4FOR A;  3DP4 A;  3EHT A;  1LAH E;  2XX7 A;  5CMC A;  1EZ9 A;  4M4G A;  3MZ9 A;  1UTH A;  3TAJ A;  2A5T A;  3KOT A;  3O97 A;  5LOM A;  1IEJ A;  1MM7 A;  3Q25 A;  1B9J A;  1L5T A;  1MH3 A;  4OTE A;  1N7X A;  2XXH A;  3SER A;  1D3K A;  3K00 A;  3G3K A;  4GVO A;  3DLN A;  3OO6 A;  2QS2 A;  3GBB A;  3PUV E;  4NMY A;  4E0X A;  3G3J A;  1P1Q A;  3L6H A;  3HHF A;  4TLM B;  2QS1 A;  1S50 A;  3FV2 A;  5CMB A;  1NH7 A;  1Y3N A;  4NF6 A;  5I59 B;  2XXP A;  4Q0C A;  3OMB A;  2HCA A;  2E1S A;  4X1D A;  4EF1 A;  1BP5 A;  5BUU A;  5JTY A;  3Q27 A;  3LSX A;  2BJJ X;  2I58 A;  3ZKL A;  1DPE A;  1P1O A;  5IKB A;  1LBB A;  3SET A;  4BDL A;  4KHZ E;  4LZ7 A;  3DM0 A;  3RTF B;  1A99 A;  2D21 A;  1FTL A;  3Q26 A;  4RNS A;  3H6V A;  2F5X A;  3TTL A;  4HCW A;  2O84 X;  3I3V A;  4IO2 A;  4IGR A;  2O1L A;  2V84 A;  3FVG A;  1IXH A;  5CI5 A;  1MXV A;  4KD5 A;  3FZV A;  1A40 A;  3EHU A;  1JQF A;  2F78 A;  4OHN A;  4KQP A;  1S7Y A;  1VSO A;  4ZEI A;  3C34 A;  4GLI A;  1UIV A;  2LAO A;  4DCY A;  2XXV A;  2D3I A;  4G68 C;  2ZYO A;  2PT1 A;  4I9D A;  2QMX A;  1JET A;  1EU8 A;  3V5A A;  1FQB A;  1GV8 A;  5IAI A;  4MF3 A;  4UAC A;  4F3P A;  4R2B A;  3FVN A;  3IOV A;  3PUX E;  3RTW B;  4HTG A;  1IIT A;  3VLU A;  1SD3 A;  3DEL B;  2ABH A;  5CBR A;  3K6X A;  3TYH A;  4LZ8 A;  3O9P A;  3SES A;  1Y1Z A;  2YJP A;  1TFD A;  1B40 A;  4HCY A;  3PPO A;  4TOZ A;  4DDD A;  2Z23 A;  3TCG A;  4G2Z A;  3O6G A;  4F39 A;  1LAF E;  4QF9 A;  5CM6 A;  4RPO A;  1SW5 A;  2DQV A;  4BDM A;  2GRV A;  5TP9 B;  3MWB A;  3UIF A;  3FVO A;  4QSD A;  4ZDM A;  3MZ1 A;  2NUV A;  2XXQ A;  2F34 A;  2QJE A;  5I57 A;  3VXB A;  1URD A;  3RUM A;  3P7I A;  5I56 A;  4OFO A;  3MVX A;  5JTY B;  3CFL A;  4QSE A;  5AA4 A;  2PX1 A;  4RJZ A;  1LCT A;  1IZ1 A;  4WKM A;  1M5C A;  3IOU A;  5DT6 A;  1H3D A;  1JVX A;  4XKP A;  1NFT A;  1URG A;  2VGQ A;  4POX A;  1TWY A;  1LFH A;  1IIW A;  2YLN A;  3K4U A;  5J1D A;  1Y9U A;  4XKR A;  1B52 A;  1MS7 A;  2RKM A;  2UYF A;  4I8C A;  3G3F A;  4U2R A;  2DE3 A;  4OZ9 A;  4PFU A;  4PP0 A;  1P1W A;  1H45 A;  2REJ A;  3O2A A;  2UXA A;  3MUQ A;  1B3H A;  2OWT A;  1LGB C;  1ZU0 A;  1SW2 A;  2DWH A;  3S9L C; 
#chains in the Genus database with same CATH topology
 3U72 A;  3VLV A;  3G7W A;  3PMV A;  2RF1 A;  2CZH A;  2VD2 A;  4FJP A;  2P3N A;  1PDA A;  3E4R A;  4YB6 A;  1B1X A;  1BTJ A;  2QMW A;  3S9N C;  4XKN A;  4GIZ A;  3MJN A;  3FGS A;  1FPK A;  3FV1 A;  4FBP A;  4GBW A;  3TTN A;  4YB7 A;  4YKI A;  3OOA A;  1MY3 A;  4PF8 A;  4NWC A;  3KG2 A;  4X9T A;  1N84 A;  4M1V A;  4XEQ A;  2AIX A;  4O7I A;  3KSX A;  3BIH A;  3MBP A;  4DLD A;  4NF5 A;  1FPI A;  5AA2 A;  2HZK A;  4EF2 A;  2Q8J A;  2P0S A;  3IJX B;  1N04 A;  4RYA A;  4HXV A;  3CHG A;  5I58 B;  4LVQ A;  4RK9 A;  1UTB A;  2PT2 A;  3HHG A;  4PGP A;  2UVI A;  2WYK A;  3UK4 A;  1PB9 A;  5I2N A;  2FA7 A;  1O7T A;  1MXU A;  1Q35 A;  1NV4 A;  2GFE A;  2F7B A;  2DWJ A;  2DSF A;  4DZ1 A;  2PFY A;  1Q1K A;  4C1T A;  1NUY A;  1B0L A;  5B7D A;  4NF8 A;  1NV0 A;  1I69 A;  5FHM A;  1QUL A;  1NNT A;  4PET A;  4F3G A;  2KQZ A;  1M5F A;  1HSL A;  5F7V A;  3N6T A;  4X1B A;  4KR5 A;  4P3L A;  2PFZ A;  4NED A;  4IO3 A;  4R74 A;  2Y7W A;  2CZK A;  1UQW A;  4P11 A;  3U94 A;  1KZ8 A;  1N7W A;  2VPO A;  1NNP A;  4ISU A;  1OLA A;  1FTA A;  2DVC A;  2DXR A;  4C1U A;  3QK6 A;  2DXY A;  4N6K A;  1GR2 A;  1EZO A;  2QPQ A;  3KFM A;  3T9H B;  2VP1 A;  1EYI A;  2H25 A;  3CIJ A;  5A5L A;  4G68 A;  3C9H A;  3TQW A;  2CMO A;  4H8J A;  4G4P A;  4ZEF A;  1Y3Q A;  4KXP A;  4ELO A;  3B6T A;  3V89 B;  2I6E A;  3CFX A;  1J1N A;  4G8M A;  2F3B A;  5CMM A;  4XXU A;  4P0I A;  2FYI