2F6KA

Crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
306
structure length
306
Chain Sequence
SKIDFHTHYLPTSYVEALKRHVPGDPDGWPTPEWTPQLTLNFMRDNDISYSILSLSSPHVNFGDKAETIRLVEAANDDGKSLAQQYPDQLGYLASLPIPYELDAVKTVQQALDQDGALGVTVPTNSRGLYFGSPVLERVYQELDARQAIVALHPNEPAILPKNVDIDLPVPLLGFFMDTTMTFINMLKYHFFEKYPNIKVIIPHAGAFLGIVDDRIAQYAQKVYQVDVYDVMHHVYFDVAGAVLPRQLPTLMSLAQPEHLLYGSDIPYTPLDGSRQLGHALATTDLLTNEQKQAIFYDNAHRLLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords metal-dependent hydrolase
publication title Crystal Structure of ACMDS from Lactobacillus plantarum
rcsb
source organism Lactobacillus plantarum
molecule tags Lyase
total genus 102
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2f6kA00
2OGJA 3E74A 3DUGA 4LALA 4F0LA 3MVIA 4C6BA 3RN6A 2I9UA 3URNA 1POKA 4LCSA 4PCPA 3URQA 4R88A 3PAOA 3O7UA 3SFWA 4G2DA 4L6DA 4CNUA 4ERGA 4KEZA 4CQCA 2DVUA 1RJQA 3RHGA 1NDWA 3PNUA 4Z42C 1A5MC 4GXWA 2QVNA 4XD6A 3TN3A 4INFA 1V51A 1QW7A 1A5NC 3GU1A 4BJHA 4IGNA 4LH8A 1PO9A 3LA4A 1EZ2A 2PAJA 3AU6A 3T8LA 2OOFA 4HJWA 4EPKA 1R9YA 2I5GA 3DCPA 4NI8A 2AQVA 1RJPA 3BE7A 3ICJA 3CJPA 1E9ZB 3KM8A 4EPEC 4XAGA 4UB9A 3K5XA 3GTIA 4C6FA 2R1PA 2VUNA 5HMEA 1S3TC 3CAKA 3NURA 4P5UA 1XRFA 4RDVA 4C6CA 3B40A 2PUZA 2PGFA 1M7JA 4QROA 3FDKA 2O4QA 1FWHC 1UMLA 3RYSA 4GX9A 2GWGA 1RAKA 1EJWC 1KRAC 3UF9A 1E9YB 2Z00A 1A5KC 2OB3A 1NDYA 4GX8A 1ONXA 1FWIC 2BGNE 3ID7A 1M65A 1KRCC 1YNYA 2ANUA 3B0YA 3RCMA 1FKXA 2ADAA 4G7EA 4CNSA 1KRBC 4HK6A 2HBVA 2QT3A 4CQDA 1YBQA 1FWEC 2R1MA 3F2BA 1GKPA 3S2MA 2VC5A 3PNZA 1J5SA 3GU9A 4KEUA 1JGMA 2QPXA 3LSCA 3MJMA 4IFKA 4C5YA 2HNHA 3HPAA 2D2HA 3OODA 3OVGA 4KERA 1PSCA 4B91A 3A3WA 4H9UA 4C6EA 2D2GA 4XAYA 1FWAC 2F6KA 2FVKA 3ITCA 1XRTA 3TN6A 4H9XA 3IACA 1K70A 4DLMA 3F2CA 2Z25A 3ISIX 3MSRA 3E0LA 3MVTA 2Z4GA 3OOQA 4RDZA 3UPMA 4PBFA 1WXYA 1A4LA 3E3HA 1V79A 3EWDA 3LS9A 4KF1A 3QGKC 3E38A 1YIXA 4LCRA 4IG2A 4BKNA 2ZC1A 4HK5A 2PLMA 3JZEA 2QS8A 3S2LA 1V77A 4HA0A 2E1WA 4C6MA 4RZBA 1EJRC 4I6KA 2Z7GA 4MUPA 1PTAA 4G7EB 2EG7A 3TN5A 4JOMA 4C6JA 2O4MA 4J2MA 3GTXA 4H9MA 4J5NA 2D2JA 4PE8A 3EGJA 3GTFA 3K4WA 2UZ9A 3MKVA 4B3ZA 3C86A 4J35A 1RA0A 3LGGA 1QXLA 2Z26A 4GYFA 3IJ6A 2HQAA 2PGRA 4IFKB 1YMYA 2R1KA 3N2CA 1A5OC 4YIWA 2OQLA 2Q09A 3IGHX 4C65A 3QY8A 1W1IE 3K2GA 3GIPA 2Z28A 1J6PA 3S2NA 4DZHA 4C60A 3T81A 3NQBA 3QY7A 4H9ZA 1EJVC 4ERIA 2P53A 2VHLA 4C6NA 3S2JA 3G77A 3URAA 1IE7C 4PBEA 4C6PA 3E2VA 4V1XA 1RA5A 2YB4A 2XIOA 4IH3A 4IG2B 1RJRA 4H9VA 4KEVA 3S4TA 3LU2A 3OQEA 1UBPC 4RDYA 2P50A 4PCNA 1V7AA 3QGAC 4GC3A 5FSDC 4EPBC 4DIAA 2AMXA 2W9MA 3FEQA 4C6DA 4DNMA 2EG8A 3TN4A 4KIRA 4XD3A 3PANA 1ADDA 1WXZA 3B0XA 3MTWA 1KCXA 4I6VA 4IGMA 3GTHA 4B90A 3GUWA 3EWCA 3NEHA 4M51A 3CS2A 5AKQA 2DVXA 3WYZA 5E5CA 4AQLA 3MDWA 4E3TA 4B92A 4LCQA 1FWFC 5CH9A 4ZSUA 3LY0A 3OU8A 3AU2A 2YZ5A 3WMLA 2FTYA 2YXOA 4UBPC 4C6OA 2Z2AA 4QTGA 4XD4A 4XAFA 1P1MA 4DO7A 2RAGA 5HMFA 2WM1A 3F4CA 2A3LA 2HPIA 2DVTA 1XGEA 4LEFA 3UR5A 4V1YA 2R1NA 4TQTA 3URBA 1J6OA 1V4YA 2OODA 3A4JA 2Y1HA 1O5RA 2HBXA 2Z2BA 3R0DA 4DYKA 1EJUC 4NG3A 1XWYA 3LGDA 1P6BA 4CEXC 1FWDC 2G3FA 1GKRA 4XAZA 4IQJA 4R7WA 3IARA 1VFLA 2Q01A 2VR2A 4DI9A 3HTWA 3O0FA 4GK8A 1EJXC 4RDWA 1YBQB 4R85A 4C6QA 1EF2A 5HMDA 4LAMA 4D8LA 1R9XA 4C6KA 2E25A 4IFOA 4ICMA 3V7PA 4DI8A 1A5LC 5LXXA 3GU2A 4H00A 2Z24A 4H01A 1UIOA 4AC7C 2UBPC 3F2DA 1P6CA 4KQNA 1A4MA 4EPDC 2GSEA 4QS5A 5A6TC 1GKQA 4EP8C 4NP7A 4XD5A 4IFRA 4QS6A 4F0SA 4F0RA 2WJDA 4LFYA 1BF6A 2GZXA 2VC7A 4DLFA 2FVMA 1RK6A 2Z27A 3DC8A 4C6LA 1M68A 1FWBC 3WZ0E 4QSFA 4L9XA 3HM7A 4RE0A 3T1GA 2VM8A 4QRNA 1DPMA 4CNTA 2BB0A 1I0DA 4GY0A 4GY1A 3PBMA 4WHBA 1NFGA 1ONWA 5FSEC 4BY3A 3QY6A 1EJTC 3FDGA 3MPGA 3GG7A 4ZSTA 4DZIA 4GY7A 4CEUC 3AUOA 3OJGA 3A3XA 4H9YA 4LAOA 1FWGC 2ICSA 4WGXA 1I0BA 3SO7A 3IRSA 4C6IA 3GRIA 5G4HC 4KETA 2Z29A 4GOAA 1ZZMA 3IPWA 4GBDA 1EJSC 1POJA 1UIPA 4CQBA 2GWNA 1ITUA 1FWCC 2EG6A 4LAKA 1K6WA 2CZVA 2YB1A 2FFIA 1YRRA 1KRMA 3GIQA 2WJEA 4C5ZA 3UR2A 1O12A 4GZ7A 2AQOA 4HK7A 4KESA 2KAUC 4OFCA 1HZYA 4IF2A 2HPMA 3IV8A 1EYWA 3LSBA 4LANA 1NDVA 4ERAA 1R9ZA 2GOKA 1RK5A 1FWJC 3MDUA 3UBPC 1J79A 3F4DA 3TNBA 3D6NA 2FTWA 1PB0A 1K1DA 1FKWA 2R1LA 3LNPA 4H9TA 2IMRA 3ORWA 1NDZA 1ITQA 4WVXA 2WJFA 3E0FA
chains in the Genus database with same CATH superfamily
3A5FA 3L9CA 4CU7A 1F05A 2WVVA 4UTWA 1ISXA 4LALA 1XIEA 1V8EA 4FNTA 2XPKA 1UKPA 3RRXA 1BYAA 1GVOA 2GDVA 2NT0A 3RN6A 1US3A 3G1DA 3XISA 3L66A 3FVDA 4LCSA 3CHEA 5EMMA 3HG4A 4EVZA 1XGZA 1TQJA 2AL1A 3TH6A 3MHGA 4HB7A 4AIUA 4GXWA 3WLRA 1E3ZA 3ZO9A 2H8XA 5C2CA 3P3BA 3LCFA 3ZJ8A 4U4MA 4XKYB 1E56A 3TTYA 4NYYA 3DBPA 1XLIA 4DAIA 1UWAA 3BG3A 2WCAA 4RXGA 2PWUA 5D2WA 1O66A 1VLIA 4PFHA 1DTNA 6XIAA 1UOKA 1W17A 4NL1A 3FAWA 1A53A 3COTA 5LXEA 3O16A 5LIKX 1J10A 2E5BA 1JPDX 5HQEA 1VD6A 3DFOA 3TW9A 2VUNA 2C1HA 1DWJM 4UR9A 4F2UA 2YLAA 4HPNA 4L5ZA 1AL7A 1FDYA 2P5NA 1C92A 2OELA 2PUZA 5K9XA 4Y2WA 2VP8A 1NARA 2NX3A 3B97A 3CAVA 3ZMRA 1TJ2A 3T44A 2Z00A 3SR7A 2OB3A 1ME7A 1GCYA 4S3JA 3UD6A 5B80A 3T2QA 3GW0A 1C8YA 3ID7A 2KZHA 4PYSA 5A3HA 5AHFA 2OEJA 1ME8A 2OYMA 1UW9A 3GBEA 3NPUA 2CXGA 2GVYA 3CLMA 1KRBC 4O1BA 6ALDA 2CHOA 1K4GA 4MUZA 3IGXA 4GUIA 