2F6KA

Crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
306
structure length
306
Chain Sequence
SKIDFHTHYLPTSYVEALKRHVPGDPDGWPTPEWTPQLTLNFMRDNDISYSILSLSSPHVNFGDKAETIRLVEAANDDGKSLAQQYPDQLGYLASLPIPYELDAVKTVQQALDQDGALGVTVPTNSRGLYFGSPVLERVYQELDARQAIVALHPNEPAILPKNVDIDLPVPLLGFFMDTTMTFINMLKYHFFEKYPNIKVIIPHAGAFLGIVDDRIAQYAQKVYQVDVYDVMHHVYFDVAGAVLPRQLPTLMSLAQPEHLLYGSDIPYTPLDGSRQLGHALATTDLLTNEQKQAIFYDNAHRLLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of ACMDS from Lactobacillus plantarum
rcsb
source organism Lactobacillus plantarum
molecule tags Lyase
molecule keywords metal-dependent hydrolase
total genus 102
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2f6kA00
2VC5A 4IQJA 3WYZA 3E0FA 4QRNA 4KEZA 2Z29A 4RDYA 1QXLA 1PSCA 4QS6A 3AUOA 4GY1A 4KESA 3S2NA 1JGMA 4C6IA 2I9UA 4LAMA 5CH9A 1RK6A 4ERAA 3FDKA 4GBDA 2R1LA 3AU2A 1PO9A 2OOFA 1R9ZA 3GU9A 1J79A 3QY6A 4EPDC 4ERIA 4IFKA 4GY7A 4C6PA 1ONXA 2E25A 4MUPA 4CNUA 2GOKA 4NP7A 1XRFA 2Z4GA 3TN5A 2Z24A 3CJPA 1RJPA 1YBQA 4CQCA 1GKQA 4HK6A 1HZYA 3G77A 4I6KA 1PB0A 2GSEA 1YIXA 3IGHX 4G7EB 2D2JA 3GRIA 3PNUA 1EF2A 1GKPA 1FWDC 1GKRA 2HBVA 1WXYA 3V7PA 4HA0A 1KRMA 2Z7GA 1POJA 3T8LA 4C6FA 2R1PA 1KCXA 4GK8A 4B3ZA 4DLFA 3K2GA 4EP8C 1M7JA 3F2BA 1J6OA 1DPMA 3PAOA 1V4YA 3F2CA 3S4TA 2GWGA 1ITUA 3EWDA 1UMLA 3F4DA 4J35A 3URBA 2QVNA 3K5XA 3PBMA 3JZEA 4XAYA 1RA5A 3ISIX 4PE8A 1XWYA 3LGGA 4KEVA 3PANA 4XD3A 2EG6A 1NDVA 2VM8A 1E9YB 1EJRC 2GWNA 3MVTA 2A3LA 1VFLA 4AC7C 3UR5A 3EGJA 3F2DA 3URQA 4CNSA 1A5KC 3UBPC 3CS2A 2Z00A 3URAA 2OGJA 3E3HA 2BB0A 1ONWA 2Z25A 2ANUA 2AMXA 4H00A 3DC8A 3E2VA 1FKXA 3A4JA 2GZXA 4F0SA 2KAUC 1V7AA 4DLMA 2OB3A 2Z28A 4LAOA 2ZC1A 3A3XA 3LSCA 4DI9A 4RDWA 4UB9A 4C6JA 4ZSUA 3KM8A 4RDVA 3F4CA 2CZVA 4D8LA 3WZ0E 4F0RA 1K1DA 3FDGA 4XD5A 4CQDA 3QGAC 1EZ2A 3MKVA 2HBXA 2PUZA 3E38A 3MSRA 4C5YA 1K70A 1UIPA 4GX8A 4GY0A 4Z42C 4IGNA 3TN6A 4J5NA 1KRBC 4DZHA 2ICSA 3B0YA 4ERGA 2YB4A 2WJDA 3GG7A 1POKA 3LSBA 2YXOA 4R85A 2D2GA 1M65A 1FWCC 4EPKA 3QGKC 1FWFC 4PCPA 3CAKA 4AQLA 1XGEA 4HK5A 4C60A 3OJGA 4H9TA 1EJTC 2Z26A 4DI8A 3LGDA 2PGFA 2YB1A 1R9YA 4IFOA 2WM1A 2O4MA 1P6BA 1ZZMA 5FSEC 1EJWC 4H9MA 3O7UA 1KRAC 4IFRA 2QPXA 2E1WA 4LEFA 4B92A 1K6WA 3OVGA 1NDZA 1O5RA 4LCRA 4NI8A 2YZ5A 4L6DA 2FTWA 1KRCC 3TN3A 4PBFA 3FEQA 4QSFA 1A5NC 3HM7A 3B0XA 1P6CA 4KEUA 1FWBC 3S2LA 2DVTA 4ICMA 3GIQA 3GIPA 1EYWA 3NEHA 4P5UA 4C65A 4LFYA 4IGMA 1NDWA 2FTYA 2PAJA 4H9XA 3R0DA 1A5LC 4BY3A 1NDYA 2HQAA 1EJXC 1R9XA 4C6LA 2G3FA 4WGXA 3S2JA 4LCQA 5E5CA 4CNTA 1P1MA 4IFKB 1YBQB 2AQOA 3MVIA 3O0FA 3GTXA 4M51A 3URNA 4IH3A 2UBPC 2Z2AA 1IE7C 3MTWA 4C6QA 5HMFA 4XD4A 1FWEC 2EG8A 2I5GA 4PCNA 4HK7A 4DO7A 2F6KA 2BGNE 3LY0A 1YNYA 3IJ6A 4LALA 4G7EA 1EJSC 3NURA 1FWJC 4F0LA 4C6DA 4JOMA 4B90A 3LNPA 2RAGA 3RYSA 3MDUA 2OQLA 4DYKA 4DZIA 4G2DA 4GXWA 1RJRA 3E0LA 2PLMA 3IRSA 4KERA 3GTFA 1W1IE 4DIAA 2R1KA 4UBPC 3T81A 5FSDC 5A6TC 3RN6A 1O12A 3E74A 3EWCA 4EPBC 3RCMA 4QTGA 1UIOA 3LS9A 4V1XA 4EPEC 1FKWA 3GTHA 2W9MA 3SFWA 1XRTA 4XAFA 1ADDA 4KIRA 4RZBA 4QROA 4C6MA 2QT3A 2FVKA 1YRRA 3PNZA 2OODA 4BKNA 1A4LA 1V77A 2UZ9A 3LA4A 2R1MA 4XD6A 3UR2A 1E9ZB 3K4WA 3LU2A 4E3TA 3OOQA 3BE7A 4YIWA 4WVXA 3AU6A 3OQEA 4CEXC 1A5MC 1BF6A 4KETA 4H9YA 4IG2B 4PBEA 5HMDA 1RA0A 3IARA 1S3TC 2WJFA 1I0BA 3HPAA 1WXZA 4DNMA 3WMLA 4C6OA 1NFGA 4H9ZA 4B91A 2Z2BA 2VHLA 1V79A 4L9XA 2Z27A 4OFCA 2D2HA 3TN4A 4LAKA 2XIOA 3OODA 4RDZA 2HPMA 1FWIC 2QS8A 3RHGA 1V51A 2PGRA 4H9UA 2VC7A 2DVXA 3GU2A 4CQBA 4KF1A 1J5SA 2ADAA 3T1GA 1A5OC 1RAKA 3N2CA 3IACA 2Q09A 4QS5A 1YMYA 4I6VA 1EJVC 3B40A 3MJMA 4C6NA 4WHBA 3IV8A 1A4MA 2Y1HA 2VUNA 2R1NA 4C6BA 4CEUC 4LH8A 1RK5A 4ZSTA 4TQTA 1FWHC 3DUGA 4NG3A 4C6CA 4XAGA 4C5ZA 3GUWA 5LXXA 2FFIA 3NQBA 1QW7A 3ITCA 1M68A 4IF2A 4LANA 1I0DA 3QY8A 4GC3A 4R7WA 1PTAA 2Q01A 3DCPA 4C6EA 1J6PA 4GYFA 3QY7A 2DVUA 4INFA 4BJHA 3A3WA 1ITQA 3HTWA 4GOAA 4KQNA 4H01A 3D6NA 2HNHA 4J2MA 5G4HC 5HMEA 3ORWA 4GZ7A 4C6KA 3UPMA 2IMRA 3ID7A 3UF9A 2FVMA 4RE0A 5AKQA 1EJUC 2P50A 4HJWA 4GX9A 3GU1A 1RJQA 3TNBA 4V1YA 2AQVA 2EG7A 4R88A 4XAZA 2VR2A 4IG2A 3ICJA 3C86A 2P53A 3SO7A 3OU8A 3IPWA 2O4QA 3S2MA 4LCSA 2HPIA 3GTIA 1UBPC 1FWAC 3MDWA 3MPGA 1FWGC 4H9VA 2WJEA
chains in the Genus database with same CATH superfamily
2VC5A 1CNVA 4QRNA 2DFAA 4XZHA 1AQ0A 1G0CA 2E9BA 1QXLA 5EPDA 3AUOA 3QFEA 1XLHA 2IKHA 2A79A 3BAYA 3APGA 4QIUA 2ZXAA 3FDKA 5DY3A 3WD2A 4IHCA 2P10A 1SJBA 1E4LA 2E1DA 4YCOA 1NSJA 1F3WA 2ISSA 1I8JA 2VENA 5IHRA 4K7VA 3B05A 4OZOA 5LNSA 1DL3A 1AFSA 4CQCA 1UZ1A 3GS6A 4GBUA 1MDLA 4JIQA 3WLMA 3P81A 3LPPA 3L7RA 1I1XA 1KM5A 2J7GA 1ODUA 1XRSA 2VD8A 1V6WA 4DLFA 1JD7A 3W85A 4UNIA 4PTWA 2FH8A 3U57A 5AYZA 1E4IA 2EPNA 1Z8AA 3H8AA 4Y9MA 3TTYA 3QF0A 2OFJA 3HURA 1RQHA 1QWKA 3M5YA 3PUOA 4LX4A 3ABQA 2C0HA 3AHXA 5LA2A 2VX5A 4PFHA 4FI4A 1K9DA 3AHTA 4XIAA 3VZZA 3MVTA 4MJZA 3FX4A 4UTTC 3KWSA 3HV9A 4C1KA 3HMCA 2DZSA 4DM2A 3IANA 3DN5A 3WDIA 4AZHA 5HQLA 1QASA 3W0KA 3URAA 3D5HA 3B8VA 3CQKA 1MO0A 4H00A 3KRUA 3AIQA 2ODOA 1PDZA 4MWAC 3QQ0A 4DLMA 3L4YA 3M1ZA 2VT0A 4GFIA 4EF9A 4PSPA 3OEXA 1VR6A 3G1YA 1Q85A 3AZRA 3F5JA 3CBWA 4KT2A 3F4CA 4W4QA 1VGAA 3KBMA 4F0RA 2CW6A 1W5QA 