A;  4ELQ A;  2QSX A;  5BWJ A;  2ZMB A;  3LV0 A;  1I6B A;  1JEU A;  3VLW A;  2GHB A;  3C36 A;  2DVZ A;  3K6U A;  3HV1 A;  3FAT A;  3SEX A;  3N26 A;  2GHA A;  2XX8 A;  2Y7R A;  2O51 A;  1NV5 A;  3PPP A;  4PFY A;  2PMS A;  4NQ8 A;  4ESX A;  4NAP A;  4XFE A;  2HEU A;  1YCJ A;  3CSB A;  4O3B A;  1G0I A;  1IMF A;  3MP1 A;  1I6Q A;  1FPF A;  2RIN A;  4TQU Q;  3QYT A;  3UP9 A;  4QFN A;  2Q89 A;  4GXA A;  4ZEB A;  4YKJ A;  2R6G E;  1A8F A;  3B50 A;  3Q28 A;  4LN5 A;  1FQA A;  4IY6 A;  4HW8 A;  4HS7 A;  4R73 A;  3AXF A;  4EUO A;  3O28 A;  1VR5 A;  3OO8 A;  2OWS A;  3IAZ A;  3LC8 A;  4LQ5 A;  4IO7 A;  1ANF A;  1Y20 A;  4OET A;  2DYX A;  2H99 A;  2I4C A;  2FIX A;  3V8X B;  4ONY A;  3PPN A;  1VFD A;  5I2N B;  4NGU A;  1B4Z A;  2Q74 A;  3IX1 A;  4UAB A;  4OER A;  1ZTY A;  5I3S A;  4DXU A;  5L9O A;  3KN3 A;  4ELP A;  3SEV A;  3MVZ A;  5H8N A;  4LA9 A;  1FJ9 A;  1SPI A;  2L5V A;  1US5 A;  3KN8 A;  4F19 A;  3PMW A;  3OEL A;  3E9X A;  4IB2 A;  4FE8 A;  4F1U A;  2ZYK A;  4KI0 E;  3QMF A;  4YU0 A;  3VVD A;  3UOR A;  3HO7 A;  3ODB A;  1FQC A;  3EPE A;  1B5J A;  4N15 A;  4QFP A;  2B4M A;  1Y3P A;  2DE2 A;  4PF6 A;  5H8Q A;  3K1M A;  1SBP A;  4G8N A;  1NV3 A;  4IR8 A;  4NE4 A;  1RDY A;  1HSJ A;  2AL5 A;  5DTB A;  1R1N A;  1USY H;  2XWV A;  3CG1 A;  2HPG A;  5JK4 A;  2MKZ A;  4DXC A;  5IM2 A;  4GOT A;  2QRY A;  5H8F B;  4MCO A;  4P9K A;  1D9Y A;  1SI1 A;  4F31 B;  3C35 A;  3JV9 A;  4H6D A;  1OLC A;  2ESN A;  2CZI A;  3R6U A;  2B3B A;  4RA1 A;  2VOZ A;  4JB7 A;  5CBS A;  1WVJ A;  1SW1 A;  1AMF A;  2V93 A;  3TQL A;  3MAM A;  3TKD A;  1ELJ A;  3B7D A;  4MEV A;  4GWW A;  4YB5 A;  1IMD A;  1OVT A;  5ITO A;  3CI8 A;  4GF8 A;  3DP6 A;  2RCB A;  4DI4 B;  2OX3 A;  4H67 A;  4MX6 A;  2ZZV A;  5I2K A;  1POY 1;  1SQY A;  1BK4 A;  5ELV A;  1Y4T A;  4JSO A;  3K2D A;  4OVQ A;  4UA8 A;  4MLV A;  5ESY A;  4H5F A;  2O69 A;  1OIB A;  3FJG A;  1LBC A;  3G3G A;  1RDX A;  1DTZ A;  4GQO A;  3MP6 A;  3TUS A;  5H8H A;  4EQ7 A;  1IME A;  1I6A A;  4LUB A;  2WYP A;  3FXU A;  5AA1 A;  4U1Z A;  4LP2 B;  3RQT A;  2NXO A;  4F29 A;  2XXI A;  4ZEC A;  1XC1 A;  2F36 A;  1ATG A;  1FQD A;  4I3Y A;  4PDD A;  4Z0I A;  4GL0 A;  3O6H A;  4AQ4 A;  4P47 A;  1UTH B;  4GWS A;  3W9V A;  2A5T B;  1YYZ A;  4OA4 A;  2PBW A;  3ILU B;  4P1E A;  4JDF A;  1B3E A;  1P1N A;  3ZKK A;  2HZL A;  1JP4 A;  1B51 A;  1MPB A;  1MQI A;  4U21 A;  1IMA A;  1LBV A;  3B6Q A;  4U22 A;  5ET8 A;  1S9T A;  4F18 A;  4NN3 A;  4OES A;  3RPW A;  3N6U A;  5IZZ A;  2OJT A;  2QFL A;  4XKQ A;  1M5D A;  3OSQ A;  3TEL A;  1FQF A;  3NOH A;  2FBP A;  4FEC A;  4NF6 B;  2CEX A;  4MNP A;  2HXW A;  4N4U A;  2I0C A;  4JSD A;  2Q2C A;  4RK2 A;  5DYH A;  3RT8 A;  4ZE9 A;  3R7X A;  4JXI A;  4XF5 A;  1LFI A;  2O7U A;  4GFR A;  5KDT A;  3VDF A;  5TPA A;  4MBP A;  5JEI A;  1WDN A;  4OEN A;  5EYG A;  2ZYM A;  1FPL A;  3T66 A;  5A5X A;  2I48 A;  1MY1 A;  4YAH X;  4FAT A;  4PE5 B;  4OFJ A;  2OK2 A;  3H4Z A;  3CSG A;  4MAG A;  3MST A;  1NUW A;  1LLS A;  2ZNT A;  2G29 A;  1LBZ A;  3TCF A;  5IZ3 B;  3PUW E;  3Q29 A;  4R72 A;  3S4U A;  3SZP A;  3IR1 A;  3K01 A;  3K6V A;  2RC8 A;  4N17 A;  1MXZ A;  4BLA A;  1PEB A;  2Q88 A;  5DEX A;  2R8T A;  4JWY A;  4N6D A;  1R9L A;  1MG1 A;  4DXB A;  1TT1 A;  1FPE A;  3KSJ A;  1NMU A;  4N8Y A;  4JWX A;  4GD5 A;  2OZZ A;  1MH4 A;  2H9B A;  2R71 A;  4O7M A;  2FIE A;  3PPQ A;  2I3V A;  3KZG A;  4OEV A;  1AWB A;  3JYR A;  2UVJ A;  3UGW A;  3PV0 E;  3L6G A;  4GWO A;  2F7A A;  3RT6 B;  3CFZ A;  3TFL A;  1URS A;  4ZZA A;  2Y7I A;  2XA5 A;  4I40 A;  3E78 A;  1SW4 A;  1DTG A;  4POW A;  3T22 A;  3H6W A;  1XVY A;  3QAX A;  3N5L A;  2H5Y A;  3IOR