3DFTA 1W54A 2R1MA 2P3ZA 3W7EA 3NFUA 4Z08A 4AMAA 4FF7A 4BR1A 1OX5A 1SZEA 1E55A 1KM4A 2R14A 3OPSA 1PSCA 2C8NA 4GQQA 4D8AA 1ADSA 2J7FA 1DIOA 1V0MA 1FDZA 4B5VA 1TWZA 3EX6A 3IACA 1W1B1 1HW6A 1EEPA 1Y5WA 4IIEA 1FRBA 1SGJA 1TV8A 1V79A 2QULA 4UQCA 4NJKA 4WXZA 1B3VA 3N04A 2PLMA 2GDUA 1ZB5A 3EEGA 5CXPA 2BZNA 3VINA 1ZS2A 3E2SA 2QMJA 3BANA 3H12A 1IWAA 3PG8A 4G7EB 4KIEA 3WY1A 5G2IA 1NF0A 2E9LA 3AHZA 3BV7A 1F7BA 1R2SA 3MKVA 4KCTA 5A8MA 1BXCA 3GB6A 4YTRA 1O7AA 4F8XA 4PUMA 1IT7A 1DE5A 3PHAA 1G4SA 3W88A 4H7ZA 4JIIX 4UFHA 4J3UA 1A5OC 4JTEA 3NL5A 3H8AA 3NQMA 4QXIA 4KFPA 3IGHX 1M41A 3AXIA 2PWHA 2PRHA 3K2GA 1TMHA 3BTNA 2A3BA 2DORA 2P53A 1ZBWA 2VHLA 1VBHA 1HJVA 1IQ8A 4Y90A 4D6EA 3QQWA 1NJJA 4MAZA 1EWEA 2ZZ7A 4Z2HA 3SY1A 3ZVIA 4YVPA 1HTIA 4PCNA 4GNVA 3NR0A 4JR5A 1XIDA 2G3JA 4H8UA 4WOQA 2GSHA 4BI5A 2OZ0A 1H60A 4PMQA 5KINA 3M5YA 3NEHA 3QYSA 2DPEA 3S5YA 2BOFX 3TXVA 1S5NA 1A5UA 3EMZA 4C90A 3ELFA 4HTYA 4JKKA 4OE7A 3S9IA 3AU2A 5F4WA 2WHMA 2FHBA 4GNKB 2YCLA 3AQUA 4AIOA 1ZBKA 2IPGA 1U1JA 1MVYA 5CPLA 3TAOA 3F4CA 4NUWA 4XX6A 4C1NA 1JZ2A 2OYKA 3I6TA 4TX8A 4I8YA 4S3FA 3A4JA 1C7TA 1TUXA 2A7NA 1ZLPA 1O5RA 1MEIA 3KHJA 2XH0A 4JIPA 4H6KA 4NG3A 1JYNA 1PZ2A 3NOYA 4IQJA 1ZFJA 5F7UA 1TJ0A 2XTKA 1SW7A 1E6NA 1I6NA 1Q65A 4ZE4A 3S1GA 4R85A 4A05A 1Z9AA 4BQ5A 4F9DA 4PMYA 5G4WA 3K8LA 1XV8A 4IP5A 1A4MA 5CJ5A 4PEEA 3QHMA 1HUVA 3OGVA 1JCLA 1C8XA 1NF7A 1JCMP 3WJWA 3EOEA 4JFSA 3KBVA 4L6HA 1AQMA 5D2XA 3OVQA 5I23A 5C0QA 5CBIA 3STGA 1MZRA 4DWSA 2P8CA 3O6YX 2CETA 4K38A 4J3WA 1U5JA 2BB0A 2ATSA 1TPUA 4P8XA 5E9AA 3CUGA 2BSLA 4TU1A 1JAKA 2O9PA 4ML4A 1KBLA 3VD7A 3GG1A 4CQ9A 1W2VA 1TV4A 4O17A 1BKHA 4LAOA 4WGXA 1VYRA 3W7NA 1QW9A 1M7XA 5AZ1A 4XSMA 2NSOA 4QG6A 4KWVA 3S9ZA 4U5KA 1K6WA 3CIWA 5HANA 3EDEA 5HPOA 1KTBA 3H7RA 4GI4A 3DESA 4JYDA 4H8HA 2ZFAA 2FKPA 1MW1A 4XO7A 4HK7A 1P48A 1QOPA 5D38A 2QDEA 3I6RA 3ZR4A 5F4XA 1A5AA 4ZB5A 3TE9A 3WDRA 4K6AA 5HDRA 1FWJC 8RUCA 4GVGA 3AWNA 3BJFA 3BAXA 1QNQA 4H04A 2WZIA 4QQ3A 1XLBA 4ZTXA 2J7CA 1J01A 3U7VA 3W26A 1PX3A 4FPSA 1TRIA 4DWSD 3EDFA 3NZGA 4JPGA 3O9NA 1WKYA 3QW4B 4W8AA 2CLOA 4NF7A 3RM9A 2C3ZA 3ITLA 2IKIA 4I5RA 1P43A 4WK9A 2PTYA 4GACA 4R88A 5AC5A 4PH6A 3Q37A 1KM0A 1OD8A 4NZ4A 2DY3A 2NZLA 4GABA 3LCXA 3RMJA 5IBXA 1L6SA 1X8FA 4Y96A 5F2MA 3MHFA 1DXEA 3N9RA 1SPQA 1EZ2A 1Q13A 4R7JA 3AU6A 4FXRA 1CPUA 4J27A 2F61A 3QF0A 4V15A 2CWNA 2H9AB 1IEXA 1ICQA 1RJPA 3WLMA 5EMKA 1JUKA 1JD7A 5AC7A 3TYZA 2ZX7A 4EPEC 3NZPA 2QF7A 1R3TA 1S39A 4RDVA 3VD9A 4GI8A 2ZC8A 1AA1B 1DJGA 1JPKA 2PGFA 3L68A 4WJEA 3GHTA 1XIBA 5CG0A 3CV6A 2NW0A 2PLJA 1RR2A 4XISA 2BGNE 2FB3A 3TJXA 2WMJA 3ZJKA 4IJRA 3TIMA 4DXKA 1Q2RA 1LG2A 4Y8FA 1Q6CA 5HULA 2VC5A 1CLXA 4Q4QA 2ZZ5A 2IPWA 3A4XA 3GXMA 4ADSA 2Y7GA 1MDLA 2Y8UA 2RDUA 3SJNA 3VKJA 4MKVA 3QLLA 2C0HA 3KTXA 1Z42A 3HV9A 5H2ZA 1WX0A 3NXLA 3F2CA 2Z4GA 3OLEA 2V6AA 3AC0A 4REQB 4ZZ9A 3K8KA 1JDDA 2OEKA 4TR9A 3T0BA 4IMDA 1XLJA 3O07A 4ES4A 4ZO8A 3CB8A 4OQVA 2WLZA 3APGA 2HSAA 4HA0A 5AVNA 2DH2A 3AYVA 3G6LA 2CXEA 4A2SA 5SWUA 4MUPA 1P7TA 4CKQA 3LRMA 4D1IA 2O4MA 3VPLA 2D2JA 3GDMA 3M5VA 3KS5A 4Q3MA 2TMDA 1RH9A 4E3VA 1JZ6A 2EJ1A 3HPZA 2R94A 3BOFA 3TTEA 3DIPA 4UQ9A 1M6JA 1K7XA 4A6GA 5I3DA 4IFKB 3M0YA 2DQWA 5A6BA 1QR7A 4AUBA 5DY2A 3CV7A 4WQ6A 1HKIA 2Z28A 3IVUA 4JD4A 1X7FA 3E49A 1UD2A 1KFLA 2F2KA 1RA5A 2IKHA 4ZCWA 1ZALA 4Q8NA 4IG2B 3MC5A 1D8WA 2AOSA 1WZLA 1WBHA 1X1NA 2Z7KA 4UOJA 4M81A 3DAQA 4MNMA 3UU0A 1SZFA 3C2FA 3ERPA 3W2NA 3BICA 2QR6A 2DVXA 3HG2A 3UJFA 5D02A 1DP0A 2DJXA 4BI6A 2XIJA 2ZWYA 4Q22A 3FYPA 4JNYA 3VKAA 4I7WA 7TAAA 3GXPA 4Q33A 1K02A 1OF6A 3EB2A 4PA8A 4M1BA 1MWOA 3USBA 1V4YA 1JYXA 4UMCA 1E0UA 1HGYA 5HMSA 9XIMA 4Q8UA 1OIFA 3C2VA 1B0IA 3ECQA 1LLZA 2QCCA 3WMSA 1E5JA 3PB2A 1VFLA 5AZ0A 1ISZA 3ZLHA 4W88A 1J9YA 4X60A 4DI9A 4IP7A 5K4XA 2Y5SA 2PE4A 5CZTA 5CCZA 1E3XA 1F73A 1TA3B 5F1UA 1UHVA 1BYBA 2C18A 2RHGA 4X2PA 1CLKA 1UJPA 4DI8A 3THAA 2WNWA 5LXXA 1MDRA 2J8FA 3VGEA 1V6XA 5HQMA 2Z24A 4QGCA 1AD4A 1PZ1A 2INZA 3F2DA 3LTYA 1WA3A 3PBYA 4FNRA 4PTVA 2GSEA 4D6HA 2D2OA 4QS5A 3FGCA 3VZXA 4LUJA 1MNZA 4W8LA 4P8WA 5A8QA 4XD5A 4IFRA 1I2RA 2PCQA 3IV3A 3NPVA 1KA9F 3NSXA 5AHLA 3ES7A 4Z1DA 2DUZA 4V28A 2ZZ4A 3RF9A 4YJ5A 1GPFA 1JCYA 3REQB 3O8AA 5H8MA 1PKNA 1IEQA 4LUIA 4I7VA 2YJQA 2DW7A 4FAMA 4GY0A 3SRHA 3N17A 2MNRA 5LNVA 1L0PA 3W7OA 3EX2A 3PK7A 1FWGC 5KMYA 4GYJA 1KKRA 3KRSA 4S23A 1CGTA 3H24A 4DJFD 2BNJA 4WY0B 2VO5A 2RFGA 4JIEA 3AO0A 3VIMA 2KX9A 4QLLA 1JFXA 1KRMA 4WKAA 3UR2A 1I9CB 4HTBA 1CX9A 1TTPA 3TSBA 1PCKA 4A8RA 1HKWA 3LX9A 1HJXA 4M6VA 4QP0A 4UTTC 1H7WA 4PUNA 3LNPA 1H62A 1RD5A 4XBKA 3UZWA 4WVXA 5GJNA 3SUTA 4HZMA 4IIHA 2NQHA 1TV5A 1U33A 3BCDA 2WC7A 5L9FA 3AS0A 5HBFA 2ZUWA 1W9UA 1RALA 3S8HA 3U3HA 3T40A 5G2WA 3QR0A 5EL1A 4PCPA 4WSJA 2ISFA 3O7UA 2Z1BA 4U3AA 2ACUA 2WANA 2QXWA 4NZ1A 3WQVA 2XVKA 2OZ3A 3GBDA 4PB5A 1TE6A 1XDMA 3H2AA 3LB0A 4EXQA 1UYQA 3UG5A 3QQ0A 1NU5A 2VOMA 3KOWA 3G0SA 5LA2A 1NEYA 1JCNA 2DUXA 1TELA 3FV9A 3DCPA 4DWDA 4LU0A 3WQFA 4GA8A 3RLUA 3B8SA 3LBMA 3D3FA 2XZ9A 1RP8A 3CAKA 4MWAD 1W56A 4AD4A 1SFLA 3L2LA 3R12A 4QJ4B 4H83A 3IAQA 1H3GA 2O4QA 4U33A 1FWHC 4GX9A 4F48A 5CLWA 4FK9A 4B5UA 2DT0A 2Y4SA 4RZ6A 3GFYA 2ZADA 