3IRDA 2PUZA 4OBTA 1L8NA 1XI3A 5AZ1A 4X9SA 4MLRA 3EX4A 4EXAA 2ZDRA 1EDGA 2WC3A 3FYOA 4DZHA 4YWIA 5E0CA 3GTNA 3W1AA 2WZIA 1GVEA 4MY9A 3B8WA 1UKOA 3QGKC 3ELFA 4AAJA 1H41A 4PCPA 1L6SA 3QV7A 2X1IA 4D6FA 1L8PA 2ZRUA 5CC6A 4FLRA 2BS9A 1CXFA 3LGDA 3DFNA 5DT5A 2DUZA 2ZIDA 1UW9A 3G1RA 4JL1A 3GLCA 2UY5A 3MHGA 5CLTA 3DEQA 2YDSA 3ABSA 4UMCA 4R9XA 4CKQA 4URIA 1P6CA 1MQQA 5C0QA 4KEUA 4AY8A 1EGZA 2IKIA 5LNVA 1AL7A 2FGBA 2CC0A 3AYRA 1AZ2A 2TODA 4GINA 1ECEA 3N6HA 1TJ0A 4DF1A 2E6FA 1J0JA 1PKLA 1DJQA 3GVQA 4DJEA 1Y5VA 4AXNA 4FNPA 4Q7NA 1KGUA 4G8TA 3DYMA 5FJUA 1KM0A 3TE9A 1WO2A 4HN4A 3TYZA 3A4WA 4Q7BA 1AJZA 3FV9A 3NURA 3PPHA 2CU0A 3TJXA 2AOSA 2NQJA 3MKCA 4J3SA 1P7TA 1S1RA 3MW7A 3EDFA 1VHNA 1EHAA 3MHUA 5EB8A 1XM3A 2R1KA 3S9YA 2OOGA 1OX4B 2CLFA 4ZL1A 1QU4A 4JIIX 2YOCA 4Q6XA 1LT8A 4DJED 3LENA 5I78A 2C15A 2JQXA 3L0NA 1B0IA 1H7XA 4GACA 4RZBA 2PWGA 1EO7A 3QZAA 4UUIA 3GQYA 3RM9A 2XUCA 3LU2A 2YZRA 4BWLA 1C93A 1CXLA 3OQEA 4KETA 4H9YA 5F4XA 1WKDA 3VK5A 4MY8A 4OBRA 3NA8A 3IARA 2J77A 3UCQA 3HPXA 5BOOA 4JCLA 3CH9A 3WJZA 2B81A 2PWHA 3HN3A 1VZWA 1QI0A 2J6VA 4XZLX 3O1NA 1VBJA 1VS1A 4ZXOA 5C2CA 4R3UA 1Q13A 4OUIA 1CB7B 1O5KA 4PEKA 3E02A 3T1GA 1XXXA 4YMZA 4H6QA 3SY1A 4R33A 3ATZA 4UQCA 1EJVC 3B40A 3MJMA 4C6NA 2VUNA 4AD4A 3VI2A 2LLEA 3PBYA 2ZA1A 1TPUA 2VEPA 3DUGA 1JNDA 3BC9A 3VX1A 5B7YA 2CETA 1YDYA 2Y5JA 2AL2A 3S5ZA 1E51A 2JFEX 5LIYX 3VIFA 4C90A 1QPKA 2E5CA 2EPKX 1PWLA 4C6EA 3PJUA 1R86A 4O8RA 1RP9A 3NL5A 3LRMA 4TO8A 2YKKA 3G6MA 1UUOA 3UGVA 5HWNA 3UJRA 5HMEA 2SFPA 3QM3A 4C6KA 4C91A 3PWIA 1DHKA 1A0DA 2FKPA 2VZOA 1TPDA 4FLOA 3I3DA 4V1YA 6TAAA 1XKJA 2Z2UA 4XAZA 1UP2A 4MGGA 2VZVA 2MUCA 2VCCA 1E1CA 1JUEA 5K2ZA 1B31A 3S2MA 2Q8ZA 1H62A 3G5EA 3PY2A 3EPOA 3CV2A 4H9VA 4B5SA 3W3OA 3NZPA 3F4WA 4N9CA 1UASA 1O94A 1N8IA 1K7FA 4D8ZA 1LYXA 4JTHA 3GXMA 1XCFA 4HNUA 2ZADA 1CYGA 1H09A 3IEBA 4RW5A 5G5IA 4IFKA 1UA7A 2E25A 2GSHA 5U7SA 2Z1BA 3TN5A 4QITA 1XQKA 3TA6A 1UR3M 1X8CA 3ZFHA 4I6KA 1PB0A 3MUIA 1TX0A 3IGHX 1UQYA 3BCDA 5JIWA 3UYIA 2INEA 1GKPA 1BWVA 3ZVHB 1KRMA 4U5KA 1V6VA 1S2CA 4CD5A 2X1SA 3RCNA 3SCSA 4Q7IA 1UZHA 3LXCA 3NO5A 1PZ1A 5A6JA 2CBJA 5AVNA 2OQYA 1RD6A 3L2LA 1PZ2A 2ACUA 1W5MA 3VNLA 5I3GA 1RALA 2NQZA 2AMGA 3F4DA 3EPMA 4J35A 3NO3A 4AWTA 2HVMA 1CXEA 3LX9A 1PIIA 3IVSA 6XIAA 3JZUA 3TZFA 3DHUA 4AXKA 1NDVA 2ZZ4A 4AX7A 2DUXA 5L6UA 4NUWA 5BYWA 3WMSA 4JTFA 1YDOA 2YXGA 4O0ZA 3P2VA 1S46A 1ENUA 1EX5A 3VM7A 3GNDA 4UOJA 3SCOA 3W26A 1V0KA 4HSNA 2RHGA 3XIMA 3KUMA 4Z1BA 1LQ0A 1EXBA 3IJ7A 1UR2A 1TO3A 2DJXA 5MF5A 1TVNA 3QGAC 4K1GA 3UA3A 4DXXA 4C5YA 2IS7A 4DF2A 3F4VA 3AALA 1W9BM 3VIGA 4PGLA 3G0XA 4AY7A 1XYMA 4RUBA 2V9DA 2Q3OA 2YXOA 4HBKA 4UQ9A 3IJQA 3EEZA 4DM1A 1MRQA 3PUGA 3KCOA 3FKRA 4BFAA 3ZJKA 1ESWA 4JTAA 2QCGA 4XKMA 4HU4A 1P5BA 4H8HA 3BAWA 3O6YX 2BNJA 5C9UA 2YB1A 4IFOA 4J3WA 1OCNA 3G0UA 3LHVA 3SGZA 5FSEC 3BOXA 4GIYA 3O7UA 4B92A 1F7BA 1AJ0A 2FTWA 3DX5A 3MHFA 2Y8VA 3ARZA 1XL9A 3HV8A 4JZ5A 1E15A 1JZ8A 4QJ4B 4MPKA 1V02A 2GJXA 3HGRA 2V5JA 3U9IA 1XDLA 4BWLC 3HGJA 4KCTA 1MVYA 2NT1A 1X96A 3I7QA 1AJ2A 5BMXA 1RCOB 4WCJA 2PWDA 3CMFA 5E5CA 2YFOA 3IIPA 1S5NA 3LG3A 3MVIA 1H0GA 3AXIA 4M81A 3O6DA 4XD4A 4BS0A 4YTUA 1LP6A 3H23A 4HSOA 4BZYA 3CM4A 2XDFA 2YDQA 3DC0A 3W84A 4EAYA 4JL2A 3BLLA 1VFHA 2PEVA 2WM0A 5FD0A 1R3WA 3WLPA 4HU0A 1QBAA 4TXEA 4W89A 4ZMGA 1NOWA 4MJMA 1PX8A 4ECLA 4PFMA 5K4XA 2YDRA 1MFUA 3KZSA 3T81A 3RN6A 1AL8A 1GPWA 1XDJA 4GI6A 1OG6A 5C7VA 2ZUNA 3GC4A 4MKSA 5D9MA 4UCGA 3N13A 1MWOA 2ZDSA 5IM51 1CGWA 3JUGA 2G96A 3OLDA 1KWGA 4G56A 4C6MA 5LNWA 1KM4A 2OODA 3F5KA 1AW5A 3TFXA 4BKNA 1YYAA 3TYUA 1OD8A 4YIWA 1M41A 3KL0A 4CEXC 4FA3A 2X30A 3K4DA 2BASA 2J7BA 5F2LA 4DJDC 2YGYA 1ZGDA 3GYCA 1CPUA 1JQXA 4AB4A 3GO2A 3LV5A 4DNMA 2VDGA 3TQKA 1BAGA 5DBTA 4C6OA 2VHLA 1H63A 1VAHA 1EXPA 2Y89A 5E09A 2CFFA 1GPFA 4IUOA 5I6SA 1HJUA 1ZPTA 2BZNA 4LU0A 3UT0A 2OX1A 4HMCA 3OTRA 1FCQA 4H7CA 4LYKA 3TR9A 2XVNA 1KCLA 3GB6A 3E49A 4DWDA 3TAOA 4Q8OA 1E9IA 1TV8A 2YBTA 1A4MA 2Y5SA 1KO0A 2E6YA 4J2PA 1FWHC 1UD6A 1SSGA 3EX1A 3NQBA 3LHUA 3VIJA 3WNNA 3W1LA 3E0VA 1M68A 2UV8G 4IF2A 1T7LA 3S1XA 4NI3A 2WVVA 3C56A 1V3IA 2XIQA 3TV8A 4WGHA 1DJXA 2IQ0A 3DCPA 1TPVA 3GXNA 3QY7A 2BLEA 3RR1A 3VGEA 2PB1A 3WF3A 3HTWA 5HMSA 3IJ9A 1JCTA 4ZBCA 3B4UA 3VO0A 3PPFA 2EKCA 1E1CB 2FPYA 3WD1A 1F76A 3VD5A 1BEUA 3V5FA 2C79A 4RE0A 3WUFA 1XKYA 2HMCA 3N4FA 3ONBA 3ZLFA 1RSCA 2JK2A 2AQVA 3S3GA 2EG7A 4M82A 5FA5A 4MIMA 3WLKX 2WJZA 5HINA 3MDWA 4NJHA 5EBAA 4B2DA 3VIHA 3FIGA 3MO4A 1G6CA 2VMFA 4W7VA 3VINA 1LROA 2Z29A 3LV6A 2OELA 3ZQ9A 4GY1A 1IIHA 1O7AA 4PMOA 1DQXA 2H9AB 4GIEA 4M5PA 3USZA 4KWUA 4Y7EA 4NNCA 2FYMA 2W63A 3MV11 1EDTA 4LV9A 3O15A 3VCNA 1QATA 4MUPA 4MAVA 3SB0A 1ZB5A 2NXIA 3PWGA 1HP4A 1G7VA 4O19A 3PTDA 4HA1A 1WKFA 5A8QA 1NFPA 2GK1B 1TPFA 4L1WA 3V16A 3E5PA 3QEZA 4LBUA 3VX0A 3WBWA 3T08A 3H70A 3M0ZA 3BCFA 4JHMA 3GZ3A 3UVIA 5FJRA 4JIHA 4F8XA 4NXSA 3F5LA 7XIMA 3K8MA 3B8UA 1F61A 2W4XA 4XKYA 2AGKA 3NL6A 4H2HA 2QVNA 4R27A 2G5WA 3V18A 3LGGA 5FOOA 4HQVA 4JX6A 3RX4A 2G97A 3WSUA 3THUA 4OVXA 4A8RA 2J8TA 4O4WA 3F2DA 3A23A 1E43A 2GQAA 1V0NA 2WHKA 2GUBA 1HJSA 3MZ2A 4K8GA 1OFQA 2FQIA 3GSMA 4W8BA 1DJZA 5FCZA 