2F6KA

Crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
306
structure length
306
Chain Sequence
SKIDFHTHYLPTSYVEALKRHVPGDPDGWPTPEWTPQLTLNFMRDNDISYSILSLSSPHVNFGDKAETIRLVEAANDDGKSLAQQYPDQLGYLASLPIPYELDAVKTVQQALDQDGALGVTVPTNSRGLYFGSPVLERVYQELDARQAIVALHPNEPAILPKNVDIDLPVPLLGFFMDTTMTFINMLKYHFFEKYPNIKVIIPHAGAFLGIVDDRIAQYAQKVYQVDVYDVMHHVYFDVAGAVLPRQLPTLMSLAQPEHLLYGSDIPYTPLDGSRQLGHALATTDLLTNEQKQAIFYDNAHRLLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of ACMDS from Lactobacillus plantarum
rcsb
source organism Lactobacillus plantarum
molecule tags Lyase
molecule keywords metal-dependent hydrolase
total genus 102
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2f6kA00
1RJRA 1YIXA 4H9UA 3MPGA 4B90A 1FWGC 1E9YB 4I6KA 4GX8A 4GC3A 3EWCA 3CAKA 5HMEA 4XAFA 1RA5A 2QVNA 1S3TC 4BKNA 4C5YA 2R1NA 4H9VA 2XIOA 1XRTA 1R9XA 2Z25A 4F0RA 2W9MA 3C86A 4C6FA 3LNPA 3BE7A 3OU8A 4RE0A 4D8LA 2Q01A 1HZYA 2YXOA 3KM8A 3LS9A 3LSBA 1FKXA 3QGKC 3URBA 3WZ0E 3K5XA 2P50A 1J6PA 4DZHA 2Z2AA 2AQVA 4LAOA 2AMXA 1EF2A 3HTWA 4XD5A 4GOAA 2D2JA 4IFKA 4GBDA 4QRNA 4WGXA 1FWBC 2QPXA 2GWNA 2VC5A 4CNUA 4C6KA 3GU2A 3N2CA 1KRCC 2R1PA 4DYKA 1V77A 1A5OC 3IPWA 1A5LC 4XD3A 4B3ZA 1RA0A 2BB0A 4CEUC 4INFA 3UPMA 3MSRA 3HM7A 2ICSA 1UBPC 2EG8A 3IRSA 3CS2A 3URNA 2HPMA 2Z28A 4NP7A 2I5GA 1GKRA 1EJVC 2FVMA 2G3FA 1I0BA 1V7AA 5FSDC 1V79A 1POKA 3GRIA 4C6BA 2OODA 1NDWA 4CQBA 4PBFA 1FWCC 2HBVA 2KAUC 3MDUA 4IFRA 2PLMA 3AUOA 3GIQA 3MDWA 4IG2A 1YMYA 3NEHA 2VM8A 4AC7C 4IH3A 1ONXA 4B92A 3OQEA 1EJRC 4J2MA 1JGMA 1XGEA 3LSCA 4GY7A 4H9XA 4IQJA 1YNYA 4QS6A 1EJTC 1K6WA 4KEUA 3ITCA 4IG2B 2UZ9A 5FSEC 3G77A 4LAKA 4C6MA 1DPMA 3OVGA 1P1MA 3A3XA 3IARA 4KEVA 3V7PA 1E9ZB 4AQLA 4V1YA 3E0LA 1NDVA 4LCQA 4LEFA 4H9YA 4IGMA 3GTFA 2R1KA 1NDYA 1EJXC 2FVKA 3IGHX 4DIAA 4ERGA 4BY3A 1P6BA 3RHGA 4H9ZA 1RJPA 4C6DA 4C6PA 3S2JA 2VR2A 4DLFA 2UBPC 1EJUC 2HQAA 1UMLA 4XD4A 1ZZMA 3ORWA 1EJWC 4ZSUA 2GWGA 5E5CA 3B40A 3GG7A 2DVUA 2QT3A 1FWIC 1YBQB 3F2DA 4EPDC 4LCRA 4IFOA 4CEXC 1RJQA 3IACA 4H01A 3E0FA 1RK5A 1K1DA 1NDZA 4PCPA 4YIWA 1W1IE 3GTIA 1FWEC 3GU9A 1PTAA 2HBXA 5LXXA 4J5NA 2E25A 4H9TA 4KQNA 3T8LA 3PNZA 3MTWA 4QSFA 2OGJA 4IFKB 4P5UA 1O5RA 2F6KA 4GK8A 4EPKA 1PB0A 1XWYA 2WJEA 4LCSA 3UF9A 2FFIA 4F0SA 3S2LA 3SFWA 3TNBA 2R1MA 3MJMA 1ADDA 4C6NA 3E38A 2D2HA 2DVTA 3O0FA 3GUWA 2Z7GA 4NI8A 2FTWA 4C6IA 4DNMA 2A3LA 3MVIA 1KRAC 3PNUA 4TQTA 3GIPA 3GU1A 4RDVA 1XRFA 4DI8A 4Z42C 4ERAA 1YRRA 4HK7A 3B0YA 3F4DA 2GZXA 4RDZA 3UR2A 1PO9A 4HJWA 3ID7A 2Z00A 3DUGA 2P53A 4L9XA 3RCMA 4IGNA 3K2GA 4ZSTA 4E3TA 4EPBC 4RDWA 2EG6A 4C5ZA 1PSCA 4G7EB 4QROA 2D2GA 2YB4A 3S4TA 3UR5A 1A5KC 2QS8A 2EG7A 4CNSA 3A3WA 2PUZA 4NG3A 3SO7A 2FTYA 1ITUA 5AKQA 4DZIA 1WXYA 3A4JA 3MVTA 3IJ6A 3URQA 2Z26A 2YZ5A 2E1WA 3FEQA 3FDGA 5HMDA 4DLMA 2RAGA 3TN5A 3D6NA 4LANA 4KESA 1ITQA 2OB3A 3QY7A 4UB9A 4XAYA 4KEZA 4QS5A 4KETA 2Z4GA 2VHLA 4G2DA 2O4QA 2DVXA 1FWDC 1QXLA 1UIOA 1NFGA 2Z2BA 1M65A 3WMLA 4GZ7A 1POJA 4L6DA 1EYWA 3GTXA 5CH9A 2IMRA 4R7WA 3OOQA 4LH8A 4PCNA 1ONWA 3OJGA 1R9ZA 4LFYA 2HNHA 4KERA 4WVXA 3AU2A 2PGRA 1EJSC 3CJPA 4XAGA 3O7UA 3R0DA 1KCXA 2O4MA 1M68A 3LGGA 3E2VA 4RZBA 1YBQA 3TN3A 2BGNE 1J6OA 3LA4A 3URAA 2HPIA 4WHBA 3EGJA 4R88A 3B0XA 3E3HA 4HK5A 1FWAC 4OFCA 1V4YA 4G7EA 2GOKA 3FDKA 4M51A 3WYZA 1A5NC 1FWFC 4LALA 2AQOA 2Z29A 5A6TC 4R85A 4XAZA 3AU6A 3LU2A 1I0DA 1A4MA 4V1XA 4QTGA 1KRBC 3EWDA 1GKQA 3PAOA 1J5SA 3NURA 2VC7A 4F0LA 3TN4A 3PBMA 2OQLA 1A5MC 4GXWA 3DC8A 4ERIA 4BJHA 4C6CA 2R1LA 3MKVA 4C65A 3IV8A 1EZ2A 3QY6A 4C6OA 4I6VA 2VUNA 4C6JA 1BF6A 4PBEA 3QY8A 5G4HC 2Q09A 2ZC1A 4C6LA 5HMFA 3NQBA 4PE8A 4C6EA 1K70A 2OOFA 4IF2A 4ICMA 3PANA 3S2MA 1FWHC 4XD6A 1KRMA 1FKWA 1P6CA 2Y1HA 1A4LA 4DO7A 2GSEA 2WJFA 1GKPA 3F2CA 2WJDA 4H00A 2I9UA 4KIRA 4MUPA 2YB1A 4CQDA 1M7JA 4GY1A 4HK6A 1UIPA 1QW7A 3HPAA 2ADAA 3ISIX 3TN6A 1V51A 3ICJA 2Z27A 1FWJC 4DI9A 4RDYA 1IE7C 4J35A 4KF1A 1RK6A 4EPEC 4CQCA 2PAJA 2CZVA 3GTHA 4UBPC 3S2NA 1VFLA 3LY0A 3UBPC 3DCPA 1WXZA 3E74A 4GX9A 1O12A 4H9MA 1J79A 4C60A 3RYSA 4GYFA 4EP8C 3LGDA 4JOMA 3OODA 3QGAC 2WM1A 3F2BA 1R9YA 1RAKA 3F4CA 4B91A 4C6QA 4GY0A 3RN6A 2ANUA 4HA0A 2PGFA 4CNTA 2Z24A 3T1GA 3JZEA 3K4WA 4LAMA 3T81A
chains in the Genus database with same CATH superfamily
1CTNA 3CMFA 4US6A 1O7AA 3CYJA 4ZOAA 9CGTA 1QO5A 4BKNA 4C5YA 2W61A 3AYRA 3LGEA 4DAIA 3VCNA 4HZMA 3TDFA 4UTIA 1HTIA 1OF8A 3K8LA 4Q4MA 2J6XA 1R3RA 5CC3A 3DIPA 2ZBTA 1XD1A 3N4FA 5BWAA 4MJMA 4HU4A 3UJ2A 3VGEA 2TYSA 2PB1A 4ZR8A 2YL8A 4AZGA 1W37A 5K2ZA 4IPPA 1F74A 2IPJA 2VC5A 4H41A 2OR2A 2VP8A 1MRQA 3WEMA 2GJXB 1AMYA 4BEQA 4Z1YA 4MPQA 3LRLA 5I6SA 2GUUA 3URNA 1DWJM 1E5JA 3SUWA 3VIKA 5DY2A 5FEZA 2XN2A 3KBSA 4HMEA 1HJSA 3FV9A 5KSWA 2W67A 2OODA 2I16A 3IRDA 1FWCC 2E9BA 2A3EA 2HBVA 5CZKA 3GIQA 4O1CA 3AMGA 3OQEA 1OCBA 2B7PA 1EJRC 3S2CA 1XCFA 3H55A 3W7IA 4B15A 3RG6A 4ORIA 3UZJA 4HVXA 3VVGA 4GYKA 2BNJA 1FDYA 1W5PA 3FAXA 4NXSA 4A6GA 1XPGA 1KFLA 3PG9A 4MDPA 2EGZA 4KIEA 3S5OA 1MYRA 2WBKA 3DG6A 4TO8A 2WVVA 4NNBA 4AZCA 4LYRA 4MWAD 4NRSA 1W1YA 3OVGA 3A3XA 1LT7A 1VH7A 1QNVA 4DJDC 2NWRA 3QZAA 3BJTA 4DIAA 4RNFA 4LBRA 4ERGA 1P6BA 2ZVRA 3V18A 4I90A 4U2ZA 2CBIA 