1FP8A 4ZB2A 3WD0A 4GUJA 4HJFA 1TTJA 3KVKA 4CU6A 2ANUA 4ASTA 3NSMA 4D9PA 4I9MA 3DFHA 1Q6RA 3KBSA 3D47A 2PURA 1KB3A 3GO2A 4MGGA 5G1YA 2HXUA 3S2CA 2C15A 4QCFA 1YTDA 3MJMA 1SMDA 3VNDA 1E0VA 1K8XA 2PLKA 4LPCA 3OVGA 2C79A 4NZ5A 1W3NA 1DVJA 1HL9A 2PTWA 4LC8A 3T0DA 1M5WA 1F4HA 4DUOA 4A3QA 1JCXA 2QMKA 2P8BA 3W2KA 4PUWA 4HNUA 4NY2A 2XFRA 3M0HA 4KF1A 5JMUA 4BKNA 3UJSA 1OFOA 4BF9A 4C6MA 1DE6A 3GDKA 3PPHA 1PZ0A 4TV5A 1ESWA 4J5NA 3GNOA 1RBOB 1SO4A 1KV5A 1ZCCA 4W9TA 1ZAIA 1GPWA 2NWRA 3FHAA 1LBFA 3OA3A 3MUAA 2CIPA 3WD4A 1TV7A 1KFEA 1B54A 3B4UA 3NQGA 2R91A 3POCA 4ONVA 2Y62A 5FI8A 1T40A 4AIBA 3G77A 3WK3A 3M0JA 1HVQA 4C6PA 3T4WA 2IQ0A 1RHCA 1EQCA 1BWKA 3N4AA 1RJRA 5CGTA 1VR6A 4LW7A 4GE8A 4NAFB 3RR4A 2DP3A 1QMLA 4KT2A 2PI6A 3SFKA 2DIJA 3THCA 3AMLA 3LPOA 3OG3A 1KCXA 4MDOA 4Y9PA 1XG4A 1WAWA 3GUWA 3EWCA 1W8GA 2WKJA 1YTKA 3CS2A 3OLDA 2DSZA 4NILA 5AKQA 4ZXOA 2WNNA 4HQVA 3SURA 2E4TA 3NL6A 2YCEA 5E0CA 3SZ8A 1HG3A 4ADUA 3RX3A 4O8AA 5M5DA 3CTLA 3KVMA 2VZVA 2X16A 2RAGA 3GTNA 3TTSA 4O0QA 1B9ZA 3VK5A 2HPIA 3AJ7A 1OC6A 3JU2A 4GG9A 4CNNA 1HL8A 3QV9A 2Y1HA 4J1OA 1H11A 1XYBA 3CUFA 3W22A 3T08A 4ECLA 2G97A 4DN1A 4DYKA 3TKFA 2J6VA 3N34A 5EB8A 4HP5A 3M43A 1OX4A 2P1FA 4CEXC 2FTPA 3FJLA 1XLLA 1UP2A 2WMFA 1PKYA 1GOOA 3IARA 1M01A 1E15A 1TRDA 4HMNA 2B0MA 1KFCA 1F5ZA 3PUEA 2B31A 2Y8VA 4BHYA 3OVPA 4EX4A 3TW6A 3DN5A 1C9DA 1Q6EA 2HNEA 1QHPA 4DUXA 3V7PA 1V6UA 3ZVHA 1BRLA 4PFMA 1G67A 2EPNA 5ABFB 5IDIA 4M24A 1I4NA 2OSXA 3S42A 4XUGA 3OTRA 3PR2A 3CUZA 4Z1BA 2ZVIA 2ZUMA 4XZWA 1GOWA 1UA3A 3AXHA 2CPUA 3GM8A 3U48A 1O95A 2WJDA 2QGHA 4LFYA 1JDAA 1MQQA 2BXVA 1B2YA 1QWGA 1ZP3A 3DC8A 1KBKA 3WZ0E 4QSFA 2PDCA 1MW0A 3SADA 3OGSA 3LM7A 4KMQA 5HAOA 2DIEA 3KAOA 1Z41A 1AW2A 2R8WA 1Q6QA 1AJ2A 1Q63A 2YFNA 4M80A 4W85A 3M0XA 2IKJA 3NO3A 3QR1A 1OT2A 4Q8OA 2V3EA 4ZSTA 3K1DA 3LYEA 1W8SA 1OFBA 1J8VA 1L2UA 1LG1A 1NAL1 4W7VA 1DJQA 3P62A 4GOAA 1ZZMA 4DF1A 3ITVA 5FCZA 3N12A 4PUKA 2EXOA 5BRQA 2HXTA 4KCVA 1RV8A 1V03A 4WDTA 4PB3A 4UTLA 4X2RA 3TA9A 4J4KA 1QO5A 4OFCA 2XH4A 1J0JA 1L8PA 3TEVA 4K8EA 4LANA 3NQCA 1IIGA 4ERAA 4LB4A 2XFWA 4XKYA 3W37A 4FS9A 4M5PA 5E0FA 2DZBA 4KRZA 2YIHA 3F5JA 4H3DA 1XDLA 5JBEA 4CU8A 2HS6A 2QAPA 3N14A 1XLMA 5EMUA 4EACA 1QK0A 5A6KA 1XX1A 1ZQ5A 2OCZA 2HISA 5C8BB 4O11A 5U7SA 3MZNA 1YDVA 1JXKA 3IUDA 1G9HA 2B4GA 2NUWA 4QG9A 1TPFA 2YXXA 1PHWA 3OP2A 4GIEA 1FP9A 3TYAA 1I2OA 4O16A 1FHLA 1EX1A 3LHZA 3UEQA 1UC4A 1UR3M 1CECA 5A6LA 1XC4A 2BOGX 2UV8G 3W1MA 1ZJBA 3PY2A 2FMOA 3LRLA 1D3CA 5DCDA 4LF2A 2WSKA 3T8LA 4QCEA 2RH9A 4I9JA 4IPLA 1H63A 1I75A 1XYLA 2QUUA 2CW6A 3C2YA 2R6OA 4S3EA 2VRQA 3AROA 1S5VA 4B9YA 1W37A 2Y7EA 5CBJA 3GTIA 4K1GA 2R1PA 2EPMX 2O55A 3A6OA 1TIMA 1XYCA 2P88A 5D8WA 1M7JA 1OG0A 1ICSA 4UFMA 3BMWA 3ZOAA 3W1TA 5EBUA 1KRCC 3PZGA 4ZQPA 1FKXA 4CNSA 1Q7ZA 4G7EA 2HBVA 1P4CA 3BLLA 3ZT6A 3UCDA 1YBQA 1ITCA 3MO7A 2PLCA 1KTNA 4PN2A 3WK2A 1EPXA 4HPXA 1R8LA 4MY1A 3CUIA 1XIFA 3TQKA 4GKLA 4F0MA 1HKVA 3WD1A 3CMJA 3TOYA 4KERA 4PUEA 4B91A 1W3TA 2I56A 3IIVA 1QFEA 2VEGA 1A5SA 2WQDA 3RPDA 4CCEA 4H9XA 1K70A 2PGWA 5A69A 1OT1A 4HCLA 4ATDA 4UTIA 2VURA 4CD7A 1LP6A 5D03A 3TR9A 2VENA 5CZJA 2VFEA 2Z1SA 1YXYA 3LS9A 3OZOA 1DTUA 1H0GA 4GFIA 7REQB 2PB1A 5HOSA 1T99A 3W70A 3W74A 1Z3NA 1QT1A 3PBUA 5FL1A 3O1NA 1R3SA 2PD5A 2DZUA 2QCLA 4DJED 3PWIA 3AS3A 4DHGA 4MWAC 4IHCA 4HCHA 4JKMA 1TR1A 3QC3A 4LAUA 3T0CA 4DELA 2GLKA 3RGTA 1ZUAX 3N2CA 2W61A 3N11A 4AIEA 3TYBA 1M03A 3NSNA 4A3RA 3TJLA 2ONEA 2Y5JA 4C65A 1CEOA 4CD8A 1TSIA 1AH3A 5LKYA 4UIOA 2XSBA 1PKLA 4H9ZA 4XZLX 1V93A 3GNPA 4M6PA 1FVPA 1LTDA 1DL3A 1OYBA 2XIOA 1FH9A 4G9PA 3CZJA 1TUFA 4RK8A 1N55A 4IICA 4JY8A 1XLAA 1FFRA 4JS3A 5I09A 2OXNA 3ITXA 4RDYA 3PFMA 2OX1A 2W9MA 4ZO6A 2Y63A 5E09A 4I8DA 1F8IA 2NUXA 2O0TA 3NQFA 3U2ZA 1GQKA 1E43A 1XCWA 1BXNA 3QEZA 3TCEA 4F2BA 3TJ4A 2OWCA 3STCA 1QJWA 3VDHA 1LLWA 2V5DA 5FJRA 4AQLA 2OEMA 2YBUA 1PCWA 1VJIA 4MMWA 1VBGA 4KGLA 4IMAA 3ABXA 4F2TA 2HS8A 3GY1A 4PSRA 4A21A 3UWWA 1R2RA 4UZSA 2ISVA 4XK2A 3L4UA 4B2DD 3RLGA 3RDKA 1CB2A 2YZRA 3RM4A 2VEPA 4JTAA 4H8NA 1XL9A 2VDIA 5JUVA 2F9RA 4UZUA 3LERA 4DZAA 1EEXA 1OCJA 1LBMA 1BD0A 4YCPA 3EAUA 1A50A 3H2OA 1OYAA 3THDA 1VFUA 3SRFA 3SSJA 2OTDA 1CXHA 5HNNA 1EP1A 4MSSA 2AMGA 4IFOA 1S46A 3BCJA 1QNVA 2P3EA 2UBPC 3VNIA 2CNCA 5C7VA 4EPDC 3AMCA 4HMDA 4NAEB 4S38A 3JZUA 1WDDA 2CLEA 3V35A 3CV2A 2ATMA 1AQHA 1IEIA 3VC5A 2I17A 4UFLA 2ZOXA 1SJDA 2AAAA 4A3HA 1BSLA 4A8NA 4O15A 4KCWA 1XH0A 2ZZ2A 3CUHA 3YPIA 2G41A 2OWXA 1XLDA 4WZHA 3VIOA 2NWSA 1HT6A 3WL1A 1P6WA 2QCFA 2VOTA 3GK0A 5EA9A 2DQXA 3L5MA 4H9YA 3TK7A 4LGXA 4EF9A 5LA1A 2PRMA 2Y2WA 5BXSA 1DJWA 3WQEA 3L4YA 1DWAM 4H6RA 4MFDA 2Z1KA 1EO5A 4UMBA 1H50A 3NZQA 4Q8PA 1FWCC 4M7SA 1XUZA 4LYRA 1E0WA 1RQBA 3ABRA 4C5ZA 3PG9A 4YTQA 3TTOA 2RDWA 2VX7A 3MU7A 4XBSA 3RRAA 4FLOA 2GK1B 3LSBA 1B3OA 5A2CA 1M53A 3B9EA 1WDSA 3RX4A 4FMVA 2H9AA 2XWEA 3JUGA 3TNOA 3LRKA 2GVEA 3NAVA 2GGIA 3BLKA 1SYTA 1MEHA 3SN1A 1FWSA 1GW1A 4NJJA 3DUGA 3SIZA 3VMNA 1E73M 1AG1O 3KEHA 3MVIA 4TXEA 5EMJA 4NT0A 2CHRA 2A7RA 4JDYA 1IR2A 1UP3A 2PDBA 4CQAA 4G2DA 3ZJ7A 4CNUA 2Y8KA 3HPXA 5FJIA 3H6OA 4QX4A 3WD2A 3RHGA 2J79A 2QCGA 3LLFA 4WY0F 1EGMA 2FYMA 4XD6A 