3E2VA 3QKEA 3A4JA 3A4XA 1OFEA 2GZXA 3B9AA 5C9RA 2QCDA 2Y70A 2PDMA 3V1HA 1PE1A 5DMLA 1AH3A 4C6JA 5FEZA 5EL1A 3CIVA 1CZ1A 4PCTA 4D8LA 4O13A 1HO1A 3R1ZA 1HTIA 2G8ZA 3QZ6A 3GR4A 2W91A 3YPIA 5KITA 2Y2WA 2ACQA 1S5MA 1OYCA 3TN6A 3DIPA 2J62A 1VF8A 3ITOA 1QW9A 4HIBA 4NJJA 3W02A 4TVUA 2WJDA 4WK9A 1LORA 1P0EA 1J2WA 3NQVA 4AHPA 1E6RA 4PUJA 5CZJA 3CAKA 1VFUA 2GQ8A 2ISVA 3QYSA 5FEWA 4LF2A 2DT0A 5C2XA 3QC3A 2Z1SA 1ZZMA 1IEXA 4IFRA 3PZIA 3AZTA 5CKSA 4AWUA 3EX6A 3P0WA 4PTXA 4KRZA 4L6DA 4O0KA 4GQQA 3ATYA 2AL2B 2ZTKA 5HXMA 4PBFA 1CBGA 3PSVA 4Q8PA 1JYXA 1RQEA 4IIHA 2TYSA 1G4TA 2DVTA 4M6PA 3W6LA 3IJIA 1I1WA 2NXHA 2O9PA 4LFYA 2VFGA 3GXPA 5GVJA 2O92A 1KM1A 1OGGA 4H9XA 3CLMA 4Y9NA 5JBFA 2ZQ0A 4AY1A 4ZA0A 5DMMA 3MUZ1 3NQDA 3RITA 2E09A 1K8ZA 1HKIA 2QR6A 4CCCA 3WF1A 3CT7A 5F7UA 3AO0A 4DJFC 3GVGA 2PWVA 3RLUA 3HFTA 3NAVA 4ICNA 3ZVHA 4ZQNA 4XVEA 3V75A 2QNEA 4HNTA 3NIYA 3P93A 1E0UA 3HPZA 3RYSA 3ZIZA 1O4UA 2XSBA 5H2ZA 4NZJA 1NQ6A 1RJRA 1J2BA 1ZJBA 4E5TA 3NZ1A 2BGQA 3TP4A 5CZTA 3KVMA 1W3KA 3NL3A 1WAWA 4V15A 1O12A 1O66A 2G41A 2VCBA 1VIWA 3AMDA 4QTGA 1SU5A 2A3EA 1DORA 1FKWA 3KOFA 4S3JA 2YL8A 1RH9A 3GDKA 4UZSA 3SECA 3VCCA 5E0KA 1XLDA 3T0CA 4XAFA 4LUSA 1I2PA 4QROA 4FX7A 1BXCA 1YRRA 2BV9A 3LN3A 3RLVA 2CKRA 2R1MA 4GISA 4XD6A 1E9ZB 2C71A 3N4AA 1NOUA 1GYLA 2CLIA 1OWQA 3SW6A 1A5MC 1B2YA 1K7XA 1LRNA 5TQLA 1FA2A 1E56A 1GNXA 5KSWA 4IX2A 4WXZA 3M5ZA 5DMYA 1F6KA 3OQ8A 1V79A 1GVSA 4HZ6A 4F3HA 2XVGA 3IUDA 4JQ2A 4EK7A 2VC7A 1ZCCA 1UKSA 4ZTXA 2OT1A 1PV8A 5M17A 1RAKA 3CWNA 2C13A 3N2CA 4JQ1A 2X1TA 4M8UA 3WH7A 1KA9F 3SADA 4CD6A 3UJSA 3NDZA 1TTJA 4U33A 2YA2A 2PSNA 2AGTA 3CHFA 4CNOA 1GOMA 4YVPA 1O95A 2FFIA 1QUMA 4GKTA 2J7DA 2RJGA 5A2BA 4JDYA 2J78A 3VOHA 3BAKA 1WZMA 4R7WA 2ATSA 3T2PA 4K68A 1J6PA 4FXFA 5E9XA 5JU6A 3H21A 3KBVA 3TNOA 1ITQA 2WCAA 4GE8A 4OKDA 3UWVA 3D6NA 2HNHA 1CCWB 1IEVA 1Z44A 1XQLA 3HZ3A 4IGSA 3T8QA 1OFDA 2EPLX 1G01A 1IEIA 1WP6A 1H5VA 1HNYA 4S2BA 3LM3A 3MMWA 3VABA 3UZZA 3CUJA 4MVAA 4D8AA 3N9SA 1QOPA 3G18A 4D72A 3BLEA 2GJPA 1RCQA 3BZJA 3G3DA 3GXTA 3BICA 5LYRA 2WMFA 4QG6A 4OUEA 5MKGA 2QCFA 4LYQA 2YCEA 3A5VA 1FH9A 2BMBA 4W8LA 4E2DA 1J96A 4UMBA 4XBKA 3TW6A 5LHFA 1F6YA 4X0VA 4E8GA 3F1QA 4RDYA 5EBUA 3CO4A 4PMZA 5C54A 4TX8A 2V2HA 3SCUA 2QV4A 2QV5A 2C0AA 2R24A 3A22A 4NZ4A 1J79A 3ZT7A 4H04A 3S83A 5BMWA 4C6PA 4UTWC 4IQLA 2Z4GA 4LF1A 3FGCA 3M16A 3WJYA 4OQVA 5HNUA 1AMYA 3WLJA 1THFD 1X38A 4HA0A 4N4PA 3KS5A 2Z7GA 2I56A 1QNVA 3LHYA 2O7SA 3WLNA 3PSWA 1CW2A 1AUSL 2FHBA 3LEPA 1I4NA 4WSHA 3IAPA 3N9KA 1ITUA 2WPBA 1UMLA 3PPCA 4LY8A 1AA1B 3NZRA 4XG1A 1Z3NA 4IUGA 1JDFA 3I3EA 4GNJA 3M07A 4DX3A 4XD3A 2W5FA 1L9WA 1Q8JA 5DXXA 4X22A 4OE7A 2DSZA 1EJRC 1TA3B 1HJVA 4L80A 3E2SA 3W75A 3MS8A 1QPNA 2VD9A 1LLZA 3U4AA 4ZFCA 1Q7ZA 3GDTA 1MQRA 3HG2A 3NXLA 2Q02A 1QFEA 3N1AA 1C3FA 4QG8A 1GHRA 4GQ0A 1CWYA 4LS1A 2Y8UA 4UTJA 1OIMA 2Z7KA 4J3ZA 3CV1A 3UCCA 3W1QA 4CQ8A 1JDAA 4XD5A 2PFHA 1PUDA 3OZOA 4OHQA 2OWCA 4JTGA 1XYZA 3BDKA 1K70A 4S3FA 1XFBA 3W53A 2PD9A 5FEXA 3B0YA 1JRBA 5U4NA 3FAXA 5LIUX 2D2GA 3UXIA 1Q4NX 1UB3A 2AAAA 3UG8A 1UH3A 3L12A 2J7FA 4AHQA 2POZA 1QT1A 4KRUA 4U3CA 3H12A 4AD3A 5IBXA 3OO2A 4MB4A 1NWRA 1VRDA 2A4AA 2QEZA 4Y96A 2FHCA 4AF0A 2EBNA 4X2RA 3TAKA 1KRAC 2Y7EA 4Z0JA 1QBBA 1A5SA 5EMJA 4GIRA 1YDNA 3T40A 3L2MA 2PDQA 4C1LA 3H2MA 3W1PA 4O57A 4OOUA 1CI1A 1HVXA 1W6TA 3K46A 3NEHA 4P5UA 4IGMA 1DOSA 1BRLB 2W67A 1GTHA 3G1SA 3N2OA 2YJQA 4LYPA 1B3XA 4H4IA 1ALDA 4UFIA 1XYFA 1OK6A 2D3NA 1FWSA 3LXAA 1R9XA 4D6JA 1ZAJA 4YL2A 4WGXA 2NQ9A 5C6MA 3OZPA 1GTEA 3RX2A 1P1MA 3SGUA 4IFKB 4DJFA 1ML1A 3MY9A 3DXIA 4JEJA 1OX5A 2VP8A 3U2CA 3QV8A 4P8UA 2XSXA 4DO7A 3QBUA 3NQ7A 3T9PA 5F1UA 5AZ0A 1HKVA 2OT0A 1TUXA 4QHRA 2HWGA 3O63A 4RXFA 2J8FA 4B90A 2D3LA 4YHEA 3TOYA 1WNOA 3H6OA 4GXWA 1O68A 2WLZA 4KERA 5C9XA 4DBEA 4O10A 4US5A 4BF9A 2J24A 4ADSA 1R47A 1KR0A 1T6MA 3VZXA 2VC9A 4RR4A 2QUVA 2UY3A 3SCTA 1N55A 3M6YA 1OYBA 4JX4A 4FHAA 2Y7FA 2X1RA 3CPGA 4PUMA 4LAZA 2R6OA 2OXNA 2XFYA 2PDCA 5AC6A 4FF5A 3F4NA 5AYIA 4NJIA 3UZYA 1Y0EA 3VOFA 2QF7A 4ZZ9A 2AL1A 4W7WA 1DJGA 1RA0A 4D71A 5D9NA 5BWAA 3NM1A 5BNKA 3P62A 2WB5A 5ECUA 1TPEA 2Y7DA 4MWAE 1UC4A 2D2HA 4WDTA 3OODA 1J11A 2QS8A 1W5NA 1TRIA 4DHGA 2UY2A 1HO4A 4D6IA 3E5BA 1LQAA 2OEKA 1LG1A 4JY8A 5TD4A 2Q09A 2VX6A 1I2QA 1MMFA 1CT5A 3T09A 2OJPA 2NQ5A 3HGOA 2BVYA 2CBUA 1WXJA 1PEZA 4PTVA 4ZR8A 4LH8A 4GKLA 5JBDA 1FWRA 3A24A 1HGWA 2J66A 4XAGA 3QW4B 2QCMA 2QPUA 4OU1A 3AQUA 2HV5A 1D7KA 1QNRA 1IWPA 1UD3A 3T05A 3TTSA 4QEEA 1W5PA 3RPTA 3LHZA 1ONEA 2BHYA 4AVFA 1HKJA 3VM5A 3QPZA 3IUIA 3N2BA 1W2PA 2E3ZA 4RV8A 3LNMA 2XINA 4QDMA 1RVKA 3OW1A 4N02A 1XYCA 1JCNA 1Z89A 3ID7A 4CU6A 1KW1A 4MNLA 2FVMA 1K7EA 4PUKA 1BTMA 5CCZA 3I6EA 4AVNA 2FMOA 5D38A 1VQTA 3RMJA 1K6AA 3R25A 1UC5A 4DBDA 5KETA 3IPWA 2CLEA 3VKDA 1XUZA 3E12A 1EB3A 1UBSA 2G50A 1P0BA 3B8TA 1UBPC 2HXUA 3MPGA 1E0WA 4MFDA 2WJEA 1CXKA 3LUTA 3S5YA 4GJJA 4QSHA 4CD4A 3W7GA 3I65A 5G1MA 4KEZA 4DO5A 3TDFA 4HPNA 3BAJA 2DW7A 2WZTA 4KESA 1LTDA 4FR1A 3CH0A 5CH9A 1ZLPA 1O1HA 2E0PA 4BQ2A 2ONEA 1U30A 2OZTA 4AWEA 1R9ZA 1WB0A 1OC7A 2B31A 2OPJA 3RNDA 1LUCA 1Q6DA 2J27A 3WNKA 5G1YA 2WZEA 1E6NA 2Y0FA 2CHNA 3D46A 