1HP4A 4XZIA 3UETA 3B05A 5FA5A 1M7PA 1W1ZA 2W0UA 1DJGA 4AIBA 2H90A 3FHQA 4N7QA 1CGTA 2ZUSA 1X7IA 5EPDA 2RJGA 3G0UA 5IRPA 2A6LA 4KWSA 4PCPA 3WF4A 1OIFA 1DJHA 2CIPA 4KQNA 3UVIA 1NSJA 1PCWA 3MTWA 4E2BA 4X0NA 4U31A 3NZ1A 2QUTA 3CAWA 1XWYA 5E6ZA 1SJBA 2QDDA 4G6CA 4CCZA 3S2LA 3WLOA 3MJMA 3M1ZA 3RXZA 3VM7A 1JZ4A 2FTWA 1O60A 3MVIA 3WG6A 5CSUA 4WQ6A 4IX2A 4QBXA 3B0YA 4PB5A 1VQTA 4JL2A 1FCBA 4IGNA 1J01A 1GVSA 4TTGA 5A6BD 4MMWA 1IXOA 1LG1A 4QROA 2PDUA 2XFFA 4RR4A 1I2NA 5EMMA 4YYFA 1IT0A 1TQXA 1K7FA 3FGCA 3BUVA 1BXCA 1GVEA 5PTDA 2E1WA 3TQVA 3R2GA 5DT7A 4CQ8A 3VGFA 1GTEA 1H49A 1QOQA 4AC1X 3TN5A 3CEPA 4DYJA 2OEMA 4R9OA 4JTSA 3MV11 1SO6A 1BRLB 1FDZA 3FSTA 1QASA 3BQ6A 2JALA 2PPGA 3T8QA 2VGGA 3CB3A 2C18A 3C2VA 1VHNA 5LYRA 4U28A 3N25A 2OX1A 3LG3A 2A5HA 4TIMA 3OJGA 2BG5A 3ABRA 4JY8A 1MQRA 3HIJA 3W53A 1J0HA 2FGLA 2DPEA 3TNOA 3N2TA 4MNJA 2YW4A 4AUBA 4DZAA 4RW5A 4HD5A 3DI1A 3CQIA 2EBNA 1CXEA 1XYMA 1A5NC 4MFEA 3RUBL 2AQOA 1DBTA 5C7HA 2DZAA 7REQB 1I0DA 3KX6A 2UWFA 1PDYA 1SVDA 3W23A 5I3GA 3LHTA 3TAOA 2QR6A 1GW1A 1J0JA 2GSJA 4Y90A 1LBMA 1XIDA 3C0JA 5CGTA 4LBSA 3W7OA 1TZZA 3SECA 3M47A 2VUNA 4UMAA 4JTHA 2C1GA 2PDPA 4GZEA 3LEPA 3PUEA 1J0KA 1KM2A 3VOCA 3WFAA 3HV8A 5A8GA 1FKWA 2IQ0A 3E12A 1F6PA 3FJ4A 1S5NA 1W9XA 3F5KA 3SSJA 3CHEA 4PMXA 1B3WA 1CXKA 4FXJA 4DN1A 4L1WA 3B9NA 3N29A 1RK6A 1IZKA 1OC5A 2QUVA 2VQTA 3N04A 1GJWA 3GUGA 3PTMA 2WSQA 4PTVA 4C60A 3RYSA 1GQKA 1I8JA 4ADTA 3H7UA 4XAPA 4HPGA 2CLMA 3EXTA 3LHZA 4N02A 4BI5A 4C1NB 4L80A 2XN1A 3TONA 2X16A 4C7DA 3T1GA 3WL0A 4JHOA 2OWWA 4E4UA 4R7OA 2YKKA 4FSAA 1KTNA 3E5BA 3NFUA 5BU6A 5CLWA 4NJGA 2BOEX 2JGQA 1G7VA 2XDFA 4MYXA 3CZJA 1UZHA 4JTRA 3ZM8A 1CPUA 3BDKA 1SR0A 4JQ1A 5E0KA 4D6IA 2JK2A 1XUZA 4L6HA 1OX4A 1ZJAA 2DT2A 4AZBA 3LSBA 1W17A 2NUXA 3SCUA 1FX6A 2FHCA 5LHEA 2DH2A 3NA8A 3VNIA 1TELA 4F0MA 2CXEA 4HCDA 3I6RA 3GDRA 5ABEA 4C6KA 4JTFA 1IZJA 3EKZA 2RJHA 3C2OA 3RR1A 2HJPA 2FFCA 1KQYA 4C1NA 3UPMA 4KWUA 3AJ7A 1UBPC 1U2YA 4XZNX 3TZNA 4H7CA 3MT1A 2VCCA 4H4IA 1HVQA 5F1UA 1OC6A 4GIAA 1V79A 1POKA 3DEQA 4M7TA 1JXKA 2QXWA 4H6KA 2CWXA 4LUTB 3CZKA 2BXZA 4Q4PA 2KAUC 1QI0A 5AOUA 1FH7A 1UUOA 1ECEA 4MJZA 3B9DA 1M5WA 2PC4A 4AC7C 4Q8WA 4OZOA 4BZYA 1O1HA 4GVIA 2NQLA 2PSNA 4Z17A 1BSIA 2PP0A 3UWZA 1G7UA 4FLOA 1E40A 5HA7A 5TF0A 3BOLA 5BRPA 4DWSA 4AFYA 3CPRA 5C0QA 4NAFB 2OEKA 2V3DA 3ZLFA 1NWTA 1UOKA 2DZWA 2X05A 1RY0A 3VUPA 2QF7A 3QMRA 4GH1A 5DRIA 3UW6A 4C6MA 3I3EA 3GNPA 3OYZA 1XHGA 4JXCA 3E0LA 1MUCA 3BXWA 4IMCA 2OFJA 1OEPA 5CZJA 3WD3A 2CLPA 4M29A 5A6LA 3AO0A 2UV8G 1TRIA 5MKGB 7ODCA 4UZSA 2DZBA 3S2JA 2VR5A 3TTQA 6A3HA 2E40A 3ORWA 3T09A 5EU9A 1TX2A 5CG0A 3PWIA 4FP1A 2XINA 3STCA 2E6FA 1F3XA 1A5CA 2OU4A 3M5YA 3N9KA 4BK9A 4HMCA 3OPSA 3MI6A 5E09A 4RCXA 1VEOA 3G22A 1LQ2A 2OZ0A 1NARA 4WDXA 2HRWA 2ZFAA 1QJWA 4YMZA 4RXGA 2WBGA 5C5YA 1R3VA 2DUAA 2FJUB 1PAMA 3ELFA 4W8BA 3GYEA 4M6VA 4AMCA 2C7FA 4FX6M 1WUFA 4IOTA 1HN1A 3EDJA 3O63A 1V6UA 2VDGA 4I9JA 2O9PA 5EMLA 1EDTA 3M9YA 2ZCGA 3HF3A 1PKYA 2VRJA 3XIMA 1RPXA 2GOUA 4F2UA 2AGKA 3QR3A 4RDVA 3TYDA 1XRFA 1YRRA 4JBRA 5KEZA 4HJWA 3MUIA 4PUMA 2RKXA 2W66A 4L9XA 4JTEA 1NELA 1VFHA 2DZUA 4GKTA 4C5ZA 2RFGA 4G7EB 1NU5A 2VX5A 1KLYA 4P8UA 2PP1A 5F4WA 3BGJA 4YTUA 1M03A 2INZA 3LLFA 1T0OA 3SRKA 3NYZA 2ZWYA 3H2FA 4HNNA 3TSDA 3ZZ1A 1MEHA 3KUMA 4NHVA 3PS7A 3BMWA 1ME8A 2RAGA 3SY5A 1GJPA 3D6NA 3DXIA 2A6NA 3GNOA 4EAYA 1QHPA 4J3SA 3ZO9A 2VGFA 1QXLA 1M1BA 3PP7A 1X6UA 1DQWA 3EOLA 3WMLA 1G94A 2WCAA 4EE9A 2OZ8A 5J5DA 3BLEA 3OOQA 1V6XA 2VEFA 1EC9A 1PIFA 4XTDA 1V3HA 3VO0A 3RJXA 4PMJA 2BS9A 3T4WA 1EJSC 1UKTA 5C7VA 3LZ3A 4Q4KA 3PJUA 4C7FA 2B81A 1PKLA 1J9YA 3E2VA 1C7TA 5FKYA 3VDCA 2ISWA 3KS5A 2CNCA 2QUNA 2W91A 3LN3A 5EL1A 1RQEA 3E3HA 2V5KA 2BHYA 1WE5A 1CENA 4G7EA 1K02A 3G1YA 3HA1A 3TE9A 4I7UA 2DT1A 3QLLA 1XCWA 2YBVA 3LI1A 4PN2A 2F84A 4R34A 4EOUA 1EO5A 1JRCA 1R2RA 2WWDA 4V1XA 3GR4A 3KOZA 3A9IA 3B97A 4HPXA 1JQVA 1GWJA 1KKOA 3DAQA 3I68A 1H7NA 1YXDA 4NZCA 1RBAA 1EZ2A 4C6OA 3C6CA 4C6JA 2CERA 3QY8A 5HMFA 3ZVHB 3N6HA 4MNMA 1K70A 4HP5A 1W56A 1DIKA 4ORMA 1VBJA 4RPQA 1QT1A 4GINA 3PZTA 3DG3A 4KCWA 4O19A 4J3TA 2ZC8A 2CC0A 1S2AA 2HZGA 3MQTA 1H62A 1W5OA 1QW7A 3HPAA 4PMYA 4X60A 3QZ6A 3DOPA 3EB2A 2GJRA 3DKLA 1ZP3A 2X2GA 2G3MA 3NPVA 3C52A 1JG9A 1CGWA 3PJTA 3S5NA 2QCFA 4RZ5A 2YBUA 1MFVA 3LM7A 5LIWX 2ACUA 1R9YA 4UTJA 1ZS2A 3RM9A 2BY2A 2J62A 2ANUA 1BWVA 2PGFA 5CZSA 3V0TA 1DHPA 3L0NA 4HSOA 3GLCA 4WEVX 3A5FA 4O54A 1RJRA 5G5IA 3WENA 1S2TA 3B8UA 3CQKA 4DUOA 3ZJ6A 1HJXA 3POCA 3N11A 1QO2A 5DMLA 1U1JA 4PMVA 1XRTA 1Z42A 3ZQ9A 4O13A 1L8PA 1H11A 4UQAA 1AA1B 2XSBA 3DECA 3KTCA 4JKLA 2Q01A 3EWUA 2E5BA 3BV7A 2V2DA 4LQ1A 2YR1A 1JRBA 2P50A 1Q6CA 1PV8A 3E49A 3WL1A 1YTDA 2VMFA 4KRTA 3VOIA 3OBKA 3TKFA 3Q37A 5JH1A 3BCJA 3TW9A 2H6RA 4QHRA 2VX4A 3GU2A 2V63A 4ATLA 1IXNA 2X0HA 1D7KA 2GJPA 5A6BA 1TCMA 3U5YA 5BXRA 1J5TA 3RNDA 1GKRA 2G3FA 2ZA1A 1BXNA 1U1UA 1QHZA 1G4EA 4ZTYA 4YN5A 3A24A 1WCGA 1Q2RA 3KL0A 4LUSA 5AC7A 3WD0A 1A53A 5HQMA 2VM8A 4B3LA 1IIHA 5EMKA 1QNQA 2TPSA 4O16A 1D8CA 3LTPA 3WBEA 1NOUA 5FAJA 4E2VA 4QCFA 3GHRA 4URIA 4O52A 1T41A 2ISVA 2ZIDA 2EPKX 3P62A 1H7PA 3BGGA 3AIQA 3LZ5A 4LB3A 5ABFB 