2F6KA

Crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
306
structure length
306
Chain Sequence
b'SKIDFHTHYLPTSYVEALKRHVPGDPDGWPTPEWTPQLTLNFMRDNDISYSILSLSSPHVNFGDKAETIRLVEAANDDGKSLAQQYPDQLGYLASLPIPYELDAVKTVQQALDQDGALGVTVPTNSRGLYFGSPVLERVYQELDARQAIVALHPNEPAILPKNVDIDLPVPLLGFFMDTTMTFINMLKYHFFEKYPNIKVIIPHAGAFLGIVDDRIAQYAQKVYQVDVYDVMHHVYFDVAGAVLPRQLPTLMSLAQPEHLLYGSDIPYTPLDGSRQLGHALATTDLLTNEQKQAIFYDNAHRLLTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords metal-dependent hydrolase
publication title Crystal Structure of ACMDS from Lactobacillus plantarum
rcsb
source organism Lactobacillus plantarum
molecule tags Lyase
total genus 102
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2f6kA00
1P1MA 4C6LA 4PBFA 3GTXA 4QTGA 4LALA 1ZZMA 2AQOA 4IG2A 3PNZA 3C86A 3PNUA 3IARA 4C5ZA 4R88A 1XGEA 3TN4A 4GYFA 3ID7A 4NG3A 3MVTA 4G2DA 4DLMA 4NI8A 4ZSUA 3EWCA 3OOQA 1HZYA 1FWCC 1DPMA 1V79A 2P50A 1V7AA 2EG8A 2HNHA 2QVNA 3ISIX 1KRCC 4XD6A 3JZEA 5HMDA 4DYKA 1K70A 1YBQB 5E5CA 2RAGA 2IMRA 4J2MA 3K2GA 3CS2A 1YNYA 3URBA 2Y1HA 4BY3A 2UZ9A 2YZ5A 4B91A 1UIOA 4G7EB 1W1IE 1YBQA 3GIQA 2OB3A 4H9VA 3WZ0E 1POKA 1V77A 4XAYA 3UR2A 4C6BA 4EPKA 3MKVA 4C60A 2E25A 3MPGA 4C6NA 2VM8A 3GU2A 4Z42C 1RK5A 3QGKC 1XWYA 3HM7A 3E74A 3FEQA 2QS8A 3EGJA 4UBPC 4IGMA 4LCQA 1J6OA 1ONXA 1K1DA 2YB1A 4INFA 4WVXA 4GC3A 2FTYA 3DUGA 4G7EA 3O7UA 4GY1A 3F4CA 4LEFA 2HPIA 4I6KA 1POJA 3MVIA 2FVKA 3PAOA 4DI9A 3PBMA 4KERA 4BJHA 1QW7A 4LFYA 2UBPC 3GTIA 3URNA 3G77A 2D2HA 2I9UA 4XAGA 4PCNA 4UB9A 5FSDC 4EPBC 2HBVA 2HQAA 4HK6A 4KEVA 1YMYA 3MTWA 4IFRA 5A6TC 4R7WA 4JOMA 2ANUA 2CZVA 2Z24A 4H01A 3LU2A 1KRMA 2BB0A 1EZ2A 4HJWA 1A5LC 1V51A 2O4MA 3SO7A 2R1LA 2FFIA 2F6KA 1R9YA 4B90A 2I5GA 4I6VA 4LANA 1R9ZA 1I0BA 3QY6A 1ITQA 4L9XA 1WXYA 4GY7A 2DVXA 1FKXA 5CH9A 4QS6A 4CQCA 1PTAA 4WHBA 3IPWA 4LAMA 2E1WA 1EJSC 4XD5A 2QT3A 3CAKA 4ZSTA 2PGRA 2Z29A 1UBPC 1ITUA 2WJEA 3OVGA 3QGAC 3LY0A 2ADAA 1PB0A 2AQVA 3ITCA 3A3XA 5G4HC 4C6KA 1O12A 3IACA 1A5NC 3TN5A 3E0FA 2Z25A 3EWDA 2ICSA 3HTWA 3LGGA 4R85A 3K4WA 4ICMA 1EJXC 3DC8A 3D6NA 1FWBC 2EG7A 4GBDA 3UF9A 4XAZA 4KESA 1M65A 4LAKA 4KIRA 3DCPA 1BF6A 2DVTA 4WGXA 4F0RA 2W9MA 3AU2A 2WJDA 3QY8A 2R1NA 1RA5A 4NP7A 1P6CA 3PANA 3RHGA 4C6OA 1IE7C 3TN3A 2VUNA 3F2CA 2YB4A 2Z2BA 1JGMA 2P53A 4XD3A 4C6IA 4CNUA 4EPDC 3WYZA 2QPXA 3BE7A 4XD4A 2OGJA 1I0DA 3LA4A 1RJPA 3F2BA 2KAUC 3S2LA 1O5RA 4PBEA 4C6MA 3AUOA 2Z7GA 2GZXA 4H9ZA 4EPEC 3IJ6A 1GKRA 4F0LA 2HBXA 2AMXA 2EG6A 4LH8A 4RDWA 4QS5A 2VC7A 4GY0A 3T8LA 4IGNA 3MDUA 4KQNA 4C5YA 4OFCA 4QROA 3URQA 4KF1A 4C6QA 4DNMA 2ZC1A 4RE0A 4L6DA 4GX8A 2G3FA 4ERIA 3T1GA 4DI8A 4H9XA 2PAJA 3GIPA 3FDKA 2FTWA 2OODA 4ERGA 4MUPA 3E2VA 4ERAA 4YIWA 4GOAA 3UPMA 3E0LA 4KEZA 1EJWC 2D2GA 3S2NA 3IRSA 2Q01A 1WXZA 5HMFA 1RAKA 3LSCA 3LS9A 4J35A 3LNPA 1FWHC 4H9UA 3NEHA 3K5XA 1PSCA 1YIXA 2R1MA 4B3ZA 2GOKA 3MSRA 2YXOA 4KETA 3RN6A 2XIOA 3SFWA 4D8LA 4PCPA 4C6CA 3OU8A 4HK7A 2O4QA 3A3WA 3O0FA 2R1KA 2Z4GA 1RA0A 3V7PA 4H00A 4AC7C 1R9XA 4IF2A 3A4JA 1UIPA 2R1PA 2BGNE 4GXWA 3S4TA 1GKQA 2Z27A 3R0DA 3S2MA 4V1YA 4GK8A 3QY7A 3GTHA 1XRTA 2GWGA 1A4LA 3GU1A 1RJRA 4CQBA 3N2CA 4J5NA 4RDZA 3OQEA 2PGFA 1EF2A 3GU9A 4IFKB 3IV8A 1XRFA 2Z28A 1A5OC 1E9YB 1NDYA 4GZ7A 3E3HA 1QXLA 4P5UA 1UMLA 3IGHX 2FVMA 1GKPA 4E3TA 1EJRC 3RYSA 2A3LA 3ORWA 1NDVA 2VC5A 4IQJA 1EJUC 4XAFA 1S3TC 1EJTC 4IFKA 4F0SA 4CEUC 3AU6A 4LCRA 4QRNA 4TQTA 4RZBA 3F2DA 3KM8A 3MJMA 3F4DA 3NQBA 1VFLA 4HA0A 1FKWA 3FDGA 1J6PA 1EYWA 4C6EA 1RK6A 3B0XA 4CQDA 1KRAC 4DZHA 3UBPC 3S2JA 4KEUA 3WMLA 1J79A 4BKNA 4EP8C 1ADDA 4H9MA 3E38A 1FWFC 3T81A 5HMEA 3TNBA 4C6FA 4M51A 2Z00A 2HPMA 1FWDC 1FWIC 1A5KC 4PE8A 2WJFA 1M7JA 4AQLA 5AKQA 1KCXA 1NDWA 2DVUA 4HK5A 4DZIA 3UR5A 2Q09A 4H9TA 1P6BA 1RJQA 1ONWA 1FWJC 1NDZA 1PO9A 5LXXA 1M68A 4CNTA 1NFGA 3GG7A 5FSEC 4IFOA 2WM1A 4H9YA 4V1XA 2VR2A 3RCMA 1J5SA 4GX9A 1V4YA 3URAA 4LCSA 3TN6A 2OOFA 3B40A 2D2JA 4C6JA 1K6WA 1EJVC 1A4MA 3GRIA 3LGDA 3NURA 2GSEA 1FWAC 4DO7A 4C65A 2GWNA 1KRBC 2Z2AA 3GUWA 3LSBA 4RDVA 2PLMA 4B92A 2OQLA 4C6DA 1A5MC 4C6PA 1FWGC 1FWEC 3GTFA 1E9ZB 4RDYA 1YRRA 3CJPA 4DLFA 3OJGA 3OODA 4IH3A 4IG2B 4QSFA 4CEXC 2PUZA 3HPAA 4DIAA 3B0YA 4LAOA 4CNSA 3ICJA 3MDWA 2Z26A 2VHLA
chains in the Genus database with same CATH superfamily