A;  4KCD A;  4QBA A;  4KCC A;  1O64 A;  4GL8 A;  4PTK A;  1MQD A;  1BKA A;  4O3C A;  4OXV A;  4R6H A;  3SEW A;  2FNC A;  4C0R A;  1XOC A;  1EH3 A;  3THI A;  1ZLQ A;  3USD A;  1XHY A;  2PYY A;  4I1D A;  2YPN A;  2UVH A;  3IK6 B;  4QFL A;  2WEF A;  1POT A;  1BLF A;  4KFQ A;  1XVX A;  2VHA A;  2I49 A;  4NF4 A;  1FTO A;  2DWA A;  3W9W A;  2NWJ A;  2E0S A;  2VT5 A;  3HPI A;  3C31 A;  3RNN A;  4F2Q A;  5KCJ A;  5HPQ A;  1B1H A;  1LCF A;  2HFB A;  4XTC Q;  4K3F A;  3BFT A;  1H43 A;  1Q9D A;  4NF0 A;  1LAX A;  2W7Y A;  4DIG A;  2KR0 A;  1JW1 A;  1IUD A;  2WBD A;  2HAV A;  4PQJ A;  3LSL A;  4R6K A;  1Z7N E;  5I57 B;  2Q2A A;  4GX4 A;  1MDQ A;  1SI0 A;  5I56 B;  5EQ9 A;  3MVW A;  4N13 A;  1A54 A;  1CNQ A;  5KDT B;  3E3K A;  3M8U A;  2JJK A;  3KGC A;  5AA4 B;  4ELR A;  2Y7K A;  3PMX A;  2QL3 A;  1DMB A;  3PGF A;  1MXW A;  5EYH A;  3GBA A;  1LBY A;  3DP8 A;  3T9V A;  4NWD A;  5HM4 B;  3PD9 A;  3EF7 A;  1O63 A;  4HE1 A;  3N94 A;  3RN8 A;  4RPN A;  4QFO A;  4HE0 A;  2B65 A;  2UYE A;  5DVI A;  4F3S A;  1FTJ A;  4O8M A;  1AL3 A;  4H5G A;  4EQ9 A;  3H3G A;  1K9Z A;  4MFI A;  4OFL A;  3MP8 A;  1FBE A;  1MXX A;  3KBZ A;  4R75 A;  5DEX B;  1MY0 A;  2QS3 A;  3CVG A;  3M3F A;  3OEK A;  2RC9 A;  3MC2 A;  3T93 B;  2OBG A;  3BFU A;  3GXA A;  4YMB A;  1DBZ A;  1GVC A;  5TU0 A;  1K9Y A;  2IA4 A;  3A3U A;  3T9X B;  1QUJ A;  4NHB A;  4NG7 A;  1FSA A;  2I0B A;  1VE4 A;  4EXL A;  1EYJ A;  3OXN A;  3F11 A;  3MYU A;  1MQG A;  1H44 A;  2XX9 A;  3KBR A;  4H0W A;  3FVK A;  3FBP A;  3K0V A;  1OQH A;  2I4B A;  3QIM A;  4F1V A;  4ESW A;  4PFB A;  2ZZX A;  4GBV A;  4OQO A;  1SDX A;  1IXI A;  2O6A A;  1IMB A;  4QXD A;  2Y84 A;  3HN0 A;  1FW0 A;  4LQ2 A;  1B7Z A;  2G93 A;  5EHS A;  2F6P A;  3PUY E;  1TFA A;  4NF5 B;  5AA2 B;  1HSE A;  2O7I A;  4O3A A;  1B58 A;  1LST A;  2HQ0 A;  3C33 A;  1B5I A;  1B3L A;  4JBZ A;  4PFI A;  1IQ7 A;  1UTB B;  5DVF A;  1NUX A;  3PPR A;  2P2A A;  1FBP A;  1B5H A;  1OVB A;  4DE8 A;  3QXM A;  2XXW A;  1MDP 1;  4OVT A;  1DSN A;  5K2X A;  1VDW A;  3VV5 A;  2NOO A;  2VD3 A;  5CRY A;  1D4N A;  2AL4 A;  4Q8R A;  3R26 A;  2WBB A;  3IB2 A;  4U23 A;  4NF8 B;  1IXC A;  2O68 A;  4G61 A;  1P99 A;  4FIM A;  1LFG A;  3S2V A;  1JW4 A;  3QUJ A;  4IY5 A;  4NTL A;  2ALU A;  3O66 A;  3S9E A;  2ONR A;  4KPT A;  4IO5 A;  1P1U A;  4FEB A;  3VFJ A;  1JW5 A;  5I84 A;  3KJT A;  4OVS A;  1FQE A;  3C32 A;  3TTK A;  4KYS A;  3VE1 B;  2NVU B;  3TEP A;  3VVE A;  1QW0 A;  1FCK A;  1MPD A;  4IO6 A;  4GWZ A;  4G68 B;  4PAK A;  5T3J A;  3VVF A;  1RYX A;  4JVI A;  4JVD A;  4OYV A;  3D1R A;  1RKM A;  5H8S A;  4P56 A;  5TP9 A;  2HAU A;  3PD8 A;  2BJI A;  3B6W A;  3H06 B;  3M3L A;  3U92 A;  2XWO A;  4QRZ A;  2XXK A;  3HCQ A;  1EZP A;  4MNI A;  3O29 A;  1N76 A;  2QVU A;  3JZJ A;  1EYK A;  3PU5 A;  2I3W A;  3BKI B;  2PCR A;  1XT8 A;  1B05 A;  4WED A;  3TCH A;  1B32 A;  5ITP A;  2XXT A;  3GYY A;  4AS5 A;  3U8Q A;  3U93 A;  2GH9 A;  5FHN A;  2DS9 A;  2Q8M A;  1MM6 A;  2X7P A;  4ZE8 A;  3A3C A;  3E79 A;  4IGT A;  1INP A;  1B7U A;  4GRK A;  1LEV A;  4YIC A;  4KYE A;  1R6Z A;  5EHM A;  5DW8 A;  1FRP A;  4WXJ A;  3UA8 A;  5ISU A;  4BDO A;  1II5 A;  3UN6 A;  3FUZ A;  3IFC A;  5AA3 A;  4ZED A;  3OO7 A;  4PBH A;  5B70 A;  2V25 A;  1FPB A;  1R9Q A;  3D4G A;  4PC9 A;  1Y4C A;  3LSF B;  3G3I A;  1ZBM A;  1LAG E;  3SEU A;  2F97 A;  1MPC A;  3FJM A;  4H8I A;  1M5E A;  5AA2 D;  4OAN A;  2F35 A;  3FIR A;  2AYS A;  1PB8 A;  4FAJ A;  4ZZE A;  2Y5K A;  5L9M A;  1QUI A;  4DI3 D;  1D9Q A;  5IGA A;  1NUZ A;  4X48 A;  3MZB A;  1USY E;  4DCX A;  4OVR A;  4RY1 A;  1QKB A;  3TPA A;  5M2V A;  1CB6 A;  5ICQ A;  1BIY A;  