1NY1A 1TSIA 4LAKA 4YVVA 3SCTA 3C8NA 1QRQA 3W7RA 3GBDA 1N82A 3FK4A 4GO8A 3G3DA 2GVJA 1LL4A 3KZSA 2Y5JA 1AH3A 1F9CA 2G37A 1C8XA 4GG9A 1GOMA 3CLMA 3LX9A 1ML1A 1LZOA 1VF8A 2DGAA 4XD4A 2PDMA 1EJWC 3AHVA 1Q66A 1NWUA 4NL1A 5LA2A 3PSVA 1FWIC 2VZTA 3BK0A 3EPOA 1UZ4A 5LIXX 4PH6A 4N42A 3CV7A 1CX9A 1V02E 1XXXA 2O7SA 2GDVA 3EEZA 1OX5A 1QNPA 3K8KA 4BCEA 3E0FA 2V81A 4YIWA 2HDJA 1FWEC 3H54A 4H04A 1DHKA 1GEQA 2PWHA 1Q6FA 1SFLA 2PWUA 4ACZA 2ZXBA 3GXIA 1O5RA 2VD8A 3EDDA 4BQ2A 3DFNA 2WJEA 4LCSA 2JF6A 1O95A 1XF0A 2FFIA 3DFYA 4ZOEA 1YPIA 5AVNA 3GXDA 3MI2A 4C6NA 4MPKA 3K8MA 2WPBA 3N19B 2ZZ4A 1HJUA 2PTDA 3GIPA 3IS4A 1VFUA 4HIBA 3S9YA 3LM3A 4PUJA 4QG9A 4MJ2A 1JDCA 4JCMA 2EPHA 7REQA 5LSMA 1WZLA 3IJ8A 4LY4A 5IDZA 3GQYA 1VS1A 3GXPA 3ZVIA 4Z2LA 1E0VA 2J74A 2OLSA 2DZXA 1N7KA 3BW2A 4ZE5A 4CN6A 3LV5A 4H2CA 1TTIA 4Z08A 1ZAIA 3A4JA 5CJNA 4NILA 3IJ6A 5RUBA 3ZR4A 1UD5A 4JIPA 3E0WA 4AIUA 4Q7BA 4JTIA 5I5RA 1O5XA 4LW7A 4ZENA 4S3FA 2G50A 4U10A 5JVLA 2Q3RA 1JZ2A 1ZALA 4WSKA 1W3JA 2Z2BA 1S2CA 1JPHA 3MZNA 4UFMA 5FEWA 3W1QA 1OK4A 2VEGA 4G1KA 2W3ZA 2PWFA 1NF0A 2VYOA 2E67A 3VM5A 2WC3A 1TE6A 3CU2A 3VOFA 5D37A 1J10A 2HTMA 3IWPA 2A3HA 4XUYA 2BMBA 5ECUA 2Z1SA 3VE9A 5EMJA 1VJZA 3EGJA 5D2VA 1X8FA 1DJIA 3EBVA 4LGXA 2D23A 2WNQA 4FPSA 3H24A 3CPUA 3W1AA 3CHCA 1W1A1 1H63A 3NL5A 2FZ8A 4DWSB 4IIBA 2QCMA 1B90A 3WQDA 1A4MA 4M1BA 1RY8A 3L5LA 3PAOA 1KFCA 3CV2A 3PZGA 3TN4A 1EBGA 3SN1A 2V8ZA 3HG3A 3EOUA 1F4HA 1US0A 4IUGA 4IMFA 4PTWA 2QCHA 4M7SA 4I6VA 4QM1A 2WVSA 3IJ9A 3PG8A 5C6MA 2JKAA 2W6RA 3SADA 3NQBA 3R8RA 3S2MA 2ZTKA 3CL7A 4QJ4B 4Y8FA 3EPNA 1B1YA 4Z2HA 4GIYA 3PSWA 3KVLA 4HK6A 1KV8A 2BBFA 3QHMA 3RMEA 2ZUVA 1OX6A 3RO6A 1XLDA 2Z27A 4NJHA 4BQ4A 2VR4A 1DXFA 3GE7A 3GNXA 1YKWA 3S2NA 1VFLA 2QCLA 3C8FA 1MDLA 4EACA 1EGZA 1PTDA 3QKEA 1TB3A 1KFKA 2ALRA 3WLSA 1KWKA 3C3UA 1WUEA 3QGAC 3AMKA 1JQXA 3KZPA 3DDMA 2J78A 3AS3A 4YU1A 2F9RA 4JQAA 4W5ZA 3GX9A 3N9SA 2FH6A 2NXIA 1EGMA 3LCLA 4Q32A 4KS0A 4JD4A 2XM1A 1VPYA 5A6MA 1L2UA 1EOMA 4WR3A 2QULA 1VYRA 5HMEA 4ZCWA 3EWYA 2R1NA 3T0DA 4XWUA 3R4IA 3RJYA 4F0RA 3T0CA 1TPC1 2ZYFA 3BAWA 1MXSA 3OU8A 1EWEA 4DJDA 2V68A 3L4ZA 1HZYA 1XGDA 3GNNA 3NQFA 1OT2A 1SYTA 3O0KA 3UYIA 2V5LA 1JZ7A 1VYPX 4GBDA 1GK8A 2Z7KA 2XJ7A 3NVDA 4CNUA 2Q71A 4U2YA 4RNHA 3EEGA 1MNZA 2XU2A 1ZGDA 2JKPA 1DV7A 4W93A 3H4XA 3SJ3A 3BAXA 4FMVA 2DJLA 2Y62A 1YX1A 2G4FA 2POZA 3NQCA 3CPGA 4K8HA 2YL9A 4W86A 4W84A 3U4AA 2E3ZA 5I3HA 1SFTA 3VC5A 4ML9A 2PLMA 2AL2A 4GFSA 1W5NA 1MDRA 3UT0A 3UWWA 1H4PA 3CK5A 5CPSA 3VUSA 4A8NA 4N6EA 5DF0A 4HQVA 3E0IA 1H41A 2QGYA 1LTDA 1WZKA 3NQVA 4ZO6A 1TRDA 2D0HA 3T0BA 2Y8KA 4JYFA 1NH6A 3JU2A 1YADA 4UZUA 2F7FA 3AISA 3QTPA 2GSHA 1IZCA 2WHLA 4LCQA 1EB3A 2PU0A 2O9TA 1V0LA 4MZYA 1M53A 2XZ9A 1W3KA 2Y7FA 4HSHA 2Y7GA 1F05A 3G1HA 4DELA 2XWEA 5AFDA 3W0KA 2R82A 2UBPC 2X1RA 4R9XA 1R38A 2PURA 1A0DA 1V8EA 3EKLA 3B40A 2ZRWA 1OINA 3IUHA 4EXQA 1OY0A 3GG7A 2FLIA 1D3GA 4XTIA 1GZ1A 1DQUA 4X61A 2Q3OA 4E3VA 1ZP4A 1A47A 1ICQA 5BCAA 4GO9A 1MUWA 1EX5A 2E25A 3B8SA 4TOQA 2YDAA 3I7QA 4MNLA 4I5UA 2VEPA 4IFKB 5FF2A 1E1CB 3C2EA 5D4YA 2ZZ1A 3M07A 1ZJHA 1BYBA 1L2QA 2R1MA 3R94A 3ITGA 3PULA 3THDA 3SCRA 3D5HA 4AXNA 5GJMA 4B3KA 2V69A 1N8IA 3LB0A 4LS1A 3UJRA 3ZWSA 5K9DA 2VX7A 4V28A 1IR2A 3FA4A 2Z00A 2Y61A 3WUGA 3VMNA 4E3TA 2V3GA 3EX6A 4EPBC 1L8NA 2DZPA 3SZ8A 1YE6A 5DXYA 4FR1A 3G5EA 4N9EA 3PPGA 2QCDB 4MY8A 1WKEA 4N2YA 2FTYA 4Q8VA 2VFFA 5HPCA 2P3EA 1JNEA 5FL0A 5A94A 1IXPA 1RZMA 2W63A 3MVTA 3VOJA 3KTSA 1U5HA 5FJRA 4C90A 3CZEA 2EJ1A 3LCHA 4MDOA 2NVDA 4LB4A 2F6XA 4HPHA 2V67A 4QQ3A 2ABAA 1H1ZA 4ENLA 3B0UX 1YPXA 1DTNA 5AECA 3GVWA 3PZOA 1OGGA 4PA8A 3VIGA 4NJKA 4AX6A 3TC7A 2X09A 4A2SA 1F07A 3S42A 4PUDA 1Q45A 1BYAA 2ACQA 3TXZA 1WAWA 4F79A 2PDNA 1BQCA 3WBXA 4H6QA 4UFHA 3ZSTA 2O4MA 4IIDA 5E93A 3LGGA 2VFIA 2JIWA 3WH7A 3RRXA 5I3DA 1XH2A 2JF7A 3UESA 5FEPA 5CPLA 3IANA 2P0IA 5E70A 1JEZA 4XBSA 2QJNA 1SSDA 4LUJA 1ZAHA 2BY1A 2CLOA 3AU6A 3GWQA 5T8GA 2P8CA 4REQA 3TU9A 4AZIA 2FZMA 4NRRA 1XGZA 1GOKA 3NL2A 1OFBA 4L1XA 2DZVA 4AU0A 3AIUA 3L4TA 4AZ5A 2QV4A 4P61A 1VBHA 5CPMA 3EPMA 1ONRA 1UZ1A 4HMDA 5CQ1A 4QNWA 3IV3A 4Q4OA 5D8ZA 1HFBA 1DWHM 1XLCA 2P76A 2Q8XA 2OOFA 2MNRA 3CQJA 4LJ3A 3EOOA 3PUDA 1OWQA 1UZDA 1P6CA 4KPLA 1KXVA 4XISA 5C54A 2OQYA 2PODA 4S3CA 4GVGA 1M7JA 1Z9AA 3PUOA 4GY1A 4GA8A 1F5ZA 4DF1A 1KA9F 3ICJA 2OSWA 2PAJA 3AIWA 4DJEA 2ZRVA 3UBPC 3GD6A 3C56A 4AZHA 2WZHA 4MUZA 3VFCA 4QCEA 2D24A 2VENA 1R3WA 2CKRA 3DESA 4AMAA 1QW8A 1WDPA 1ELSA 3DG7A 3CMJA 1F2JA 2INFA 3WK1A 3EXSA 5JU6A 1MXGA 1AJZA 4D6JA 1GHSA 4CNTA 3TLQA 3UJEA 1QFEA 2ZA2A 1QBBA 3E02A 3LPOA 4B9YA 3TYBA 4AIOA 1XLAA 1QUMA 2BVDA 3NPXA 1TJ0A 1DJYA 2V30A 1W2PA 4GI4A 5TIMA 4DF0A 3N34A 1P7TA 5CXPA 3WLPA 5HOSA 1UQZA 3DU0A 5F4SA 3LCGA 5I07A 2FKPA 5EMYA 4QXIA 5HK4A 1K8XA 3CL8A 1QOPA 4D8LA 4RV3A 1C8YA 4G1NA 3LS9A 5TQLA 1AVAA 3NDZA 4A3RA 1HGWA 2WSPA 1Z89A 3VZYA 5A69A 4LAOA 3KRZA 4CCDA 3GC5A 2XFRA 4Y8EA 4FNSA 2PZNA 1VLWA 2D69A 4B9ZA 4Y96A 2Y6ZA 1XICA 4DB7A 1SM9A 5I79A 3UZWA 1KCLA 3ERPA 4O1AA 4WDUA 3GC4A 1LLWA 1V3IA 1JFXA 4GQGA 3WDRA 5TD4A 2OYLA 1WOAA 2YCLB 2HK0A 5BNKA 1E15A 4PBFA 3WN6A 1ZY9A 3R5EA 2OZ3A 4H6RA 3AUOA 1XH0A 