2UY2A 2P10A 5D32A 2FTPA 4HHHA 4PTXA 1JZ6A 4E2VA 2X42A 4L4LA 1HL8A 3SIMA 1TQJA 4K39A 1HVXA 1MQRA 3C2EA 4GYFA 4Z2IA 2PBOA 3G1YA 1SR9A 1X8FA 1J5TA 3EWYA 1FWCC 3AZRA 4Q8QA 3ARRA 4RV3A 1V0MA 3W86A 3RCYA 3WMSA 2DZAA 2WSYA 2NV9A 4XZWA 2YL5A 4U2ZA 1OB0A 5I3DA 4YNGA 4JIIX 5FOOA 1W1IE 1SJCA 3SM0A 4Z2KA 1LORA 1POKA 1V3JA 4NZJA 2PFHA 3GH5A 1AQHA 2WMIB 4LUTB 1E1EA 4WVXA 4EXAA 4PUDA 3VGBA 2OR2A 3F4CA 1VFTA 3TFCA 2FVKA 1RCOB 3PWIA 1OCBA 5AC5A 4UCGA 3URNA 3VABA 1WPCA 3GW3A 1LQ2A 2PE4A 7ODCA 5DQPA 3NZQA 3QR3A 3W24A 1QCWA 4L65A 4JEQA 2FFCA 2Y63A 2Y8KA 3QFWA 1OG0A 1XLGA 4Z1DA 4HT3A 1ZCOA 3LXCA 4UMAA 1SVDA 2FZMA 4QP0A 4GQRA 5FJJA 1CBGA 2YL9A 3GVGA 4I6VA 4TU1A 2EKGA 2VFIA 3LHZA 3KW3A 4GY7A 2PGWA 1V6VA 2QJHA 2ZZ3A 2PDPA 3PSWA 4IMDA 3PUGA 1SW0A 1WKEA 4XVDA 1KXTA 3Q45A 1XUZA 4YTRA 5CBJA 4HHLA 4IJRA 1IT0A 3VD7A 4YWSA 4AH7A 1R7OA 3VIIA 1XDLA 4MJ2A 4EANA 4WY0B 4ZE4A 3UF9A 4J3TA 1R3TA 2PP0A 1QHZA 2WJDA 2H90A 1DYSA 4N4PA 5BU9A 2P53A 3WQ6A 4CQ8A 2J7CA 2TODA 2W5FA 3IS4A 1ZB5A 2D22A 3HV8A 1LZOA 3GBDA 1O5RA 3E5BA 4DJFD 4WJXA 2NUXA 4HN8A 3ABSA 2XHYA 5HATA 4LAUA 4DUXA 1IT7A 2VZTA 2AKMA 4LVGA 3VGFA 3UXKA 3W88A 6XIMA 2UY4A 2P8CA 4GYPA 2AGTA 4M24A 4Q4QA 3MDUA 3OQ8A 1YXCA 3URQA 2ZRWA 4V15A 2A4AA 3PZUA 1X7FA 3H2FA 2INZA 4DUOA 4M1BA 2YXXA 1MMFA 3VCRA 1CT5A 1YTEA 4ERAA 4YIWA 1P43A 4S2CA 3PF3A 4MDPA 1LUCA 4DNHA 1Q7MA 1JJKA 2X0SA 3ARTA 2E9LA 4R27A 4YS1A 1FWHC 4XO7A 1GQIA 1A5UA 1H4PA 4L1WA 1OX6A 3F4NA 5IOBA 5C9ZA 1CXFA 1KCLA 1F4HA 3AIQA 2IXUA 3G1DA 2E9MA 3W87A 3NTYA 5BMXA 1E73M 4IX2A 3ZWSA 3HA1A 2R1KA 5FESA 4PUUA 2BHUA 4Q4MA 3BTNA 5CPOA 3NQMA 1J0YA 2XH2A 4PMUA 1XLJA 3S5ZA 3STPA 4GK8A 1W0MA 3BLLA 3N2OA 1A4LA 2C8NA 4CCCA 1ZY9A 4Z1BA 5JVLA 3BOLA 2PZ0A 3KOWA 3UWWA 2V63A 4NKCA 3GHUA 3W1MA 4M3PA 1QXLA 4QQ3A 2VP8A 2FHFA 5FIPA 4N9CA 3B4UA 5BNKA 4E3TA 3NUKA 2D20A 5F4SA 3GHTA 4FXFA 3BSGA 1S3TC 4JYEA 5K9XA 4CEUC 3K8KA 2HK1A 3EDJA 2FJKA 3LD5A 3RLHA 3V35A 4OT7A 1VFMA 4JY9A 2QUUA 2HV5A 4DZHA 1JUEA 2YCLA 4BKNA 4HMDA 4E38A 1ADDA 3VD5A 4H9MA 4OU1A 1CI1A 3CWNA 3USZA 1MEIA 1LT7A 3LLDA 2Z00A 3A23A 3G1HA 4PRRA 5C2GA 1E51A 3EBVA 4JFVA 4NZ3A 4GGHA 1W5NA 4K8HA 1FWJC 3TSDA 1VH7A 1KD0A 2OOGA 4XSMA 1SFLA 3JW7A 1O5KA 1UC4A 3TKFA 3VIPA 3KCJA 1B54A 2DQXA 1TVNA 3URAA 3NIYA 1H1YA 1W9PA 4YYFA 5BYWA 1XBVA 2E6AA 5ABTA 1CXHA 3NURA 2PRLA 2ZRUA 4DO7A 3ITTA 4MKSA 3HQOA 2OYMA 3CBWA 1XIHA 3TC6A 5CZTA 3FXGA 3SUSA 1IEQA 1LWIA 4YTSA 1W37A 4D6CA 2X05A 5I03A 1DIOA 3VKCA 3L0KA 1P1MA 2MUCA 1HT6A 3GTXA 4D6FA 2BY0A 1M9HA 2AMGA 1RR2A 2BLEA 1XGEA 5BOOA 1P5BA 2VFGA 1W9DM 4KPLA 3UXIA 4O4VA 2V5CA 1KQYA 3DKJA 1KKRA 1V79A 3VMOA 5LNWA 2BZNA 3CMGA 1AZ1A 4K8GA 3T8QA 2PGEA 3MO4A 4MPQA 3I4KA 3R89A 1H7PA 5HMDA 3WD0A 1BD0A 3LTYA 3OIXA 3NA8A 2W61A 4YU1A 3U2OA 1GQNA 3VNIA 2UZ9A 3AROA 1A50A 3ELFA 3M5YA 4HHPA 1PDYA 2YW3A 1JCYA 4XZLX 4ZQOA 1MZHA 5CG0A 4H7VA 4L1GA 3BMXA 3FEQA 3ZZ1A 5CBBA 5K4ZA 3SGGA 3MZ2A 1S2TA 2OGYA 2HPIA 1J01A 1ENUA 1EQCA 3CQKA 2OO6A 4Z2JA 4Y9PA 1XIBA 3FNDA 4U28A 3S5SA 4MFDA 4D2JA 3T78A 2XGZA 4DZ5A 2G41A 4GUJA 1LL7A 4GQGA 3B9EA 1HW6A 3ME3A 4N2YA 3DYOA 1NY1A 3H53A 3VGGA 3E1F1 1DJNA 1ZJBA 2Z1VA 4RJEA 4CU8A 4N02A 3L12A 5DXXA 2FFIA 3PB0A 4E3VA 5A95A 3L2IA 2BGQA 1UUQA 1NEYA 4FSAA 3HZ3A 1EP2A 4BWLC 1XLFA 1JDCA 1SO4A 1BGGA 1JRCA 2P1FA 1I0BA 2SFPA 4FOUA 5FI8A 2QJJA 4M81A 3RCNA 2WQPA 1UWSA 3F7JA 1I8JA 4UTMA 3AMKA 1XXXA 4HOZA 3DFSA 2ZX8A 3HIJA 4UTHA 5LNRA 2XIBA 3B8VA 5DMNA 4MNJA 1WQ5A 4C6KA 1O12A 4O57A 2Z7KA 3IACA 2VC6A 3TE9A 2BBFA 3AS0A 3R58A 4CQAA 1YE6A 4U10A 4PMDA 3T2OA 4QDMA 3F1QA 3L4YA 2I5QA 1Y5XA 4NAFA 3CPGA 5FF2A 3RR4A 3HBLA 3QBUA 3WDHA 2NW0A 4C7DA 1VBUA 4JL2A 4KWVA 6CGTA 3LI1A 1Q8JA 1Z44A 3W7MA 1REQB 2PEVA 2V8ZA 2R82A 4EK7A 1KR1A 2XTKA 3VIFA 2V2HA 2DP3A 4IUGA 4AD2A 1VLWA 3MO7A 1R3YA 3VD9A 1FXQA 1VJSA 2A7PA 3IUDA 4LUSB 2V9DA 3RRXA 1JNEA 1US0A 2DUXA 1KGXA 4IPJA 2INEA 3L2LA 3EDDA 4BR1A 1H11A 2VX6A 3M0MA 4P8WA 4XUGA 5U7SA 2DT3A 4LH8A 2YFOA 2NLIA 1Q7ZA 1DHPA 1TZ9A 3U9IA 4IMCA 4KQNA 5CLWA 3ITXA 2P0OA 4MTVA 4RE0A 1F9CA 4EE9A 3ANUA 1AH3A 3ITOA 4R7JA 1WB0A 5CPNA 1PIIA 4GLEA 4KH2A 3FDKA 1V0LA 2JK2A 4IUOA 3ZLHA 4LU0A 3R8GA 1E56A 3TW7A 3W7QA 4TX8A 3FXYA 5LA1A 3C5QA 3I68A 3CHDA 3TW6A 2BVWA 2PTYA 1ECEA 1RLDA 5H6HA 3AZTA 1LOLA 2Z0IA 3J7HA 4UTIA 3L4WA 3TAOA 4IZGA 5HNTA 3CGTA 2B7PA 1XBYA 2W3ZA 3QYQA 1TMHA 2EQDA 2B0MA 3N12A 1UR0A 3LV6A 3TYBA 3TC7A 3V5CA 2DZPA 2CWNA 3SFKA 4AC7C 1K3UA 5GNXA 3QLDA 3W81A 3MKKA 4JTDA 2DZSA 3A9BA 4M7SA 1KB3A 3LGEA 5CZKA 1Q2RA 1KM6A 5D04C 1GKQA 1UROA 2WNWA 4O19A 4V1YA 3QY7A 1IXOA 3IUIA 1W1PA 1XLAA 1KXHA 5C5YA 3GNXA 8XIAA 4TTGA 1ZFJA 1PKLA 1HP4A 1YLVA 1ZCCA 3EWUA 4EAMA 1DWHM 1GZ1A 1VJIA 2WVUA 1U33A 1ZENA 2JBMA 3LYEA 4RNFA 5HPCA 4AWUA 3WJWA 3AJ7A 3F03K 5FD0A 3S6DA 4HU8A 1ZTVA 4PL1A 2A6LA 2J47A 3ITVA 1MRAA 4GZJA 1W1A1 3AS1A 4Z0SA 3C0LA 2VZVA 5EFFA 4Q32A 2X41A 1XGZA 4J3WA 1NP0A 1XSKA 3GBEA 2QULA 1AMKA 3KWXA 1OFEA 4DF0A 4AB4A 1IV8A 2WNNA 2Z6IA 3W23A 4JDBA 1IGSA 3BGGA 4LVAA 2Q8XA 