1GZGA 1GKQA 4A21A 4NX0A 4JQ3A 4LS2A 2C19A 1L6WA 2D2JA 4TTUA 1Q6LA 3BARA 5A6BD 1E0TA 1BVWA 4ZE4A 5FJIA 2QJJA 3DYPA 3AXKA 5M2FX 3NSMA 2GUYA 4EP8C 3ITLA 3VILA 1LBFA 3PTQA 5HPCA 4I9AA 1RBLA 3EWDA 3VZYA 4EWJA 9RUBA 4HVXA 1GOQA 1F05A 2ZZ7A 4GGBA 3NM3A 5IBXC 1XWYA 2ABAA 4A8NA 3ZJ7A 2VDHA 4M24A 4MKVA 1E9YB 1HIZA 1NP2A 4O52A 2X1UA 4AC7C 1Q63A 4CNSA 2NVAA 5C7HA 1IF2A 3I10A 2BY3A 2X40A 2G4FA 4S3AA 3VAVA 1TIMA 1FKXA 4ZFMA 1J4EA 1E6PA 2NX3A 3NR0A 1E73M 1EZWA 1JNEA 1V7AA 4L4OA 2RDWA 4DB7A 3WEZA 4RK8A 1FHLA 3M0IA 5DRIA 3KW3A 4KBXA 3G3MA 3DFSA 2PPGA 2XH4A 1CDGA 1VFMA 3TEVA 4REQA 4AC1X 3MSRA 1PHWA 1KKRA 2PP3A 4GX8A 2V3GA 3RO6A 2Y24A 3PBGA 2ICSA 4PL2A 2J7HA 1Q45A 3WK2A 3UJFA 4LUYA 3B8DA 1E1FA 3AXHA 3QRHA 3UY7A 5C55A 3CQIA 1FWCC 3QHMA 5I0DA 1S2UA 4JFTA 3GW3A 4JR5A 3SQMA 4HK5A 4LXFA 3C0JA 3D3FA 4PRWA 1GYNA 4JD4A 2C6QA 5CPOA 5A94A 7CGTA 1XLEA 2I14A 3KOWA 4ATLA 4D6EA 3NQAA 4XZMX 1OT1A 4JKKA 1TFVA 4V2XA 4WLCA 5DF0A 2D1ZA 4ZOEA 3UERA 4FXSA 4NI8A 1GW9A 3JU2A 2PBOA 1XH1A 1KRCC 3E2RA 3NYDA 1SVDA 3SZ8A 1E0VA 1MUMA 1IR1A 2FMNA 2OZ0A 5HBFA 2I16A 3GIQA 3SJNA 3M7SA 3BV7A 1VP5A 3TJLA 3K8KA 4LC6A 4BR1A 4FXJA 2WK2A 3AS3A 4JEQA 3VYLA 1IXQA 3DAQA 5C9WA 4E3VA 3FW6A 2PLKA 1KBBA 1UPPA 4WZHA 4WY0F 3QTGA 3LPFA 2V81A 1XLFA 5DRCA 2XH0A 3PULA 5FF4A 2NLYA 4P7LA 4F0LA 1V6XA 2ZRXA 2IW0A 2YDAA 3DKJA 4R7JA 2GJXB 3WO8A 2E6DA 3CPUA 1WDPA 4KFNA 5E70A 1IV8A 4FO4A 1XLBA 4GI4A 2DT3A 4XSLA 4IPLA 4E2VA 1VB9A 4KWSA 2GVLA 2FTPA 3TW7A 1TIWA 4XB3A 1OVDA 1XLIA 1UH2A 4Q4PA 3LI1A 3KTSA 1H7PA 5BXPA 4XZWA 4P8XA 1E3XA 2B7QA 5HJYA 1RPXA 3VD7A 3VFCA 1E6SM 3G2GA 1TE6A 4OBSA 3TK7A 2FVKA 3TKFA 4L56A 3DG3A 3LA4A 5JUVA 1I2RA 3OOQA 4GGHA 1LRQA 1Q6CA 1ODZA 5IDZA 3W25A 4CN4A 5CPNA 4RNJA 1S3TC 4LY4A 5XIMA 3KOXA 4XKYB 3AIRA 1GJPA 4WF7A 4YXGA 4K2SA 2A5HA 1B4EA 1NFGA 2DZTA 1EGMA 4N6FA 3EWWA 1UKQA 1FWIC 1W5OA 1VJIA 2PGRA 3CEUA 3RGTA 1BXBA 1A0EA 2DVXA 3UPWA 1FHUA 3VFLA 1JL8A 4RW3A 3D0CA 3R8GA 1QK0A 3HPSA 5FF3A 5LXEA 3ALGA 1LWJA 3WFZA 3SRFA 1EP3A 4C6BA 4JKMA 4F9JA 2YL9A 1B9BA 4OWGA 3LERA 5BXSA 3CASA 4FLQA 3CIWA 2FJUB 1VFTA 3SRHA 2J9ZA 1LL4A 4XZNX 1XLLA 5E6ZA 2NWSA 4Q4OA 1SUXA 3UVAA 1GOOA 1B54A 1E70M 4BJHA 4CU8A 4LUTB 4JN7A 1V7YA 3QR3A 1BWKA 3H2EA 5H8PA 3EWYA 4QG9A 3OGRA 4KMQA 4IIDA 4GO9A 3VGDA 1OF6A 1DP0A 4Y2WA 2DQXA 4D9PA 3M7WA 4JTIA 3M9YA 3Q65A 3EDEA 1ZFJA 2VO5A 4KW2A 1JZ3A 4AG0A 3WD0A 3GTIA 1FWAC 3QHOA 3PB2A 1TTPA 1W31A 1GK8A 3FJNA 3GHTA 1NM9A 4IQJA 3DFYA 5DANA 2DW6A 5CC3A 5AC4A 1S3HA 3MBDA 4WKAA 4DN1A 3TR2A 4S3BA 4F40A 4K7YA 1HKKA 2I9UA 3G1HA 1CGYA 4PMUA 2ZX5A 4JTUA 3AU2A 2Z6JA 1EIBA 3UD6A 4C7DA 5ABHA 1SZGA 5I06A 2GGEA 2PLJA 3BXWA 3HG4A 2J13A 4KWOA 3MYPA 1KV5A 3WIJA 2EJ1A 4MLJA 4US6A 4NNAA 3CJPA 1OGBA 4E8DA 3VOIA 5EFDA 2GSEA 3ARQA 3GRIA 4JFUA 4PN2A 1R87A 1IT7A 2E5DA 2XGIA 5D2YA 3TYDA 4GRSA 1MW1A 1I2NA 1J6OA 3S8HA 3POCA 3R13A 2GWGA 4I5RA 4PB5A 1GZ1A 2WZHA 3DFPA 3URBA 1J0HA 3I7RA 4XAYA 2QIWA 3D47A 4PE8A 4IXXA 1ZCOA 3CZJA 1JIBA 2WQPA 2VVNA 4C1NB 1XSJA 1VJZA 2GGJA 2V5KA 4UQEA 3CLWA 5FL1A 4UFLA 3RG6A 3UR5A 1OCQA 3URQA 3W7MA 1LL6A 3W72A 1EEPA 2BB0A 1ZP4A 4HKPA 4EKJA 1TTIA 2IQDA 2WQDA 2XTKA 1D8WA 4LAOA 3CTTA 4QCFA 5CEWA 1B57A 2PDBA 3PM6A 3A3XA 4FS9A 3PP7A 1S2VA 3QMTA 3TXZA 3SAZA 1W1ZA 4UB9A 4NVTA 3OLGA 4ZSUA 3WH6A 1ZAHA 4I90A 2JGYA 2NQHA 2EPMX 3BCJA 1VLWA 1ISYA 1YHTA 1QTWA 3S0CA 2D22A 4ONVA 2DZVA 4DUOA 4HP5A 1XS2A 2G37A 1MW0A 3W1MA 3AYTA 3TONA 1PTDA 3CHEA 2D0GA 4JXCA 3IAQA 1AG1O 3W7QA 5AHEA 4Q33A 4E4UA 4NZ1A 3WD4A 3G1DA 1TA3A 2VR4A 4RNFA 3W01A 1B4KA 3N34A 4J7RA 3BW3A 1UYQA 4CU7A 1PJ9A 5FF2A 3T0DA 4DI8A 4HMNA 3GVWA 1A5UA 1OFBA 1PXGA 2BVTA 1P6BA 4AD1A 1VH7A 2ZX9A 2X09A 2EHHA 4H9MA 2E1WA 3NQCA 2ZXQA 4G9PA 3PJXA 4I9MA 1M03A 1FXQA 1XH2A 1KFLA 1V3LA 3OBAA 3BG9A 1IXPA 3HM7A 1F3XA 2VGIA 3OZYA 1R38A 1EYWA 1IGSA 5AHFA 2ACRA 5J5DA 3VXGA 8XIMA 4LAUA 1J0IA 4BY3A 3L5LA 3W7EA 1NDYA 4GQRA 3EDJA 2X41A 3WLTA 4MADA 3LLFA 3IIZA 1TMHA 3O0FA 1HJXA 2R14A 1RCXB 3S5OA 1SO5A 3C4UA 5HNNA 3OP2A 3EOUA 1VLIA 1E5NA 1NFBA 4LALA 5AHNA 1EJSC 1VEMA 4HHPA 1IT0A 3ZZ1A 5EFFA 1U1HA 5M3WA 4Z2GA 1FWJC 4MNJA 4JOMA 3VDAA 3QH2A 3LNPA 2DIJA 3MDUA 4QJ1A 2PP0A 3EWUA 4G2DA 1WV2A 4H6RA 2YFNA 1VCVA 2PLMA 7ODCA 3NZGA 2VFFA 4PRRA 4M6QA 1W1IE 3MSGA 2QCNA 2Y62A 3TLLA 1CLXA 4W86A 3RPDA 1XYLA 1WOBA 4AX6A 1RR2A 4EPBC 1SR0A 2ZFAA 1MI3A 6ALDA 4EPEC 1QPOA 3EKGA 2YCJA 5D05A 1XH0A 4JFWA 1EWEA 2PWUA 2PDFA 4QNEA 4EAMA 1PYMA 3S46A 3CAQA 1JPMA 1EEXA 5KZDA 1J9YA 3NQMA 4HJFA 1Q7MA 5CSYA 1JPKA 3RM8A 4UTMA 4CUCA 1I9CB 1TELA 3QZEA 4IWWA 2DQWA 3OLEA 1QI5A 1J5TA 3N11A 4GIAA 5BXTA 1I0BA 3HPAA 5DN1A 3GHSA 2HS6A 4B91A 2Z2BA 4WRHA 1B30A 2V2CA 2ZRWA 1LQ2A 3UWQA 3PUEA 3TN4A 4LAKA 1K8XA 4QM1A 5GJPA 4H9UA 3M43A 3W7PA 4IPIA 1XIHA 1V3MA 4TV6A 3FKKA 1FDZA 2VNCA 1HL8A 3V36A 3O6AA 1MEHA 2NX1A 2C91A 1KXHA 3M0MA 2CPUA 5HR7A 1D9EA 4C5ZA 5LXXA 3NDOA 2C1HA 3ZR6A 2RDTA 3CPRA 4L1XA 1QDSA 1XLCA 3CQHA 3DFHA 1ZBCA 4O53A 1K9EA 1R5YA 4GXMA 2YCIX 4M1RA 3H2AA 3PHAA 3GYEA 4FB7A 1X1NA 4RZ6A 3CV7A 3WBYA 1TWIA 4FF7A 2OU4A 2QULA 1ME8A 4L4LA 3RX3A 3INPA 2GDQA 1CXIA 5D02A 1UUMA 4BQ3A 1IWBA 4ZQOA 1XLKA 1WAUA 4AISA 1R7OA 4TOQA 1KNWA 4IG2A 