5FJOA 1NOFA 3PK7A 4XZMX 4TU1A 3YPIA 4QAWA 1JGMA 3W83A 3NL6A 4B5TA 3M0XA 3GK0A 4LTSA 5IDIA 2I14A 1XM3A 3A3HA 2WVTA 4FIRA 1GT8A 2Z6IA 5KZEA 1YNQA 2A7RA 1GHRA 2NT1A 3G1VA 5FSEC 5LA0A 1JDAA 3FNDA 4GYJA 5TAOA 3SB0A 3VABA 1NFBA 3G1AA 2ZZ7A 2QMJA 3W25A 1G67A 4Z1BA 1WBHA 2E09A 1ODUA 3N9RA 4U3CA 2XIBA 2ISSA 2W62A 2BVTA 6ALDA 4GBUA 4HNTA 1NM9A 2PI6A 3UZXA 4BR1A 4Q4RA 2UY3A 1Q3NA 3QYSA 1OIMA 3W6LA 3CUIA 3N3TA 5E5CA 4ZQRA 2C19A 3REQB 4XUGA 1LYXA 1XUUA 4AD4A 3FIGA 4TMCA 4CQAA 4F3HA 1HX0A 3TTEA 3CUXA 4MWAC 1E71M 5TNVA 4P8XA 2GLKA 3CT2A 4J7RA 3PNZA 1ZU8A 2CBJA 2CU0A 3OW1A 1TQJA 4PCTA 3VNJA 1OG6A 3M5ZA 3RDKA 2R24A 3I4KA 2CETA 3B9EA 3KLKA 2VZUA 4MSSA 1IXQA 4GI8A 3G8EA 2A3LA 1RD5A 3G2GA 4R7JA 3TQPA 3AZTA 1VCVA 4K6AA 4QLLA 5AZ0A 3ABXA 3WY1A 1PO9A 1VJSA 3P8JA 3FS2A 1FUYA 6ENLA 3H7VA 2Y4SA 4IISA 3LV6A 1H60A 3OIXA 2GQAA 2PUZA 4W89A 4GYPA 3W70A 4EXBA 5I7GA 1ZL1A 1TV8A 3CV6A 3SY8A 2Z0IA 6REQB 3FEQA 4TX9A 4PUUA 1ZHAA 2DSZA 1UR3M 2X30A 4O53A 2Y88A 3DH7A 3S5YA 1OCQA 4WSJA 1XBXA 2VT0A 4WKFA 1XBYA 3LPPA 1Q63A 1M65A 4CVUA 1OYBA 4ADUA 1GVIA 3FX4A 4D72A 1S5VA 4LFYA 1CNVA 1PS9A 1E73M 3WELA 2XHYA 4Z0JA 2XG9A 4YHEA 3R0DA 5G1YA 4QE1A 1VGAA 5L6UA 1IEXA 2I57A 4AY7A 1GPFA 2GQ3A 2O55A 2HS8A 1PVNA 1F8MA 4UTWC 3ITVA 1YDNA 3B0XA 1R85A 4LS0A 2J7BA 3SGGA 1TUXA 3WK3A 5U7SA 3WYZA 4LALA 4XQ6A 3PPCA 5KZ6A 1OFAA 1X6LA 5E9XA 2Y8UA 2TMDA 4QTGA 4QEEA 2A79A 5AC5A 2EEXA 4W8LA 4W7VA 1B2YA 4MGGA 4MB4A 4DPQA 6REQA 5BOFA 1K8CA 3U2EA 5G4EA 2OQLA 3DFHA 2J8TA 1GG0A 4OJYA 4IGSA 3DC8A 1J93A 1GVQA 3W76A 1EXBA 3R12A 4BJHA 3IIVA 4F9DA 3LLDA 3LCWA 1F6KA 1JZ8A 3W37A 2NQ9A 1HXJA 5CC5A 1F4AA 1PE1A 1LM1A 1TTPA 2IUZA 2XIMA 1TIMA 2H3BA 1Q7MA 2P3ZA 2AL2B 3OZOA 1GKPA 5FIPA 4H00A 3I7RA 3OB8A 1ME7A 3MSYA 3PJWA 5HINA 1RHCA 1GQLA 3RITA 2YSWA 2ADAA 1ZNNA 3MHFA 4O8AA 1WZMA 4A4AA 3NPUA 3DCPA 3U9IA 1B9ZA 3WQEA 2YPIA 3KWXA 1F3TA 2RGMA 3XISA 3DHPA 3OODA 4MG4A 2IKJA 3W7DA 1YXCA 1EUNA 1XIBA 3W7QA 5REQB 1H5YA 3RN6A 3WJYA 2OSXA 1KM3A 3WUFA 3L0GA 2Z24A 2PEVA 2ZZ2A 4WXZA 3VU2A 6CGTA 2A3CA 4LAMA 1XYFA 4ZQNA 5DCBA 1J2BA 2Z1KA 3CAKA 3GDLA 4JNZA 3AI0A 3ZJKA 1RA5A 4GCAA 1E0XA 4D9PA 3QR1A 4CU7A 3HMCA 4MB5A 3H6OA 5LIUX 2PZ0A 5HWJA 4KFNA 1KM6A 1I2PA 4PFHA 4EK7A 3N2XA 4RZ6A 2ZE0A 1H7OA 1SMAA 3M41A 3MI3A 4YPJA 3GH4A 1NVMA 1CLKA 1BVNP 3R25A 3SCPA 1CXLA 1EJ7L 1YHTA 4L5ZA 4FLQA 4XD3A 1XDJA 3QC0A 3F03K 3NM1A 3WMCA 1UA7A 1ZLPA 3E2SA 2I5GA 4WKAA 5KETA 1EJVC 3G1FA 1V7AA 2G0WA 3GRIA 3COTA 1PHQA 1VBRA 4I9AA 3BTNA 3C2RA 4RW3A 1AH0A 2A4AA 3POHA 1W9BM 2NVCA 2PCQA 2WHJA 3TW6A 4HZ8A 3PZQA 4B92A 4JIIX 3R7MA 1NP2A 4PB3A 4QISA 3CM4A 3N12A 1V3KA 3HPFA 3ZLGA 3NAVA 1NAL1 1GVRA 3GZAA 5D2WA 1REQA 3WO8A 4PMNA 3HGOA 3LLXA 3BO9A 2R8WA 5AYBA 3RK8A 5G1TA 4B4HA 5E9AA 1X97A 2GVYA 3HO8A 3MBDA 1SUXA 3EA2A 5A3HA 4V1YA 2VO5A 3QH2A 1Q85A 3F5JA 3GR7A 2NUYA 4IGMA 2FVKA 5FF0A 3T2OA 3MUCA 3MANA 4BY3A 2J88A 5ABGA 4C6DA 3DC0A 4HT3A 2XH0A 4BI7A 3CHFA 4M6PA 4NUWA 2GJNA 4B5WA 3KDOA 5C55A 3KCJA 4OHQA 2E6AA 5ABTA 1FFQA 2YCEA 1S5WA 3ITTA 3WDJA 3UFYA 3FVMA 1WDRA 3NL3A 1GOXA 2GVLA 1TPFA 4H01A 2NQHA 1X1NA 2YYTA 3ANYA 1RP9A 1VCGA 1XDMA 1TA3A 1H50A 4LF1A 2HBXA 1BKHA 1JI1A 4QDPA 1LQAA 4H9TA 3T8LA 3HGJA 1C93A 2XN0A 2IPFA 3RX3A 4IUOA 2QF8A 1QMLA 1ZPTA 1BYCA 5CEWA 1HKKA 4E38A 2WJZA 4UNKA 3QZEA 2DIJA 3GUWA 3TQ0A 3IAPA 2Z7GA 1UCWA 2ON3A 3TLLA 3DZ1A 5EYWA 4DNMA 1KRAC 3HPSA 1CBGA 3KP0A 4DI8A 5D04C 3W88A 1KFEA 3TJXA 2BVWA 3PR2A 4HK7A 3ZWTA 3F4DA 4XZLX 3A47A 4JTKA 4F4RA 4BQ3A 1V02A 3QPYA 3TA6A 1JCJA 3S4TA 4LUYA 3ZT5A 1Q13A 3M0IA 2A85A 4NG3A 4AF0A 4F0HA 2WVUA 2YLAA 5XIMA 4DZIA 1V93A 3QV9A 3EX4A 4ZO9A 4ILSA 4A29A 3BV4A 4QITA 2O0TA 3O6YX 3NSMA 5FF4A 4UOQA 3S1GA 3L4YA 3V4BA 3U8GA 1UR2A 2VX6A 3K4AA 1RV8A 2XH4A 3UG8A 2Z4GA 2BV9A 4M1RA 1JCXA 4H7ZA 4E8DA 1B3YA 3GIYA 4NKCA 3TJIA 3QW4B 3WLKX 1PKNA 2CXGA 1K03A 3UP8A 1LORA 1POJA 2CKSA 4OOUA 3FW6A 3SCVA 3TTYA 4HOWA 3VD7A 3G8RA 3PBGA 3W72A 4AEOA 5DN1A 2DSVA 4K3ZA 1J11A 3FJNA 4KERA 4JEQA 3EDEA 2PGRA 2YL5A 1OFDA 3E1F1 1H7XA 1M68A 1XQKA 1T40A 3TV8A 4RZBA 2PTXA 4O1BA 2I1OA 1PIGA 4DO6A 3D3FA 1FWAC 2C8NA 2HSAA 5K4ZA 1ADSA 1EOKA 4P8VA 4D71A 2WZMA 4Z1AA 5A6TC 2YXGA 4NAFA 5HNTA 1I45A 1E6SM 4NZ5A 1GKQA 1AQMA 2VC7A 2ZDRA 4WJXA 2GK1A 1OHLA 2FZNA 2FMOA 1R6WA 4GXWA 3W7NA 2CESA 5FL1A 4Q4QA 4BF7A 4P7QA 3O16A 2B4GA 4IGHA 1ICSA 3IVUA 4XX6A 3W6MA 1RVGA 3OEXA 1ECQA 1W54A 2J7EA 3KRUA 5HANA 3B8TA 4ZGYA 3QPZA 4RK8A 2DU2A 1O4UA 4GQ0A 4IF2A 1TMQA 2INEA 3LERA 2RDWA 1A4LA 2PWGA 1EIBA 4KEMA 4KMQA 3CB8A 4CU6A 2DSKA 2QVHA 1AW1A 1B5TA 4K8GA 4GC4A 2ISFA 3NZQA 1SZNA 4NZJA 2FIQA 2OQHA 3N18A 4DXKA 4EPEC 5C71A 4AVOA 3S1WA 2XVNA 3W24A 5B7ZA 4Y9OA 4UBPC 1LLOA 2YCLA 3V1HA 4MJ4A 3PPFA 1CGVA 5EGRA 1O12A 4NX0A 3D0CA 1LF1A 3THCA 4A35A 3TSBA 4OGZA 3L68A 1V7YA 3ARVA 4XV0A 2WM1A 4YCOA 1MXDA 1QOXA 1PZ2A 3O2LA 4KWWA 3SN4A 4AD0A 2HWGA 4HA0A 4LVGA 1XBZA 3C2FA 1DEDA 1AL7A 1R2TA 2ACSA 1GCYA 1R3YA 3SEPA 1UR4A 3M16A 1YIXA 3NQAA 1JUEA 3TVAA 1WDSA 3EAUA 4ZXOA 3CNYA 3S6TA 2OSYA 1Y8BA 3W00A 3NQ8A 2QVNA 2P1FA 1S3TC 3U7BA 1EHAA 1DJWA 4AWSA 5AB3A 3H4GA 4M3PA 4TV6A 1EGVA 5L9FA 4H2HA 2WMKA 3WQVA 4UTHA 4X2RA 3G6LA 4FOKA 1OQFA 2OEJA 