4XBSA 3UJ2A 3N17A 1UR1A 4A29A 5G4WA 4YTTA 1QK0A 3H23A 3KBVA 3VILA 1V4YA 3HGSA 3TN6A 3T4CA 3BK0A 2KX9A 2OJPA 4OQVA 1JPHA 1NWUA 1TV7A 5HPOA 4S3GA 2XG9A 1JCNA 1NF7A 3DGRA 3AI0A 4B92A 3H4XA 1DWIM 5F4XA 1JZ3A 4BHYA 3CMFA 1Q6QA 3NO5A 1F6PA 4GIRA 1Q6RA 4IG2B 3BLDA 4DM1A 4JDYA 2F61A 4H6KA 1ODZA 2OYLA 3IJ7A 1YYAA 3CH0A 1BKHA 3AIWA 5J8LA 3MS8A 3WF0A 5AHFA 3K1GA 4NXKA 2XN2A 4LALA 1E71M 4CN6A 1TUXA 3IANA 2FYMA 3C86A 3LCLA 3IARA 4R88A 4FEZA 4ACZB 1XBZA 5CC5A 1HXJA 3OOQA 2J24A 4JBRA 3DC0A 3CIXA 3TQPA 1A0DA 3HV9A 1RPKA 2HZGA 2IQDA 1JPIA 4J2MA 4US6A 4BY3A 4FNPA 3N6JA 5H8PA 3WUEA 4LY4A 4PMJA 1YHTA 3PWAA 3MKVA 1PAMA 2JGQA 2IUZA 1FH8A 4K36A 4C6NA 3GXMA 3QGKC 4I8DA 4FX7A 5RUBA 4WR3A 1GQLA 3QQWA 3DUGA 3OBKA 3P6LA 3SIZA 5C0QA 4NJGA 2CBVA 2FGLA 3HPSA 1I75A 3SJ3A 3L4VA 3MU7A 3UNDA 2WMIA 1SJAA 3CTTA 4GE8A 1VFOA 4LAZA 4PC8A 5HNUA 2HBVA 4XISA 3RX3A 2VD8A 4HTBA 1JEZA 2ZUVA 2BX7A 3LQGA 3C56A 2F6KA 3G22A 1L6FA 5HXMA 4IMAA 2DU2A 1QNOA 1WA3A 2D1ZA 4QQUA 3VOCA 4IIHA 4FO4A 1CLVA 5C9UA 1H60A 3JU2A 5D9PA 4H2HA 1B9ZA 3IPWA 5AECA 1DQWA 1M5WA 2DW6A 2DQWA 4IXXA 5I78A 1JUBA 4Y9AA 2ZYFA 1TCDA 6A3HA 3UZXA 1GYLA 4PZVA 4ATWA 2GDQA 3RJYA 2V67A 3FKRA 4E0CA 3UPBA 3A3XA 3PJUA 1PZ1A 3M7WA 4F8XA 2V5BA 4ICMA 2ZUSA 4Y7EA 4XTIA 3XINA 2NVCA 2HCVA 4XAZA 1DIDA 1QO5A 5FJOA 1DWAM 4LF2A 2OWWA 3F4WA 2DVTA 2CLFA 3CUGA 5KSWA 2XIIA 3GG8A 3TDFA 1JDAA 2EO7A 4AWSA 2R1NA 4KRUA 3V3WA 3FS2A 4C6OA 4NQ1A 3WJSA 2YB4A 3VC5A 4WY0A 4W4QA 3KVJA 2VUYA 3UG3A 3UD6A 3TXVA 3CM4A 1HJUA 1FCBA 3FW6A 3IJQA 2GSJA 5GQBA 3S2LA 1E6QM 1DJYA 3HPXA 4K68A 3MP3A 1TWIA 2GZXA 1W5OA 5HA7A 1R7AA 5D33A 4MZ1A 5D2WA 5DY3A 2BHYA 4F0LA 2RH9A 1E6RA 4DPPA 1CWYA 4I9JA 4HCLA 4FLQA 3CWHA 5HNRA 2G3FA 3T2PA 3RIKA 3WLSA 3FYYA 4H2CA 3GIPA 3RNDA 1D2KA 4UTJA 1ZAJA 3QV6A 4WDTA 1TV4A 3W38A 4H4IA 2C1GA 4DWSB 2R91A 1OX4A 3Q2DA 2DSKA 1OVDA 3MMTA 1X7IA 3G1VA 3EB2A 1R6WA 3PS7A 2C6QA 1RD5A 4R5EA 1QUMA 2OG9A 4KETA 5KITA 4FS9A 2FH8A 1XW8A 1EHAA 5KTLA 1L2UA 1GW1A 2W62A 3HGJA 2P3EA 5JQ9A 5E9AA 3GC5A 2BVYA 5DT7A 3P84A 4HZ7A 1AD4A 3C2OA 1MQPA 4GC4A 1O1ZA 3STGA 3PBWA 5EMYA 5AVNA 2ALRA 5BXSA 1QASA 3SDOA 3BH4A 3OQEA 2VOMA 1SZNA 3RAOA 1EPVA 1QK2A 1GOIA 5A8NA 1IT8A 5BWFA 1E0UA 1D7FA 2DSUA 3NXLA 2VC5A 4QEHA 4TVDA 3BZJA 2PDJA 2F38A 1PYMA 3N25A 5LIKX 4Q8TA 3DIPA 1B57A 3LBMA 4F48A 4PTDA 3L67A 4NSBA 3O8AA 4IQEA 4FI4A 2DJXA 1AQFA 3WMLA 3KTSA 4DWDA 3W27A 3QW4B 1DWGM 3A4AA 3GDKA 3BL3A 4MZYA 5GJNA 2EPLX 4C6FA 1U1UA 4KWSA 2E77A 4X9SA 1GVRA 3PZ9A 4JX4A 3WY1A 2WJFA 4MB1A 2J9ZA 4YCPA 1TVPA 1ONWA 3FA4A 1PO9A 3MANA 1U1HA 2D24A 3P81A 1MO0A 2CLIA 3VMPA 4QHRA 1E9LA 4IP5A 2R6OA 3KDNA 5FSEC 3PZIA 1J5SA 4LJ3A 2REQB 1UWUA 3R8RA 3W2KA 1W5PA 4A4AA 2YX0A 4W93A 4MY9A 3UWUA 1YKWA 4C65A 3PWGA 3PPFA 4XBKA 1H7OA 1T5AA 2OQLA 4AEOA 5I06A 1QWGA 3U7VA 3GTFA 1RP9A 4JQ4A 2OYKA 3UJRA 4PFMA 4DLFA 4HU3A 4Q8VA 4JTGA 4IH3A 4CKQA 3CMJA 1VFUA 4NJKA 3HPAA 3VNJA 4ZOCA 2VKZG 2YW4A 2W66A 1LL6A 4NUWA 2F6UA 3PZTA 1CXEA 1XCWA 4AVFA 5K4XA 5A94A 1JFXA 1BEUA 4OUEA 4Q6JA 3R2GA 1B2YA 1XG4A 2J7BA 1U5VA 1XRSA 4UCFA 4DJEC 5FCZA 1KGUA 6TAAA 1IXNA 4G6CA 1Q6DA 3AS3A 1OHLA 3CASA 1UR8A 3CHEA 4ES4A 4UTUA 4A8NA 2YDQA 1V7AA 2EG8A 2WZIA 3TROA 2QCFA 3HMCA 4EVZA 2IW0A 4ICNA 3S5YA 4A6GA 1TPEA 4AISA 5ABFA 3QOMA 4KFOA 4F2UA 2OQHA 1JGIA 4L6HA 3VNYA 1HNYA 4HSNA 4HNUA 2NV2A 3W2UA 4Q6XA 5LGXA 1Z7AA 3DGBA 1AQ0A 4AMAA 3B9OA 1BVZA 2ZRXA 2QNEA 3HM7A 4JFSA 3E74A 1GONA 4AD4A 2TPSA 5LNSA 5IXEA 1RBAA 2ODOA 4INFA 1BQGA 5EBUA 1G7UA 2CPUA 2XPKA 4LEFA 1PKNA 3NCOA 5I3IA 1JD9A 2XVGA 4OBTA 3MVIA 2VI0A 1EGMA 4LFYA 4B4FA 3UGRA 5CJ5A 4L4PA 4MY8A 2VFHA 3LN3A 2W27A 3MYOA 3VOGA 2E3ZA 3W71A 2QCMA 1R2SA 4RE2A 2P5NA 4AVNA 3VC6A 2W79A 3CHCA 3WIJA 3N2TA 3WH6A 4GFIA 2CKSA 2HWGA 4AZ6A 1KC7A 4ADSA 1EC9A 3BG5A 4QDPA 4KWUA 4DEFA 3V4BA 4L1XA 1R9ZA 1SYTA 3EA2A 5JUVA 3QY6A 3DESA 2E1DA 1TJ0A 3IVUA 5A8PA 1BHGA 4DQWA 3T7VA 1OFBA 3DKLA 3HO8A 5LA0A 2Y7GA 3QSTA 2ZUTA 4BI7A 4MWAA 3TN5A 1GOQA 4FX8A 1ZBKA 4R85A 2PMQA 4Z1AA 4H19A 2G3JA 4MSSA 4Q3MA 3RM4A 3P8IA 4I8YA 4FAMA 1OADA 4UFHA 1UCWA 5HWMA 4ZENA 1QDSA 4IPPA 3EAUA 1JDFA 1K8YA 3H22A 4L4OA 2W63A 4U33A 4L9YA 3TN3A 3W70A 1A3WA 1TPB1 1GCYA 1DJZA 4EPDC 2POTA 2V5DA 1TR1A 3W26A 3KDOA 3CIVA 1EXBA 5AYIA 1TX0A 4CN1A 1VP5A 4RE3A 1PDZA 3N13A 1FWWA 1REQA 3E0WA 2YIHA 3VM7A 3QLLA 1FDYA 4AXKA 4RNIA 2YCEA 3WELA 2WHLA 4U4MA 1O66A 4NYYA 3VMNA 4BCEA 1QT1A 1B0IA 5EBAA 4O12A 4OFCA 1R47A 4Q8NA 4AD1A 1XR2A 1H7NA 3QMRA 1GOOA 2JIWA 4DI8A 3Q94A 4O4WA 5I2UA 1G7VA 1TKKA 4HA1A 3DEQA 3W29A 1HO4A 2QHAA 3QV7A 3OLIA 4POCA 2O7QA 3P3BA 2B31A 2INFA 3WLPA 4KGJA 3QN3A 1XJBA 3VGEA 3BLKA 1DJGA 2JIEA 2PSNA 