1NNF A;  2XD2 A;  3KJ7 A;  5EQ7 A;  1A7L A;  3E13 X;  5H8N B;  1T0K A;  2HXR A;  3RPL A;  1B2H A;  4QHQ A;  1A8E A;  4N91 A;  3IO4 A;  1FPJ A;  5I58 A;  3KOS A;  5ICT A;  3A29 A;  1SVX B;  3K1N A;  3SKP A;  1Z7M E;  4RXL A;  4TLL B;  3HFU A;  5ET7 A;  4H1X A;  1QKA A;  3KC1 A;  5L8D A;  4ZS9 A;  2ZNU A;  5EYF A;  2XXU A;  1GTK A;  3ZSF A;  4I62 A;  3KN7 A;  1A55 A;  3W15 C;  4BDN A;  5H8Q B;  3PUZ E;  1AOV A;  2CZL A;  3K02 A;  3K1P A;  4OEU A;  3RGY A;  3TZA A;  3MPK A;  3LUY A;  5ET6 A;  1LBW A;  1XS5 A;  2WKY A;  5DVJ A;  3IO6 A;  4F2O A;  1YAE A;  3EHS A;  1OQG A;  3IB1 A;  4EXK A;  1YTV A;  1PBP A;  4MJO A;  3RYD A;  3LBS A;  3A09 A;  3IJO B;  4GWX A;  2ONK E;  4Z7E A;  1YPN A;  1QJM A;  1JVY A;  1NH8 A;  4GWY A;  2XXR A;  1N0T A;  2THI A;  1CE2 A;  1GGG A;  1FTK A;  2XHD A;  4H45 A;  2Z22 A;  3SDF A;  4E0W A;  1OMP A;  1ZJL A;  4YZZ A;  2Z8E A;  2D5W A;  4N8G A;  1IXG A;  2ANJ A;  3T96 B;  2V4C A;  2H4I A;  1FTM A;  2P1S A;  1RYO A;  1IMC A;  1DPP A;  2F8D A;  2Z8D A;  5I2K B;  1TXF A;  2B3F A;  1MY4 A;  3CG3 A;  4F3B A;  5AE4 A;  4YMA A;  4U4S A;  2Y5L A;  2DE4 A;  2DP8 A;  3O6I A;  4F22 A;  2UVG A;  5EQA A;  3EQ1 A;  3BBR A;  1N3W A;  4YKK A;  5CMK A;  4MHF A;  2DOJ A;  3I6V A;  3PTY A;  4G77 A;  1B3G A;  4MH5 A;  5H8H B;  4N6P A;  3TTM A;  4PFW A;  3FAS A;  4XIG Q;  4BDQ A;  2ZNS A;  2A5S A;  1F9B A;  4R6Y A;  1QUK A;  1SYI A;  4OWD A;  4MLQ A;  4N07 A;  2Q9T A;  2PVU A;  3IL1 B;  1AH5 A;  3WAE A;  3ILT B;  4LON B;  5F1Q A;  3GLB A;  1FPG A;  3IOT A;  4MMP A;  3U1O A;  1QVS A;  4Q30 B;  2KLF A;  2V3Q A;  2REG A;  2QVV A;  1QGX A;  3CR9 A;  3RPL B;  1KWH A;  4EDP A;  1LB9 A;  4P0G A;  5FTI A;  4AB5 A;  3H03 A;  3G3H A;  1FBC A;  3OSR A;  4PFT A;  2HHM A;  1NKX A;  4EQB A;  1Y1M A;  3ECR A;  3MW0 A;  4R9G A;  3OEM A;  3ZS6 A;  4BDR A;  4FED A;  3KC0 A;  4LAT A;  4LZ5 A;  1NV2 A;  3IOW A;  4L17 A;  1YXI A;  1B46 A;  3I5O A;  2ZXT A;  3FJ7 A;  1H76 A;  3IB0 A;  4ND9 A;  1D9V A;  1DOT A;  4IO4 A;  1AIV A;  1NV7 A;  2ZZW A;  4P1L A;  1PBQ A;  4QFK A;  2ONS A;  2H98 A;  1MQJ A;  1NL5 A;  2P3V A;  3T0J A;  4WEP A;  5TPA B;  3T1B A;  4GWU A;  4ECF A;  1FPD A;  4F1Y A;  3QSL A;  1MRP A;  5A5X B;  1LB8 A;  2QS4 A;  2OCU A;  4U1O A;  3TOD A;  2M8C A;  4THI A;  4GX6 A;  2V3U A;  1NNK A;  1N3X A;  5CC2 A;  4PGN A;  3CRB A;  5I7I A;  1MQH A;  3M3K A;  5K2Y A;  1WOD A;  4PCD A;  3U65 A;  2Y7P A;  3MQ9 A;  1ZMG A;  1UIU A;  1ZIU A;  1MY2 A;  5I59 A;  1YZ0 A;  1VFE A;  2O1M A;  4U4X A;  1JNF A;  3H6U A;  3OO9 A;  1B6H A;  1NV1 A;  2ZYN A;  1JEV A;  1US4 A;  3H7M A;  4R9F A;  1M5B A;  3MPL A;  1XI6 A;  2XXY A;  1LBX A;  1FBG A;  1SYH A;  3RY3 A;  4JWO A;  2OLB A;  2XD3 A;  5HBC A;  2WX9 A;  4ZEK A;  3SEY A;  1B7H A;  4R2F A;  5H8F A;  3H6T A;  1B0H A;  4PFR A;  3IFA A;  2RC7 A;  3TDJ A;  3ONM A;  1MXY A;  3TTR A;  3VXC A;  3OEN A;  2F6G A;  4G8H A;  3RLF E;  4AB6 A;  3KEI A;  4KYD A;  2RCA A;  3FD3 A;  3C4M A;  1PC3 A;  2VPN A;  3T9U A;  4NX1 A;  5KZT A;  3S9M C;  3OD7 A;  3QUF A;  1FBH A;  2IEE A;  3LR1 A;  5FHO A;  3FXR A;  2F7C A;  4QSC A;  4NF4 B;  5FTH A;  2V3T A;  3EN3 A;  3FXQ A;  3MVY A;  4OMB A;  5L9S A;  2R9J A;  2Z8F A;  3D4C A;  1ZKB A;  3TMG A;  3LSW A;  5ET5 A;  1B4H A;  1PB7 A;  2X26 A;  3HST A;  4PE3 A;  3GZG A;  5KCJ B;  1B3F A;  4H65 A;  3V83 A;  4GXS B;  3K6W A;  2DWI A;  4JVC A;  3WAF A;  2X7Q A;  2XXX A;  4OVJ A;  4Q5T A;  4YKP A;  4FOR A;  3DP4 A;  3EHT A;  1LAH E;  2XX7 A;  5CMC A;  1EZ9 A;  4M4G A;  3MZ9 A;  1UTH A;  2B4L A;  3TAJ A;  2A5T A;  3KOT A;  3O97 A;  3BIG A;  5LOM A;  1IEJ A;  1MM7 A;  5EQ8 A;  3Q25 A;  1B9J A;  1L5T A;  