1N2VA 3URBA 2XVGA 2ZQ0A 1PZ3A 4Q8MA 4YTTA 2OWXA 3EKGA 4NAEB 3B0PA 1H09A 3WBAA 3H8AA 4FX8A 1TVNA 4IQLA 1E5NA 3F4WA 3GFZA 2GWNA 1WYIA 1CB7B 1UA3A 2OT0A 4NNCA 2IXVA 2ICSA 4LUIA 1KM0A 5K4XA 2ZDSA 3SFKA 3UD6A 5D2XA 4IT1A 1ZJIA 1KGUA 3RAOA 1S1RA 3AICA 3KL3A 1JI2A 3FEMA 4UCGA 3NR0A 2GPTA 3II1A 4M6UA 1TJ2A 3OBEA 2G97A 1HP5A 4U3AA 3STFA 3CO8A 3QEZA 1KBBA 2HVOA 2C16A 2PLJA 2V5CA 4JX5A 4FALA 3NQ2A 2QV5A 5C2CA 3MJYA 3S1UA 1C9DA 1FP9A 3TFCA 4PUNA 3BLFA 2BXYA 4HCLA 2QCEA 1DPMA 1UKPA 1P1MA 1XLIA 4YLWA 3V7PA 1E9ZB 4Q3MA 1TWZA 4JR5A 1ESWA 1HKWA 1XLLA 1L6GA 1OFOA 1UC5A 2A3BA 4PGLA 3NSXA 4Z2IA 4UTMA 1KWGA 1MW2A 4DJFA 3DFQA 3D46A 3BW4A 5JBFA 3WQGA 2PRLA 1FWNA 2YCJA 1E9IA 2D0GA 3GW0A 3W01A 4JIRA 1UPMB 3RLUA 1OVDA 5DX7A 1UHVA 2H9AB 2D73A 4QJ5B 1SZGA 5DT5A 3ZIZA 1NDZA 1R86A 5GNXA 2NQ5A 3N13A 1PTAA 3NXLA 3QGVA 3T05A 3M44A 5IBXA 3PJXA 4CNNA 4O0ZA 3NQDA 3O6CA 3UZYA 3IUDA 2VRKA 3W28A 1BKSA 1BD0A 1WBJA 3VIIA 4JQ3A 1P5BA 3UF9A 1HKVA 2WKLA 1YQ2A 3W02A 4O0QA 3RO8A 1GQNA 4FOUA 1XDLA 3U5UA 3V16A 5HUOA 1EA9C 1O68A 2OXNA 3FJLA 3W2JA 3N4EA 4FNPA 5EBAA 5DBTA 4D1IA 1X96A 3PFRA 3ZFHA 3CT7A 5FF7A 3PZUA 4GI6A 3CTTA 3RCMA 3TWBA 5M3WA 3K13A 3ITXA 4R27A 4IX0A 1DOSA 2VOMA 4QG8A 6XIAA 2TRSA 5BYWA 1KFWA 1KBJA 5LNSA 2OKTA 4R53A 4EXAA 4BHYA 4O4VA 4IP5A 3MWCA 4PRTA 4QE5A 1R0MA 4P7NA 1SGJA 1YYAA 4XG1A 5BXSA 2VTFA 3AFBA 4L4MA 4LT9A 3S0CA 3AWOA 2R94A 1UASA 3TX9A 1S5MA 3M0YA 3UWQA 3MKCA 2J4GA 1L6YA 1AJ0A 1R46A 5CCZA 3HFYA 1CECA 3B4YA 3V0SA 2D1ZA 1RVKA 1U83A 3QR0A 5T9BG 2W27A 1VFMA 4ES4A 4ZFMA 1LWIA 1R9ZA 1EPXA 2ZOXA 4IIHA 1MZRA 1EC7A 1RP8A 3O9NA 3CJPA 1XYCA 4XAGA 3NGJA 3VD3A 1PDZA 2OYKA 1SZFA 3SQSA 4M81A 1LDCA 1S2UA 2BGNE 1M3UA 4ML4A 4EKJA 2J7CA 7TIMA 2B0MA 4IJBA 2WMGA 1F61A 2X8RA 2QNEA 5KITA 4NYUA 4KH2A 5CKSA 4LVBA 1FWFC 1OD8A 2E1DA 5LNVA 4R5EA 1TV5A 4K68A 3V0UA 1ONEA 2X0SA 3GFXA 4E4FA 1Q6EA 5LNRA 3DX5A 3B9AA 1NTHA 2WSYA 4DXVA 1YW1A 5AYYA 3QY6A 1FCVA 4O50A 3I6EA 4BFAA 4I5RA 4PE8A 3GDKA 5DY3A 4ICMA 3BOXA 2PF0A 5M17A 3L2MA 2Y1HA 4GNKB 3MKKA 1R87A 4CUCA 3ARTA 3KXQA 2E77A 1Y7VA 2WPGA 3H23A 1EBHA 3PB0A 2AAMA 4S3BA 1E55A 1WNOA 3TN6A 3V35A 3ANVA 3VDBA 4RDYA 3A21A 2GDQA 3EX3A 1RQBA 1R3SA 2CZVA 4X2PA 3O07A 4V2XA 1B31A 3W7HA 2JEPA 3VKBA 1I9CB 2ZICA 3P74A 4LF2A 1MW1A 1W3HA 4MB3A 1AZ1A 4H9MA 4HTBA 1J79A 3WLNA 1RALA 1KW1A 3O06A 4E5TA 1UQYA 3W7EA 3MCMA 4B91A 1B57A 3UXDA 3U7VA 4YHGA 2QDHA 1J12A 1SJDA 4EAMA 1KCKA 3TMQA 5MKGA 4B16A 1IEIA 4B5SA 4Y9NA 4GKLA 4YTRA 1MSSA 2VFDA 1AZ2A 1AD4A 3TYZA 1DJXA 4QE4A 1UH3A 1UP2A 1HL2A 5CBJA 2NX3A 2EO7A 4U5IA 3JS3A 4C6FA 3UXIA 4RE3A 1XLEA 3D47A 1AW2A 2AMGA 1W32A 2WMFA 1UJQA 3EWZA 3EB3A 1JDDA 1NQKA 3E0VA 1OFQA 3BURA 1KXQA 3TJ4A 1BTCA 4IFKA 2C79A 3VFLA 1C90A 1FWBC 2NWSA 2WMIB 1KRCC 3IUIA 2Z2UA 4CVWA 3PZ9A 1EIXA 2AL1A 2WK2A 2VEMA 3PWGA 1VRXA 4GJJA 2ZZ3A 3A5VA 3USZA 3QQ0A 1FXQA 2Q8ZA 3C0QA 1DP0A 2WLZA 2I17A 4QDMA 4KT2A 3RU6A 1M41A 4JS3A 1H1YA 2C0HA 3V1PA 4TX8A 3H12A 4QNEA 1A3XA 3NIYA 2OG9A 1A80A 4GJ1A 2X1UA 3RCYA 4Q22A 3M6DA 3MDUA 5BMXA 3PVFA 1B4KA 2CBVA 1LJYA 3NO1A 1JR1A 2L5HA 6XIMA 4ZEPA 2G5WA 3QV8A 2D22A 3AXHA 4H8UA 3V75A 4H9XA 1Q65A 1ITXA 2F61A 4KEUA 3GHTA 1VKFA 3ITCA 3SIMA 2VC9A 4NJIA 1BGGA 1OYAA 3U48A 2VJXA 3SCOA 5A2BA 1ODZA 4IMAA 3NQ7A 1FY6A 2QPUA 1PYFA 1VIWA 3MS8A 4N9CA 2DIKA 1LCOA 3VIMA 1F3WA 1MMFA 5HDRA 5D05A 1O5KA 4FI4A 2PF8A 2PD5A 3WUBA 4AHOA 4BQ5A 4H9YA 2OKOA 2YFOA 2NQJA 1REQB 1GGOA 2FH8A 3T0AA 5M2FX 2NXGA 1EJUC 4FNUA 4CLMA 3HN3A 5B7YA 5CZTA 3ZYZA 4ZSUA 5H1WA 5GNYA 1GNXA 3L23A 3OGSA 3P3BA 1YBQB 4Y7EA 4WXYA 3AXIA 3BANA 1HVXA 2IW0A 4EANA 1XLGA 5CGQA 3W1LA 4PYSA 3PZMA 5AHNA 1M01A 4LV4A 5SWUA 3OA3A 2OGJA 1ZCOA 4FO4A 3UA4A 2XM2A 1XR2A 4ZMGA 2E0PA 2FJKA 1VEMA 1CLXA 4HMNA 5T9CE 2P88A 2QCGA 1L0PA 4J28A 1JAEA 2JEQA 1RXOB 1HF6A 3FKKA 3QVQA 3GG1A 4Q8OA 3Q58A 1OABA 3P6LA 5EA9A 3N73A 4Z42C 5A6AA 2WSKA 2NZLA 5HATA 2DEPA 2VFEA 5J04A 3K2GA 1LLZA 3VDHA 1FWSA 1L6SA 4HPNA 1AMKA 4F2BA 1PSCA 3LCIA 3TROA 1Q8AA 4IMDA 3GVQA 2XUCA 2PDWA 1XSIA 2WOQA 3WQPA 1BEUA 4WD0A 4Z1DA 4C1LA 5I00A 1BG4A 1MVYA 1H1NA 3C4UA 3VDAA 5FEXA 1WDDA 3WK0A 3VNDA 5B80A 4LANA 5F2GA 4UB9A 3L4VA 4UXDA 2VHLA 1KBKA 4FZIA 4IMEA 2V82A 3QHOA 3SGZA 4JICA 1QU4A 4I7WA 4RXFA 1Q6RA 3CAVA 1J4EA 1XIIA 5CH9A 3ARUA 1CEOA 3F5LA 1W8SA 2NSXA 4JAWA 2PP3A 3RRAA 3HB9A 4XVDA 4AHPA 1LWHA 4GWEA 3KBWA 5CJ5A 4H8HA 4A3YA 3BG9A 3RM8A 1I4NA 4M0XA 4L4OA 3OVRA 3IK4A 2RH9A 5G4WA 8XIAA 1AL8A 1ISVA 3HG2A 4GI9A 3O3RA 4YTQA 4XVEA 4M19A 4KW2A 1B3OA 2IPWA 2OPJA 3UERA 5C2XA 2NV9A 1IT8A 3FOKA 3LPGA 1CYGA 3WLMA 1T5AA 3UXKA 1FH8A 1E6XM 4MTVA 1CI1A 1YTEA 2EJAA 3MMDA 4L64A 1GW9A 3AMCA 5DBUA 1XSJA 3WMBA 3PC0A 1UP3A 2ZXAA 4XZWA 3MZ2A 3S47A 2FGZA 4J27A 5KZDA 3LDVA 1JPIA 4C65A 1TREA 5D9OA 1Y5WA 3JUGA 4D1JA 1V6YA 4G8TA 4C6LA 4LXFA 1DWIM 3B8IA 4C6EA 3WH5A 1FWWA 1IF2A 1VR6A 3S5SA 3WQ6A 2CLHA 4LEQA 1HKJA 1KRMA 4U33A 3IIXA 2MANA 4YS1A 1R30A 4LAUA 4TVCA 1TMHA 3GH5A 3CUHA 1LBFA 4MUPA 4CQDA 1EFZA 2BVYA 2DV0A 3L4XA 2BODX 1FWJC 4Q6JA 1S3HA 1KM1A 4XO6A 3STGA 1XV8A 2HISA 1K9DA 2E6YA 1K8YA 3BWWA 2REQA 4XZ9A 1LWJA 4UQDA 1QI4A 2X0YA 1U22A 4MZ8A 3ARXA 8XIMA 3DENA 2Y7EA 3F2BA 3F4CA 3FXGA 