2ZZ6A 5HR6A 1DQXA 3W2JA 3SW6A 2XYLA 3MUZ1 1L2QA 2BXZA 3TA9A 1NSJA 4FMVA 3R5EA 2BXVA 4PA8A 1TA3B 3RN6A 1Y65A 3SFWA 4NASA 3CLMA 1AFSA 1YE4A 2OU4A 5HQEA 3OU8A 2V5LA 3G8EA 2TYSA 1YTDA 3A3WA 3GW0A 3V7PA 4IT1A 2C16A 4PEEA 4B5WA 3P5YA 4YXGA 1XINA 2IKJA 3LUTA 1O95A 4B4HA 1FBAA 3T6CA 5E6YA 3GLCA 2PP1A 4EXBA 4CU6A 1C3FA 1UP3A 3FAXA 2OVLA 3BICA 4KWWA 1XDMA 3P0WA 3LZ5A 2I5IA 2F8QA 1AMYA 2CXEA 3WH5A 3AMDA 5D4YA 1XYLA 1NDYA 1EIBA 1WAWA 2EBNA 3AALA 5A1AA 3GDMA 3F4VA 3BCDA 3O6DA 2Z1XA 1UD5A 2CIPA 4WKFA 3UU0A 5A2CA 1HN1A 2Q02A 4QRNA 4Z1YA 4TUFA 5DMMA 4RZBA 3GFYA 4R9OA 1BGAA 1E9IA 3Q58A 1MNZA 1P7TB 3WQ4A 1W54A 5E0FA 3H2AA 4LNCA 1J79A 3FKKA 5CGMA 4AHPA 1JCXA 4P7QA 3HG2A 1HL9A 4MWAD 3VI2A 1ZAIA 1TUFA 3AXHA 3W9ZA 3IIOA 5HK4A 3U3HA 2HPMA 4KEMA 4MYXA 4IICA 3WEOA 1ZAHA 4WY0F 5AKQA 2G50A 5U4NA 4O1AA 3K4DA 3DYPA 2D3NA 5D2YA 3UG5A 4DJDA 2VT0A 5A8OA 1JNDA 2PP3A 1JPMA 4F40A 1NFGA 3T09A 2E0PA 1EYEA 2E5BA 2A3AA 3HOJA 1D9EA 5I02A 2CFFA 1TELA 4ICCX 2PLJA 1GUVA 4A22A 3STEA 4DUWA 4IPIA 3LCGA 1K6WA 4HB7A 4NX5A 4M5PA 2TSYA 2V3EA 4EWND 1G4PA 4ZB0A 3LSBA 1D7KA 5A5WA 3LXBA 2X8RA 3TK7A 2QCNA 4PSRA 1US3A 3CIWA 5I09A 5EMKA 3SCTA 3EDKA 4DIAA 4GIAA 3PZQA 4XZ9A 1ZSXA 3B03A 4S38A 3KTXA 2X1RA 1PE1A 4PUNA 4XZIA 3LZ3A 2WNQA 4GCXA 3KBMA 3TX9A 4L9ZA 2CESA 2NX1A 3C6CA 4JQAA 3BLFA 3R4IA 4IG2A 1JF6A 3IJIA 1TYGA 3PNUA 5CPSA 4MM1A 5BOEA 2CZ5A 1AA1B 2PU0A 4NI8A 2OX1A 3GDRA 4O0QA 1WDQA 5C55A 2JKAA 5FF3A 1R46A 3SUWA 1JYNA 3AYVA 1WAUA 3M43A 3WLRA 3QKZA 3C52A 4ACZA 3OLDA 4TIMA 1P0BA 4LVFA 1S1RA 5IHSA 3EB3A 1NWTA 4E2DA 1Z9AA 3WCZA 3U4AA 4B5SA 2ZA3A 2E67A 3G0XA 2YZ5A 4UFLA 2VFDA 4K37A 4C6BA 5EKYA 2V5JA 3D3AA 1HGYA 3UWEA 3SBFA 3SRKA 2ZVRA 3GC2A 4UR9A 4BS0A 1FWRA 3IVTA 2R8WA 2RHGA 1ISWA 3WLJA 2PZNA 1X6NA 1UWAA 4EIVA 1XPYA 2QMJA 5C7HA 4HP5A 1UKSA 4A2SA 1QPOA 3BAXA 1O68A 2YA2A 4WUIA 4UNKA 3MTWA 4PMOA 3VGHA 4H01A 4J1OA 3F5JA 4NI3A 1DORA 3FGCB 3SO7A 2ZX9A 4HSHA 4L7ZA 1E72M 1G9HA 3NPUA 4GA8A 1C90A 3OZMA 1Y7VA 4CCDA 3S42A 3WF2A 2QUMA 4ZQNA 1PTAA 4LC8A 1BPLB 3QV9A 3EA3A 3CAKA 1GYNA 1HJQA 2VVSA 3GFXA 3W07A 4DO6A 4DX3A 2GJNA 1UBPC 1ITUA 4GH1A 4M6VA 4NU7A 1DHKA 3IVSA 4MFEA 1TCMA 1A5NC 1MSSA 2PD5A 3SCOA 3EWDA 4PH6A 2NUYA 1TSIA 1VYSX 3K4WA 3KOXA 3L7RA 8RUCA 1KBLA 4BF7A 4FNTA 4PMQA 2YKKA 2W9MA 1P0KA 1E1CB 3ZJ7A 4RR4A 1JUKA 2O9TA 3CC1A 1JRBA 2NVDA 5FEPA 3PZMA 4QG9A 2WBKA 3WENA 5AHIA 1H61A 1YNQA 1DIEA 3QMSA 4HNCA 1RQBA 1OD8A 1N55A 1V7YA 4HQVA 2A6NA 2WLZA 1VEPA 1CW2A 3LHWA 2PA6A 4P2VA 1GKRA 3H2CA 1GOMA 4AIUA 3A47A 2QZRA 3U8GA 4FOJA 2PLKA 5E70A 3ATZA 1G4SA 5AN7A 3RPDA 4QROA 1OJXA 1QVBA 3GVQA 1NVMA 4H9XA 4M0XA 3WQWA 4H7ZA 4HNVA 3VE7A 3WF4A 1QHOA 3AOFA 4ERGA 4DUVA 1OT1A 1SFJA 3ZR6A 4NJHA 5FF7A 1JG9A 5DXYA 1W5QA 3TU9A 1MEWA 2WZTA 3PPGA 3BV7A 5CC3A 1BG9A 4PB3A 1GEHA 5FJRA 1P0DA 4NZ4A 3TH6A 1YIXA 2D0FA 3TQ0A 4DWSA 1TZZA 2Z6JA 2I57A 1U5HA 1W9BM 1VYRA 1T7LA 1J9YA 4NL1A 1DKWA 5KINA 1TO3A 4KFNA 2YA1A 4CCZA 4F9JA 5I23A 2QVHA 5DCBA 2EF9A 4GYKA 1SJDA 4PTWA 2XN1A 4ASTA 3CYJA 1KTNA 1RY0A 5AHEA 3AQUA 2FKPA 5CGQA 4C1LA 1K7FA 1EF2A 3CQ0A 3AHVA 3UJSA 3PN8A 3N6QA 3E3HA 4US5A 3ZMRA 5CZ0A 2ABBA 4G8TA 3DN5A 4U3AA 3M6YA 2RJHA 4GQQA 2E6YA 1EJUC 3M4HA 2OSWA 2HTMA 2PCEA 3FSUA 3PZNA 4XBJA 4GNJA 1FKWA 1CGXA 2A1YA 4UR7A 2XWEA 4C6EA 3M6DA 4ADTA 2WZEA 5T9CE 4JEJA 4L6OA 3UEQA 3ABOA 1VENA 3ITGA 1UZHA 2G4JA 3MHFA 1UA7A 4EOUA 5C9WA 1FWIC 1PCWA 5BRQA 2X1UA 1Z41A 4TVCA 4UFJA 3W3OA 4H6QA 4A3UA 1JPKA 5B80A 4AD3A 5FF0A 5E93A 1XLEA 4RX0A 1F05A 2VNCA 4PMRA 5JU6A 4UQBA 3EZ4A 3PG9A 2OELA 3BOXA 1Z6KA 3PG8A 1UD4A 3V18A 1E6ZA 1FVPA 1SGJA 1GGOA 2C1IA 4ADUA 1F4AA 3VU2A 2CLKA 1B3OA 1KRBC 1R3VA 3FK4A 4KWOA 1OIFA 3SURA 4S3JA 2XU2A 3RU6A 2QDEA 1YQ2A 3ARXA 2REQA 1CYGA 2BVDA 3OJGA 4MLJA 4AU0A 3CTLA 4GUGA 1X6UA 4JNZA 2GVEA 3TW9A 3S47A 4GUIA 5CSUA 4LVBA 3C0JA 5KZMA 4Q33A 1CZ1A 5MHBA 1JYXA 3NO1A 4UMBA 2GGJA 3UCCA 1M7PA 4IJCA 4GZEA 1QI3A 2CBIA 2J8GA 1EC7A 3DDMA 3PUOA 5I3JA 1BRLB 3ID7A 4WXZA 3QPYA 1S38A 2YL6A 4HNTA 4IX0A 2WSRA 4QISA 3REQB 1O5QA 7REQB 5M3WA 4G9PA 1XQLA 3E6EA 1XLBA 1CENA 4UNLA 3OVRA 1QATA 3QQ0A 1GVIA 1R2RA 2POZA 5I79A 3TSMA 4DWSD 1ME9A 1GT8A 3ARZA 1Q5MA 1V3KA 2D0HA 3IIVA 1A0CA 1HUVA 3LERA 3UVAA 3BAIA 4NXSA 2CHNA 5T8GA 4AZHA 3GIQA 5D30A 4N6FA 3EKZA 4NNBA 2E68A 2VM8A 4J3UA 4RXGA 2PD9A 5AFDA 5HQLA 2PTZA 1AG1O 5CG7A 1F73A 3PPHA 5M17A 4B2DA 4R34A 4QCFA 5DLCA 5DT5A 2DW7A 1SJBA 3EEGA 2QIIA 4K7YA 5AHNA 4O28A 2PB1A 5CGTA 3GQYA 1LUCB 3MV01 3QF0A 4WD0A 1KWKA 2PC4A 1PTDA 4IFRA 4LC6A 4TV6A 4US5D 3ZJ6A 3LLFA 4YCOA 1CB2A 3ALGA 3BZGA 4EF9A 2WCAA 3GYEA 3RITA 2O4MA 3FY1A 4AEEA 3BQ6A 3EB4A 4UTTC 4HA3A 3LHTA 