2OFJA 3UWYA 2JF7A 1XH2A 2W3ZA 4DJDC 3QYQA 4AZCB 3W1UA 1BQGA 2GGHA 2DZSA 3LA4A 4DPPA 4HJWA 4TTUA 3RJYA 3DGRA 3KVJA 2A6LA 4PL1A 5A95A 5FEZA 5CQ1A 3H4WA 2TRSA 3PC0A 5LHEA 1KFBA 2NXGA 4G56A 1W1TA 1P0KA 4UB9A 3KZSA 3B8VA 3T2PA 5GNZA 5DY3A 4ICNA 3T6CA 3VDGA 1L6FA 4X9SA 2QNEA 4IIGA 3C52A 1MUMA 1J0IA 4REQA 1G0CA 3W7LA 2TAAA 1RAKA 3CMFA 5D30A 6ENLA 2ODOA 4KWWA 5CSUA 4GX8A 5AHEA 1XINA 1XLCA 1H41A 4JYFA 5M03A 3VOCA 3VDCA 3CZLA 2D3NA 1YDYA 4GXMA 4BEQA 2GSJA 3VCNA 1FWEC 1NY1A 2AGTA 4NNAA 2DIKA 4OIFA 3GZAA 1J5SA 3F5KA 3MA8A 2XHYA 2JGQA 4HSNA 3FXGA 1XJBA 4IFKA 4DBEA 2HNHA 4O8RA 4B9ZA 2GVGA 1OFEA 3A3WA 3HMJG 2D2GA 2F6KA 2A6NA 4O13A 4HHLA 2QIWA 1EFZA 3TQVA 1PTGA 2G37A 3S1XA 1K7EA 4XG1A 5DCBA 1S5WA 4F4RA 4MPKA 5AFDA 3Q67A 4Q8WA 5F4SA 3QGKC 3FY1A 4KRUA 2QPSA 3BGJA 4IG2A 2VCCA 2W0UA 2A85A 5HNTA 2HE5A 2PDHA 3OBKA 4PMVA 3PVFA 5HPCA 1UWRA 4J2MA 4P7RA 1DJIA 4RLIA 5MKGA 1TCDA 1LCOA 4K3ZA 2BP1A 4FLQA 3PBWA 1ALDA 4DO6A 2Z26A 1QXLA 2BV9A 2BWGA 2CERA 3M7WA 2E68A 4JEJA 3SEPA 2POTA 2PGRA 3GKFA 1U5HA 1JXJA 2FB2A 3P5YA 2YYUA 3SUVA 4QBXA 1AW1A 2ZA3A 7ENLA 4DZHA 4ORMA 3QY7A 3KOYA 4LWWA 3S2JA 1UP0A 3B4YA 3DHUA 4IJBA 2WK2A 3UXLA 1W1A1 4UTKA 3CUXA 2MANA 3L4VA 1FHUA 4ZOCA 2PCEA 4JTUA 2YDRA 1UQZA 3MS8A 4I9AA 1R6WA 4HIBA 3W71A 5JH2A 1F74A 1BYCA 1TWDA 3QGAC 1PWMA 2QJMA 2AMXA 1OZMA 2BGSA 5FL0A 1UMYA 4Q4SA 2PDKA 4ZQNA 5LNUA 1TA3A 1ISYA 4OOZA 3KZPA 2ZA2A 4B92A 5HA7A 3LY0A 3WBWA 3VX1A 4MM1A 3NUKA 3GR4A 3W87A 1L2QA 1DJXA 4YMZA 4M19A 3P14A 3NQAA 3WBYA 2QGYA 4XTDA 4ATWA 2O56A 4W87A 1SSDA 3GAYA 3W7JA 3QOMA 2ZDSA 1AODA 4E0CA 3REQA 4PODA 3R10A 3LQGA 2DV0A 4US5D 2CITA 5H1WA 1XP3A 3LCWA 1HKJA 3MYOA 1XD0A 4A29A 3UNDA 3W6LA 1V0KA 1E4IA 1TMQA 1OGGA 1QDSA 1OK4A 4PCSA 1RSCA 3B0PA 1H7PA 4CD6A 3IVTA 5BXPA 1REQB 2HE8A 4PMXA 1UCWA 1UIOA 4RR4A 4WY0A 2BBFA 3LTPA 4ZXLA 4B5SA 4RW3A 4DEFA 5FEPA 4CCZA 2I1OA 3UXAA 4IL2A 1IT8A 1J4EA 2D73A 4F0SA 1A80A 3W9ZA 1ZBVA 2ESCA 2V63A 2BTMA 2XH2A 4RUBA 4C6LA 2GDQA 3WJXA 1SR0A 3ZLGA 2B7PA 2PDIA 3WUBA 2B7NA 3I68A 5TQLA 4Z0JA 4WR3A 4YL2A 1RY0A 1ONWA 5FSEC 3VKCA 5CPSA 4MHBA 2PEVA 4E38A 3A4AA 1SFTA 3INPA 4UXDA 2HWGA 1Q66A 2EEXA 3S46A 3TYEA 5E70A 3ABOA 1RUSA 3S1WA 1D7KA 5C55A 5HR7A 1POJA 5DMMA 4TX6A 3BPWA 3OLGA 2GWNA 5D8ZA 3IJDA 2XDFA 2CEQA 2ZYFA 5HATA 1VGAA 4CVWA 3PULA 2HROA 1AK5A 3SECA 3M0LA 4ROPA 2A7PA 2V2HA 4LRTA 5FAJA 5M17A 1KXTA 3GDRA 1R9ZA 3WNPA 2NQ5A 4PULA 1U30A 5E93A 4LT9A 1RQEA 4FX8A 4W8BA 5I79A 3W1LA 3BXWA 1QBBA 3CWNA 1ITQA 3E0FA 3IUHA 1NFPA 1W5MA 4UTHA 2GPTA 5LIUX 5MF5A 4P8VA 3BK0A 3VZYA 4AVNA 3PAOA 2WMIB 4JEQA 3QLDA 3WIJA 3WLKX 5CSRA 3IJ7A 3OZYA 3GWQA 3J7HA 5B7ZA 3FKKA 3MJYA 3CMGA 5LZLA 4UUIA 1UZHA 3LZ3A 4DX3A 4EPKA 3MQTA 1N8IA 2TPSA 2RGLA 4MIMA 1EHAA 3DYMA 2AQVA 3PJUA 3VC6A 4QITA 4X0NA 3M44A 1R5YA 3SUWA 4WGHA 4XAGA 1SUXA 3WF0A 4C6FA 2D23A 3CYJA 4NJHA 2E9BA 2DSKA 1U5VA 3WBXA 3CPUA 3WN6A 4EANA 3BSGA 1UMLA 1XHGA 2PP0A 3WDHA 3GW3A 4CN1A 1FWNA 1FQ0A 1H1NA 4E2DA 1XYZA 4L4MA 4GISA 1M65A 4RZ4A 3XINA 2YDQA 5BOFA 2QW5A 3ARRA 1LDCA 2QT3A 4CQDA 1KFKA 2XVPA 3NGFA 1ZPTA 2PDUA 4ENLA 2QPXA 4IZGA 4Q8MA 2ZXDA 3PZMA 1Q6OA 5DRCA 1V6YA 3H26A 1D2KA 1H51A 2J4GA 2ZBTA 1ISWA 4KW2A 1OBAA 1R47A 2VFDA 1FWAC 1NWRA 1K9DA 4GZJA 1US0A 4HYVA 3HBLA 4PBFA 4ZOAA 3BOXA 2EPHA 4HU8A 3EWDA 4U5IA 4TMCA 2ZC1A 4D8ZA 4LYKA 1OINA 4NAFA 1GEHA 2OKTA 4U3CA 1OIMA 1QNPA 2Z7GA 2QV5A 2XFFA 1XBZA 2ACSA 4UC5A 2ZX6A 1JIBA 4HD5A 3WEMA 2ACRA 2V9DA 3U4FA 3MI6A 1E6XM 1EUNA 4B3ZA 3C86A 3W7MA 2ZVRA 4TTGA 1KXQA 3KHDA 1ENUA 4D1JA 1YDNA 1GORA 2FZNA 4XZMX 5EGRA 1GQLA 5HJXA 3BLDA 2VD9A 2Z1XA 3H53A 4OZOA 3QZ6A 2AAMA 3WUGA 4X63A 1SM9A 8A3HA 3ZYZA 3UG8A 1NQ6A 4U2YA 3EBVA 4UR8A 3P8IA 2DT3A 3PS7A 3MO4A 1GYLA 2YB4A 4N7QA 4IH3A 3R2GA 1E1CB 1JRCA 3QVQA 5CEWA 1VCGA 3S4TA 1BWVA 1PIIA 1KW1A 2P50A 2I16A 4RW5A 4PUJA 5H91A 3O63A 1A47A 2GL5A 2EG8A 4XD3A 3STEA 4D6CA 2PDLA 3LPPA 3MSGA 3I7SA 5CAKA 3PZIA 1E6SM 3W2LA 4M51A 1WDWA 1JG9A 1CCWB 4ALDA 3LN3A 3ARQA 1IF2A 4GUFA 2E5CA 5ABHA 1SMAA 3H4XA 1FX6A 4ZQMA 3BV4A 3N4FA 4IUGA 1S2WA 3TYCA 5CH9A 4BZYA 1XBVA 1GG1A 1NQKA 4EIVA 2DZWA 3UPBA 2VVNA 2XM2A 3WLLA 5F2IA 2DVTA 1TPB1 1EGZA 2E6FA 1TREA 4YWSA 2BMBA 4RNIA 2XIMA 3PZUA 3ENLA 2DT2A 4YTSA 3TV8A 4HGXA 3LLXA 4ATLA 3H21A 2GUYA 1G5AA 1KO0A 1JCTA 1GKRA 2Q3RA 1UD4A 4YVXA 4Y9AA 3KOZA 3PB0A 4MJZA 3M1ZA 5XIMA 1MRAA 3FK4A 1V3KA 1KV8A 3ARZA 4JQ3A 4D8LA 3W1RA 4JNZA 4X22A 4MNJA 2E25A 3LV6A 3UYCA 2CC0A 3GS6A 1A5LC 1VPYA 2E9MA 4KQNA 3OIHA 1EC7A 5F2LA 1TQXA 2BVWA 3DOPA 5HWMA 3M0VA 4GNJA 3NPWA 3W3OA 3RIKA 2EKGA 4RZ5A 2XVGA 6PTDA 3IGSA 4MWAB 3DC0A 1XLHA 4HYWA 2WZTA 1I8JA 3EX1A 3NM1A 5CSSA 1YE6A 1UA7A 2OR2A 1MZHA 1P5BA 1QI3A 2CLFA 3CPGA 2OPJA 1T7LA 3P67A 4HU3A 4NZ3A 3QV8A 3WNLA 3LHWA 3RM8A 2YX0A 2L5HA 4YU1A 2OMAA 4X9YA 5HWNA 4ROQA 3ZT5A 4QEEA 2HZGA 4YYFA 3WO8A 4N6EA 4HVXA 1LL7A 2PDNA 3UJ2A 1O5XA 2V0TA 1X96A 4JTQA 3I3BA 1ITUA 1BTMA 1Q6FA 2I9EA 2EG6A 3WF3A 1E1FA 4IXXA 3MI2A 2FJUB 1B31A 2X40A 3QFWA 3W7PA 4P7LA 3KP1A 1ELSA 4HOXA 2FH6A 1HZYA 2VC9A 2QCDB 3DEQA 4GBUA 1V0LA 1YKWA 1MEWA 2OT0A 2PBGA 3PN8A 4K68A 3WF1A 3QFEA 3N6QA 2BASA 4OVXA 1K1DA 1Q4WA 4UFIA 3NVDA 5CPNA 1VIZA 2OG9A 3HJZA 