1JYVA 4PSPA 3CC1A 8A3HA 3QFEA 5D09A 1OGBA 4TX6A 1G6CA 2IKHA 1GOOA 3HV9A 3WD4A 1LQ0A 1KTBA 3T81A 4DBSA 3R0UA 3NG3A 2D0FA 1E9YB 3GAYA 1FH9A 4JHMA 1E3ZA 2XIOA 1W31A 1EX1A 3MHUA 3LD5A 1CZ1A 3BQ5A 1W91A 3NQMA 5I06A 1P43A 5AC4A 1J6PA 2FPTA 2VOTA 3IGXA 3THQA 3UXLA 1M6JA 2CYGA 4ACYA 3IJLA 1LT8A 4BF9A 3HTWA 1HQTA 1HIZA 1BWLA 3SQLA 4Q6XA 3NZPA 3WDPP 4HNOA 3QTGA 2AKMA 4PTXA 3IVTA 1UWUA 4UFJA 1TZ9A 1V77A 4RNIA 5JQ9A 2NVAA 1K4HA 4CEUC 4INFA 1V3JA 3RR4A 1U5VA 2CEQA 2CFFA 3ARWA 1OGSA 4NP7A 3VK5A 1BXBA 2RDUA 2CWNA 4RX0A 4JPGA 5FSDC 4PMQA 3MHGA 3MUXA 4PCSA 4QEHA 3VZXA 1Z32X 4Y9PA 3KOXA 2DT0A 3SY1A 5A6SA 3HG5A 5EMUA 4ZL1A 1O66A 4IH3A 1XIMA 4XKYB 1UW9A 2WC7A 3GW3A 1D2KA 4NZFA 3VAVA 3WDQA 1M04A 4PMRA 5EB8A 1I1XA 1EL3A 3RX2A 3UJSA 5G1MA 4ZFCA 3WH8A 4JQ2A 1BGAA 1E6RA 4F48A 3W07A 2UZ9A 3NEVA 3HGSA 1S2WA 2G3NA 3LRKA 5DCEA 4KEVA 4PR4A 2B7QA 3VNYA 5T91A 2ASHA 3N2MA 3UPWA 1W3LA 5IHRA 2BHZA 3CEUA 1FFRA 3FLUA 3QPEA 1E6ZA 1WQ5A 5I3KA 1TJ1A 2ISDA 1Y5XA 4E4PA 1VAHA 4GZJA 4DF2A 4C6PA 5AHMA 2RUSA 2NV1A 3WLLA 3O6DA 4FS9A 3LBMA 2ESCA 1F6YA 1VENA 3QF0A 1DIDA 1HJVA 1QNRA 4OIFA 5LGXA 2HK1A 1HL9A 3BAIA 1W8GA 4FOJA 3MW7A 3AZSA 2GUBA 4KRZA 4H83A 3OZPA 2PE4A 3TYAA 4MIMA 3EX1A 2OCZA 1SFSA 1T96A 2Y24A 3HQOA 5D2TA 2IKIA 3TNBA 3WUEA 1TPUA 2Y5SA 2Y0FA 1B4EA 1BHGA 1GVYA 4O0KA 4NZ3A 3GNRA 4NZ1A 1J96A 1FRBA 3O05A 3ABOA 3PNUA 4U5KA 4TQTA 1BTMA 3EA1A 3H7RA 3DFSA 3LXBA 3CMGA 1QCWA 2IXUA 1TPH1 2DIEA 4MHBA 1TWWA 3T9PA 1BF2A 4PC8A 3LBOA 1SZRA 1XKYA 2EHHA 1PX3A 5A6JA 1G4SA 3UWVA 3APYA 4WDTA 2BP1A 3BLOA 1LRNA 4L4LA 2J6VA 1KFJA 3A3WA 4DBUA 5I09A 3SUUA 3WBYA 4CD8A 4E2OA 2B31A 4RZ4A 3ZMRA 1QDSA 5FAGA 1VYSX 4F40A 2Z26A 5A8PA 3L5MA 1JCYA 2NLYA 2PDLA 4PUKA 1KO0A 1GG1A 1TPWA 4JX4A 4S3DA 5FI8A 1P0EA 2O56A 3L4WA 5BMWA 3V36A 1NIUA 5HBFA 1ITQA 3TCEA 4UTLA 4MF4A 1A50A 5GPRA 4GUIA 2J66A 1SU5A 3AXMA 4IPNB 1E6NA 1E51A 1DVJA 2WHKA 1EP2A 4OU1A 3SUVA 3WF2A 4S3JA 1TIWA 3VIJA 2D20A 1CGYA 1EYWA 5DFAA 4PRRA 1QWGA 1JD7A 1ONWA 3H22A 3AJXA 4H1ZA 3KAOA 4WVXA 2Y70A 4DNHA 5HQEA 1GYLA 4D6HA 4WY0A 4XSMA 3O7UA 2TSYA 4DQWA 1E1EA 3CH0A 3C0LA 3K1DA 2PRMA 4NU7A 5FACA 1SSGA 2FZ9A 1NOWA 4R88A 4NIRA 5C2GA 4UFIA 4W4QA 3WQOA 3G6MA 3AALA 3HOJA 4HHPA 2GOKA 5H8PA 4M51A 1SMDA 3P0WA 3BSGA 5I3IA 3UQNA 5DMMA 4OECA 4QG6A 5HMSA 3QLDA 1EZWA 1IEVA 1XCXA 3GHUA 2SFPA 4N9DA 2J79A 3WNMA 1H7RA 3KE0A 5CPOA 3KRSA 2F38A 3KHDA 2VQUA 3TH6A 3M0JA 3RLHA 3AS0A 2BSLA 1V6TA 3MKVA 4EF8A 4Q8UA 2G4JA 4PBEA 5G4HC 2Q09A 3Q4DA 4P2VA 4M6QA 4W5UA 3QMTA 1TR1A 1YTKA 1FXPA 2PGEA 1P4CA 1FHLA 1V6VA 4XD6A 3Q45A 2GQ9A 3WQWA 3GXTA 3VZZA 3P14A 2D2OA 3N6QA 2NUWA 2PLCA 3G0XA 4IM4A 1GOWA 1G5AA 2OJPA 1LP6A 3FGCB 3VKCA 3WBWA 3G3MA 4GCXA 3HQNA 3M64A 3CL6A 4K8EA 5I23A 3T55A 3PWAA 4PFMA 3T2PA 2ZX6A 3B8VA 3BC9A 3A12A 3ES8A 4NX5A 2ABBA 5HNNA 1EUAA 2W79A 1IR1A 1CGUA 4UOZA 5C9ZA 4I9TA 3UGVA 1E0TA 1RAKA 5HR6A 4GY0A 4UMCA 4LBUA 3AYVA 4GHRA 4TVDA 1XPYA 4UFKA 1UD3A 1RUSA 3MSGA 1EHNA 5HWNA 1UD6A 3PTQA 1LUCB 1G4TA 4HN4A 3TQKA 3NO3A 2CW6A 3EX2A 2KX9A 4K37A 2Y89A 3F4VA 4O8RA 3W84A 3IJIA 4ZOBA 4MKNA 4FA3A 1Z7AA 4F8XA 4RE0A 3OBAA 4OQVA 2QHAA 1VLIA 4MY9A 4LUSB 4EIVA 1P0DA 4BWLA 4GZIA 1WP6A 3H4WA 3ZR5A 1QI5A 4IHCA 3B06A 2AMXA 4KGLA 2PWEA 5AC6A 4DUWA 5M1TA 2D2JA 4AWEA 1GPWA 2V38A 1QVBA 1TJPA 3F4NA 2IPGA 2A0NA 3N2CA 5C9WA 3P81A 1FWRA 4HU0A 3A6OA 3HM7A 1OD0A 2YGYA 3FA5A 1WZAA 4Q8QA 4GACA 4S1FA 5FOOA 4HSNA 1Z69A 4J40A 1OYCA 1ISWA 5D03A 1XYAA 1T8QA 1PX4A 3U2OA 3VNMA 3PZNA 5DLCA 1OF6A 4GY7A 4IQJA 4GXMA 2PDIA 4PL1A 3S5ZA 1K9TA 2A1YA 1X7FA 1XBVA 1T7LA 3ES7A 1LROA 2PCEA 2CHNA 3G77A 4O12A 4JTTA 3QM3A 4NYYA 3I7SA 3AIRA 4HA3A 2DUXA 1EA0A 1XYBA 1K8ZA 3A4AA 1OBAA 4DPPA 3W9ZA 1I2QA 1JULA 4ATDA 3C2YA 3WFLA 1QK0A 1JFHA 2AQWA 2HQAA 1DORA 1X39A 1B0IA 3EZ4A 5F2IA 3S6OA 4E0CA 3NDOA 4ZB5A 1F73A 1FCUA 1EP3A 4JTQA 4YL2A 2NW0A 2VVSA 1PX8A 1TR9A 1U1HA 2BHUA 3GZ3A 4DAFA 3EDKA 5FD0A 3L67A 1EEXA 3ABSA 3E9AA 3GTIA 4QX4A 1KGXA 3GB6A 3MUAA 3VGHA 2OGYA 1OB0A 3KCLA 4Y9MA 5K7JA 5LHFA 3WDIA 4LVFA 5BW6A 3FAWA 1PB0A 1IIGA 5A1AA 4GUHA 2YA2A 4F0SA 4FNTA 5BROA 3W86A 4HA4A 2YCKX 2WNZA 1G4PA 4AZ7A 3BLIA 3WD1A 2XIQA 4C6IA 2EPNA 4FXSA 3FJ6A 1HL8A 3QN3A 5F7UA 1JD9A 1FDJA 3N2BA 3ENLA 4ZSTA 1VFTA 1UKQA 3INPA 3QXBA 5E0FA 1EF3A 4FF5A 3VPLA 3GH7A 1HJWA 4CNSA 1OM0A 4A3QA 1W3NA 1XC4A 5AKQA 4HNCA 5A8NA 1QNOA 4MY1A 3W1TA 4RUBA 2G96A 5CPNA 4KFPA 2NX1A 4E6MA 3PBVA 4AY8A 1JPDX 1V0KA 2J13A 3OLEA 1Q2SA 5I02A 3TIMA 3KTXA 4JN6A 1TWSA 2DY3A 3ABZA 3Q2DA 1R47A 1UH2A 1V0MA 1UWRA 1K7EA 2O4QA 2AKZA 2YCIX 1DE6A 4W85A 3R0KA 2XFYA 1NFGA 1E3XA 4AH7A 2IMRA 1D7FA 1OFPA 4DEFA 3WJZA 1EH9A 3P67A 1MWOA 2EAWA 3QBUA 2J7HA 3VIFA 3BG3A 4JY9A 2HNHA 5EFDA 1MO0A 2DW6A 3HQ1A 3VD5A 1M9HA 3MU7A 3OG3A 4GLEA 2ATSA 2A21A 1WB0A 3HG4A 4M24A 4B2DD 5H8UA 1UPPA 3B03A 3WF3A 1BVWA 2ACRA 1DJQA 3B3DA 4G9PA 4FK9A 4HK5A 3P82A 1V4YA 5IXEA 1C29A 3BW3A 4QGCA 1RH9A 4WSHA 2YDQA 1BSLA 3GNDA 4LNCA 4Q4SA 2CLIA 4UTKA 1I1WA 4FX7A 1HW6A 4HPJA 3NO5A 1PIIA 1UWQA 2C1IA 3IGSA 1SO5A 3DKJA 4UC5A 4Q8PA 1VBUA 1A5MC 2DSWA 4N4PA 2X7VA 4C6CA 2XTKA 3T4CA 1GORA 2X40A 2GQ8A 3KFTA 1VRDA 2VD9A 3I3DA 1JVNA 7ENLA 2VDHA 1BWKA 4ZE4A 4K1WA 