4S3EA 1R9YA 1ZHAA 3NM3A 4AZGA 1JDDA 1C9WA 1GTHA 3U48A 5CEWA 4GCAA 1CGTA 1EEXA 3GNOA 3TTYA 2WXDM 1ITQA 4P8UA 3AMLA 2WMJA 3VFCA 3K46A 5D09A 1VBHA 1X8CA 3AWNA 3NQ2A 4QDWA 2Z29A 4F9DA 4DBWA 3UETA 2UY3A 3VIOA 1HP5A 3DAQA 3TTEA 4KCVA 2ADAA 2H8XA 2ZX7A 2AQVA 2UV8G 1FDJA 1HKKA 3GC4A 2CKRA 3T0AA 3B9DA 2J74A 4JIHA 2J7FA 3CZJA 3R11A 3ZR4A 1E5JA 3U2CA 2BODX 2VQTA 1A47A 1KBKA 4ZQMA 1Q4NX 3W1NA 3TEVA 2JQXA 4MYAA 1P6CA 4RE4A 1IE7C 4WJEA 2E5DA 1Z3NA 4C6IA 4GYJA 3BE7A 4XD4A 1QI5A 1LM1A 4F4RA 1K03A 3TYEA 1XBXA 4RZ5A 2ZWZA 4V33A 5CC7A 1TPWA 2FPTA 3G6LA 1QHPA 1W6TA 3LPPA 3ZM8A 1ZS2A 3NPWA 4NX0A 5D9OA 4BF9A 2D23A 2EXOA 3GM8A 5KZEA 3PTQA 3TYAA 3CT7A 2DJLA 2EG6A 1XRVA 4D8AA 4JTHA 3EX1A 4Q8PA 3B3DA 3T8LA 2RDXA 3WQPA 2I7GA 4PEKA 1WCGA 1FQ0A 3IJ9A 3NFUA 2TMDA 4GX8A 1C7TA 1SSGA 4GMEA 4A3YA 3IRDA 2ZOXA 3PBVA 2A2IA 2DZWA 4R7OA 1O94A 2YLLA 1IYXA 2VGFA 3RF9A 1V6TA 4DJDC 1QI2A 3UXAA 2WM0A 4JN6A 3PP7A 4DXXA 3LNPA 4AG0A 3T55A 2QCCA 3GVWA 1GG0A 1F07A 3K5XA 1DE5A 4B3ZA 4S23A 1N8FA 1E40A 3CT2A 4RKAA 4C7FA 4ZBCA 1PJ9A 4B2DD 1XYAA 4X2PA 3M0XA 3AXMA 3I6EA 3RLGA 2HISA 4D1JA 3A4JA 1KWGA 5EB8A 4U3CA 3EOSA 5AC7A 3F5LA 1ML1A 1BXNA 1US2A 2BGNE 4GVHA 3IGXA 4I5UA 1XIMA 3CQHA 3WQOA 3IAPA 3GTHA 4QAIA 1RJRA 2IPGA 2VDHA 2JE8A 3RM9A 3ZFHA 4FR6A 4ROPA 3T40A 2CBUA 2PDLA 3AXXA 1R8LA 3NZ1A 1RCXB 3O6AA 3UXDA 3TONA 5H2ZA 1UZ1A 2C3ZA 4IIBA 5GNYA 1FHVA 3S83A 5LSMA 3NVTA 2CU0A 4WKHA 4LCRA 5EMMA 1NJJA 4WSHA 3ZIZA 2VRQA 3MJMA 3NQBA 3MHGA 1OGBA 2R24A 4CQDA 3V5OA 1UPMB 3AC0A 2VO5A 1UD6A 4GKTA 1LL4A 2WCSA 3P80A 2HXUA 3G1RA 1UKOA 5FEWA 3CUJA 3DFNA 4PE8A 1P7TA 5JBEA 1JXJA 2DVUA 1PX3A 3LV5A 2QYGA 4R9XA 5BRBA 1RSCA 2WOQA 5LXXA 3BLEA 3EMQA 5TBOA 4MB5A 3HURA 3RCMA 1VFHA 3IJ8A 1N7KA 4JTFA 3LRKA 3H6OA 4H1ZA 4ZEPA 1A4MA 2GSEA 1PEZA 3RU8X 2ZA1A 3UZWA 2PODA 1OT2A 1IXPA 3UW6A 3UJEA 2PUZA 3EDFA 2OT1A 4CNSA 3ICJA 3T07A 3VZZA 2W0UA 4QE4A 3ECQA 3DFOA 4PBFA 2Q8ZA 4Y2WA 1AH4A 3CQIA 3L0NA 3GE7A 1B9BA 3FN9A 3NQ8A 1RQEA 1WOAA 3NDZA 4ZSUA 5J04A 3EWCA 3KL5A 3CXOA 3HGRA 1ZJIA 3GO2A 2ZZ5A 5MF5A 4M6UA 3JZUA 3UZYA 2QR6A 3WFAA 2AL1A 3PVFA 3GAKA 1QRQA 4DF1A 1ICQA 1O4UA 3G1SA 1XIDA 3M64A 3S8HA 1XLDA 4GZIA 1E3XA 4NJJA 4PUEA 4UQCA 2OWXA 3UR2A 4H04A 1I45A 2XFFA 4C60A 2VGIA 1OEPA 4GHRA 3QKEA 3ZLGA 1PHQA 1NARA 1E15A 2P3ZA 3MY9A 4KFPA 3WJZA 3LXAA 3B4YA 4ZMGA 3JVAA 2XUCA 3PAOA 1HGWA 5JIWA 4NVTA 3H7UA 3ONCA 3QXBA 1HO1A 1OFPA 1PUDA 4JTCA 2HQAA 3NSNA 4ML4A 3WQFA 3RRAA 3APTA 2MANA 2GOUA 4FNQA 2FH6A 4W5UA 3JS3A 4JX5A 3PZVA 5D8ZA 1EZ2A 5KZDA 2A79A 1OYCA 5JMUA 3HG3A 4HCDA 3NDYA 3N4FA 4JQ1A 3PY2A 1L6YA 3INPA 3CH9A 1HG3A 2A0NA 4IIFA 2QMKA 5CH9A 1TR9A 3W76A 3FGCA 3OVQA 3W1QA 2QKFA 2QT3A 1QBBA 3LCXA 1S5TA 2WC4A 4WF7A 3I3BA 2WJEA 3OVGA 4MAVA 1DBTA 3FLUA 3RDKA 2XFYA 3NXFA 4RK8A 2FGBA 3RX2A 4B5UA 4E4PA 2CETA 3MUXA 4JNMA 4NIRA 2ZKMX 2QIWA 1OY0A 4HYVA 4ZO9A 1ZNNA 4GBDA 3RO8A 4HPGA 2XFWA 2J6VA 3QYSA 5DO8A 2ISDA 1TB3A 5I5RA 5C6MA 5A6BA 3EWXA 4HSOA 4NP7A 4UOZA 1IEIA 1IWAA 2Z2BA 3TQVA 3MSDA 5HJXA 4P7LA 3LA4A 5C2XA 2KAUC 1A5BA 1ZL1A 4PBEA 3GZAA 3MUAA 1UUMA 2ZBTA 1MWOA 3KHDA 2E6FA 1B3VA 1JL8A 1ZUAX 1G6CA 2ATMA 4ML9A 3YPIA 5DRCA 1HTIA 4RDWA 2VZOA 3W28A 2QPSA 2DUZA 2WNZA 2GUBA 4GY0A 3LI0A 1EBHA 4XKYB 4ATDA 2W6RA 3G5EA 3LPFA 4UNIA 1A80A 1BAGA 3TTSA 3IEBA 4WDUA 1W3LA 4MNKA 4CNNA 1LLOA 5C71A 1TIMA 2DH3A 4JL1A 1XS2A 4KCTA 4JYDA 4LV4A 2BY2A 4WZHA 3SN0A 2J13A 2DT1A 3N4EA 3TSBA 3COTA 4S39A 4JS3A 1UC5A 2WC7A 3MZNA 3UCQA 2YFNA 3TJLA 4S3KA 4GUFA 1WKYA 1LLZA 4HZ8A 3DERA 2ATSA 2J9XA 2A3BA 3VX1A 4M8UA 5H8MA 2PWGA 4B3LA 1EL3A 1TJPA 4X61A 2BXYA 4DELA 1EFZA 2G37A 1XHGA 2CZFA 5J5RA 2RGMA 1R9XA 4ZFMA 3OGVA 2WVTA 3N3MA 4PCTA 3ZJKA 3L68A 3ABXA 1UIPA 3I65A 3OGRA 3WLMA 3HB9A 1UB3A 2AQWA 2VFEA 1SQ7A 2Z27A 3LBCA 1MFUA 4AWTA 2PPGA 1JCLA 2CLOA 4RZ4A 3GU9A 4WKAA 3IV8A 4XQ6A 3VD3A 2X30A 1H7RA 4FLRA 2ZFAA 1UD2A 1UMLA 1OF8A 2FVMA 2YOCA 1P6WA 3VUPA 3RYSA 1AH0A 1NDVA 4IQJA 1G4TA 1XUUA 1H50A 4ZVJA 4K3ZA 3C61A 6REQB 2X09A 4PB4A 3HFYA 3KM8A 1B90A 4U5KA 3FDGA 4UC5A 4LEQA 4Z08A 3MA8A 3U0HA 4KEUA 2IKHA 2W4XA 3N9SA 1QAPA 4FIQA 4FLOA 3LLXA 3L23A 1UD8A 4MB3A 1DTUA 3LX9A 4LBUA 1T99A 2WMHA 1I6NA 2V0TA 4KRTA 5I7GA 2BOEX 4Q8OA 1SW7A 3UR5A 2Q09A 2QAPA 2YDRA 4K38A 3VVGA 5BRPA 5A6BD 4GPNA 2FDSA 4WDXA 3GG7A 1W91A 4EACA 3TV8A 3THCA 3CB3A 4IFOA 2WM1A 2YYTA 2VR2A 4LCSA 3B8IA 3DYMA 3SCUA 3NQAA 1T0OA 2VCCA 1T8XA 1P0NA 5IDIA 5D2TA 1TV5A 2R9RA 4X2RA 2Z2AA 1V6XA 2HMCA 3TNOA 3LMYA 3KVMA 3KXQA 3FVDA 2PDGA 3OODA 1ADOA 1ZP4A 5BWAA 1OZMA 4O8RA 3ALFA 2VEFA 2VHLA 5IDZA 4NILA 1Z48A 4LRTA 2QV5A 1TTQA 2XZ9A 2PDNA 4C6LA 4R53A 3C4UA 4X9YA 3QHOA 1XPGA 1Z69A 1V93A 