1VCFA 3PZOA 4YVVA 1K9FA 3C86A 3U2OA 5D33A 4GUIA 3GX9A 2GOUA 4XAPA 1WDWA 1OQFA 1DKWA 3PR2A 1J8VA 4TU1A 1U22A 2REQB 3WQVA 3DFOA 1DXFA 4AH7A 1PYFA 3ZLHA 3C2OA 4LPCA 4YTTA 2O7QA 5MHBA 1NU5A 4W93A 1DWGM 3ZR5A 2ZZ5A 4N2YA 5A95A 4MF4A 4MUZA 1SR9A 2W3ZA 3RF9A 4LNYA 5T9BG 3ZJ6A 2QDHA 4K1WA 1C8YA 4O1AA 3W70A 3D3AA 5B80A 2CXGA 2D2OA 1T8QA 4GY7A 4CNUA 4GPNA 2QMJA 2XIMA 5JIPA 1NARA 3TIMA 2XVKA 4MY1A 4QR6A 3THDA 1WOAA 4ATDA 2R91A 4F79A 1FWDC 4ALDA 3SCNA 1W3LA 1SMAA 2P0OA 3C6CA 3LCGA 4G6CA 5G1TA 1BWLA 1TMQA 1J12A 5D2XA 1U5JA 1JCYA 3THQA 1DE6A 4S38A 1TR9A 3P60A 3VKCA 5LA0A 4DUXA 3T0AA 4Q32A 4YTSA 2QUNA 4TUFA 2V5DA 1BYDA 3LMYA 4NYYA 1GWJA 3QPYA 3T0BA 1PX3A 3VE9A 3KBSA 1IEQA 4G1KA 5ABFA 3CS2A 3QW3A 4HHHA 1EC7A 3BLFA 4EWND 1UR1A 4JNYA 1A3WA 1KFWA 2NV2A 3ZWTA 1F4AA 1WDDA 5I07A 2D23A 1O1ZA 2J7CA 4KGLA 2F6UA 3B0PA 4KWVA 2XPKA 2A2IA 3KM8A 4RDVA 1M3UA 3ZT6A 3AUJA 4MG4A 6REQA 2PDUA 2CZVA 1RQBA 3PBVA 4HGXA 5IXEA 1VKFA 3GKAA 2D0HA 1EBGA 1J0ZA 1CGXA 5D8ZA 1C92A 4AWSA 2CXEA 3LB0A 4IQEA 1YPFA 1EYEA 3BTNA 2P3EA 3BO9A 5ABFB 1KFEA 4FX8A 5CC5A 1M65A 1S2AA 1EIXA 4AZ5A 1ITCA 2QAFA 2XVPA 4XK2A 1KBIA 5LKYA 4QISA 2TRSA 3KP0A 3EOEA 3OBEA 4GJ1A 3T4WA 3AMLA 1P0KA 3STGA 3VD4A 3WQEA 2JEPA 1WKEA 2FZ9A 4NRSA 1TWSA 3APYA 5D37A 3RM4A 2QDDA 1TPWA 3KEHA 1C8VA 3UU0A 4AUBA 1E6XM 4NAEA 3S2LA 1GQIA 1R6WA 2VYOA 3GIPA 5HATA 1W17A 3PB0A 3CHCA 4W84A 1ZHAA 3VNYA 3R0DA 1J0KA 3ES7A 2ATMA 1TV3A 4QDPA 1PKYA 1JCJA 4F48A 3C2FA 3LLDA 1SM9A 2RDXA 3FYPA 2ABBA 3BUVA 1LLOA 1NQKA 5AC7A 3TC3A 4OIFA 3GDMA 4HK7A 1TV7A 2A6LA 1YNYA 3W2UA 3VGHA 2QKFA 1EGVA 3RRXA 1W54A 3UZ5A 2ZWYA 3N19B 1XJBA 2VJXA 4ZB2A 1EKOA 3V35A 1K77A 4AD5A 3W2MA 4GZEA 1XIEA 5H1WA 1F2JA 4UCFA 1FCUA 4DBUA 1RXOB 4GZJA 3FEMA 3TC6A 3LS9A 3G6LA 1RY0A 3SN4A 2W9MA 4K37A 2G95A 4ZVJA 3SCRA 2ZVRA 2PRLA 3PNZA 3APTA 1NAL1 5AFDA 1IZJA 2XH2A 1KTNA 3L21A 2DZAA 4P7OA 3TTEA 3ZSTA 1G9HA 4WVXA 4PTDA 3AROA 2BFGA 3L5MA 1PIGA 1MW3A 3N29A 4N4QA 2A1YA 4WKFA 1B1YA 3WJXA 2OX4A 4IIGA 3C3UA 3AS2A 3PZVA 4NILA 3SFKA 1QI4A 3W1UA 4FOJA 4R5EA 2FDMA 2CZ5A 2Q8XA 3PZNA 2NT0A 3CEPA 4OFCA 3H2OA 5HULA 2EJAA 3WFLA 3MWAA 2WNZA 4Y9PA 1IR2A 1KBJA 4CQBA 2YXXA 4ZO6A 2XJ7A 4HPHA 3XINA 1VIZA 2I17A 2WMIA 5BRBA 2WMIB 1TPH1 3VKJA 4DO4A 4GH3A 3VCRA 2OWXA 5CQ1A 4NG3A 1WBJA 6REQB 2C7FA 3WUEA 1RY8A 5EU9A 3ITCA 3W76A 5C2GA 4LANA 3ANYA 3W27A 3RK8A 1R3YA 3AIEA 3PG9A 3GR8A 1FWTA 1Y5XA 3L66A 4XQ6A 1O6IA 4H01A 4DWSA 3H4XA 3UXDA 1XRVA 1G4PA 1VENA 4M6UA 3MU7A 2IMRA 4DJDA 4ZQRA 4DZ5A 1LWHA 3U8GA 1DJIA 5D8WA 5FF0A 2R9RA 1XBXA 4KIEA 2WVVB 2ZE0A 2E77A 4QP0A 1UQZA 3M0XA 1OT2A 2HPIA 1JPHA 2ACSA 4IMDA 3BMVA 4QX4A 1TREA 2GFTA 3W07A 3WDJA 4TVCA 4QCEA 3REQB 1HT6A 3O06A 3GFZA 3M44A 2QW5A 2E6AA 1EJ7L 3K1GA 4G5DA 4X0NA 8TIMA 1SQ7A 4O4VA 1ZP3A 3JVAA 3S2NA 3DG6A 4QJ5B 1BVNP 3SUTA 2Q6ZA 2BX7A 4U31A 1GOWA 2UY4A 4W85A 4PEEA 3I6RA 4B4FA 2EEXA 1VBHA 4ERIA 3SI9A 5EKYA 4AIUA 4IL2A 4CQ9A 3AFBA 4R9OA 2EKGA 3MI6A 5EGRA 3LYEA 1BSIA 4M0XA 3I3BA 4HHLA 2V6AA 4BF5A 3KZPA 3GIYA 3W1NA 1LT7A 1CGTA 3W7LA 3M46A 2G0WA 2FIQA 1DWAM 4RCXA 1CXHA 1GKRA 3NOEA 3V7PA 3HQNA 3T8LA 1KCXA 3FS2A 2ON3A 1HKMA 1SZFA 3NQ2A 1ZBVA 3ZWSA 1M7JA 3S6TA 5CSUA 3GUGA 1F9CA 1P4CA 1E4MM 1OG0A 1HGYA 2X2GA 1ZS2A 3VOCA 2V38A 3U2EA 3OIXA 5XINA 1EUNA 2W79A 2ZWZA 3JR2A 4U2ZA 3FA5A 5J5RA 5CPMA 3OGVA 3NYZA 1EA9C 4YJ5A 1T96A 2PA6A 1OYAA 4UZUA 2ZC8A 3DKLA 4W87A 2PRMA 2E40A 4FK9A 2HZGA 3S5NA 3A6OA 5FJPA 1UWIA 3DGBA 4UQDA 5LGXA 1K9TA 1CLVA 1YDVA 3CHVA 1ONWA 4WSJA 1E5JA 1YXCA 1UZ4A 2NWRA 2O55A 3C3NA 4WJEA 1Q65A 5HR6A 1QCWA 1H1NA 1H0IA 1DWFM 1JI1A 1EUAA 1YPIA 4GYKA 1DBTA 1WQ5A 3UG4A 1JDDA 3R43A 2Z0IA 4H19A 4WD0A 3BK0A 4Q4SA 2BY0A 3TQVA 3O6CA 3U5UA 3SDOA 4F9DA 3BV4A 3FLUA 3QSTA 2ISFA 6XIMA 4IP7A 3EEGA 4V33A 4HN8A 2GVJA 4ERGA 2G3NA 5CBJA 2L5HA 5T26A 1Z7AA 3GHUA 2PDPA 4ZQPA 3TQPA 3SURA 1QRQA 2FZ8A 1BGAA 1LWIA 2WCSA 3BJFA 3RU6A 1U5VA 2DSKA 3RJYA 2WXDM 1R8LA 1S39A 2WM1A 2ZZ1A 3BLOA 2C14A 1KCZA 4O1DA 2VOMA 3NO1A 4US5D 3GD6A 3SCVA 4HCLA 3DHFA 5J8LA 4D1JA 2HJPA 2IXUA 3LHWA 3WLRA 1JUBA 1H5YA 1CB2A 1RBOB 3HOJA 3W2KA 3N25A 4ZOBA 4JTSA 4YS1A 2VKZG 4AF0B 1X6NA 3P0XA 4KCWA 3V0SA 5HJLA 2QYGA 4E4FA 4XTDA 4F0MA 3U4FA 5F4SA 1UWAA 2FHFA 3B06A 2FZDA 4LCQA 1JDEA 4CNTA 4X63A 2WSYA 4HYVA 3A4AA 5I24A 3A47A 3URNA 1DIOA 2VQUA 3MTWA 3AIBA 4GH1A 3W22A 2P76A 3SGGA 5ABGA 5I03A 1KXVA 2OYMA 4E6MA 3GH5A 5HQMA 1DTUA 3R89A 5BCAA 4I3GA 2NV9A 3QQWA 3TSBA 4IIEA 3RPMA 5AC5A 3P5ZA 3UEQA 3VNJA 2HXTA 2WKJA 3KAOA 1FY6A 3PZGA 4U10A 5IFTA 1C7SA 4B4HA 2HCVA 4EXBA 1O5QA 1VEOA 3GTFA 3DDMA 4DIAA 3KLLA 4UFHA 4Y9AA 2PBGA 5A6TC 3STCA 2V63A 3E74A 3CL6A 5BU9A 2VZTA 5CG7A 5M03A 3BPWA 4M1BA 5HDRA 3WEOA 3GTHA 2VX4A 1KTBA 1VD6A 1OZQA 4GUFA 3SFWA 4KKXA 2F84A 2GQ3A 4OV4A 4F2BA 4Z2JA 3E9AA 3VMOA 1W3TA 3R10A 3K4WA 4Q6JA 3DU0A 4NX5A 3T07A 1XSIA 1HP5A 1PKNA 1IXOA 3BANA 3AMKA 3ZT5A 2WJFA 5DFAA 4O14A 1W3JA 4H3DA 4HSHA 4ORMA 5AECA 5A6AA 2CBIA 4UTWA 5A3HA 1H7OA 1U1UA 2CWNA 1PX4A 3TVAA 3CNYA 3ARRA 4M7SA 2FH6A 2XGBA 3W87A 3AHVA 1TWZA 2DZPA 3CQJA 4HPXA 3RILA 3W73A 1C29A 4MWAA 3MUXA 3KLKA 3SCQA 4H1ZA 3CGTA 3HU7A 4XZIA 3GDLA 2WMKA 2QPSA 4O18A 1S5TA 3B04A 2OZ3A 