5FJTA 3U0HA 4FAMA 2WZTA 1AODA 2ZRZA 3BCFA 2GSEA 2WJDA 3DGRA 5CBBA 1RQHA 2V5BA 3UZZA 2PWVA 4I7VA 3UWEA 2E28A 1UR0A 2BXVA 4I3GA 1XW8A 3HFTA 4I8YA 4DI9A 4FLRA 2XZ7A 4Y2WA 4GXPA 3H26A 5DANA 3ARPA 3GS6A 3WNPA 4LV9A 4HU8A 4O17A 4JTDA 5FJPA 4KCUA 4JZ5A 6PTDA 4K38A 1TKKA 5CGMA 3RGTA 3ALFA 3MC5A 4QLKA 2CZEA 3RPDA 1YEYA 4EWND 3UA3A 1MI3A 1LOQA 4X3ZA 3OO2A 4AF0B 4B90A 1C3FA 3EWCA 4Q8TA 4XAFA 2C0AA 4JFSA 4REQB 4ICNA 3EXRA 4E8CA 3C86A 3LNPA 3WH6A 2AAAA 4ZBCA 1CXHA 3WF0A 3IIZA 3LMYA 4JDBA 2OLAA 3AMDA 1W9VA 1RSCA 1CIUA 3KM8A 4IWWA 1MW3A 1RBOB 2V9DA 1ZBKA 2BX7A 4O1EA 2PDKA 2XH7A 1BLIA 3K4DA 3NCOA 1OZMA 4XD5A 4GOAA 1Q4NX 5I24A 4DJDD 2JGYA 4QR6A 2FPVA 4WUIA 4NY2A 2QPXA 4CQ9A 2VEKA 4IIEA 1NFPA 5J5RA 1W5QA 2FQIA 4LVDA 1C8QA 2EG8A 3N3MA 4W7WA 1AJ2A 3N4AA 1FHDA 2OOGA 1TA3B 4GYPC 5A8QA 4GQQA 2XIJA 4CKQA 2E9MA 3KBJA 2CHOA 1ENUA 1RLCL 3NNTA 3A22A 2XGZA 3QQWA 5DQPA 1YMYA 3M0ZA 4GQBA 5FJIA 3IAQA 4D2JA 3SURA 3M0HA 1A5AA 1XGEA 3VNLA 3LSCA 4ICCX 1TMLA 2RDXA 4OUEA 4W7UA 1KQZA 1S46A 2HCVA 1MQQA 1QR7A 1QPNA 3W4RA 5A8OA 1S1PA 1IWPA 1V08A 2NXHA 3TYEA 2IQDA 1U5JA 4QSHA 3BLPX 2VZOA 3EWBX 3NQGA 1IQ8A 1GQJA 3CO4A 2HEJA 3W74A 3GXMA 1BQGA 4AEEA 1RJPA 1PEZA 3OHIA 5AHIA 2QAPA 3I4EA 4AD5A 3W2NA 3U2CA 1LL6A 4G5DA 1LOLA 1XSKA 1PBGA 3GHSA 2B7OA 1E1FA 3W6YA 1X6NA 3ATYA 4KFOA 3QRHA 3CIXA 2EKGA 3WMSA 3KS6A 1K9FA 4MKSA 2NV2A 3AIEA 3WQ8A 3TSMA 2UY5A 2XSXA 1JCNA 1Z44A 3QMSA 1E0UA 2B7NA 1X38A 3HJEA 4QSFA 4UR8A 2PDFA 4CD7A 2F6KA 1T6MA 1UR1A 5M03A 2ZZ5A 2WNWA 4TXEA 2D2HA 3W82A 1O94A 4PRWA 3O0FA 4HNVA 1N8WA 1WO2A 3L66A 1FHVA 3W1MA 1PCKA 4IXHA 4GH3A 3TK7A 1JYXA 1XLFA 3GU1A 4UTWA 1A0EA 2V3FA 2X1SA 3CHDA 3T08A 1BPLB 2DSUA 4JQ4A 2J7DA 2PFHA 4L9ZA 5DELA 4WX2A 2EG6A 3CTLA 2YYUA 2QPSA 2PDHA 2CPUA 3W71A 1LG2A 3SN0A 1K77A 5LZLA 1TZ7A 4Z2GA 3KVJA 2A7PA 5LIYX 3EMCA 5EFFA 1T99A 3KHJA 4UOJA 3AAMA 1XX1A 2VZSA 4AG0A 3ARZA 3MMTA 3W26A 3GXFA 4LAZA 4CCCA 2EKCA 1E6QM 5D2YA 4ZO8A 4DLMA 1US3A 1JAKA 4MWAB 1Q6DA 1AW5A 4O1FA 5CZ0A 1CWYA 1UWIA 2WMHA 1DWFM 4GUJA 3WEOA 1EC8A 1SR9A 3ZR6A 3LXCA 3M6YA 4DJED 3H53A 4L6DA 2BGQA 2PBGA 3M5VA 5DXXA 4PCNA 3A23A 3DI0A 1KM5A 1QWKA 2QCCA 4V15A 3RLVA 1W9DM 1J18A 1H7WA 4WDWA 2VZVA 3OIHA 1H0IA 2XSAA 3QOKA 1J6OA 3FFSA 4DXXA 1KBLA 4WHBA 1X1OA 5C70A 4NAEA 4AXKA 1JXJA 4MM1A 3AC0A 4OFCA 4ZQPA 3NZRA 5ABHA 2BZNA 5GVJA 2GGHA 4O28A 1B30A 4XAZA 5BWFA 5CJMA 3CBWA 3NM3A 2QDEA 3M0VA 2ODOA 5E0CA 2NX9A 1SW0A 3W7LA 4DBWA 1PZ1A 5E6YA 1QATA 4WOQA 2R1LA 1PYMA 3IV8A 5D32A 4S38A 1QW9A 4D6FA 2X7WA 2J27A 4AD2A 3VA8A 2VXNA 2EF9A 4DWDA 5ABFA 2QMKA 2OTDA 2XPKA 3ATZA 3R11A 4UTUA 4KIRA 1GZGA 2PRHA 1R8LA 4ZOCA 2OWCA 5A8MA 1UG6A 2EPMX 4DZ5A 1DXEA 1UBSA 5DEZA 3MO7A 4NI3A 1DKWA 3U3HA 1IYXA 1SW3A 3L21A 1FVPA 3LY0A 2CLEA 3QYQA 1R5YA 2VWSA 2XH2A 2PDJA 1TPDA 4DY1A 3KVMA 2QJHA 3NTYA 4AB4A 1QPOA 3LNMA 2DW7A 4PUEA 2V6AA 3H2EA 4FF7A 5JH2A 1JJKA 2PTYA 3CZ8A 1HG3A 5FESA 4H9UA 3MPGA 3HGRA 1FWGC 1JUKA 5AN7A 4W87A 4PEKA 3TC6A 2Z25A 1TCDA 2VELA 4WF7A 4IQEA 3VGBA 3SCWA 4UCFA 3LOTA 3P80A 4TTUA 1L9WA 4QJ3B 4OTKA 4AZ6A 1FKXA 1AH4A 3BSMA 3WZ0E 3GG0A 2G3IA 4FLSA 2IS7A 1XRSA 2AQVA 4UR9A 4S2BA 4I5XA 1A5BA 2ZZ6A 3N17A 2P10A 4ADSA 2OMAA 4X22A 4D6CA 3KWSA 4QRNA 3LCFA 3MP3A 1LRQA 1W1B1 5BXTA 1X98A 3E5PA 2WC4A 3WNLA 3BZGA 1V5XA 2Z28A 2A3AA 3STPA 3VTRA 5I3FA 3TMLA 3MB9A 1JUBA 1H5VA 4ZB2A 1E72M 2F8QA 1XLKA 4IFRA 3UXAA 4RE2A 3EMZA 1JCTA 1KBIA 3WJSA 2I5QA 5MHBA 3CLWA 3WSUA 3OGVA 2ZX5A 1R2SA 1HJQA 5CC7A 3FSUA 2PS2A 2Y2WA 4JFUA 3W1PA 1I2RA 3GKFA 4QJ1A 1DYSA 4PEEA 4CN1A 1QPQA 1NEYA 4LYPA 5AYZA 4N6FA 3OYXA 3H70A 3DBPA 4ACZB 3NOEA 4K2SA 2ZE3A 3SCQA 4RLIA 1GYNA 2R1KA 4JIQA 3WKZA 3RHGA 4H9ZA 1XC6A 2FB3A 4LWWA 2VR2A 4WY0B 1PJ9A 5AHLA 2Z1XA 3MMUA 3S9ZA 1UJPA 1UROA 3DYPA 1UD4A 1G1YA 2GWGA 2DFAA 2E4TA 3HQPA 2EXOA 3Q65A 4JN7A 3M0MA 4CEXC 1RJQA 3M7WA 3MP5A 1RK5A 2YA1A 1W1IE 2YL6A 3GU9A 5DRCA 4FIQA 5XINA 4B2DA 4J4KA 5H2ZA 1IWAA 3F7JA 3IJDA 2WQDA 4JDYA 5M5DA 4S3EA 4HCHA 5CPTA 4MKVA 1WKFA 2J25A 2ZTJA 3OLIA 2WV8A 3FYPA 4PZVA 3SGUA 1CXFA 4GK8A 5BOEA 1JZ3A 3EA3A 3KVKA 4TMBA 3C3NA 5HUPA 1QK2A 3S1VA 1YDYA 3B8DA 3E38A 1CDGA 1IV8A 4ECLA 4HBKA 4OOZA 4ZVJA 4JGDA 4QP0A 3L5AA 3KBNA 4I8DA 3SCSA 4XZHA 3VD9A 3KL5A 1OADA 3LCXA 2YDRA 1I60A 5ENLA 1HKMA 3HBLA 1G01A 3W27A 1V03A 4JL1A 3I6TA 2QS8A 6TAAA 2HMCA 2ZWZA 4DBDA 3UGRA 3MWAA 5J8LA 3RU8X 3SO7A 4HZ7A 3S8HA 4IICA 4IQDA 4OBRA 4B5XA 4L7ZA 2CLFA 4MYAA 5KINA 2QW5A 3J7HA 1VPXA 3NZGA 4A8IA 1NWSA 4A21A 1VFOA 3B4UA 3FDGA 3CUZA 3WCZA 3TYUA 1JCLA 2WCSA 1JL8A 5FF3A 2VUYA 4QS5A 1OX4B 1ZJBA 4DWSC 2DZSA 2DVXA 3ARSA 3G1DA 3QKZA 1Z48A 1UIOA 2DQXA 3AHYA 4HGXA 3DHDA 2F6UA 3GTXA 3UY7A 3BGAA 1DIEA 2JBMA 2VWTA 4L65A 3XINA 5K9XA 4L61A 5BXPA 3NGFA 3R8HA 1A49A 3MUY1 4ZB0A 3AU2A 3BLDA 5GJPA 2R91A 2E8YA 4HZ6A 2YOCA 1YNPA 1NWRA 1I75A 2ZA3A 2O92A 2G8ZA 7A3HA 4N9BA 2QKFA 1B9BA 3FVDA 3MCOA 1S5TA 2V5DA 4ZODA 4ZTXA 2HPIA 1KKRA 1QAPA 3VIOA 3W7KA 4RPPA 1U30A 4PTDA 3H2CA 2I5IA 3QV6A 4GMEA 4QQUA 5HNUA 1EQCA 3FDKA 4A3UA 2XYLA 3VX1A 1TO3A 5K3VA 4JIEA 4XZBA 2E7FA 1V6WA 2FB2A 2ZXDA 4X9SA 3LU2A 4MWAA 1KFBA 1B3ZA 1ZCCA 1XYLA 4D6GA 2XGBA 3RIKA 2YDSA 3N15A 2I7GA 2PDGA 3FHAA 1E0WA 