1MH3 A;  4OTE A;  1N7X A;  1FBD A;  1FBF A;  2XXH A;  3SER A;  1D3K A;  3K00 A;  3G3K A;  4OVP A;  1NV6 A;  3ISP A;  4GVO A;  3DLN A;  3OO6 A;  2QS2 A;  2OWZ A;  1G0H A;  3GBB A;  3PUV E;  5I5P A;  4NMY A;  4E0X A;  3G3J A;  1P1Q A;  3L6H A;  1KA0 A;  3HHF A;  4TLM B;  2QS1 A;  1S50 A;  3FV2 A;  5CMB A;  1NH7 A;  1Y3N A;  4NF6 A;  5I59 B;  2XXP A;  4Q0C A;  3OMB A;  2HCA A;  2E1S A;  4X1D A;  4EF1 A;  1BP5 A;  5BUU A;  5JTY A;  1RDZ A;  5FBP A;  3Q27 A;  3LSX A;  2BJJ X;  2I58 A;  3ZKL A;  1DPE A;  1P1O A;  5IKB A;  2F3D A;  1LBB A;  3ROJ A;  3SET A;  4BDL A;  4KHZ E;  4LZ7 A;  5F24 A;  3DM0 A;  3RTF B;  5J16 A;  1A99 A;  2D21 A;  3LUZ A;  1DK4 A;  1FTL A;  3Q26 A;  5IZ3 A;  4PAI A;  2CEY A;  4RNS A;  4HE2 A;  3H6V A;  2F5X A;  3TTL A;  4HCW A;  1FJ6 A;  4O94 A;  5LDZ A;  4I3E A;  2O84 X;  4PBQ A;  3I3V A;  4IO2 A;  4X8R A;  4N81 A;  4IGR A;  2O1L A;  4PDH A;  2V84 A;  3FVG A;  1IXH A;  5CI5 A;  1MXV A;  4KD5 A;  3FZV A;  1A40 A;  3EHU A;  1JQF A;  2F78 A;  4OHN A;  4KQP A;  2GQ1 A;  1S7Y A;  4X04 A;  1VSO A;  3FXB A;  1NI9 A;  4ZEI A;  1KA1 A;  4MNC A;  3C34 A;  4GLI A;  1UIV A;  2LAO A;  4DCY A;  2DDK A;  2XXV A;  2D3I A;  4G68 C;  2ZYO A;  2PT1 A;  4I9D A;  2QMX A;  1JET A;  1EU8 A;  3V5A A;  4P8B A;  1FQB A;  1GV8 A;  5IAI A;  4MF3 A;  4UAC A;  4F3P A;  4R2B A;  3FVN A;  3IOV A;  3PUX E;  3RTW B;  4HTG A;  1IIT A;  3VLU A;  1SD3 A;  3DEL B;  2ABH A;  3B8B A;  5LTC A;  5IZ1 A;  5CBR A;  3K6X A;  3TYH A;  4LZ8 A;  3O9P A;  3SES A;  1Y1Z A;  2YJP A;  1TFD A;  1B40 A;  4HCY A;  3PPO A;  4TOZ A;  4DDD A;  2Z23 A;  3TCG A;  4G2Z A;  3O6G A;  4GX3 A;  4F39 A;  1LAF E;  4QF9 A;  5CM6 A;  4RPO A;  1SW5 A;  2DQV A;  4BDM A;  2GRV A;  5TP9 B;  3MWB A;  3UIF A;  3FVO A;  4QSD A;  4ZDM A;  3MZ1 A;  2NUV A;  2XXQ A;  2F34 A;  2QJE A;  5I57 A;  3VXB A;  1URD A;  2XWI A;  3RUM A;  3P7I A;  5I56 A;  4OFO A;  1DCU A;  3MVX A;  5JTY B;  2XWK A;  3CFL A;  4QSE A;  5AA4 A;  2PX1 A;  4RJZ A;  1LCT A;  1IZ1 A;  4AS4 A;  2QVR A;  4H46 A;  4WKM A;  1M5C A;  3IOU A;  5DT6 A;  1H3D A;  1JVX A;  4XKP A;  1NFT A;  1URG A;  2VGQ A;  4POX A;  1TWY A;  1LFH A;  1IIW A;  2YLN A;  2FHY A;  3K4U A;  5J1D A;  1Y9U A;  4XKR A;  1B52 A;  2FVZ A;  1MS7 A;  4MIJ A;  2RKM A;  2UYF A;  4I8C A;  4PAF A;  3G3F A;  4U2R A;  2DE3 A;  4OZ9 A;  4PFU A;  4PP0 A;  1P1W A;  3EKI A;  1H45 A;  2REJ A;  3O2A A;  2UXA A;  3MUQ A;  1B3H A;  2OWT A;  1LGB C;  1ZU0 A;  1SW2 A;  2DWH A;  3S9L C; 
#chains in the Genus database with same CATH homology
 3U72 A;  3VLV A;  3G7W A;  3PMV A;  2RF1 A;  2VD2 A;  4FJP A;  1PDA A;  3E4R A;  4YB6 A;  1B1X A;  1BTJ A;  2QMW A;  3S9N C;  4XKN A;  4GIZ A;  3MJN A;  3FGS A;  3FV1 A;  3TTN A;  4YB7 A;  4YKI A;  3OOA A;  1MY3 A;  4NWC A;  3KG2 A;  4X9T A;  1N84 A;  4M1V A;  2AIX A;  3KSX A;  3MBP A;  4DLD A;  4NF5 A;  5AA2 A;  2HZK A;  4EF2 A;  2Q8J A;  2P0S A;  3IJX B;  1N04 A;  4RYA A;  5I58 B;  4LVQ A;  4RK9 A;  1UTB A;  2PT2 A;  3HHG A;  2UVI A;  3UK4 A;  1PB9 A;  5I2N A;  2FA7 A;  1O7T A;  1MXU A;  1Q35 A;  2GFE A;  2F7B A;  2DWJ A;  2DSF A;  4DZ1 A;  1Q1K A;  4C1T A;  1B0L A;  5B7D A;  4NF8 A;  1I69 A;  5FHM A;  1QUL A;  1NNT A;  4PET A;  4F3G A;  1M5F A;  1HSL A;  5F7V A;  3N6T A;  4X1B A;  4KR5 A;  4NED A;  4IO3 A;  4R74 A;  2Y7W A;  1UQW A;  4P11 A;  3U94 A;  1N7W A;  1NNP A;  4ISU A;  1OLA A;  2DVC A;  2DXR A;  4C1U A;  3QK6 A;  2DXY A;  1GR2 A;  1EZO A;  2QPQ A;  3KFM A;  3T9H B;  2VP1 A;  2H25 A;  3CIJ A;  4G68 A;  3C9H A;  3TQW A;  2CMO A;  4H8J A;  4G4P A;  4ZEF A;  1Y3Q A;  4ELO A;  3B6T A;  3V89 B;  2I6E A;  3CFX A;  1J1N A;  4G8M A;  5CMM A;  4XXU