1QNVA 3H4WA 1KXQA 3LHVA 1NOFA 5CZJA 2ZDRA 2RDWA 4O14A 1IF2A 4QFUA 3V0SA 2J25A 4DHGA 2OCZA 2QAFA 4AYGA 3WBWA 3MBFA 4JTLA 3U5YA 5HBFA 2DPEA 1H0GA 2QVNA 4H41A 3QPEA 1BRLA 4X60A 3A64A 3MKCA 1RV8A 5E1QA 1EUAA 2IMRA 3MCNA 3REQA 7REQA 1YDYA 3WNKA 1UBSA 3B8WA 1O7AA 3M07A 4J3ZA 4JTSA 1DXFA 4UUIA 1LP6A 3SB0A 4I3GA 5TIMA 3S1XA 2WCGA 3NVDA 4G7EB 2CXGA 4XAYA 1R30A 2ZRZA 3EWZA 2DEPA 1E1FA 3GDTA 2NUWA 3N73A 3TQKA 3ERPA 1XWYA 5AC4A 4O1BA 1KLYA 2G97A 4GC3A 3WD1A 5JH2A 5K9DA 4QG8A 3R6IA 2KZHA 1JAKA 3GHRA 3FYOA 3AZSA 2E09A 3KE0A 5DELA 1TPDA 2GQ8A 1OX4B 3FA3A 3V1PA 4ONVA 1V08A 2I56A 4XTDA 3G24A 3LRMA 1TTPA 3WJYA 2Z24A 5IBXC 1KRMA 2EJAA 4F0KA 2C91A 3H4GA 3WUFA 3KOZA 1ADSA 1CGYA 4Y9OA 2HDJA 3QOKA 2NXGA 3C8NA 1T6MA 1QJWA 4PCFA 3HJZA 3BJSA 3M0VA 1G01A 2RDTA 1IHIA 2EJ1A 4WHBA 3MJYA 2QCDB 5FJTA 1HJVA 4MNMA 3W02A 5F1UA 4DVOA 3BSMA 1J18A 2C1HA 3DX5A 3N11A 2VR5A 2Q3OA 1TREA 5CAKA 4HGXA 5G1YA 1Q6GA 2BGSA 3E0FA 1QOQA 1AD1A 2H3BA 4TOQA 3VUSA 3ZO9A 4ZFCA 4AF0A 3DHPA 4KGLA 5G4EA 3NGJA 1UWIA 1FWBC 4MIMA 3W84A 4HOXA 1W3KA 1YDVA 3AWOA 4YVVA 4A8LA 2IXVA 3AU2A 1OYBA 3UYCA 5EY5A 1H1NA 4M6QA 2JF6A 4TMCA 1UH4A 4N6EA 1X97A 1VHNA 2BDQA 3DHDA 3BG9A 3DFPA 4KIEA 3K13A 5D8WA 2QPXA 1BQCA 3E9AA 2X1IA 3SCSA 3O2LA 1BXCA 2BV9A 1XICA 1L6GA 4GQ0A 1OK4A 3BJFA 3IJ6A 1U30A 2OXNA 4MOZA 3LQLA 3PJTA 2VZSA 2YYUA 3BARA 1Y5VA 1TMLA 5LYRA 1QNQA 3VGDA 4DO4A 1YDOA 3DOPA 3IK2A 1ONRA 2A7RA 3IWPA 3CQJA 3WFZA 4K1WA 4GIEA 2HK0A 1ZPTA 2RFGA 5PTDA 3H70A 4AMCA 5CZSA 3TA6A 4UTWC 2UY5A 1F3XA 4PMNA 3RUBL 1OCNA 5BXPA 1KBIA 2FTWA 3LMZA 3KWSA 3BLOA 5GJMA 3RK8A 4LS1A 2G0WA 3IJDA 3AMCA 5I0DA 4ZODA 3MQTA 3QRHA 3VXGA 4YHEA 3SRHA 1FFRA 2Y24A 2H3DA 2ZDSA 2YXOA 8A3HA 1I4NA 3IJLA 5I3HA 1KM0A 3BV4A 2CLMA 1UWTA 3WH7A 2PRMA 4OV4A 2ISWA 5D03A 4EF8A 1MYRA 4XZNX 4I9AA 1NIUA 3OW1A 1ISYA 2ZXQA 1HJXA 4GIYA 1A3XA 5AVHA 4DY1A 3UWQA 3M41A 1XCFA 3W82A 2VYOA 2C13A 3A12A 4O54A 3MV11 3CU2A 5B7ZA 3R0DA 3NDOA 2QCLA 4RV8A 5HR7A 2GK1A 1KCKA 1F3WA 1FHDA 5ABFB 1JI2A 1WDRA 1N82A 4GZ7A 5DMYA 1MW1A 1SM9A 3CPRA 2H6RA 1GKPA 1EB3A 2J7HA 5KETA 4GD0A 4Y9MA 3ABRA 3I7RA 4QAWA 2NQZA 1JDEA 1IQ8A 4MKNA 1IIHA 4TQTA 1FA2A 4QNEA 3VOJA 4JNYA 3RR1A 2ZRVA 1VEMA 2H8ZA 3B0XA 1K02A 2GLKA 4AD0A 1ELSA 1H2JA 1UH2A 3ATYA 3GAYA 2EPMX 4JTTA 4QX4A 2FIQA 3EWWA 3KLKA 4XG1A 1KCXA 5A8QA 4BQ5A 4H9TA 1JZ5A 1DWJM 1MUCA 4HZ6A 1UKPA 3BAWA 1KFEA 3VZXA 2NXIA 4D71A 4J2PA 4ZL1A 1OX5A 1E0XA 4OGZA 1K4HA 1YPIA 8CGTA 3R8HA 2Z1BA 2OOFA 2Y6ZA 1OG6A 3DHFA 3WF1A 3GNNA 4OE7A 1XQKA 4ZQPA 2YA0A 5I77A 1UR4A 1A5MC 1Q4WA 6ALDA 5C9RA 1E9ZB 1RXOB 3VINA 3SCNA 3KS6A 4MWAB 4J28A 1LG2A 2WC3A 1EDTA 4AVOA 4OJYA 1KFKA 4G1KA 1RHCA 1U1JA 1EX1A 2BWGA 5ENLA 3POHA 3CUIA 2AKZA 3KP1A 3DBNA 4JPGA 1XYCA 3OLEA 1HKVA 4E6MA 4NG3A 4G2DA 2PDBA 2GVGA 3WNMA 3ZVIA 5A2BA 2BOFX 5A6JA 5JBDA 2OMAA 3ES7A 2X40A 4V27A 5HWJA 2E28A 4DYKA 4KW2A 5E5CA 1N2VA 1R86A 2HE5A 2DUAA 3PUEA 2XIMA 3EMCA 4X22A 1E5NA 3BLIA 3W25A 3S1WA 1LYXA 3THDA 4H9VA 4QM1A 5A3HA 3G6MA 1S2AA 1K6AA 1UHVA 1RK5A 2Q71A 1BYDA 1HL2A 2WKJA 1OQFA 3WL1A 1GORA 2XIQA 2GGIA 3BANA 2GSHA 3B8DA 1POJA 3B8TA 5CPTA 1LBLA 4CLMA 2OO0A 3UVIA 4BJHA 1R87A 2QGYA 4NNAA 2UBPC 1XH2A 3NQ7A 2J77A 2HS8A 1E4IA 4PMZA 1CNVA 4A21A 3HQPA 5E09A 2IKGA 3AHZA 2FDMA 3LU2A 4LVDA 4UFMA 1YEYA 3CUXA 2R1LA 2XH7A 4G5DA 4Z2GA 1Q6FA 1DE6A 3TCEA 4P8VA 5D38A 3EX2A 1GYMA 1EGVA 4M80A 3I7QA 1LWJA 4CQCA 2DFAA 4LAMA 4AAJA 4E8GA 1E4LA 2O55A 2Y85A 1WKDA 1FCVA 1VRDA 1AL7A 1EH9A 3PJWA 3QGAC 4O1EA 3LY0A 1GVEA 5LZLA 4Z1CA 1E6PA 4DJFC 1XC6A 3HPFA 1RQHA 5BXRA 4MMWA 2JF7A 3N19B 4RPQA 5FL1A 5EMUA 4FOKA 5IM51 3AIBA 5JXQA 5AYYA 1YNPA 5AOUA 4C90A 4ALDA 1KM3A 3L0GA 4D1IA 1WZLA 2VEKA 1RA5A 4N9DA 2FMOA 3F2CA 3R1ZA 4XD3A 4CNUA 3Q37A 3PBYA 2X1TA 4MG4A 3W37A 1E70M 1V3MA 1LRNA 3WUGA 5E0CA 3C3NA 3BC9A 3A9IA 4HOWA 3P67A 4WX2A 5H1WA 3Q65A 5DCDA 3KZPA 2ZADA 3K30A 3LHUA 3D3FA 3HPZA 4UTFA 2NLYA 3WK1A 1O6IA 3WLKX 1TJ1A 4HJFA 2GL5A 1TE6A 1J96A 1XLKA 4HZMA 1W1YA 2QJGA 1H5VA 2ZZ2A 3WLLA 1Q8AA 4C1NB 3EX4A 5AYBA 1XCXA 4NZFA 4ERIA 3T1GA 3TP4A 2P88A 2PAJA 1KM1A 6TIMA 2E8ZA 3THQA 3ZWTA 2VQUA 4MUPA 2CZDA 4GOAA 3W7HA 1R3RA 3M44A 1J0HA 4XKYA 3E49A 4GBUA 2PF0A 2VTFA 2QLYA 3AIVA 1WXZA 2JFEX 1SPQA 4O18A 2FJUB 4LS0A 3A24A 4CNOA 1WZMA 3QZEA 1KV8A 3OHIA 2GDUA 4B3KA 5MKGB 2A3HA 5EGRA 4B16A 4LNYA 2XIOA 1K8CA 3EMZA 1Q45A 4H8HA 2FVLA 2DSZA 1XYBA 4PUWA 1UR3M 4PL2A 5K7JA 3CL7A 4OWGA 2O9OA 2QCGA 4UTKA 3CZEA 3O0FA 3DZ1A 2G8ZA 2WB5A 1J0JA 3NQGA 5BROA 3CHFA 2R1PA 4URIA 4MJ4A 1RALA 1U83A 3B0PA 2GFTA 3GYCA 3K1DA 5FKYA 3EPOA 3EEZA 1UPPA 1SMDA 2E4TA 2GWGA 2P0IA 3AISA 3TAKA 2OSYA 1V6YA 2DGAA 2XWDA 1LBFA 