4FNSA 4NF7A 4P7QA 2DPEA 4IL0A 5A2CA 1BQGA 2WC7A 4GMEA 3AOFA 3TUUA 2ZBTA 5EA9A 1TJ2A 5CGQA 1SPQA 1W8GA 4HU8A 4JFVA 1ECQA 3W1TA 3CYVA 3TROA 4LVGA 2VFIA 3ZYZA 2DVUA 1D8CA 3A5FA 1EFZA 4IPNB 3FFSA 3VIOA 3W38A 3WQ6A 3P74A 3ONCA 2D24A 1ZBWA 1ZNNA 3H7RA 1NF0A 2A7NA 3S1GA 4LQ1A 4B3LA 2CEQA 3W7JA 3U7BA 1XLAA 2I1OA 5HUOA 4K8EA 3IWPA 4X9YA 4D2JA 4R88A 2OR2A 1F6PA 4PMNA 4FALA 4KWWA 1HJQA 2HISA 5D9PA 1SO3A 4LBSA 2HSAA 1GHSA 4DO6A 1E40A 3M0YA 1TZ9A 8RUCA 1XFCA 1QOXA 1F8IA 1V08A 3DG7A 1R85A 5AY7A 1MQPA 3Q37A 1J18A 4JTTA 1XD0A 1JJKA 1FDJA 1FUYA 4KGJA 6PTDA 1LG2A 4O17A 3GU9A 3EA1A 5KMYA 2PDLA 3C0SA 3LI0A 5K9XA 3MWCA 1Q5MA 3P67A 5CZ0A 1EOMA 2GOKA 4NP7A 1P43A 2ASHA 1BYBA 1M5WA 3P14A 4ML9A 1CTNA 3Q45A 4N7QA 4Q8VA 4HMEA 3VGFA 3OG3A 3LBMA 4LW7A 4AYGA 2GUUA 2XIJA 1KFCA 2DZBA 3H26A 3RLHA 4M6VA 1A80A 2R1PA 1ZL1A 3N04A 2G3MA 1F3EA 3PPGA 1VBGA 3TSDA 4AW7A 1BD0A 5T8GA 4A2SA 5F4WA 1XLGA 4OGZA 3G8RA 1SMDA 1DPMA 1WUEA 2QCCA 3F2CA 1KM3A 4A29A 4RNHA 1JAEA 4RJEA 3AIWA 2PF0A 3UPBA 1O60A 2Z6IA 1S38A 5CJMA 4MZ1A 4GUGA 2DSWA 2EG6A 3EB3A 3WDPP 3PZUA 3DZ1A 2EPHA 1QHOA 1GVOA 5FAJA 4Q8WA 4HTYA 2XVLA 2OLAA 4RZ4A 5EMLA 4QJ3B 3TU9A 3QGVA 5HANA 4J3UA 4HMDA 3AYSA 5BU6A 1CX9A 3TJ4A 1N8FA 2E9MA 1YW1A 2Z25A 5FI8A 2PDXA 2C8NA 4HNVA 3W7RA 2ZC1A 4ZQMA 4GCXA 1W9UA 1Q6QA 3H2NA 3LRLA 1JFXA 2OEJA 1JZ5A 4W5ZA 1QO5A 3PTKA 3PFRA 5G2IA 4YPJA 4Z42C 4HNNA 4Z2HA 4IMEA 4UTUA 9XIAA 3UWEA 4C7GA 1RBAA 2WAGA 3E0WA 2DIKA 3OA3A 5CGMA 1POKA 3KBNA 4JY9A 3GW0A 1VFSA 1XGEA 3S1VA 2HEJA 1WDSA 3OJGA 4PUDA 1JCLA 2VWTA 4FPSA 1EJTC 4IGHA 2XISA 4DUWA 3UZXA 2Y5EA 2D20A 1KBKA 3XISA 4EXQA 4RNIA 2WPGA 1JXKA 3N14A 2H90A 2IPFA 4LEFA 1BKHA 1NDZA 2YZ5A 5F2MA 1KWKA 1VPXA 1AW1A 1QI2A 4NU7A 1MRAA 4XO6A 3IGUA 4QSFA 3R0KA 2GYIA 3N2MA 2XU2A 3MMTA 1UHVA 4X60A 3LD5A 4O54A 2J74A 1W3NA 2ZRZA 2PDHA 4MPQA 4CVWA 1S5WA 3UXAA 1QVBA 4S23A 4PCFA 6CGTA 4WJ8A 1C90A 2REQA 4P7NA 3B9OA 4TV5A 1IZKA 3DHPA 3PJTA 3VDGA 3S5SA 4CNNA 1XBZA 5KZMA 4AFYA 1XP3A 2F6KA 3WELA 5BRQA 1GQJA 3R5EA 3TYEA 4MB3A 3TYBA 3R94A 4DZIA 3DENA 3NXFA 1GJWA 2ISWA 2ZZ6A 4PBGA 3T2QA 1MEIA 2Y63A 2JKPA 1HW6A 1MXSA 4PSRA 2MANA 2PDIA 3ITXA 4UBPC 5C9ZA 4UTHA 3G1VA 3BQ5A 4Q4QA 1ELSA 1CEOA 3NGFA 4JTKA 2FB3A 5CZKA 3W23A 3VKKA 3TWBA 2PC8A 3L4WA 4D6CA 2XG9A 2E67A 4JICA 4NZ5A 3BH4A 3LK6A 3GC2A 2OLSA 4LOCA 5IFPA 5DO8A 2DJLA 4NNBA 1QOQA 2JF6A 4WX2A 3WENA 4XZ9A 2CESA 3DFTA 4GVIA 2WVUA 4R7OA 3KWXA 3WLIA 5A6KA 1JPIA 1JRCA 3AISA 4EACA 3CMJA 3ABXA 4XX6A 1AH4A 4K8HA 2HRWA 1FH7A 4L9XA 4WIWA 1OFRA 3VVGA 1E72M 3AS0A 3RHGA 5GJMA 1V51A 4NZFA 3W7DA 1OCJA 1XG3A 4QQ3A 1WDQA 5DEZA 4GYPC 3C61A 3A3HA 1X8FA 1J5SA 2JIEA 3G22A 1FDYA 1QR7A 2P3ZA 3R6IA 4B5TA 3FJ4A 1MNZA 1QNQA 2R82A 1QHPA 4I6VA 5T91A 3F7JA 4TR9A 1R3QA 3TYAA 4MJ4A 4KCUA 1R2SA 4ZSTA 2PGEA 1NWTA 3A13A 3L0KA 1BF2A 4FAMA 1JGIA 3WCZA 1VYSX 1GQKA 3N6JA 3WNOA 3CK5A 4FIRA 1EBHA 3SN0A 2XFWA 3R2GA 4ZB5A 5GJNA 3VKBA 4ACZB 2CLHA 3GNNA 1TQXA 1XX1A 3PJWA 2HS8A 4JGDA 3TC7A 5A6MA 1BVZA 5HNRA 4WSKA 1YTDA 3WQWA 3GFXA 1XCXA 2DSUA 5G4HC 4X2PA 1G5AA 3NVDA 3QOMA 4DY1A 5A8MA 4L1GA 3WLSA 2EGZA 1SJCA 5GQBA 5DCDA 4CCEA 3EKZA 3GU1A 1A0CA 3J7HA 3QOKA 3TNBA 1H1YA 4LUSB 1M01A 2IPJA 4E8CA 2VR2A 3WMBA 1MFVA 1HUVA 4RX0A 1EH9A 2QJHA 3B9EA 3OHMB 1LOQA 1FWGC 1IYXA 4IJBA 1TUFA 1K8YA 1F3TA 1KM6A 1G7UA 3EDDA 3SQSA 3WH9A 4MWAD 3W2NA 1UWTA 1PSCA 3CWOX 1TV5A 4TX9A 2CYGA 1DVJA 3WJWA 3TYCA 4UXDA 1WYIA 4PMRA 3SR7A 4F2TA 3UJ2A 3HF3A 3P84A 3AIVA 1DV7A 5CPQA 3RUBL 3ZR4A 3QR0A 4ADTA 1XRFA 1TPC1 3RO8A 1XC4A 3EYPA 1KFJA 2BY2A 3EXSA 2JBMA 3BJTA 3QPEA 1HJWA 2A3AA 4XWUA 3VMPA 1BRLA 4Y8EA 1ONRA 4Q8QA 4P8WA 1XCWA 1KXQA 4OTKA 2EQDA 1KKOA 4PMYA 3GWQA 7PTDA 1GGOA 2A6NA 2Y4SA 4Q8TA 1QO2A 4LUTA 3VE7A 5XIAA 4BI7A 2PD5A 1S5VA 2D69A 3S4TA 1K03A 4UTIA 3CUGA 2QGHA 2Y88A 4JX5A 3DBPA 3ECQA 4UOQA 4IP4A 1EDQA 1M04A 1UWRA 2XM1A 1SZNA 5CJ5A 2RJHA 2W27A 3NWRA 4NL1A 2OGYA 4IJRA 3WF0A 4O8AA 3MCNA 2A3LA 1L2UA 2WSQA 1EQCA 5AHLA 1LUCB 3MMUA 1L0PA 1UKTA 2Z00A 3LPGA 2OGJA 3E3HA 4EOUA 4QXIA 3MP5A 3NPUA 5I3FA 4U3AA 2A3CA 1QW8A 1RHCA 2GLKA 4HU3A 1SW7A 3MCMA 3OBKA 5FACA 8CGTA 2Y61A 2OYLA 3WBXA 1W37A 4EE9A 1WE5A 3WZ0E 4DAIA 2HBXA 2HE5A 4Y9OA 3LBCA 2QVHA 3M64A 3SRKA 1RZMA 3TTQA 1LZOA 1V0LA 2DP3A 5GNXA 2VRQA 4KPLA 3BSGA 2R94A 4JTLA 3GG7A 3Q58A 1K4GA 4J40A 1FWFC 3WD3A 4MZYA 5CBBA 2QUTA 2DT1A 2VI0A 3FHQA 3SUWA 3W4RA 2VGBA 4U5IA 3WY1A 1P7TB 1NVMA 1EJWC 5DQPA 3OVQA 1SFSA 3N15A 1J93A 4RKAA 3RU8X 3Q94A 1OX4A 1SFJA 4U4MA 3NSNA 2X0HA 3O2LA 1HQTA 2BXVA 2XSAA 1PCWA 3B0XA 4ZENA 1QJWA 4EANA 3L9CA 1LCOA 1TE1A 1JPDX 3EOSA 3BW4A 1TX2A 3ZXWA 1BYCA 4QE4A 2IUZA 4O1CA 2CBVA 1TJPA 1NEYA 1EA0A 4C6LA 2Z1XA 5G4WA 3L67A 4Z2LA 3DERA 2V3FA 4FNTA 3VUSA 4AZCA 4ZO9A 4IMCA 1BSLA 3ANVA 2BBFA 3WNLA 1QPQA 1QWGA 4JTCA 2VL4A 1FRBA 1PAMA 4JYDA 4LWWA 3RFAA 3V4BA 1XG4A 1SSDA 1UPMB 3QXBA 3FJLA 1TCMA 3LXBA 3W88A 1YLVA 3BW2A 5BRPA 2RAGA 3MSDA 1TRDA 1B3VA 5AB3A 1XGDA 1A50A 4K38A 4UNKA 2V30A 6TIMA 4MDPA 3KX6A 1XPGA 4GVHA 5GNZA 1B3ZA 4YHGA 4LJ3A 1TSIA 3SRDA 4BEQA 3MZNA 5BWFA 2C3ZA 1FQ0A 5CAKA 4C7FA 4ZGYA 1ADDA 4KIRA 1CLKA 1X7IA 2XFRA 1B9ZA 2PGWA 3N12A 3STFA 3LTYA 1JCXA 1US2A 2P1FA 1OCBA 