1V3LA 1LROA 3UESA 1YXDA 3VM7A 2G3MA 1B3YA 2V67A 4A3UA 3DFSA 3B9DA 2TODA 4AX7A 3MY9A 2J7HA 3CLWA 3CH9A 5CPTA 3OHMB 4IISA 4C6BA 1L6WA 3G8RA 2IQDA 4A8IA 3LCLA 1FH7A 3ZWTA 3F5LA 3CHCA 2ZXBA 3TWAA 1NWUA 4Z42C 3RFAA 8TIMA 4INFA 3IWPA 1YTEA 1XIMA 4L65A 2A3EA 4JTDA 3DG3A 3CT2A 3WQOA 1YE4A 4OKDA 1NELA 4YTUA 2DZPA 4AZ7A 4V2XA 4PSPA 5DELA 4QLKA 1OFDA 2J7EA 3BAYA 1UJQA 3ICJA 3NDZA 1I2PA 5D05A 3MT1A 3QOKA 1YNPA 3UW6A 2NQ9A 4OECA 3U2EA 3JR2A 1S3TC 1ML1A 1IT0A 1OG6A 4HNLA 3A21A 1XKYA 1PIGA 4HHPA 1IGWA 1B3WA 1ECQA 1EJWC 4EWND 4EAMA 2YBTA 1XGDA 2A2IA 4R7OA 2Y6ZA 4R33A 7REQA 2E67A 1JFHA 3GSMA 5REQA 1TZZA 1GVEA 5JBFA 3VKDA 4DAFA 2YSWA 4FA3A 1RY8A 3W07A 3TQ0A 3G8EA 3AFBA 4HNNA 5AB3A 1JGMA 4O52A 3R6IA 5CC7A 2DEPA 3ARVA 1E70M 2C14A 4AC1X 3NZ1A 1B3ZA 1R38A 4JKLA 4HNCA 4N42A 2JGYA 5EPDA 1FCQA 2VZTA 1KBBA 3S6OA 2VMFA 3N2MA 3W28A 1YX1A 2RUSA 3Q2DA 3N9SA 5FJTA 1A49A 5AYZA 2NQZA 4D71A 1GOKA 3KL3A 2YYTA 4GO9A 4HK5A 3SCQA 3DBNA 2E0PA 2F7FA 1NP0A 1VIWA 1F3XA 3W2UA 3TC7A 4HOWA 1JPHA 4MNLA 1RBLA 4LVFA 3N2TA 1MFUA 3ARSA 5D33A 4AMCA 2VTFA 4J35A 3VNKA 2YL6A 2ZX8A 4AZGA 4FNUA 1PS9A 1UKOA 4GYPC 1JD9A 5U4NA 2D3LA 2MUCA 1EIBA 1XLFA 1ONEA 1EZWA 1DIEA 3HV8A 3T81A 4IGHA 3QQ1A 4GJIA 1IE7C 1VJZA 3E2VA 9RUBA 2JF6A 2VGBA 1W2PA 1CYGA 1E5NA 3CBWA 5HINA 5I6SA 1SR9A 1HL2A 1G7VA 4LV4A 5AN7A 1YLVA 2G4FA 1R0MA 4NXSA 3N6HA 4O4WA 4DNMA 1A3HA 3U2OA 1U1HA 3L5AA 4I6VA 3LDVA 1AL8A 1YPIA 2W6RA 3WH7A 4F9JA 2Z0IA 1EXBA 4ZSUA 2Y85A 3T78A 3PUGA 3GX9A 3VKBA 3V18A 1UB3A 4NAEA 1F4AA 2OOGA 3H23A 2VNCA 1VEPA 1V08A 3PZTA 3MW7A 4H4IA 4LUTB 4WDXA 3RNDA 3IS4A 9XIAA 3I10A 3BLPX 4NX0A 4XQ6A 2PDWA 1R3YA 1RCXB 2BY0A 3QXBA 2VT0A 4LF1A 3K46A 4N9BA 3GNNA 3L21A 4ZQRA 1KGWA 2YLLA 3AUJA 2HBXA 3VOIA 4M82A 2CZFA 1XWYA 2WBGA 1DQXA 4GIAA 3CHDA 1P6BA 4AY8A 2G8ZA 3BLEA 3KW3A 3MWAA 5K3VA 1Z69A 1JZ3A 4GK8A 1GVIA 4AG0A 1RP9A 1N8WA 5HMDA 3V5FA 2ZRZA 5T8GA 4L7ZA 3EZ4A 1QO2A 1ZU8A 3CV1A 4J3TA 1DJZA 2PDFA 2DZAA 4H00A 3B06A 2VDGA 3OZMA 4MVAA 5G5IA 1J5TA 1GNXA 2F6UA 2O7SA 2PDMA 5I78A 3M0MA 2XGZA 2Y24A 2XN0A 3UG4A 1ZY9A 3DFYA 3E0IA 5I3FA 5FJJA 1I60A 5CGMA 2OYLA 4LYPA 1MNSA 1LWHA 2FVMA 2OLAA 2WLYA 1FWBC 5D9MA 5CC3A 4EXBA 1YW1A 3ZSSA 2H3DA 3DX5A 4JTFA 1GQJA 1WDPA 1BVWA 1DPMA 2CZ5A 2AKMA 2RDTA 5C70A 2XM1A 2GUUA 3ARYA 1XQKA 3QY6A 3L4ZA 2I7GA 3B04A 1XKJA 3FN9A 2ZZ1A 4Q4RA 3UETA 4GWEA 2D22A 1SO5A 3G0XA 1PIFA 1UKSA 1X7IA 3BG5A 1UR1A 1LOLA 3W24A 1TR9A 4AWSA 1OFQA 5JIWA 3AICA 1UR8A 1VFTA 1TWSA 1O5KA 2Q8LA 4O28A 4B4FA 5C9RA 4JQ2A 3FAXA 4NU7A 5FA5A 3T55A 1QU4A 2OGYA 1XFBA 1HKMA 4AZCA 1L6YA 3TONA 1VFFA 5IOBA 1TTIA 1E9LA 4ZQOA 3L12A 2VX6A 2XH7A 2IMRA 4L1WA 4QJ5B 1YPXA 3CAQA 3FKRA 2VX5A 4GQRA 1A0EA 3VI2A 3WNOA 2X09A 1C7SA 3N2OA 1JI2A 2PDJA 3MBDA 3NWRA 2A1YA 1B57A 2J77A 3H7UA 3CQJA 1JRBA 3NOEA 4KS0A 3W81A 4B3KA 3C2RA 4MB1A 1YYAA 4LS1A 3KBWA 1QVBA 3SAZA 4IMFA 3AIWA 3OQ8A 4O12A 3A4WA 2BLEA 3AYTA 1DJHA 1A5MC 4UFJA 3IJ8A 5PTDA 3CPRA 4AXKA 3U4AA 1F07A 4LH8A 1LJYA 3WEOA 3R94A 3RU8X 3KOXA 1V7YA 1FCBA 1BEUA 2OVLA 4IQLA 3WLJA 5G1TA 3LPGA 4S3BA 3WNNA 4W89A 5KEZA 1TVPA 4HCDA 4C6CA 2NVCA 4MAVA 1UZDA 4YVVA 4HSOA 3L4XA 3C8FA 4MJMA 3VABA 1HP4A 1FHVA 3S1UA 3WEZA 1XYAA 1SVDA 2IUZA 1QPRA 1S2AA 3EOUA 3G22A 3KP0A 3KLLA 2J47A 3A5VA 3TZFA 3P80A 1ICPA 4C7FA 3B8WA 5AECA 1XPGA 1WP6A 1Q6GA 1OWQA 3ZT7A 3DG7A 1CWYA 4JYEA 3IIZA 4V33A 2WHKA 4BCEA 2VKZG 3N13A 2Q3OA 6XIMA 2QUNA 1P0DA 1X6UA 2Q71A 3ITOA 2DFAA 3P2VA 3W85A 4R53A 2J24A 2BDQA 3TMLA 4S3CA 2DUAA 3LI1A 3I65A 5IFTA 4CD5A 2BHUA 1S3HA 4UNIA 3NYZA 2VFIA 2VRKA 2VWSA 2FDMA 2W63A 3AS2A 1RPXA 3UP8A 1A4LA 3E3HA 2Y7FA 2FPVA 3PP7A 3N1AA 2ZUSA 4B5XA 2NVDA 4AF0B 3LLDA 2W67A 4M29A 3UWZA 2FZ8A 1W1PA 3HQOA 2E6DA 4MOZA 2VGGA 3TAKA 3VD5A 4H9MA 2JKEA 4NKCA 1V3JA 1U22A 2GUBA 3BDKA 4Q7BA 1TPDA 4XB3A 3BJSA 4M1RA 4US6A 2D0HA 4KWOA 4GH3A 3WLOA 1YQ2A 2J9YA 3GZ3A 1C3FA 1MRQA 1JNDA 3ATZA 2GJNA 3WCZA 3W83A 3QN3A 1QI4A 1J18A 4ERIA 3QKZA 3LHTA 1EWDA 2QJHA 2ABAA 4JHMA 3C8NA 3RG6A 1UZ1A 4S2CA 3BMXA 3OQEA 2X1SA 3W38A 2P0IA 3M5ZA 1VP5A 1J0KA 1S2CA 3EXTA 1M7PA 1ADDA 3MI3A 4CNOA 4B90A 1GUVA 1YDOA 3B9AA 1VKFA 2OSYA 1VLWA 2DW6A 1E4LA 1RVKA 2JEQA 4N9DA 3B9NA 1REQA 2WSQA 1MW2A 4GC4A 3ANUA 3SCNA 2ON3A 4XD4A 2PODA 2ZRYA 3ONCA 1F3EA 2YPIA 3VCCA 2YCJA 1K77A 3NZRA 3GFZA 4O1FA 2XYLA 1W0MA 3CZ8A 3VOJA 4UQBA 1S2TA 3PBVA 1U1UA 3SGGA 1GHSA 3RCYA 2WYSA 1FWDC 1JCJA 2PF8A 3LG3A 4LNCA 3WK0A 1QI2A 4F3HA 4Q7NA 5CJMA 1LOSA 1G4PA 2J74A 3DXIA 1GW9A 1KQYA 2J9XA 3V36A 2WPBA 1KR1A 1Q85A 2QZRA 3PF3A 2W66A 4RPPA 1P6CA 1EO7A 1S5TA 4GQGA 2E1DA 3AZSA 2FMNA 3GC2A 2GJXA 1KM2A 4IM4A 4X0VA 3KBMA 1GKQA 4LY8A 5DANA 2XJ7A 5T9CE 4K1WA 4NP7A 4PTMA 2C6QA 4MY9A 3HIJA 3SCWA 5EFDA 2PDXA 3UA4A 1TG7A 5CAHA 7A3HA 1LZOA 1Q7QA 1W1VA 1SW3A 3GNXA 4WRHA 1KXHA 2NQJA 3LK6A 2PDGA 4IQDA 2G3NA 2WWCA 1BVNP 4RV3A 3PWAA 2E5DA 1XCXA 3WLPA 1F76A 4D72A 1TVLA 1EJTC 3IIOA 2ZX5A 2XSXA 4DZIA 4GY7A 2GFTA 2CYGA 1TTQA 3A3XA 3T0AA 3WQDA 3SCTA 5C9XA 1JQXA 3AIRA 2X1RA 1W5PA 2ZRWA 4N02A 4DO5A 2VGFA 2E8YA 3OO2A 2YXGA 5I2UA 4Q6JA 4DBWA 3BW4A 3L67A 2WMIA 4CQBA 2CBJA 5DQPA 4MPQA 4UQDA 3PTDA 1W31A 2NLIA 3GIQA 1NOFA 5E6ZA 3SRKA 1XF0A 5CPOA 1CGXA 2PC4A 