A;  4P0I A;  2FYI A;  4ELQ A;  2QSX A;  5BWJ A;  2ZMB A;  1I6B A;  1JEU A;  3VLW A;  2GHB A;  3C36 A;  2DVZ A;  3K6U A;  3HV1 A;  3FAT A;  3SEX A;  3N26 A;  2GHA A;  2XX8 A;  2Y7R A;  2O51 A;  3PPP A;  4PFY A;  2PMS A;  4ESX A;  2HEU A;  1YCJ A;  3CSB A;  4O3B A;  3MP1 A;  1I6Q A;  2RIN A;  4TQU Q;  3QYT A;  3UP9 A;  4QFN A;  2Q89 A;  4GXA A;  4ZEB A;  4YKJ A;  2R6G E;  1A8F A;  3Q28 A;  1FQA A;  4IY6 A;  4HW8 A;  4HS7 A;  4R73 A;  3AXF A;  4EUO A;  3O28 A;  1VR5 A;  3OO8 A;  2OWS A;  3IAZ A;  3LC8 A;  4LQ5 A;  4IO7 A;  1ANF A;  1Y20 A;  4OET A;  2DYX A;  2H99 A;  2I4C A;  3V8X B;  4ONY A;  3PPN A;  1VFD A;  5I2N B;  1B4Z A;  3IX1 A;  4OER A;  1ZTY A;  4DXU A;  5L9O A;  3KN3 A;  4ELP A;  3SEV A;  3MVZ A;  5H8N A;  4LA9 A;  1US5 A;  3KN8 A;  4F19 A;  3PMW A;  3OEL A;  3E9X A;  4IB2 A;  4FE8 A;  4F1U A;  2ZYK A;  4KI0 E;  4YU0 A;  3VVD A;  3UOR A;  3HO7 A;  3ODB A;  1FQC A;  3EPE A;  1B5J A;  4QFP A;  1Y3P A;  2DE2 A;  5H8Q A;  3K1M A;  1SBP A;  4G8N A;  4NE4 A;  1HSJ A;  2AL5 A;  5DTB A;  1R1N A;  1USY H;  3CG1 A;  5JK4 A;  4DXC A;  4GOT A;  2QRY A;  5H8F B;  1D9Y A;  1SI1 A;  4F31 B;  3C35 A;  3JV9 A;  4H6D A;  1OLC A;  2ESN A;  3R6U A;  2B3B A;  4RA1 A;  2VOZ A;  4JB7 A;  5CBS A;  1WVJ A;  1SW1 A;  1AMF A;  2V93 A;  3TQL A;  3MAM A;  3TKD A;  1ELJ A;  3B7D A;  4YB5 A;  1OVT A;  5ITO A;  3CI8 A;  4GF8 A;  3DP6 A;  2RCB A;  4H67 A;  5I2K A;  1POY 1;  1SQY A;  5ELV A;  1Y4T A;  4JSO A;  3K2D A;  4UA8 A;  4MLV A;  4H5F A;  2O69 A;  1OIB A;  3FJG A;  1LBC A;  3G3G A;  1DTZ A;  4GQO A;  3MP6 A;  3TUS A;  5H8H A;  4EQ7 A;  1I6A A;  4LUB A;  3FXU A;  5AA1 A;  4U1Z A;  4LP2 B;  3RQT A;  2NXO A;  4F29 A;  2XXI A;  4ZEC A;  1XC1 A;  2F36 A;  1ATG A;  1FQD A;  4Z0I A;  4GL0 A;  3O6H A;  4AQ4 A;  1UTH B;  3W9V A;  2A5T B;  2PBW A;  3ILU B;  4JDF A;  1B3E A;  1P1N A;  3ZKK A;  2HZL A;  1B51 A;  1MPB A;  1MQI A;  4U21 A;  3B6Q A;  4U22 A;  1S9T A;  4F18 A;  4OES A;  3RPW A;  3N6U A;  2OJT A;  4XKQ A;  1M5D A;  3OSQ A;  3TEL A;  1FQF A;  4FEC A;  4NF6 B;  2HXW A;  2I0C A;  4JSD A;  2Q2C A;  4RK2 A;  5DYH A;  3RT8 A;  4ZE9 A;  3R7X A;  4JXI A;  1LFI A;  2O7U A;  4GFR A;  5KDT A;  3VDF A;  5TPA A;  4MBP A;  5JEI A;  1WDN A;  4OEN A;  2ZYM A;  3T66 A;  5A5X A;  2I48 A;  1MY1 A;  4YAH X;  4FAT A;  4PE5 B;  4OFJ A;  2OK2 A;  3H4Z A;  3CSG A;  1LLS A;  2ZNT A;  2G29 A;  3TCF A;  3PUW E;  3Q29 A;  4R72 A;  3S4U A;  3IR1 A;  3K01 A;  3K6V A;  2RC8 A;  1MXZ A;  4BLA A;  1PEB A;  2Q88 A;  5DEX A;  4JWY A;  1R9L A;  1MG1 A;  4DXB A;  1TT1 A;  3KSJ A;  1NMU A;  4JWX A;  4GD5 A;  2OZZ A;  1MH4 A;  2H9B A;  2R71 A;  3PPQ A;  2I3V A;  3KZG A;  4OEV A;  3JYR A;  2UVJ A;  3UGW A;  3PV0 E;  3L6G A;  4GWO A;  2F7A A;  3RT6 B;  3CFZ A;  3TFL A;  1URS A;  4ZZA A;  2Y7I A;  1SW4 A;  1DTG A;  4POW A;  3T22 A;  3H6W A;  1XVY A;  3QAX A;  3N5L A;  2H5Y A;  3IOR A;  4KCD A;  4KCC A;  1O64 A;  4GL8 A;  1MQD A;  1BKA A;  4O3C A;  4OXV A;  4R6H A;  3SEW A;  2FNC A;  4C0R A;  1XOC A;  1EH3 A;  3THI A;  1ZLQ A;  3USD A;  1XHY A;  2PYY A;  4I1D A;  2YPN A;  2UVH A;  3IK6 B;  4QFL A;  1POT A;  1BLF A;  4KFQ A;  1XVX A;  2VHA A;  2I49 A;  4NF4 A;  1FTO A;  2DWA A;  3W9W A;  2NWJ A;  2E0S A;  3HPI A;  3C31 A;  3RNN A;  4F2Q A;  5KCJ A;  5HPQ A;  1B1H A;  1LCF A;  2HFB A;  4XTC Q;  4K3F A;  3BFT A;  1H43 A;  1LAX A;  2W7Y A;  4DIG A;  1JW1 A;  1IUD A;  2HAV A;  4PQJ A;  3LSL A;  4R6K A;  1Z7N E;  5I57 B;  2Q2A A;  1MDQ A;  1SI0 A;  5I56 B;  3MVW A;  4N13 A;  1A54 A;  5KDT B;  3E3K A;  3M8U A;  3KGC A;  5AA4 B;  4ELR A;  2Y7K A;  3PMX A;  2QL3 A;  1DMB A;  3PGF A;  1MXW A;  3GBA A;  3DP8 A;  