3JS3A 4ZO8A 3NNTA 2V2DA 3AS1A 3H22A 1SW0A 1AQFA 3ITYA 2F61A 1UR0A 4J3XA 5D32A 2W62A 3MKKA 3TTOA 3P80A 3O07A 1Z42A 4DVOA 4PMJA 2QDGA 3AWOA 2PP1A 2CHOA 2V5BA 1I75A 3V5CA 3L4VA 4HT3A 1W3IA 3GXDA 3HPFA 4FOKA 1R46A 4JIEA 1PWMA 2X7VA 3EPNA 1TV4A 1TWDA 4Z2KA 2FB2A 1X98A 5A1AA 2ZXDA 3VU2A 5I77A 3R4IA 2OO6A 2WWDA 2VWSA 2JIWA 2OYKA 1YMYA 4JYEA 4O0QA 3LQLA 3FYYA 4AEFA 3STEA 3SEPA 5A6LA 3CWHA 2OKTA 3B97A 2R1NA 4CVUA 1GVIA 1JR1A 4UOZA 1NWSA 1Z69A 4P8VA 3W6MA 2FZBA 2WSPA 4RE4A 3M0LA 1XYBA 4J3TA 3TJIA 5I23A 3T42A 2ISDA 1M9HA 2TSYA 1N8WA 4QLJA 2PMQA 2I9EA 3VDHA 1JYNA 1FXPA 2QIIA 3K13A 4MWAB 4AU0A 3NG3A 1N82A 3A3WA 2OKOA 5CLWA 2J9YA 5DX7A 5DT7A 1UWSA 2J7EA 3UXLA 3G1AA 3OB8A 3W74A 3L4XA 4GZ7A 3N6QA 4MSSA 4LEQA 1C9WA 2V67A 4HA4A 3CQ0A 3VD9A 5HAOA 1TPB1 1EF3A 3A12A 4NY2A 4K3ZA 1SYTA 3G8EA 2QCLA 3IJLA 3WLLA 1E6ZA 4P61A 4YLWA 3VNZA 1JVNA 2VEIA 2YCKX 3ARVA 1MW2A 2O0TA 2VCAA 2YA0A 3G0SA 2Z1VA 3ZS4A 1DWHM 3WN6A 3VGBA 2VFHA 1RK6A 1W56A 2YW3A 2QCHA 3DI0A 2J75A 3C2VA 1PZ3A 2QJGA 3LQGA 5G4EA 2W0UA 4GABA 1B90A 5JVLA 4NT0A 1HL9A 5AHIA 4JN8A 4Y6GA 3WK3A 1RJPA 1YBQA 1XINA 3G77A 4PULA 2WSRA 4AVOA 3PNUA 2NW0A 3CL8A 2D0FA 3E2QA 2JKAA 5ENLA 3CTLA 3CXOA 2OVLA 4UR8A 3TX9A 1EX1A 3ITGA 2W61A 4QGCA 4MOZA 2DY3A 4DJFD 3K5XA 3JZEA 1Q6RA 1F8MA 1FP9A 2G3IA 4KEVA 3WQ4A 5LGZA 3KFTA 2WBKA 2PTZA 1US3A 2IKGA 3T55A 4B2DD 7REQA 3LHTA 4GJIA 4M80A 2VM8A 3O9NA 4M29A 2QAPA 3FA4A 2YLAA 3EGJA 3TXVA 1ZU8A 3UBPC 1OZMA 1W1A1 2BXZA 3W2LA 3E96A 3NPWA 4IPJA 3CU2A 4DWSD 3VUPA 1UJQA 1KXTA 3MI3A 1OINA 3T7VA 1OC6A 3BMXA 4XUGA 3FGCB 2OB3A 1AQHA 2Y6ZA 1VHCA 4Z0SA 4H7ZA 2XIBA 2NZLA 1XUUA 3GVRA 5I09A 1XV8A 3ZM8A 1EC9A 3E38A 4WOZA 3N17A 1C8QA 3T78A 2XWEA 2GVGA 4IGNA 3L5AA 1GQLA 1UR9A 4F2UA 3QR1A 2XHYA 4A3RA 2V68A 3NEVA 1KRBC 4MAZA 5J04A 5JMUA 5LIXX 4V28A 3WK0A 3DFQA 3SQLA 3W2JA 1U2YA 1BPLB 3KVJA 4O15A 4WUIA 5I5RA 1SJDA 3LLXA 1TG7A 3EB4A 1GCYA 3VD3A 3NQ8A 1E9LA 3WQPA 4QBXA 4UNLA 5ABEA 2CLOA 4R53A 3ARPA 3KTXA 1GT8A 4BA0A 4NJKA 1P48A 4L4MA 3R8HA 2P8CA 1N2VA 3TCEA 1TVPA 3NSXA 4NQ1A 3WX7A 2I7GA 2ZX7A 1FP8A 1HX0A 3KRBA 4HCDA 1W1YA 1V3HA 4CCDA 3EOOA 2ALRA 3VOJA 1ZJIA 4HB7A 4UWMA 2HE8A 3FN9A 4ICMA 3GH4A 4HZ7A 5BZAA 2Q8LA 4WDWA 4IM4A 3UWUA 1MYRA 1OFOA 1XR2A 2QCDB 1A5LC 5DCEA 3AHYA 1UD2A 3FK4A 3LM7A 1OEPA 3QHNA 1FTXA 1HN1A 5CAHA 4ENLA 3VC5A 5BXRA 5JBEA 1V5XA 5GNYA 2X7WA 3GTXA 5AOUA 3UA4A 2HVOA 3UXKA 4V27A 3ZVIA 3WQDA 3RR4A 4M19A 2I5GA 4PCNA 4W9TA 2WCGA 3WUBA 2FVLA 3CT2A 4G7EA 4UR7A 3QSRA 3WDRA 2XZ7A 4N9BA 4S1FA 2A7RA 5EMYA 3AHZA 4K6AA 1J01A 3QJAA 1I6NA 1R30A 1D3HA 2QJMA 2HK1A 1D3CA 3EX2A 4HYRA 2QGYA 1H51A 3KHJA 4QNWA 4K36A 3EWCA 4RE3A 1EL3A 2J6XA 3ERPA 4LB3A 1GVQA 4ZOAA 3RXZA 1SZRA 1AMKA 2ZA3A 5EYWA 3UQNA 2OSYA 4FXRA 5C70A 5RUBA 4OV9A 2I57A 2WV8A 2WSKA 4CN6A 2DH3A 3R79A 1E55A 1R3RA 1LOSA 2P88A 3DOPA 3TSMA 2E5BA 4MB5A 2BTMA 2PDWA 4AD2A 1ZQ5A 1FH8A 4NKCA 3WQOA 2WKLA 2ZUSA 5HMDA 1HXJA 1U1JA 1W91A 2E4TA 1IGWA 4ATWA 3TLQA 4BI5A 4ZE5A 5K7JA 4PL1A 1JI2A 1V0MA 2PI6A 1R7AA 3KDNA 4Q8NA 3AZSA 3UR7A 2DV0A 2YYUA 3BZGA 2BG5A 3TWAA 2WNQA 3M4HA 2DT2A 4KS0A 3CMGA 4M56A 2GJNA 1X7FA 2AKMA 2QJIA 2YBUA 3GU2A 5LSMA 2RGMA 3WMCA 3VDBA 4OJYA 2ADAA 2CZFA 4TX6A 1A5OC 3UETA 4KEMA 5D4YA 5KZEA 4ILSA 1OD0A 3EZ4A 2OCZA 5G2WA 5KINA 2PODA 5FL0A 1CECA 3HFYA 4WHBA 4TTGA 1EPVA 1PHQA 4CEUC 1V02E 3SY5A 4TQTA 3M47A 3FXGA 4C6CA 4O16A 4GZIA 1PKMA 3QFWA 3O16A 4BF7A 2GVEA 1W9PA 5K3VA 3OA5A 2BDQA 2JE8A 4I5XA 5K9CA 4L6OA 3TOPA 2QZRA 1WZAA 3OPSA 4JNMA 1KCKA 3ALFA 1S2TA 3ORWA 1YPXA 2E7FA 1PZ0A 4E2OA 3S2CA 3WH8A 3FVDA 3GKFA 3S6OA 4YU1A 3TW9A 1XIJA 2P53A 4J3VA 3SO7A 1SW3A 1UUQA 4PMDA 4OECA 4B9ZA 4GLEA 1ZSXA 5FIPA 3R8RA 3E0FA 4UTKA 4JHZA 3UR8A 4AZ6A 4DZAA 4JIRA 3BGJA 1XGZA 1OK4A 2VVSA 3CUHA 4ERAA 2Z1WA 4GBDA 2R1LA 1PO9A 3P5YA 4RXGA 4ML4A 1KQYA 5F2IA 2EF9A 1SFLA 1EP1A 3CYJA 3IIVA 1UP3A 1LM1A 3UNTA 2Z24A 5A8NA 4HPJA 3S47A 1MUWA 4HK6A 1W1TA 4O1BA 3EAUA 1J0YA 1G4SA 1OF8A 2PDJA 5HA7A 4G7EB 1US0A 3LCLA 2WMHA 1WXYA 2OWWA 4JTDA 3IJ8A 3O3RA 2ZZ2A 1VYRA 2O56A 3HG3A 3F2BA 2CLKA 1A5BA 5HWJA 3NL2A 2Y8KA 1F74A 3IGXA 3PAOA 4MMWA 5HOSA 1N7KA 3EWZA 3B03A 4Z1AA 1GG1A 4Z1DA 4XUYA 4O1FA 3NQFA 1KBLA 3H24A 5CPTA 2F2KA 1BXNA 3BOFA 3SUVA 4L7ZA 1TJRA 3L2IA 4HD5A 4DELA 1M53A 1A3HA 4JDBA 3DC8A 3B0VC 4HNLA 1XD1A 3MQTA 3WJSA 2W92A 3BQ6A 3RDKA 4WY0B 1PL9A 2ZUVA 4QAIA 3LCHA 1A49A 1ZJAA 3FDGA 3U0HA 5EMKA 3W28A 1UOKA 4AEOA 1OABA 2OQHA 2A7PA 3VIIA 3C0QA 3PG8A 3R7MA 1BHGA 7TIMA 1BQCA 1R0MA 1LBLA 4AD0A 4PYSA 4ASTA 2PDGA 1AH0A 3GHRA 3UGRA 4IICA 5KEZA 5REQB 1XYAA 4DJDD 4AQLA 2XM2A 4H7VA 2VOTA 3TMQA 1A5CA 5D03A 3CV6A 3PZQA 3T2OA 1L6GA 1XF0A 3WLQA 3KE0A 2X16A 4H9TA 1KR1A 3R12A 2PGFA 2O4MA 3NQGA 2BVDA 3SCPA 4JS3A 1IEWA 1DEDA 1K3UA 1O5RA 4LCRA 1UH4A 3NDYA 4FOUA 3UWZA 3GNRA 1JYVA 1LF1A 2QXWA 1C91A 3GM8A 1FBAA 3SY8A 2WZMA 3STPA 1NDWA 3EOLA 1WPCA 2VEGA 4FNRA 1QI3A 4TMBA 1YNQA 3MO7A 5AN7A 2VXNA 3P7YA 4DAFA 1F73A 2HQAA 2X0SA 2DSVA 4JQAA 3IV3A 3N73A 2ESCA 4HTBA 3C8FA 4XBSA 5SWUA 1WBHA 1D2KA 3AAMA 2P5NA 1YBQB 3K1DA 4I8DA 4WKHA 3DECA 4AZIA 4L65A 1NIUA 4M51A 4GUJA 2CWXA 2QLYA 2Z2AA 1IE7C 4IMGA 5HMFA 1ZUAX 4H2CA 1W8SA 1GG0A 2BGNE 