2CLPA 3MBFA 3CZGA 2NQLA 4IMEA 5TNVA 1D3HA 3NTYA 3E12A 4HNOA 1GOXA 3IV8A 1RK5A 5LHFA 3QPZA 5JBDA 4LUSB 2X0SA 2FTWA 3GVQA 4FALA 4RE4A 3K4DA 1W9DM 2WKGA 3LHVA 3EYPA 1PVNA 4F0LA 3S5ZA 3GH5A 5ENLA 3UYIA 3ARWA 2DU2A 2PP1A 4XVEA 1VJSA 4I90A 3DGBA 3ANVA 3CL8A 4ADTA 3VIPA 3O6DA 1CXIA 4CVUA 1TPEA 3PJXA 3UVAA 1WZMA 3W84A 3WDJA 3ZQ9A 2IPJA 2XFYA 1XUUA 1HXJA 5EU9A 5ECVA 3QH2A 2XIBA 1V51A 1OCBA 5AHIA 3KUMA 4ZFMA 4X61A 2ZRVA 1G69A 2ZICA 2WNZA 2OQYA 2GGJA 2J7GA 3ABSA 4A3YA 3OVRA 2BHZA 3QRHA 2UY4A 5C6MA 3QJAA 3O6CA 1FWTA 3GVGA 1EJ7L 4LY4A 1QPNA 4JXCA 4HPGA 5G1MA 2ZRUA 3N9KA 1E9ZB 1V0NA 3F1QA 2Q8ZA 2HJPA 4GGBA 3M07A 5HMEA 3TWBA 5HNUA 4PL2A 4H41A 4WF7A 1A0CA 3FDKA 3AIQA 2G96A 1A5KC 3WLHA 5I3JA 5K4ZA 3NM3A 4Y7EA 1FWIC 3MZ2A 2YL8A 4LBRA 1XYMA 3TJIA 3S6DA 3EA3A 3TX9A 2EPLX 2Q02A 2FLIA 3THUA 3VZZA 2ADAA 2JKAA 4IPIA 1XR2A 4JTHA 3XIMA 4S3GA 1V5XA 4LVGA 3S2MA 4W84A 3FHQA 1OYCA 4PMUA 3BURA 3GU9A 3W4RA 3E6EA 3QV7A 5AC6A 5A2AA 3LEPA 3WH5A 4K36A 1PX8A 3C3UA 1QAPA 1JZ7A 1CGYA 1LUCB 2J8GA 5H6HA 4DLMA 2OU4A 4GFSA 1QBAA 1F6YA 2ABBA 3E9AA 5FF4A 4FLRA 3NYDA 4J3SA 1C8QA 3SBFA 1SJCA 2E7FA 3RLHA 4DJFA 2VI0A 1V77A 2V30A 4ILSA 1H61A 2WCGA 1IZKA 3EPOA 4KKXA 3UCQA 4DNHA 2NX1A 3R11A 1GGOA 2EG7A 4S2BA 2D0FA 4JOMA 4C6JA 1QPKA 3GTXA 4XKMA 4HZ8A 4JHOA 5D04C 2W5FA 1RCQA 5HNRA 4XSLA 1XCFA 3DKJA 1EXPA 4YNGA 1TZ9A 3E1F1 2J13A 4PEKA 5HUOA 2IXVA 2ISDA 5C2GA 3U5YA 2C91A 3UZ5A 3MP4A 4FI4A 4EF8A 3ANYA 3TDFA 3LXAA 3GR8A 2WWDA 2DSWA 4L56A 3S2NA 3HA1A 2QHAA 3WNKA 5FOOA 4PBEA 3IANA 5AYYA 4PBGA 4B3LA 4LQ1A 1IEVA 4BWLC 4N6FA 3FVMA 4AZHA 2A0NA 2VVSA 1A3WA 3V4BA 3FEQA 3PANA 3UGRA 5DLCA 4IGMA 4NQ1A 1Q6DA 1TV3A 2PTDA 3P0WA 2ZXAA 4E3TA 3VUPA 4QNEA 3DHDA 1IWBA 2ZTKA 4CN4A 1X6NA 3AOFA 1DQWA 2VELA 2EHHA 2VFHA 1UWUA 4MY8A 4JGDA 4WCJA 5BOOA 3T07A 4XAFA 4DUVA 2DZXA 1WKEA 3TTQA 2PDYA 4MWAA 1UH2A 3H2NA 1EP2A 1VEOA 1MQRA 4JTSA 5KZEA 5BZAA 3A9BA 1B90A 3S5SA 3AXMA 1ITXA 2PP3A 1WOBA 5AY7A 1L9WA 3IJQA 1TMLA 4FX6M 1X38A 3WK1A 1PJ9A 4R7WA 3KS6A 4KWSA 4JL1A 2RJGA 4IP4A 2VUYA 3W72A 4EXAA 1OFRA 3CWHA 2J78A 2YCIX 1XYFA 3R43A 1M04A 4N4QA 3OEXA 4UTUA 1TV2A 3HMCA 2ISWA 2FFCA 2FQIA 3CB3A 4KCUA 2PZNA 3CXOA 5EKYA 3PZOA 1XSIA 1WDRA 3KWXA 4MTVA 5F2GA 1P0NA 5A6TC 4EP8C 3W01A 1UKQA 3OW1A 4O10A 1ZGDA 2XUCA 2CU0A 1BF6A 1OQFA 5M3WA 4O4VA 3OGRA 3QTGA 3BAKA 2WZHA 1LF1A 3ZIZA 2QCDA 4WOZA 3WH9A 3HM7A 1DWGM 1NVMA 1N7KA 3VD4A 5J5DA 3NQ6A 4GY1A 1KTCA 2VD8A 3GNRA 3L7RA 1IXQA 4AH7A 1LYXA 4URIA 3FDGA 3GG7A 1VFHA 1W1YA 1I1XA 1XIJA 2WJZA 3ABZA 3WMBA 5HUPA 2E3ZA 3AI0A 1AMYA 3M0ZA 1ONRA 3SRDA 1HKKA 2Z29A 3IPWA 2F8QA 2JIWA 1EJSC 2R9RA 3G1FA 1EUAA 1LQ2A 2VCAA 4GVFA 3TZNA 4YLWA 3Q58A 4E4UA 5DX7A 3HGJA 1FOBA 3SN0A 3JVAA 4OTKA 3GR7A 1R46A 4IF2A 3MUCA 1QHOA 1YADA 8CGTA 1N82A 4XUYA 3DFQA 4OGZA 3F4DA 1S2UA 2X05A 3I4KA 1V6VA 1K6AA 1AJZA 5DBTA 3ORWA 3CUJA 3G6MA 3CU2A 4PMOA 3UNTA 3FA4A 1I45A 1S5MA 1LWJA 4HPJA 3SM0A 3LNMA 5LNWA 1ZNNA 1UUMA 1E71M 3UZYA 5KETA 4FXJA 3EEZA 1W5QA 4S3DA 3SY5A 4A35A 2VDHA 4R27A 3S6TA 3BLOA 2PFHA 2J9ZA 3N19B 2QYGA 3FEMA 1VFSA 2PDQA 2ZE3A 1YPFA 4FNPA 5I24A 3O3RA 5HQLA 2VC6A 3UR7A 4BFAA 5JXQA 4FHAA 2PAJA 3O6AA 2VGIA 4OV4A 4GJJA 2YCKX 1VFMA 3ZSTA 4NI8A 1BQCA 5LGXA 3WQ8A 1OX4B 1U83A 3E2RA 4N0RA 4JTLA 3GC5A 2JALA 2VFGA 4YCOA 1KM5A 3ARUA 4I7UA 3SSZA 3KBNA 4WUIA 4IIBA 4XTIA 1KWGA 3GHRA 3RYSA 2GWGA 4AVOA 2QQ6A 3VM5A 4IL0A 4PMNA 1KRAC 1EOMA 1WUEA 3CT7A 2V5BA 1KLYA 1LQAA 1SO3A 1W3KA 2P76A 4D6GA 2V5LA 3C61A 3APTA 3ITYA 2QVHA 1R3VA 2DGAA 2XU2A 4XIMA 3W25A 3PNZA 4N2YA 3QZAA 5L6UA 4KEUA 3MYPA 3T8QA 3NNTA 1GZ1A 3ZXWA 5DEZA 4FEZA 1UOZA 3QM3A 4LVDA 4J2PA 3H22A 4XAYA 5XINA 1XSJA 4M6UA 5FJUA 1B1YA 2E09A 4EWJA 1MXSA 1G6CA 4H6QA 3VIIA 4DJDA 3PJWA 4DQWA 3ISIX 2YA0A 1AVAA 5ABTA 1DJYA 4LJ3A 2J7BA 3S0CA 3GAKA 1O1ZA 5DXYA 3FLUA 2FIQA 4AZ5A 1H7NA 1NOUA 2Y0FA 4JTGA 2V38A 4K39A 1KXVA 4L4LA 3SGZA 1DYSA 4PMRA 1NWSA 4UNKA 3GTFA 2UZ9A 3GVWA 2A4AA 3E2QA 4F66A 2VEKA 4DRSA 2XG9A 4HU4A 1YMYA 4NIRA 3VGHA 3MMWA 3OA5A 3T2OA 5BU6A 3TFCA 4MG4A 1BPLB 2VL4A 1GONA 2QDHA 4BF5A 1BGGA 4WEVX 1OCNA 4M3PA 3B03A 1J6PA 4AD1A 1RBAA 1WOAA 4B16A 1EJVC 4LUTA 3UQNA 4MNKA 2VRJA 4C6NA 3FSUA 4ZOBA 4S1FA 2WMGA 1J12A 2V3GA 5D09A 4H9VA 4KEVA 3KVLA 4JFVA 2ZDRA 4H8VA 1HP5A 4P7QA 4R9XA 4JIHA 1IXNA 1UG6A 5FSDC 4DIAA 4DJDD 1AW5A 1SZNA 4B15A 3TN4A 4H2CA 3BCFA 3UXIA 3N2XA 3OYZA 4KGJA 1O94A 3UT0A 3WYZA 3N2BA 1DIKA 3IGUA 3KXQA 4LYQA 3AIVA 3R8HA 4PTXA 5M1TA 3WFLA 4OUEA 4C6OA 5KZMA 4K8GA 3WLNA 1B4KA 3EMQA 3HURA 3HQNA 2HRWA 3UWEA 5BW6A 2NXIA 3HFYA 3ARTA 3LCGA 1XIHA 3W75A 3ARPA 3H2EA 2R1NA 1JDCA 5C5YA 3CQHA 4AY7A 1J6OA 1ZAJA 3PPFA 3LI0A 1FWRA 3IIXA 3NVTA 4YXGA 3TYUA 3NA8A 3B8DA 1RPKA 3KCLA 3VIJA 3E5BA 3VGBA 2X42A 1PUDA 4XVDA 3L65A 4M6QA 4JZ5A 3HTWA 1JDEA 3O0FA 1FDJA 5FF3A 2QDDA 4QQUA 3KCOA 5JVLA 1YBQB 3LGEA 3BZJA 4XZ9A 3WJYA 1KM3A 1R9XA 3W6YA 4C6KA 2A3AA 3WDIA 3UWQA 3CO4A 3VNJA 1B3XA 4HOZA 1PBGA 1WO2A 5TIMA 5D4YA 1PYMA 4LOCA 2FJKA 2RKXA 3VX0A 3GH7A 3WF2A 4JX5A 3UJRA 1AFSA 4TVDA 4DLFA 1VC4A 3WL0A 1M68A 2W91A 3ATYA 4L9XA 4RE0A 1AZ2A 3W7QA 4KPLA 2VCBA 4F0HA 4WD0A 3WFZA 2UY2A 3NCOA 4IOTA 4LBSA 1NFGA 1WDQA 3USZA 3TVAA 3Q4DA 