3T9V A;  4NWD A;  5HM4 B;  3PD9 A;  3EF7 A;  1O63 A;  3N94 A;  3RN8 A;  4RPN A;  4QFO A;  2B65 A;  2UYE A;  5DVI A;  4F3S A;  1FTJ A;  1AL3 A;  4H5G A;  4EQ9 A;  3H3G A;  4MFI A;  4OFL A;  3MP8 A;  1MXX A;  4R75 A;  5DEX B;  1MY0 A;  2QS3 A;  3CVG A;  3M3F A;  3OEK A;  2RC9 A;  3MC2 A;  3T93 B;  2OBG A;  3BFU A;  3GXA A;  4YMB A;  1GVC A;  5TU0 A;  2IA4 A;  3A3U A;  3T9X B;  1QUJ A;  2I0B A;  1VE4 A;  4EXL A;  3OXN A;  3F11 A;  1MQG A;  1H44 A;  2XX9 A;  3KBR A;  4H0W A;  3FVK A;  3K0V A;  1OQH A;  2I4B A;  3QIM A;  4F1V A;  4ESW A;  4OQO A;  1SDX A;  1IXI A;  2O6A A;  2Y84 A;  3HN0 A;  1FW0 A;  4LQ2 A;  1B7Z A;  2G93 A;  5EHS A;  2F6P A;  3PUY E;  1TFA A;  4NF5 B;  5AA2 B;  1HSE A;  2O7I A;  4O3A A;  1B58 A;  1LST A;  2HQ0 A;  3C33 A;  1B5I A;  1B3L A;  4JBZ A;  5DVF A;  1IQ7 A;  1UTB B;  3PPR A;  2P2A A;  1B5H A;  1OVB A;  4DE8 A;  3QXM A;  2XXW A;  1MDP 1;  1DSN A;  5K2X A;  3VV5 A;  2NOO A;  2VD3 A;  5CRY A;  1D4N A;  2AL4 A;  4Q8R A;  3R26 A;  3IB2 A;  4U23 A;  1IXC A;  2O68 A;  4NF8 B;  1P99 A;  4FIM A;  1LFG A;  3S2V A;  1JW4 A;  3QUJ A;  4IY5 A;  4NTL A;  2ALU A;  3O66 A;  3S9E A;  2ONR A;  4KPT A;  4IO5 A;  1P1U A;  4FEB A;  3VFJ A;  1JW5 A;  5I84 A;  3KJT A;  1FQE A;  3C32 A;  3TTK A;  4KYS A;  3VE1 B;  2NVU B;  3TEP A;  3VVE A;  1QW0 A;  1FCK A;  1MPD A;  4IO6 A;  4G68 B;  3VVF A;  1RYX A;  4OYV A;  1RKM A;  5H8S A;  5TP9 A;  2HAU A;  3PD8 A;  3B6W A;  3H06 B;  3M3L A;  3U92 A;  4QRZ A;  3HCQ A;  1EZP A;  3O29 A;  1N76 A;  3JZJ A;  3PU5 A;  2I3W A;  3BKI B;  1XT8 A;  1B05 A;  4WED A;  3TCH A;  1B32 A;  5ITP A;  2XXT A;  3U8Q A;  3U93 A;  2GH9 A;  5FHN A;  2DS9 A;  1MM6 A;  2X7P A;  4ZE8 A;  3A3C A;  4IGT A;  1B7U A;  4GRK A;  4YIC A;  4KYE A;  1R6Z A;  5EHM A;  4WXJ A;  3UA8 A;  5ISU A;  4BDO A;  1II5 A;  3UN6 A;  3FUZ A;  5AA3 A;  4ZED A;  3OO7 A;  5B70 A;  2V25 A;  1R9Q A;  3D4G A;  1Y4C A;  3LSF B;  3G3I A;  1ZBM A;  1LAG E;  3SEU A;  2F97 A;  1MPC A;  3FJM A;  4H8I A;  1M5E A;  5AA2 D;  2F35 A;  3FIR A;  2AYS A;  1PB8 A;  4FAJ A;  4ZZE A;  5L9M A;  1QUI A;  4X48 A;  3MZB A;  1USY E;  4DCX A;  4RY1 A;  1QKB A;  3TPA A;  5M2V A;  1CB6 A;  5ICQ A;  1BIY A;  1NNF A;  2XD2 A;  3KJ7 A;  1A7L A;  3E13 X;  5H8N B;  1T0K A;  1B2H A;  4QHQ A;  1A8E A;  3IO4 A;  5I58 A;  3KOS A;  5ICT A;  1SVX B;  3K1N A;  3SKP A;  1Z7M E;  4RXL A;  4TLL B;  4H1X A;  1QKA A;  5L8D A;  4ZS9 A;  2ZNU A;  5EYF A;  2XXU A;  1GTK A;  3ZSF A;  4I62 A;  3KN7 A;  1A55 A;  3W15 C;  4BDN A;  5H8Q B;  3PUZ E;  1AOV A;  2CZL A;  3K02 A;  3K1P A;  4OEU A;  3RGY A;  3TZA A;  3MPK A;  3LUY A;  1XS5 A;  2WKY A;  5DVJ A;  3IO6 A;  4F2O A;  1YAE A;  3EHS A;  1OQG A;  3IB1 A;  4EXK A;  1YTV A;  1PBP A;  3LBS A;  3A09 A;  3IJO B;  2ONK E;  4Z7E A;  1YPN A;  1QJM A;  1JVY A;  1NH8 A;  2XXR A;  1N0T A;  2THI A;  1CE2 A;  1GGG A;  1FTK A;  2XHD A;  2Z22 A;  3SDF A;  4E0W A;  1OMP A;  1ZJL A;  4YZZ A;  2Z8E A;  2D5W A;  1IXG A;  2ANJ A;  3T96 B;  2H4I A;  1FTM A;  2P1S A;  1RYO A;  1DPP A;  2F8D A;  2Z8D A;  5I2K B;  1TXF A;  2B3F A;  1MY4 A;  3CG3 A;  4F3B A;  5AE4 A;  4YMA A;  4U4S A;  2DE4 A;  2DP8 A;  3O6I A;  4F22 A;  2UVG A;  3EQ1 A;  3BBR A;  1N3W A;  4YKK A;  5CMK A;  2DOJ A;  3I6V A;  4G77 A;  1B3G A;  4MH5 A;  5H8H B;  4N6P A;  3TTM A;  4PFW A;  3FAS A;  4XIG Q;  4BDQ A;  2ZNS A;  2A5S A;  1F9B A;  4R6Y A;  1QUK A;  1SYI A;  4OWD A;  4MLQ A;  4N07 A;  2Q9T A;  2PVU A;  3IL1 B;  1AH5 A;  3WAE A;  3ILT B;  4LON B;  5F1Q A;  3GLB A;  3IOT A;  3U1O A;  1QVS A;  4Q30 B;  2KLF A;  2V3Q A;  2REG A;  3CR9 A;  1KWH A;  4EDP A;  1LB9 A;  4P0G A;  5FTI A;  4AB5 A;  3H03 A;  3G3H A;  