5H6HA 3VIHA 4W88A 4ERIA 2HXUA 3UWYA 4FXFA 3WDHA 2DZTA 2QCNA 3RPMA 4OVXA 1VHCA 4LRSA 2NT0A 3QV7A 3GVVA 3PANA 1PPIA 1FWHC 1OT1A 2PDYA 2BY3A 4ZO7A 1UIPA 3UJFA 2GYIA 4ZQOA 3ISIX 1KR1A 2YA0A 1KV5A 3A13A 3NQEA 4J35A 3UY8A 3GTHA 2BY0A 3VE7A 5CG7A 4IPLA 1X8CA 3IIPA 3ECQA 3MY9A 3OTRA 1XIHA 3RMJA 4JTJA 1ZENA 1ADOA 3PBUA 3CUJA 5AYIA 1JPKA 1C9WA 3IK2A 5U4NA 1JDFA 3F1QA 4GUFA 5F2MA 5AVHA 1C92A 3UR8A 3W7PA 2Y5EA 1B54A 4XO7A 5LNUA 4DO7A 3SRDA 2OLHA 1XLJA 1Q4WA 5LNWA 1W1TA 1EO7A 4JFTA 5IBXC 5D8WA 4FHAA 1SO3A 2NLIA 2J7GA 4LC8A 1AQHA 4Q7IA 3GM8A 4AD3A 1BAGA 1C8VA 2YJQA 3DYOA 3W7GA 1F3EA 2FZDA 4NF7A 1W2VA 2GFTA 2ZUWA 3BJSA 1YDOA 4RL3A 2Z2AA 4KGJA 3MCNA 3FN9A 2WYSA 3T0TA 2X1IA 1WDQA 2DUZA 1XIJA 1H3GA 3R8GA 4BS0A 4JN8A 5DMNA 1MNSA 3TXVA 3AIVA 2C14A 4YTSA 4DM2A 1A5LC 3G1XA 4B3ZA 4NQ1A 3MBFA 4PULA 5JBEA 1XFBA 1CCWB 1XH1A 4JKKA 3K1GA 4HOXA 2BFGA 3BAYA 2HPMA 2E5CA 4R3UA 1I0BA 2ZRUA 4HU3A 1A3HA 2PGWA 5A5WA 3UU0A 1A0CA 1NDWA 2BTMA 4CQBA 1HGYA 1Q6QA 3B04A 1M7XA 4AD1A 5IFTA 4J1OA 1DWAM 4OBSA 2C71A 1W6TA 2WKJA 1YXYA 4H6EA 1RCXB 1VPQA 3L0KA 3SI9A 2WMJA 3E96A 4XK2A 1OG0A 3BCDA 4GUGA 3SW6A 1M7OA 4NNAA 3CQHA 4WJEA 1RPKA 5HULA 2F2KA 1E1CA 3ITYA 1NQ6A 2ZXQA 5K9CA 4GFIA 2Z1VA 4IG2B 1DJNA 3TYCA 2FDSA 3AIBA 3TR9A 5IFPA 3UNTA 3TTSA 3NQ6A 3IARA 4IJCA 3S9IA 3M0KA 4RKAA 5D02A 3B9OA 3WNKA 3DHFA 3GC2A 1EP1A 3EMQA 1IT7A 2V5JA 3JR2A 3GTFA 1NDYA 3IGHX 1GONA 3Q94A 5HWMA 2GK1B 1LRTA 1UMLA 2E68A 1ZQ5A 1ZZMA 1OK6A 4NASA 5FCZA 3NYDA 1E4LA 4QIUA 1OJXA 3W85A 1HO1A 4JNMA 3WJWA 1E43A 2WSRA 3KOWA 4IPIA 4AWUA 4LCRA 4WY0F 4G7FA 1AG1O 4FR6A 4M82A 3W2UA 4IP7A 1K1DA 1UKSA 4CD6A 2VC6A 3KOFA 5LXXA 1FWTA 3T78A 3WQFA 4D6DA 2XISA 4DVOA 5I77A 2TODA 4UR7A 4A3HA 4NZ4A 4CCEA 2GGEA 3C0SA 4S3KA 3WEZA 3WLHA 4WK9A 3V5CA 4O4WA 3HJZA 4AYSA 2ZADA 3GVRA 4NI8A 2FMNA 3BZJA 5JIWA 4MWAE 3IGUA 1UWTA 3P2VA 4JFVA 1N55A 2PWDA 4ERAA 4BA0A 4DJFD 3UR2A 1FCQA 3ID7A 3DERA 2P53A 2P0OA 1RCQA 4GE8A 2YLLA 4ROQA 1SJCA 2WHMA 1XLMA 4X9YA 2EQDA 2OZTA 2O7QA 4MADA 1A5KC 4IMGA 3B8WA 4LYQA 3W1XA 4H7VA 3OA5A 5HPOA 1ITCA 3LXAA 2O9OA 1JYWA 1PKMA 1H61A 3T40A 1ZFJA 4DHGA 4OKDA 3LHVA 3H2NA 1SO4A 5A2CA 5JBDA 1P0KA 4KESA 1H0GA 3QY7A 2OB3A 4Q8NA 3VCRA 1IWBA 3SIZA 4KWVA 3C61A 4Z2KA 3UR7A 1QI2A 2IKGA 3R58A 3BJFA 5AHEA 1H51A 4R7WA 3T2QA 1EDGA 4J3XA 1R3TA 2DT3A 1VP5A 3ITLA 1QBAA 4JHZA 5D9PA 3WLRA 2H3DA 3VXGA 1ZAJA 1OZQA 3B0VC 3TP4A 2WZIA 1AK5A 1LBLA 3WQ4A 1PWMA 4A8RA 1ICPA 2GVGA 3R79A 5CSYA 4PMZA 2BLEA 4MB1A 1QHOA 4DBEA 3I3BA 1EKOA 2ZX9A 3T7VA 2VDIA 3CV1A 3DFOA 2QCDA 2Q6ZA 3OGRA 1OFEA 3R6IA 2WB5A 2C6QA 4D6EA 1JIBA 1QPKA 3VIPA 2GGJA 3CHVA 1EDQA 3SDOA 4LVAA 1BFNA 4JYEA 3L12A 1KRBC 1KD0A 1I6NA 1Q5MA 2ZUNA 1FQ0A 4M8UA 4E8GA 4A05A 3VINA 2DORA 1J5SA 2FVLA 3PTDA 4JCLA 3FYOA 4HKPA 2PC8A 3PBMA 3VCCA 2ATMA 1K7XA 2P8BA 4CNPA 3PM6A 1LL7A 5D30A 1R3QA 3W2KA 4AWTA 4ZQMA 4YVXA 5I78A 4AZCB 3RILA 4B5VA 5I2UA 4AHQA 4DO5A 1CXIA 3VI2A 2A2IA 1TYGA 3GYCA 4ALDA 4U4MA 1BG9A 3PBWA 3F2CA 2GJLA 4JKMA 2YB1A 3VGDA 5CSSA 2F2HA 1EEPA 2QJIA 4M56A 3MP4A 1VJIA 4PTNA 2BWGA 2Y85A 4OWGA 5HR7A 3WX7A 2H9AA 2C1HA 2EPLX 4LOCA 3T44A 4GGHA 2ZX8A 3O1NA 4DM1A 3QC3A 1OCJA 3KBVA 3GBEA 2VKZG 3AMLA 1B3VA 4EP8C 5A95A 4Y6GA 3UG5A 1W0MA 4YNGA 4YWIA 1XINA 2W4XA 4AY1A 3TJLA 4FEZA 3QJAA 3ZT6A 4KBXA 3JZUA 3LYEA 2Y8VA 1FP8A 5BRBA 4K36A 3CXOA 1TG7A 1Q6OA 1XL9A 1GJUA 4LSBA 4GX8A 1UC4A 4MFDA 1JCMP 3PZVA 4YVPA 3HZ3A 3RF9A 4JTLA 1VD6A 4PMUA 3N14A 3SR7A 4UMBA 1HUVA 3V3WA 1XS2A 2P5NA 2VNCA 1SFJA 3GVGA 5AHFA 4GQRA 2W5FA 4PTMA 1PTGA 4K1GA 2WM0A 2R9RA 2J9ZA 3FA3A 3MA8A 3VMOA 1I2OA 1W9UA 3P84A 3CYVA 3LI0A 4XBJA 1W5MA 3ONBA 4Z0SA 5JIPA 3DFPA 4O11A 5DMYA 4WGXA 4NSBA 4JNYA 5DO8A 1ISYA 2IQTA 1GOIA 1VCFA 3DBNA 4POCA 3IPWA 2OO0A 2HS6A 1WV2A 1WXJA 1YLVA 7TAAA 1C7SA 3WIJA 3U2ZA 3W1RA 5CSRA 3EWWA 1XISA 3NOYA 1J0YA 2E9LA 1Q7ZA 3VOHA 3ABQA 4GIRA 2R14A 4MLRA 4B5UA 1ME9A 4IG2A 1BRLA 4HA1A 3CUGA 1T8XA 1ONXA 2XWDA 2PDCA 2YFNA 3W81A 1UB3A 4BEUA 2D3LA 4UIOA 2VI0A 2ZKMX 1EJTC 2OYMA 2PDXA 3C5QA 2G95A 3LQGA 4ASTA 1JNDA 5D33A 1VFSA 2ZUUA 2TAAA 3OVPA 5F2LA 1SQ7A 4AQLA 4IL0A 2I56A 1VFFA 4LYKA 1NDVA 2WZEA 3SBFA 1XQLA 4LEFA 3WD2A 2DH3A 4IPJA 3BLKA 4C91A 3UEQA 1US2A 3AS1A 3GO2A 4FNRA 1DL3A 5G2WA 4LX4A 5LA1A 1LUCA 3M43A 4PSRA 2QT3A 1P6WA 1XG4A 4GNVA 3ITOA 3TWAA 2QJMA 2V2CA 3S1XA 3F2DA 2E8ZA 2REQB 4IFOA 2FHFA 4D8ZA 3BLLA 4HNUA 2XVLA 4WZHA 4BWLC 4V33A 3AXKA 4QDWA 3CZGA 2E5DA 2WNNA 3SCNA 1G69A 3UZ5A 1TV4A 3OVQA 4RV8A 4US5D 4UFLA 1D3HA 2Y63A 3ANUA 4OV9A 1V3LA 1BVZA 2HXTA 1UWSA 2WVVB 3SFWA 2GVEA 4NJJA 5H91A 2V3EA 7XIMA 2JQXA 3FKRA 2QUUA 3K30A 2FHBA 4NVTA 4ROPA 4WKHA 1E70M 3LUTA 2G3JA 3A4WA 2CZDA 1VB9A 1DQXA 1O1ZA 2Z1WA 2JKEA 3H2OA 2GZXA 4RDZA 4JEJA 3AHZA 3H2AA 4RDWA 3PZIA 2DJXA 2WKGA 4DRSA 3AYTA 3CZLA 2D2GA 2Z1BA 4HYWA 4R33A 2HNEA 1KNWA 2EG7A 3AZRA 3CQ0A 2ZX7A 1P0BA 1ITUA 3VKKA 1A5UA 3OLGA 1VIZA 1PL9A 3CWOX 3URQA 3TFXA 2GJXA 3CASA 4YYCA 4PMOA 3SUSA 4L9YA 1YDVA 3E2QA 1HO4A 4O57A 2Q02A 3A64A 3I10A 1AUSL 3SRFA 4A22A 3AUJA 2FGBA 1JF5A 3ARYA 1TUFA 2I9EA 5MF5A 4H19A 4IXXA 4OT7A 4KCVA 3H21A 4PUWA 4GZ7A 1TWDA 3FY1A 4B4FA 2KZHA 2QQ6A 2PDQA 3G1SA 5LXEA 4S2CA 1KXHA 1P1XA