1LDCA 1LJYA 4IPPA 3GNPA 4O28A 3UCDA 1XISA 3FSTA 4C6DA 2B4GA 3OLIA 1SZEA 5HUPA 3EWXA 2WBGA 1NY1A 1OBAA 3IRSA 1AK5A 5ECVA 2PU1A 3WNPA 3UG5A 1Q4WA 1E3ZA 3KRSA 5I7GA 2AKZA 1H1ZA 3HA1A 1FX6A 3M6DA 2RFGA 2IPGA 4QLLA 2NQLA 4H83A 3AMCA 3SM0A 4PMXA 3FJ6A 2B7OA 1TB3A 5D9OA 2QT3A 1MXDA 3SBFA 5CG0A 2UZ9A 4XV0A 5LIKX 5KZ6A 3W7IA 1TMLA 2V82A 3FCPA 4JIPA 3FA3A 4IG2B 3FHAA 4MFEA 2VGGA 2NVCA 4UQAA 1A5AA 3ABZA 1QNPA 5HPOA 2GDVA 4HNOA 4YCPA 1CGUA 3JRKA 3LTPA 4DYJA 5D2TA 3EX3A 4A8IA 1QHZA 4LSBA 1P6WA 4RDZA 4IIFA 2PF8A 1GEHA 3EDKA 4PODA 4BCEA 4KF1A 3N2XA 2GSJA 1XIIA 4IT1A 4CN1A 1FCBA 3O8AA 4QS5A 4P7RA 2XH7A 1ISZA 4ADUA 1H7NA 1UP0A 2H3BA 5EMUA 3SIMA 4PTNA 1RK5A 1Q6FA 3GY1A 4PUNA 2BHZA 3R58A 2A0NA 5D04C 4NZCA 3U48A 2GJLA 3T0TA 3L4UA 1I0DA 4I9TA 3W29A 4IISA 4L64A 4ACZA 5CSSA 4YYFA 3GC5A 3EB2A 1DQWA 1YE6A 4GOAA 5I3JA 4DPPA 4BI6A 3H2CA 4UTFA 4HHMA 4QE5A 4GX9A 4WOQA 3M0JA 1Q6GA 3MUY1 3CZLA 4GXPA 4E4PA 2O4QA 1R3TA 4LCSA 4XTIA 2EO7A 5EMMA 1B3YA 1YQ2A 5FEPA 2CNCA 4GFSA 1YNPA 5JXQA 1XICA 4NJGA 5AVHA 4PB3A 3MUCA 5FESA 3LRKA 1V6YA 4LBRA 3EA2A 3NCOA 2ZUMA 3L68A 4JNZA 5G2HA 2VEFA 1IQ8A 2I5QA 3KCJA 1RD5A 1V03A 2FGZA 4GD0A 3A9BA 2VX7A 1L6YA 5FJTA 3QY6A 4EPDC 1K4HA 1H49A 1REQB 2X0YA 4J27A 3LCIA 4L6HA 4Y8FA 4ZXLA 3BJSA 5CSRA 4OOZA 3CL7A 4S2CA 3MCOA 4MKNA 1ADSA 3ZSSA 2DGAA 3IIXA 4JTEA 3M0KA 4PZVA 3I6TA 1WA3A 4O11A 4HNCA 1JUKA 5CGTA 4GA8A 2WNWA 5A2AA 4GK8A 3CZEA 3K2GA 3WFAA 1XLMA 4BQ4A 1Q7QA 4OT7A 2OO0A 1TWWA 4RLIA 4XISA 4A4AA 2XZ9A 2EXOA 5FKYA 1RVGA 3P3BA 1U5HA 4RE2A 3WQFA 4YNGA 4A3HA 3E6EA 2HVNA 4JAWA 3P61A 4HA3A 1NOFA 2WC4A 4PUEA 4PUUA 1TZZA 1T99A 3ZOAA 1D3GA 3HBLA 3PS7A 3EWBX 2DH2A 3QV9A 7REQB 2AMXA 1GUVA 3VNMA 4A2RA 1F07A 4F0HA 2V3DA 2FFCA 3GAKA 5DBUA 4RDWA 5A8OA 1W1VA 4DBSA 2BWGA 2CCRA 4DNHA 3WQCA 1YKWA 3HQOA 2A21A 1RP8A 1OJXA 3WG6A 4MNMA 3OVRA 2Q71A 4GVGA 2YPIA 3C0LA 3KVKA 2R8WA 3P6LA 3EMCA 3KTCA 1HVQA 4GQBA 3UESA 4UQBA 2YB4A 3CC1A 3OIHA 3RJXA 2ZA2A 3M5VA 2ZX6A 4EPKA 4MDOA 3UZJA 1G67A 1Y8BA 2BOGX 3KRZA 1E0XA 2VEKA 1JULA 1VEPA 1UJPA 4JQ4A 2B0MA 3H7UA 5CPSA 1R9YA 5EY5A 3W7OA 2PE4A 1H11A 4MHBA 2XIIA 4S3EA 1PDYA 3I4EA 1PIFA 8XIAA 2Q3RA 5CPLA 2ZE3A 4CD7A 4ZEPA 3GXFA 2WW5A 1QMLA 1SGJA 3CUZA 1FWBC 3CZKA 2VELA 2ZRVA 1R2RA 1JZ2A 2FTYA 4Z2IA 4QFUA 4FX6M 4FP1A 2OSXA 1G94A 3S2JA 5A6SA 2WHJA 4KRTA 4P2VA 1PBGA 5I3IA 4PH6A 1JF5A 2ZUWA 2ZVIA 2VRKA 2D73A 4YWSA 3KBWA 2B7NA 1HKWA 3EMZA 3RAOA 2ZYFA 3LY0A 3IJ6A 5H8MA 7ENLA 3C2RA 2CLPA 3T44A 4HOZA 4PMVA 1KV8A 1Q66A 1C8XA 3E0LA 1IWAA 5LNUA 3WEMA 1VBRA 5HK4A 2JGQA 1EPXA 1H50A 5FSDC 3BOLA 2FZMA 1GVYA 4X3ZA 4I9JA 1BYAA 3IK4A 5M1TA 5CZSA 1XC6A 2A3HA 3II1A 4WJXA 3G1FA 3WH5A 3P8JA 2XGZA 4LUIA 3O05A 3V0UA 1DJNA 4NAEB 3ARSA 4S3DA 1DQUA 3B3DA 2VFDA 5MKGB 4Q4MA 3UW6A 2E68A 5DLCA 5LZLA 5B7ZA 4RV3A 7A3HA 1Q6EA 1FHVA 3GE7A 2ZUUA 2NX9A 3ABOA 4G7FA 3WF4A 4GYPA 4EIVA 1K8CA 3N9RA 1X39A 2RKXA 1VRXA 4IMAA 1LBMA 2XIOA 3UWWA 3PTMA 3CO8A 2OZ8A 2J47A 1I2OA 1P0DA 2PTWA 3LZ3A 4ZB0A 4GI9A 2DU2A 4DBWA 4LTSA 3IACA 1MZRA 1KD0A 2FDSA 1OY0A 1GYMA 3WLOA 2KZHA 1Q6OA 1A53A 1OFPA 1AD1A 3QVQA 2Y1HA 4AZ7A 1AODA 3EXTA 2QJNA 3S1WA 2H8ZA 2WWCA 4A22A 1DJHA 5D2VA 1Q3NA 2NSXA 1MEWA 1QW7A 3OYZA 4B5WA 3QMRA 3NGJA 3LMZA 3CUFA 1T5AA 2VC6A 3PZTA 1UWUA 3GG0A 2DEPA 2BP1A 3UY8A 3C5QA 3S9IA 1UD5A 4ICCX 4KQNA 4POCA 4A05A 1ADOA 1EQPA 2V0TA 3ANUA 3KS6A 2H3DA 3MBFA 1PS9A 3DHDA 4HPGA 4AMAA 1RUSA 1BGGA 3BGAA 4XBJA 2YR1A 4LRTA 1EJUC 1RJQA 4J1OA 4EF8A 1OADA 4N42A 5F1VA 3QV6A 1XIDA 4LRSA 5AHMA 2YA1A 2ZUTA 2DIEA 4REQB 3K8LA 4AIBA 3TMLA 2YW4A 3CUIA 1LLWA 3ZJ8A 4Q4RA 1G69A 3WYZA 3RMEA 5I3HA 3AJ7A 2JKEA 3WDHA 1DIEA 4NXKA 3KHDA 4C6IA 3PFMA 3RCYA 5A6BA 4HZ8A 1R3VA 3C2YA 5HJXA 2HTMA 1X1OA 4FEZA 3TFCA 1FOBA 1U83A 1M7OA 2RDUA 4Q3MA 3KXQA 1VYPX 4N6EA 3GDBA 1YIXA 3ES8A 4AIOA 1B5TA 1W0MA 2QQ6A 1KFBA 4FNUA 4NRRA 3WL1A 3W71A 2V69A 3GXIA 1Y7VA 4C6FA 1C7TA 3BURA 1GJUA 4B3ZA 2WHLA 2PDYA 3VIMA 3NFUA 5E93A 2VUYA 4MJ2A 4YN5A 1V4YA 2RGLA 1IZCA 4MYXA 4S3KA 1RA5A 2NVDA 4YTQA 3S9ZA 3CZ8A 4AIEA 4EVZA 2OLHA 2C1IA 3THCA 2GWNA 2NV1A 3REQA 4YYCA 1DYSA 1OFAA 1VFLA 3SSJA 3QC0A 3NJ3A 1PVNA 1BTCA 1A5KC 3ABRA 3S42A 2F2HA 3KOYA 4HYWA 3W7HA 1ITXA 1Q2RA 5L9FA 2W6RA 4EX4A 2ANUA 1UROA 2FJKA 2V5CA 4UFJA 1DIDA 5I79A 3MSYA 4F0SA 5DMNA 2AAMA 3CB3A 3PAJA 1OM0A 1IXNA 1UR8A 2E8YA 2KX9A 3SUUA 4CQDA 3IUHA 1EZ2A 3WK1A 2PTDA 3RLGA 5C8BB 3HMJG 2F8QA 3Q67A 4PCSA 1B3WA 1UIPA 4AZGA 1EHNA 1W1PA 1S1PA 3LGEA 4GHRA 2WYSA 3PK7A 2QHAA 4QLKA 5DELA 2CITA 3OG2A 3KDOA 2BVWA 4FMVA 2ZOXA 7TAAA 2Z1KA 3S6DA 3A64A 1VPQA 4C60A 3W00A 2QUUA 2VGFA 3WQGA 3LCXA 3NTYA 2E8ZA 3VIPA 1H7WA 1K6WA 1DTNA 1WX0A 3S1UA 5A5WA 1Z32X 2CIPA 4DYEA 3N4EA 3LPOA 3L4ZA 4AHOA 1KLZA 2JEQA 1WZLA 4CQAA 4Q22A 4WEVX 1BG4A 3IVUA 2QDEA 4DF0A 2ZX8A 2FPVA 3W82A 3E0IA 3N3TA 1PPIA 4S39A 1L6FA 3QN3A 3B9NA 2GQ9A 4N0RA 1JZ4A 3IJDA 3H4GA 4W8AA 4JBRA 4JYFA 3LOTA 4XO7A 1W2VA 2GGIA 1AVAA 1VCGA 3THAA 4J28A 4A3UA 3QLLA 2J4GA 4XSMA 1XW8A 4E0CA 2OQLA 2EAWA 2JF7A 2AQWA 3HJZA 5FF7A 1TYGA 1X1ZA 1JF6A 1RV8A 2F9RA 4GNKB 3B9DA 4ACYA 1DWIM 3KCLA 1ZENA 4PR4A 1UIOA 3OZMA 4V1XA 5I02A 1NJJA 4B5NA 3BAXA 1Q2SA 3COTA 3LBOA 3U2ZA 1UOZA 2NUXA