3OSR A;  4PFT A;  1NKX A;  4EQB A;  1Y1M A;  3ECR A;  3MW0 A;  4R9G A;  3OEM A;  3ZS6 A;  4BDR A;  4FED A;  4LAT A;  4LZ5 A;  3IOW A;  4L17 A;  3I5O A;  1B46 A;  2ZXT A;  3FJ7 A;  1H76 A;  3IB0 A;  4ND9 A;  1D9V A;  1DOT A;  4IO4 A;  1AIV A;  1PBQ A;  4QFK A;  2ONS A;  2H98 A;  1MQJ A;  1NL5 A;  4WEP A;  5TPA B;  4ECF A;  4F1Y A;  3QSL A;  1MRP A;  5A5X B;  1LB8 A;  2QS4 A;  2OCU A;  4U1O A;  3TOD A;  2M8C A;  4THI A;  2V3U A;  1NNK A;  1N3X A;  5CC2 A;  3CRB A;  1MQH A;  3M3K A;  5K2Y A;  1WOD A;  2Y7P A;  3MQ9 A;  1ZMG A;  1UIU A;  1ZIU A;  1MY2 A;  5I59 A;  1VFE A;  2O1M A;  4U4X A;  1JNF A;  3H6U A;  3OO9 A;  1B6H A;  2ZYN A;  1JEV A;  1US4 A;  3H7M A;  4R9F A;  1M5B A;  3MPL A;  2XXY A;  1SYH A;  3RY3 A;  4JWO A;  2OLB A;  2XD3 A;  5HBC A;  4ZEK A;  3SEY A;  1B7H A;  4R2F A;  5H8F A;  3H6T A;  1B0H A;  2RC7 A;  3TDJ A;  3ONM A;  1MXY A;  3TTR A;  3VXC A;  3OEN A;  2F6G A;  4G8H A;  3RLF E;  4AB6 A;  3KEI A;  4KYD A;  2RCA A;  3FD3 A;  3C4M A;  1PC3 A;  3T9U A;  3S9M C;  5KZT A;  3OD7 A;  3QUF A;  2IEE A;  3LR1 A;  5FHO A;  3FXR A;  2F7C A;  4QSC A;  4NF4 B;  5FTH A;  2V3T A;  3EN3 A;  3FXQ A;  3MVY A;  4OMB A;  5L9S A;  2R9J A;  2Z8F A;  3D4C A;  1ZKB A;  3TMG A;  3LSW A;  1B4H A;  1PB7 A;  2X26 A;  3HST A;  3GZG A;  5KCJ B;  1B3F A;  4H65 A;  3V83 A;  4GXS B;  3K6W A;  2DWI A;  3WAF A;  2X7Q A;  2XXX A;  4OVJ A;  4Q5T A;  4YKP A;  4FOR A;  3DP4 A;  3EHT A;  1LAH E;  2XX7 A;  5CMC A;  1EZ9 A;  4M4G A;  3MZ9 A;  1UTH A;  3TAJ A;  2A5T A;  3KOT A;  3O97 A;  5LOM A;  1IEJ A;  1MM7 A;  3Q25 A;  1B9J A;  1L5T A;  1MH3 A;  4OTE A;  1N7X A;  2XXH A;  3SER A;  1D3K A;  3K00 A;  3G3K A;  4GVO A;  3DLN A;  3OO6 A;  2QS2 A;  3GBB A;  3PUV E;  4NMY A;  4E0X A;  3G3J A;  1P1Q A;  3L6H A;  3HHF A;  4TLM B;  2QS1 A;  1S50 A;  3FV2 A;  5CMB A;  1NH7 A;  1Y3N A;  4NF6 A;  5I59 B;  2XXP A;  4Q0C A;  3OMB A;  2HCA A;  2E1S A;  4X1D A;  4EF1 A;  1BP5 A;  5BUU A;  5JTY A;  3Q27 A;  3LSX A;  2BJJ X;  2I58 A;  3ZKL A;  1DPE A;  1P1O A;  5IKB A;  1LBB A;  3SET A;  4BDL A;  4KHZ E;  4LZ7 A;  3DM0 A;  3RTF B;  1A99 A;  2D21 A;  1FTL A;  3Q26 A;  4RNS A;  3H6V A;  2F5X A;  3TTL A;  4HCW A;  2O84 X;  3I3V A;  4IO2 A;  4IGR A;  2O1L A;  2V84 A;  3FVG A;  1IXH A;  5CI5 A;  1MXV A;  4KD5 A;  3FZV A;  1A40 A;  3EHU A;  1JQF A;  2F78 A;  4OHN A;  4KQP A;  1S7Y A;  1VSO A;  4ZEI A;  3C34 A;  4GLI A;  1UIV A;  2LAO A;  4DCY A;  2XXV A;  2D3I A;  4G68 C;  2ZYO A;  2PT1 A;  4I9D A;  2QMX A;  1JET A;  1EU8 A;  3V5A A;  1FQB A;  1GV8 A;  5IAI A;  4MF3 A;  4UAC A;  4F3P A;  4R2B A;  3FVN A;  3IOV A;  3PUX E;  3RTW B;  4HTG A;  1IIT A;  3VLU A;  1SD3 A;  3DEL B;  2ABH A;  5CBR A;  3K6X A;  3TYH A;  4LZ8 A;  3O9P A;  3SES A;  1Y1Z A;  2YJP A;  1TFD A;  1B40 A;  4HCY A;  3PPO A;  4TOZ A;  4DDD A;  2Z23 A;  3TCG A;  4G2Z A;  3O6G A;  4F39 A;  1LAF E;  4QF9 A;  5CM6 A;  4RPO A;  1SW5 A;  2DQV A;  4BDM A;  2GRV A;  5TP9 B;  3MWB A;  3UIF A;  3FVO A;  4QSD A;  4ZDM A;  3MZ1 A;  2NUV A;  2XXQ A;  2F34 A;  2QJE A;  5I57 A;  3VXB A;  1URD A;  3RUM A;  3P7I A;  5I56 A;  4OFO A;  3MVX A;  5JTY B;  3CFL A;  4QSE A;  5AA4 A;  2PX1 A;  4RJZ A;  1LCT A;  1IZ1 A;  4WKM A;  1M5C A;  3IOU A;  5DT6 A;  1H3D A;  1JVX A;  4XKP A;  1NFT A;  1URG A;  2VGQ A;  4POX A;  1TWY A;  1LFH A;  1IIW A;  2YLN A;  3K4U A;  5J1D A;  1Y9U A;  4XKR A;  1B52 A;  1MS7 A;  2RKM A;  2UYF A;  4I8C A;  3G3F A;  4U2R A;  2DE3 A;  4OZ9 A;  4PFU A;  4PP0 A;  1P1W A;  1H45 A;  2REJ A;  3O2A A;  2UXA A;  3MUQ A;  1B3H A;  2OWT A;  1LGB C;  1ZU0 A;  1SW2 A;  2DWH A;  3S9L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...