4IFKB 3RX4A 2QDHA 3WK2A 5FJIA 1J0ZA 3G0UA 2GGHA 1UOKA 3U7BA 3QSRA 3CV2A 3SSZA 4CVWA 1FP9A 1P48A 3TMLA 3CEUA 4CGTA 3SAZA 1AL8A 3VKJA 2FZDA 4PODA 3FJ4A 1XLHA 3KS5A 4EWJA 4AX6A 4UIOA 4O15A 1JXKA 3WQVA 4D9PA 1WZKA 3W00A 3VPLA 2CHOA 4IIDA 5FJUA 6REQA 3TR2A 4F0HA 3DECA 1TQXA 5HMEA 5E0KA 1LF1A 3FFSA 3UY7A 2P8BA 4AEFA 1G94A 4DZAA 3CLWA 1FWDC 4D8ZA 1P6BA 1G5AA 4GYPC 3B9AA 4LX4A 1QPRA 3W7IA 2ZE3A 1EWEA 4A3QA 4OTKA 1XSJA 3P8JA 2ISSA 4H9YA 4Y6GA 4BWLA 4D72A 1H63A 4HTYA 3B9NA 2D0GA 3GNRA 1NTHA 3N29A 1FX6A 2HVOA 4IWWA 3N6HA 4C6JA 1M6JA 3LGDA 3GS6A 1VS1A 2PLMA 2PDXA 4C6DA 3KAOA 4M1RA 4M82A 2HSAA 4BI5A 3UR8A 1CGVA 3VOHA 3GXIA 3L21A 2GUYA 3FHAA 3CUHA 1IEVA 2CLHA 2NSXA 2WK2A 3C3UA 2WAGA 3A5FA 5DCEA 3ANYA 5T26A 4JCLA 3M9YA 4ZE5A 2VURA 5FEZA 4ZQRA 3WSUA 1LJYA 5T91A 3I3EA 4AZ5A 1SU5A 4YJ5A 2RGLA 3OZPA 2G96A 1NQKA 4YL2A 2F9RA 3WEZA 2W67A 3GK0A 2ISFA 3LOTA 4PGLA 4CQ9A 3DI1A 2HNHA 1XIFA 4ROQA 1JZ7A 3G0SA 4AZCB 3VKDA 2BVTA 1YBQB 1VJZA 1WUEA 3T0TA 3TUUA 4JHOA 4W88A 3S2CA 1TV2A 3M0YA 2XGIA 1EP3A 4B91A 1FH9A 3O9NA 3WBYA 1NH6A 4AW7A 1UZDA 2YL8A 1KM5A 4ACYA 2HVNA 2ZE0A 3R12A 3TXZA 2CZEA 4E2BA 2DZVA 4WJ8A 2QS8A 2VX5A 1SFTA 3UG8A 4G7EA 4UR8A 3CYVA 3VK5A 4GY1A 4JTJA 3W53A 4JICA 3I6TA 4I6KA 5HMSA 2CCRA 2CHRA 1XYMA 4NYUA 1TVLA 1DP0A 1ZGDA 1SZFA 3T0DA 3SY8A 2VGBA 1RCQA 2PRHA 1U22A 2D2HA 3G77A 2I9UA 1HQTA 4H3DA 4IQLA 1H7WA 4JOMA 4V2XA 1BYAA 1HX0A 2DORA 4IIGA 1WUFA 2NXHA 3GVVA 1K9TA 1V51A 9RUBA 1CEOA 3WG6A 4W7WA 1PKYA 3VNKA 8XIMA 2FZNA 2DZUA 2PWFA 2XVNA 3GH4A 1HJWA 3ARUA 1W2PA 3BDKA 3WX7A 1W8GA 3MCOA 2DVXA 1ECQA 4ZOBA 1I2OA 3PC0A 4A3RA 3NOEA 1CX9A 4MAZA 3H21A 3LCHA 4HU0A 4BQ2A 4GXPA 4JTQA 2QCEA 3MMWA 3UFYA 4BEUA 3GFZA 5CJNA 2BFGA 5HJYA 5LNUA 5EMJA 3W83A 1OYAA 3RGTA 2QCDA 4A05A 2VC9A 1EOMA 3W7LA 3R79A 4CUCA 3KCOA 4P7OA 4E8DA 4I7UA 4D6EA 3M46A 1BF2A 1JYVA 4KESA 4MWAE 4K8EA 3S9YA 3HQNA 2IS7A 4LV9A 2PTWA 2GJXB 3PANA 3BMWA 4YHGA 3S1UA 1XL9A 4IP7A 5D9NA 3QPZA 1D3GA 1EGZA 4UXDA 5ECVA 4JN7A 3G8RA 3OYXA 1H62A 2VJXA 3VIJA 4E4UA 4F79A 1Z8AA 2Z2UA 2W91A 1UR9A 4H9ZA 1DQUA 3USBA 4MPKA 2TAAA 2Z1KA 1EUNA 1R38A 1GVYA 3UA3A 2HS6A 3VNMA 1DIKA 3H2NA 3CUFA 2ZTKA 1ISVA 1UKQA 3PFRA 4KKXA 1ALDA 1E6SM 1KCZA 3GNDA 4KF1A 4PRWA 3S1GA 1A0EA 2Y62A 2E7FA 1WDDA 4GJIA 9XIMA 1F8MA 3B06A 3L5MA 5XIMA 2ACRA 3UPMA 1F3TA 1SW3A 2L5HA 2QJIA 3S2NA 1VB9A 1HKWA 1T41A 3N34A 5HMFA 4FPSA 1M7XA 1QOPA 3PAJA 3NEHA 3K8MA 3BURA 3U57A 1HKMA 2R1MA 1X98A 3CUZA 3BW3A 1UASA 1ICPA 1JIBA 4JTEA 2OPJA 1S1PA 3IIPA 1OC5A 2XVPA 4PCPA 4OBRA 3RMEA 4GINA 1KNWA 3LDVA 3NL5A 2JEPA 1FFQA 4HK7A 1CGUA 1R5YA 1Z32X 1NU5A 4PFHA 3P61A 4S3AA 2BG5A 1QU4A 4JTAA 1ZP3A 2QQ6A 2RDUA 3N3TA 4FXJA 5CSYA 4YYCA 1AJ2A 3BGJA 4TMBA 2WZHA 4HYRA 3R94A 5HWNA 1VD6A 1UR2A 3A21A 4CQBA 2A3EA 4LTSA 2GGEA 4IOTA 2VR4A 4OHQA 1IXQA 2B81A 1C8YA 4GH3A 4GNVA 1EOKA 4GRSA 4ORIA 5XINA 4ORMA 2A3LA 2D73A 4XAFA 3MYPA 4QSHA 4H6RA 4XK2A 1I60A 1SZGA 5AZ1A 3DENA 1LROA 2JALA 1KQZA 3AYTA 4JQ2A 3QR0A 1FWFC 5DY2A 1XV8A 3S3GA 1WP6A 4IISA 3EXTA 4DBSA 1X1OA 1B3WA 1NDWA 4QEEA 3BSHA 4O13A 1XF0A 2PDCA 1YW1A 2HNEA 1CXLA 1QNRA 5JIPA 2ZIDA 5FACA 4MLRA 5J5DA 3KBJA 1PZ3A 1J8VA 1HVQA 1DEDA 1GJPA 1HIZA 3PR2A 3DH7A 3G1XA 1E0WA 3TYDA 3W01A 1L6WA 2D2OA 5LHFA 3DHUA 2XGBA 5CJMA 1MDRA 4D6IA 3NR0A 3RM8A 4Q8MA 4RDYA 5LNVA 2V38A 2PURA 2OLSA 4DM2A 5E6ZA 2PTDA 1UJPA 3CL8A 2GVYA 3B0YA 3PBUA 1ZQ5A 2Z26A 2ACQA 5HDRA 1MZRA 3H55A 2QJMA 3HN3A 4Q4RA 2YPIA 4QTGA 3BMVA 3B0VC 4H8VA 1MFVA 2VEPA 1VAHA 1RVKA 1S3HA 1V0KA 1PTGA 3SUTA 5XIAA 1KM2A 4IIEA 4YN5A 6XIAA 1GEQA 3NL3A 5LKYA 1SO5A 5CPQA 1LRTA 2Q3RA 2P50A 2WHMA 4HKPA 3OIHA 1Q13A 3HG4A 2PU1A 2CEQA 3G2GA 4RCXA 2XINA 4M56A 2WMGA 3EWBX 2XISA 3O0KA 4B5XA 4W8LA 2ZUUA 2C71A 2FQIA 4W89A 3WBEA 3VOIA 1OFAA 3LRLA 5C70A 2C0HA 2E25A 4CU7A 4XB3A 3CAWA 2DSWA 1CLXA 3WL0A 1OBAA 3H2OA 3T44A 2OZ0A 1FCQA 2X0YA 3SY1A 3TOYA 2J7EA 1GQJA 2DH2A 4TV5A 4M19A 1VPYA 5E9XA 1LQAA 3Q4DA 1TPUA 3TTQA 1EO5A 2TRSA 1QW7A 3VTRA 3T05A 3N4AA 4HPNA 3BQ5A 3UWVA 3CV7A 5D05A 4QJ1A 1YMYA 4BQ3A 1VYPX 1MXGA 1AJ0A 3MBDA 3DG7A 2ANUA 1AUSL 3OBAA 3BXWA 3N2MA 2ZX6A 3PZGA 4HJWA 2OEKA 4AYSA 4W85A 5DRIA 1K8ZA 4B90A 1GWJA 3XIMA 3NAVA 3PFMA 2X2GA 2XFRA 3CAVA 4L9XA 4MADA 1WXYA 4R3UA 3WNOA 1EO7A 2E1WA 2C7FA 1EJSC 4XD5A 1KFCA 4NAEB 4ZSTA 4A35A 4JTRA 1LRQA 2GJPA 3BAYA 2ZX5A 3VDGA 1PB0A 3APYA 1IR2A 4QIUA 3H8AA 3S0CA 3PK7A 1XISA 2V82A 5JH1A 1LLWA 1CECA 4LYPA 3D6NA 1ITCA 3E2QA 1VGAA 1VCFA 4Q4SA 1M01A 4KIRA 2G95A 5D02A 2C19A 3W1LA 4KS0A 3EA1A 1H3GA 3T4WA 3KBWA 3O05A 1XYFA 1I1XA 4C91A 3OLGA 2WLYA 1FCUA 5ECUA 2DV0A 2J8FA 3APGA 3PBGA 3A4WA 4H8NA 1K9DA 4XX6A 4KBXA 4U2YA 1J0KA 