1CB7B 2V82A 2X30A 1CTNA 4ORIA 4OU1A 4DJEA 4FSAA 3R5EA 2ICSA 2WQPA 1H5YA 2PGEA 3EXSA 3IRSA 4C6IA 1VPXA 1XBYA 3N6JA 3DDMA 3K30A 1EKOA 4PTDA 2DSUA 1Q8AA 5BROA 4GCXA 4AYSA 2X2GA 1W5NA 2X41A 3QKEA 4OBRA 3KRBA 2WBKA 1JZ5A 4G7FA 1Q3NA 4TX9A 1TWWA 5CGQA 4IPNB 4RKAA 5DN1A 3AHTA 5GJMA 1AD1A 1US2A 1SQ7A 2E8ZA 3EOLA 2QCNA 1OFAA 3DI1A 3TNBA 3K8MA 3SQSA 4PC8A 1PTDA 4DUWA 1E4NA 1FKWA 3HGOA 2DJLA 1GVQA 3HGRA 2C7FA 3A13A 2CFFA 3BAIA 2J27A 3A24A 1FY6A 2E40A 3K1GA 3WBEA 3N25A 3OYXA 4O14A 4EK7A 4PMDA 1QPQA 1TO3A 1E6RA 3QTPA 1SW0A 2FZ9A 4JY9A 4J40A 3BQ6A 1VH7A 2OQHA 3V5CA 4O1AA 4I5UA 5D9NA 4FO4A 3KOFA 3PUOA 4AWTA 3EMCA 1IXOA 3QPYA 5ABGA 4NRRA 4CQCA 2B7OA 2V8ZA 3CO8A 5RUBA 4YHGA 4I5XA 2XIIA 4LVAA 3WQGA 4L9YA 4H7VA 1UWTA 1NP2A 3VMOA 4TOQA 3LHYA 1F2JA 1G1YA 1PO9A 4B2DA 5JIPA 2ZUUA 2Y61A 4HN4A 1JYVA 5C9WA 1OB0A 3B0UX 3VNYA 5LIXX 3TUUA 1XRSA 3UXDA 4GI9A 5FJPA 3NQVA 3NPXA 2OO0A 3NQ2A 4U28A 5F1VA 2LLEA 4V27A 3CL6A 1YEYA 3EWYA 3B40A 1QCWA 4ACYA 4DY1A 4RE2A 4IMGA 4MWAE 1S1PA 4M0XA 1IWPA 2JK2A 3QMSA 1E6ZA 1UUQA 4AF0A 5TAOA 3CIVA 3N3MA 2VR4A 2HDJA 2EBNA 3FW6A 5E9XA 1JVNA 1YNYA 1G4TA 3RCMA 4C7DA 4OBSA 4QEHA 4Q4KA 1FFQA 2REQB 2X1TA 2JFEX 5AHNA 1KFJA 2PS2A 1ZHAA 1J0HA 3BSHA 1H7OA 4PMZA 2HK0A 3VAVA 2V81A 4H9UA 2ZE0A 1R85A 3SY8A 2W62A 3RCNA 4OOUA 3TN6A 4HBKA 4RNFA 5B7YA 3CQKA 3MSRA 3MVTA 1ZCOA 2VEFA 1L8NA 3VO0A 4IMCA 5K2ZA 1Y7VA 2WM0A 3WQ6A 1TKKA 3E5PA 3WQ5A 5JQ9A 5I77A 1QNOA 1UASA 3S2LA 5MHBA 2C1IA 3KLKA 4FLSA 3OG2A 4FIRA 2J88A 4IUOA 1LORA 3BZGA 5CPMA 3RPMA 3CK5A 1WCGA 3W7KA 4QAIA 3MMTA 2DH3A 3TN5A 3PJTA 3KWSA 2PWGA 3N4EA 4KBXA 4U2ZA 1RD6A 1J2BA 2D0GA 3LGGA 3NL3A 4TVUA 1P0EA 3IJ6A 3TOPA 1BHGA 2HQAA 3V1PA 3TSMA 3AALA 3W7GA 1LT8A 4JBRA 1NOWA 2YR1A 1OSEA 3C0JA 3HGSA 4PMJA 3BQ5A 1JEZA 2CCRA 4D6DA 1W1IE 4CD4A 4IXHA 3W53A 4XZNX 1WE5A 3N73A 2Z1VA 4MB5A 1EOKA 1VS1A 3CAWA 1RLCL 3FA5A 3M16A 2GQ8A 2QCMA 1CBGA 3B0VC 1PKMA 3W1XA 3T09A 4E2VA 2TSYA 1NTHA 4J7RA 2WB5A 4AVFA 2ZA1A 5I06A 1R87A 4EPBC 5HJYA 3TSDA 2JEPA 3R8GA 4MYXA 1BSIA 1A5BA 2HVOA 3SQLA 1IGSA 2UY3A 3WBAA 3KTCA 1UQYA 2PDPA 1PX4A 4AFYA 4LNYA 3WMLA 1O4UA 2Z2AA 2FH8A 1WBJA 4ZO7A 4GZEA 2O9TA 3AJXA 2X7WA 1VPQA 4LEFA 1HIZA 1XLGA 4G1NA 4AB4A 4JN7A 2YFOA 3OZPA 4NI3A 2VQUA 5DO8A 3VXGA 3VGDA 2I57A 3ZM8A 1X1ZA 1WYIA 3STFA 3G1HA 4FNQA 3GYEA 4LB3A 4AX6A 2C19A 1OVDA 1VENA 4ZODA 1DBTA 3DU0A 4S3KA 2YDSA 1VBRA 2VR2A 4WSKA 1OHLA 4L61A 3M9YA 2VYOA 1WAUA 1XISA 4FXFA 3W00A 4C6QA 1ZJHA 1EF2A 1TYGA 4DO4A 3F03K 1X98A 4ZMGA 5LA0A 4P61A 4GINA 1CXLA 4IIFA 2PU0A 1VCVA 4GQ0A 5HWJA 4ICCX 1JL8A 3P61A 2SFPA 1O68A 2WSRA 5IHSA 3N15A 3V0SA 5A1AA 2WPGA 4Z0SA 3G5EA 1CGVA 1CI1A 3TC6A 4UTWC 3LPFA 3VIGA 2GZXA 1H7RA 3H2FA 4HMCA 5CC5A 5FD0A 4QFUA 3E96A 4UQEA 2VM8A 1KBJA 5DMYA 1GQNA 3IJIA 3G3DA 4LUSA 1XLEA 3B9OA 3TU9A 4BY3A 1BXBA 3L2MA 3MPGA 1GT8A 1NM9A 1DXFA 1W5OA 1PHQA 3EKGA 3AUOA 2PWFA 5MKGB 3AYRA 4IPPA 1T8QA 4DF0A 1I0BA 1OF8A 3L0NA 3TQPA 1EL3A 2CESA 3WD3A 2X2YA 1UPPA 4FB7A 4WLCA 1UIPA 3W02A 1LWIA 3VVGA 1W32A 1CXKA 2D20A 3EB3A 2FFIA 1YRRA 3E02A 3W7HA 1Y8BA 3MCNA 1IZJA 4N9CA 1E6PA 1NIUA 3R79A 1HF6A 1OC7A 2BX7A 3A22A 3PZ9A 5C7HA 3TA6A 1W3LA 4GIYA 4Q8TA 2PD9A 2J66A 1EBGA 4L6OA 3P5ZA 2Y89A 5A6BD 1EGVA 1PB0A 1GHRA 2VEIA 2Q6ZA 4LEQA 3G1RA 3L0KA 3M4HA 3BW2A 2HEJA 3ALFA 3DECA 1NDZA 4CNPA 1KWKA 1PDZA 3VDAA 1HJUA 2YA2A 1FA2A 4GI6A 3M64A 5JU6A 4QE5A 3ZR6A 1GZJA 5C9UA 4NSBA 3URNA 5I5RA 2INFA 1K4HA 1PEZA 2A21A 3G1XA 4Y8EA 2PZ0A 4ERGA 3ALGA 2DVUA 4NZJA 3ZJ6A 1OM0A 3PNUA 4LRSA 4IX2A 5LIWX 3RILA 1ODUA 2ZKMX 1A5NC 3E0VA 3KX6A 4Z2IA 3L5LA 2QCHA 1R9YA 2QV4A 1XH1A 4G5DA 4HN8A 3EKZA 3T0TA 4US5A 3S5OA 3WQ4A 1DKWA 3HF3A 4QDMA 2HCVA 3VGFA 1R7AA 2YDAA 1VCFA 3K5XA 4DM1A 1TPC1 3WENA 1QATA 3NO1A 3K4AA 3NURA 5BYWA 1P0BA 1LUCA 2ALDA 3OLIA 3NQ7A 5DBUA 2X1UA 4B5TA 3AZRA 2YBVA 2IXUA 5H8PA 3BOLA 4FOJA 2EKCA 3S1VA 4U31A 3GG0A 4GLEA 1E9IA 5IM51 4JDBA 4AZ6A 2E6YA 3ES8A 3PSVA 4IT1A 2GYIA 4PZVA 1U2YA 1TPVA 4Q7IA 1A5CA 3MUXA 3VA8A 4W7UA 1W3HA 4Z2GA 3KL0A 2XVLA 2FGBA 3U6WA 3S9YA 3HPAA 2D2HA 1C29A 3H4GA 3JRKA 2BVYA 1RQHA 3SCSA 3ITCA 4MFEA 3FJ4A 3SCRA 4QR6A 4ZOEA 4A2RA 1E72M 1WXYA 4L64A 2D1ZA 2TYSA 5K9DA 3SIMA 3MUY1 2W4XA 2XZ7A 1AJ0A 4BQ2A 3MUZ1 5A2BA 1UD8A 2A5HA 4AZIA 4J3XA 2VQTA 3AISA 3O15A 5AC8A 2EPOA 2QIIA 3PPGA 4NNCA 2HVNA 1VHNA 5FF0A 3CC1A 1D3GA 1H7XA 2C1GA 5KZDA 4IIDA 2FHFA 2XIQA 1T96A 2RDXA 4YIWA 3G18A 3P8JA 1IEWA 3LTSA 4O50A 5AHMA 3UVIA 9CGTA 3W0KA 3NG3A 5G2HA 3EPMA 3EWUA 3OHIA 4Y9OA 2WHJA 1R30A 3KTSA 1C90A 3DFPA 2UWFA 3ZWSA 4MKSA 5D32A 3SN4A 4OJYA 1IR1A 2QF8A 1K8CA 1WV2A 1ZAHA 3GE7A 3C5QA 3C6CA 1EHNA 3NIYA 1GVSA 5HJLA 3SW6A 1R3WA 3WELA 1BLIA 2C13A 4ML9A 1V7AA 3IAPA 1IYXA 1FH8A 4Z17A 4R3UA 2FPTA 4TO8A 3U57A 2PWVA 4YTTA 2GQ9A 1GVRA 2GJRA 4UCFA 2QDGA 3IIPA 3TMQA 4ZENA 4DWSC 4RX0A 5BRBA 2D24A 3LQLA 1GJUA 3M5XA 1ZRQA 3OU8A 4B4HA 2EQDA 1F6PA 2PRLA 3BWWA 3VNZA 5HMFA 3N18A 2A3LA 3W29A 3P82A 3MUIA 1IV8A 3UFYA 2VR5A 4R5EA 5BOEA 4K7VA 1NWTA 1ZJIA 3NO5A 1T41A 3C2EA 1HJWA 4POCA 1LRNA 2FDSA 3DZ1A 5A94A 5BNKA 3QSTA 1AUSL 2V2DA 4LS0A 1KLZA 2V3FA 1UD6A 3GXDA 4GYPA 4JCMA 5XIAA 4PUDA 3JW7A 1WZAA 3C3NA 3QR3A 5CJNA 4MB4A 4Y9NA 3KCJA 3UR8A 2V2CA 2GGGA 4KH2A 2BGQA 4WDUA 2BY1A 2PWEA 3OBEA 3LV5A 2BY2A 4IWWA 1XIGA 3RU6A 5D2VA 3GD6A 3MP5A 1CNVA 1V3IA 4IPJA 1JNEA 4AWUA 1TIWA 1ADOA 3BG9A 3NL2A 1VZWA 1K03A 1XC6A 1UBSA 4L1GA 3G1AA 4C1KA 1NFBA 4PCTA 3DERA 4BI7A 1VF8A 4Q8QA 2BG5A 2X7VA 1JZ4A 1T0OA 1GJWA 5EMLA 1J11A 5K7JA 4DBDA 2VC7A 1RK6A 4GD0A 4E4PA 3G2GA 4PUUA 3GXTA 3EB4A 2BHYA 4GPNA 2EF9A 1E0XA 1Q45A 4WHBA 3PTQA 6TAAA 3VIFA 3AXXA 3MANA 1F6KA 2CLIA 5IBXC 4IGSA 4FR1A 2E28A 5JH1A 3AMKA 2VZUA 3WF4A 3PFRA 3SO7A 1KR0A 3GDTA 4PTWA 1W9VA 2G50A 4GBDA 1BKSA 2FZMA 3WMCA 4LAKA 1EB3A 1QWKA 3MMUA 1XICA 2YB1A 3W7DA 4IJCA 5CPQA 3DYOA 1K8ZA 2CLKA 3NEVA 1VB9A 3W73A 1Q7MA 2HPMA 1HO4A 5GPRA 2HVMA 5KZ6A 3HU7A 3UBPC 1CGWA 3A9IA 4GVHA 3L2IA 3EWXA 1MO0A 3WJSA 4BA0A 5LYRA 1PZ3A 1S1RA 2H6RA 3P84A 3D3AA 1HNYA 2AL2B 2NT1A 3FA3A 4L4PA 1QOQA 3EDJA 4HZ7A 3S5NA 1PL9A 2DT1A 3URQA 3LM3A 2BOEX 4HZ6A 3HO8A 3GG8A 3SFWA 4JIQA 1PV8A 1JJKA 2OZ8A 3S3GA 3T9PA 3NGJA 1RJQA 1NDWA 2XWDA 1SFJA 1THFD 2G0WA 2QJIA 4FX7A 3LD5A 2RJHA 5D9PA 1J96A 3MMDA 1QW7A 4J28A 2FGLA 2F2HA 2BXYA 2OOFA 3QGVA 4G8TA 6REQB 1LL4A 2I5GA 3I4EA 1PWLA 1OADA 3V1HA 2AGKA 3P6LA 4NHVA 4H6EA 3FXYA 4MZ1A 3B3DA 1QNSA 1FBAA 1OX6A 2IPFA 5K9CA 3PM6A 3LXBA 4XZIA 1Q6LA 4W5ZA 3EA1A 3M0IA 4PGLA 1CGUA 2C71A 3PSWA 4FIQA 1MXGA 3FS2A 3I7RA 4HKPA 4NASA 4ZE5A 1ONXA 3GDLA 4JNMA 4ZFCA 3GIYA 4HA1A 3CIXA 1XFCA 3H7VA 2OLSA 4F79A 3W1PA 4JTTA 2YGYA 3CEPA 4Q4PA 5DT7A 4UWMA 1ZENA 4HA4A 2C0AA 1GKPA 5A5WA 1Z6KA 2F38A 3IRDA 3WQWA 3WLQA 1M1BA 3AHYA 5ABFA 1ZP4A 1Z89A 4JTJA 4C6EA 3NDYA 3U7BA 5I0DA 1E40A 4OV9A 2Z25A 3E0LA 4L80A 2O9RA 2Z6IA 3IK2A 2Q8XA 4GQBA 1F3TA 2YL5A 5FACA 5C9ZA 2V68A 4FP1A 1EA9C 3BJTA 1XDJA 3E38A 4E8DA 4LCRA 3ITGA 4PB4A 3FOKA 2QS8A 4EE9A 4E5TA 3VDBA 1W3IA 4FXSA 4O0KA 2P0OA 2Z2UA 3RJXA 3R25A 4DXVA 4PRWA 3SUSA 1LLOA 3K4WA 3CM4A 4KFOA 3EOSA 1GQIA 4LVBA 3R13A 4OT7A 3U8GA 3MKKA 1H49A 3WH6A 3WUFA 3H54A 3HG3A 4GYFA 2NV2A 2YA1A 1CXEA 1ISVA 5A8GA 1E1EA 2QJNA 4UTFA 1EP3A 4DJFC 3ITTA 4ZGYA 1KQZA 1DHKA 3GIPA 3KFTA 4A8LA 1K8YA 1KGUA 3UZXA 3LZ5A 4J3ZA 3G0UA 4JN6A 1IHIA 5FEWA 5LSMA 2ZRXA 4GKTA 3WX7A 1UWSA 5BRPA 3RLVA 1W9PA 4GZIA 1VYPX 4JTRA 4QE1A 4JHZA 1FTXA 1LL6A 1F61A 4GC3A 2B81A 3GXFA 4HYRA 3UWUA 2O7QA 3TP4A 2WVUA 4C1LA 4HT3A 1X1OA 3W86A 3B0XA 1XW8A 4EOUA 4GJ1A 4JIRA 3W27A 1KCLA 3CASA 3KE0A 4GH1A 2PA6A 5E5CA 5FF7A 2UY5A 3THQA 1FWFC 5CSYA 1W1ZA 2POZA 4GUGA 4UBPC 1OABA 3AMDA 4MLJA 4K7YA 4A22A 2XINA 4TVCA 3SCPA 1H2JA 3ZZ1A 1OK6A 3L4TA 3M41A 4DO7A 4QJ3B 3HFTA 3UERA 3OBAA 3UR5A 4V1YA 1GVFA 1JUEA 2HTMA 1OEPA 4JTKA 4UMAA 3GXIA 3P81A 3AWOA 1HO1A 3VFLA 4ACZB 1EQPA 4PCFA 3G24A 3WDPP 3R58A 2VJXA 3ONBA 2ZXQA 3EWWA 2VEMA 3WDQA 2G3FA 4XAZA 5REQB 1CDGA 4O0ZA 4C91A 1O1HA 2DZVA 2NXHA 3ARXA 1BAGA 1B30A 2GQAA 4L1XA 4C7GA 1FXPA 1Q5MA 3R89A 4RDWA 1QTWA 4NRSA 4LAZA 1S38A 4QAWA 3VYLA 1HGWA 2WW5A 4FOKA 3SGUA 1R7OA 3W23A 4Q8VA 3CHVA 2YOCA 1TJRA 2OO6A 3D46A 3AIBA 3G1VA 4WDWA 4Z1YA 4MADA 1MFVA 5BU9A 1JULA 2R24A 3HZ3A 3SB0A 1QK2A 4BF7A 2ISSA 5A8OA 3I6EA 2YW3A 3S47A 4YYCA 3EOOA 2FZBA 5DCEA 1OJXA 3W1NA 4ZVJA 5AC4A 3B05A 1B9BA 4JTCA 4UNLA 1QUMA 3M6DA 1UR4A 3CWOX 4N4PA 1OGBA 4X3ZA 3BH4A 4QHRA 3VNMA 4J3VA 1MW3A 2ASHA 3GXNA 3A47A 4CEUC 5EFFA 4HU0A 3GDBA 3QHOA 1TPH1 4RXFA 4RJEA 3MHUA 4M8UA 3GRIA 5E0KA 3NQDA 3GH4A 1EC9A 4FF5A 4AEFA 1BVZA 1IZCA 2PMQA 3RO8A 1PYFA 2CZVA 2WJEA 2CKRA 3B8UA 2X0HA 1C93A 6TIMA 2QUTA 4O57A 3CZEA 3GKAA 1V6TA 4M56A 1KGXA 3B8TA 1F9CA 1ZTVA 4OWGA 1UWIA 4Z1CA 3MV11 3D6NA 3CHFA 4H19A 3TYDA 4RPQA 4K2SA 1ZBCA 3BL3A 1V6WA 4Q6XA 1DWFM 3BAJA 3RO6A 3KDOA 2J62A 4DF2A 3B8IA 5TD4A 1POKA 3V0TA 2G4JA 4MZYA 4LC6A 1Q4NX 3AZTA 2CBIA 3N3TA 2OSWA 2WMKA 3O06A 4K8HA 1XPYA 7CGTA 3PZVA 1K3UA 1MUWA 2E77A 3U0HA 1FXQA 4NJIA 5D9OA 4JQ4A 3QV6A 2REQA 5T91A 1UR2A 3GUGA 2WXDM 3EWBX 2CBVA 4JQ1A 2JQXA 1D9EA 3BE7A 5A6MA 5EYWA 2G95A 2W27A 4MJ4A 1AQFA 3GC4A 2Y88A 2WVVB 1Z44A 4P5UA 1XRFA 3P7YA 3FSTA 4LTSA 5AYIA 3C4UA 4UCGA 1W91A 2W79A 4QROA 1E51A 1DWIM 4DBSA 4E2BA 1Z48A 3WLSA 4HPHA 4JAWA 3I3EA 1OFPA 1NDYA 3F4WA 4BK9A 1HVXA 1YNQA 4TMBA 1QOXA 4BEUA 4W93A 1T6MA 3ABQA 3DG6A 4HA3A 3B0YA 3DHPA 4O1EA 5DMNA 1QRQA 3M7SA 3FYYA 4N9EA 3MSDA 1EYEA 2YW4A 2CBUA 4QE4A 3W76A 3PZQA 3F2BA 1XI3A 1QASA 4NZCA 4U10A 2FGZA 3LSCA 2I14A 5CZKA 1HFBA 3T42A 4DBUA 3A64A 1TFVA 3L4WA 3EKLA 1DQUA 5C2XA 1HQTA 2OLHA 3LBCA 5BXTA 2ZWZA 3SI9A 1JGIA 2DSVA 2ZIDA 3RMEA 1KM1A 2C16A 4RDZA 3UPMA 3TC3A 4ZEPA 5I03A 4DVOA 4O53A 1VAHA 1UH4A 3TFXA 5AYBA 2CKSA 2NV9A 3VOHA 5J8LA 4I9TA 3AIEA 5IHRA 1R3QA 3QBUA 3DH7A 1D7FA 3UCCA 1WNOA 3AS1A 1PTAA 3D0CA 2FZDA 3GHUA 2OT1A 5DT5A 3GVRA 4OHQA 2PWDA 3V3WA 3Q45A 5ABEA 4GO8A 4QISA 3IEBA 1R3RA 1TX2A 4JN8A 1EPVA 3KBJA 1WUFA 3H55A 1VRDA 3PWGA 1EA0A 1I2NA 2GK1A 3ZS4A 1SO6A 4V1XA 3GNDA 4W7WA 5TF0A 4PTNA 3MV01 3LU2A 3EA2A 5A8PA 2ZQ0A 4UTJA 3UY7A 3BUVA 1CIUA 2I5QA 4MYAA 4WKFA 5KTLA 4C6DA 4KEMA 4D6FA 3O05A 4K37A 1NH6A 4WJXA 3EDDA 5I3HA 3F4VA 1KFWA 2IW0A 2BVDA 1MXDA 1S2VA 5A8NA 2CLLA 4B5WA 4QNWA 1AZ1A 1VBJA 2WAGA 4HMEA 1GG0A 1ZSXA 2BFGA 4WX2A 1BG9A 2FTYA 1EBHA 4L9ZA 1T5AA 3F4NA 4TUFA 2R82A 1P1MA 5LIYX 3AMGA 1N8FA 1XBXA 1FHDA 1VBUA 2WOQA 4NYUA 1ZJAA 1AH0A