4C6MA 3ARPA 4LSBA 1G69A 4QBXA 1D8CA 4GJJA 4HNLA 2QUVA 4N0RA 3OHMB 2WJZA 1B4KA 1XIGA 3NL6A 2QEZA 1XLIA 4WQ6A 4OIFA 1BLIA 3NYZA 3CAQA 4W9TA 4NRRA 2BSLA 1JCJA 2BTMA 3FSTA 5G2WA 3G3DA 2PDQA 4E8CA 3KOFA 3WNPA 2UWFA 1BYCA 4JKKA 3WNLA 1RBLA 5FAGA 3GD6A 1UP2A 1V5XA 3W2MA 1E0VA 1TIWA 1V6UA 2OODA 1RUSA 1PKMA 1U2YA 4C1NA 5A6KA 1H1ZA 2ZTJA 1W9UA 3GXPA 1EJWC 2JKEA 1SR0A 3O6CA 4GACA 5K9CA 1TPH1 5K2ZA 1AQMA 3H2MA 2Y5EA 4LYQA 4ECLA 3VO0A 5CC6A 3CB8A 2YJQA 3CZGA 4HU4A 3JRKA 1PSCA 4UFKA 1FWNA 2CBJA 4WIWA 3MSRA 3ZS4A 3HG5A 1KTBA 3WK3A 1G4EA 1RD6A 3V1HA 2HXTA 3FCPA 4L80A 1Q6OA 4DJEA 1L8PA 5DX7A 1DJHA 1K8XA 4NF7A 5MKGA 1WDWA 2WSKA 5CSRA 1GZGA 2WKLA 4E2OA 3DFYA 4DB7A 3EPNA 3U4FA 4REQA 2PWVA 1CCWB 1GOKA 3KX6A 3OPSA 1UQYA 1XKYA 3NZGA 3GU1A 5G1TA 1C91A 3FJ6A 4XIAA 1KFLA 1XKJA 2GVLA 4YMZA 1J2BA 2NT0A 1FDZA 3MWCA 4RLIA 1PWMA 5I3FA 2YBVA 3PTKA 2J4GA 1QNPA 1PCKA 5LHEA 3VOFA 3WD3A 1CXKA 1VEOA 1DOSA 3W7GA 5G1MA 4QLJA 3ZT7A 4A8IA 1PYFA 1KFJA 4IFKA 3QEZA 4HBKA 1BKSA 4AWEA 2GJLA 3FOKA 4AHOA 2Y7EA 4XZMX 1X1ZA 3F2DA 3F4DA 4A3HA 1GTEA 1EYWA 1BSIA 2QW5A 3GXTA 1F6YA 3KRZA 3ZOAA 5FA5A 1F76A 2PBGA 4OUIA 3P60A 1RZMA 1ZBWA 4DRSA 4ATLA 3TNBA 3ZSSA 3OA5A 5REQB 1DJQA 2VD9A 1M7JA 2YCIX 3OO2A 2Y5SA 5H8UA 1W2VA 4NJIA 2J75A 1S5WA 3UT0A 4B5NA 3MI6A 4F2BA 3MHUA 2ZICA 1S2CA 1KLZA 2FGZA 4XZHA 3TC3A 1PWLA 3UERA 3ITYA 2ZA2A 3GRIA 3WMCA 1FWAC 4RDVA 3I4EA 4GI4A 1F3EA 2OZ8A 3W1UA 4Q4OA 1FWEC 1J11A 3KFTA 3VYLA 1ITXA 2EKCA 1F6KA 5HUOA 4LXFA 5LIWX 6PTDA 1W56A 1RY8A 3VIHA 4NY2A 2C79A 1RLCL 1M7OA 3VKBA 3DBPA 1OIMA 2PDIA 4FP1A 3NQFA 2ZRYA 1E6XM 1D8WA 1QR7A 3TN4A 3HQ1A 3UWYA 3VKKA 4ZXLA 1E55A 1UUOA 1GQKA 2YZRA 1HF6A 4FNSA 3VNLA 2H9AB 2ON3A 4MGGA 1HZYA 3WQ5A 2V81A 4IXHA 3NQEA 1H09A 4RZ6A 2J7GA 4FF7A 1RH9A 1A5SA 1ZBVA 3CV6A 3CS2A 2AGKA 4G1NA 3TVAA 4IPLA 4N4QA 4DF2A 2DT0A 5BCAA 5H91A 3TYUA 1UIOA 2PTXA 4UQEA 3WK0A 4AZCA 2PWUA 1YBQA 3KBSA 3GIYA 4O0KA 4EPKA 4DJED 4EAYA 3NSMA 4Z42C 2Y61A 3VM5A 5FF4A 1J6OA 2WWDA 3VCCA 7TAAA 2FTYA 4WDWA 3I10A 3POCA 1JZ8A 3ZT5A 4LS2A 2CNCA 4LF1A 4GQBA 4UQ9A 4DI9A 3CPUA 1W8SA 3L5AA 3MSYA 4FF5A 2CLPA 5HANA 1RPXA 5FSDC 3I6RA 2OX4A 4EPBC 4HK6A 4B5VA 2WHJA 1K9EA 1M04A 2CZVA 1RBOB 2PDWA 3LM7A 1WBHA 3QQ1A 1BVNP 1TWZA 5AC8A 2WHKA 5EYWA 2R94A 1Q85A 3R7MA 2QXWA 3TWAA 3HMJG 3KZSA 1GVSA 1ICSA 1KA9F 4JZ5A 4XIMA 1TPC1 1OFRA 3AIEA 1OC7A 2PS2A 5DANA 2OSXA 3UA4A 1JZ2A 3C2YA 2PGRA 2NQLA 2VWSA 1VIZA 1N8IA 4X0NA 4C1KA 2VX7A 3UPWA 2Y5JA 2A21A 1C7SA 1V6WA 1AW1A 4J27A 3M5VA 4YWIA 5LIYX 1GVFA 3CZKA 1L9WA 3RO6A 4O17A 4O8AA 2IPFA 3H26A 4YTQA 1EJXC 4PYSA 4AX7A 1PHWA 4PMXA 3DI0A 4IMGA 3FJLA 2W92A 3NG3A 5BZAA 1HJSA 1XFBA 3E5PA 3T42A 3CV1A 3H2EA 4ZXOA 3GDLA 3M7SA 1Q6LA 1XC4A 3M0LA 3WYZA 1SMAA 2OGJA 4LBRA 1RJPA 1UD3A 3V36A 1QW8A 3EOUA 3L2MA 4QXIA 1Y8BA 4HCHA 5A69A 3ENLA 2GJXA 4Y9NA 3NZPA 2Z7GA 1BTCA 3SY5A 5G5IA 3M47A 3AHTA 2ZQ0A 3LEPA 3AXKA 2AMXA 1F61A 1I2NA 2DZBA 3P82A 4K2SA 1VBGA 1B3YA 4BF5A 4EKJA 1FH7A 1B4EA 3ZSTA 3LCFA 2ZC1A 4LUTA 2OLHA 4JX6A 1W9VA 2IKIA 4M29A 1Q63A 2F6XA 3NEVA 2GJRA 4FXSA 3KVKA 1JFHA 3NYDA 2XJ7A 3WLTA 1CDGA 4W7VA 4HD5A 2RUSA 1NM9A 1VLIA 3EOLA 1DJIA 4AZ7A 3CL6A 1W17A 1OF6A 3MCMA 4IPNB 2IPWA 4P61A 1E6NA 3G1AA 2I17A 1LTDA 1WYIA 1FHLA 4XVEA 5HULA 1EPXA 2X7WA 6ENLA 1KFWA 2Y7DA 1NWSA 2HJPA 3QC3A 1XLMA 4H00A 4PSPA 5GNZA 3P5ZA 5K3VA 3AAMA 4NHVA 3WD4A 5ABHA 3S4TA 4LWWA 1IWBA 1Y0EA 4WSKA 1PPIA 1H5YA 1D3CA 3MUY1 1JQXA 3O63A 7ENLA 4MWAC 2B4GA 4RDZA 2PGFA 2WSPA 4JQ3A 2GDVA 4F0MA 3VDBA 4JKLA 1CXIA 3W1RA 3PTMA 1F74A 3LK6A 2FZBA 3KTCA 4HMCA 4NZ5A 4O10A 3W0KA 1FY6A 3LB0A 1CB7B 4IP4A 1NQ6A 3BOFA 5FL0A 2AAAA 5HJLA 2BS9A 5I07A 3UNTA 1E4NA 4FIRA 2YBUA 4LOCA 4IQDA 1J6PA 4F66A 1MI3A 1EWDA 2AL2B 3O3RA 4GUHA 3S2JA 5B7YA 4Y8FA 3WN6A 1BG4A 5CCZA 1S5MA 1KV5A 4CD7A 1PZ0A 1E4MM 2G4FA 1JCTA 2FZ9A 4I9TA 4J9JA 2EAWA 4MVAA 2QDGA 3THAA 2PDMA 4GABA 4WGHA 5AHMA 5D2XA 5DN1A 3S46A 1PX8A 4DZIA 2O9PA 4KT2A 3ONBA 1VRXA 4GVFA 3W1PA 3ZQ9A 4PUMA 4L4MA 1TRDA 2BMBA 3V0UA 4UTLA 3ANVA 1QPNA 3FAWA 5CXPA 3RJXA 5C54A 2IQTA 2RJGA 4AY7A 2G5WA 3FA5A 4E4FA 2OT0A 1Q65A 3VD4A 5M03A 2CYGA 3AICA 4YLWA 1EDQA 1EBGA 3WQ8A 3KEHA 1X6LA 1A3HA 2PC8A 3SJNA 3A13A 3U2EA 3CJPA 3RPMA 3TMQA 3UQNA 4MHBA 5I00A 4W7UA 4JIQA 4LAOA 4UMCA 2PDKA 2PLCA 2Y2WA 1MW2A 1XH1A 2ZXBA 3A22A 3LPGA 1PVNA 4AF0B 3S6TA 1ZZMA 3W7DA 4WEVX 1SO3A 1B1YA 3P14A 4C5ZA 3GXFA 1JCMP 4DLMA 3A3HA 1J10A 4L64A 1QI4A 1AW5A 1Y5WA 1TFVA 2XSAA 3M0HA 4ZO7A 1TV3A 1QNSA 5EPDA 1YADA 2E6DA 4AY1A 4JFWA 4W8BA 3RFAA 1JF5A 3ISIX 1W3HA 3VZYA 1KRCC 3THUA 4EXQA 3JZEA 4WOZA 3T0CA 3URBA 4ZB2A 4C7GA 3HF3A 5L6UA 1Q2SA 1BYBA 1KR0A 4AHQA 4HHMA 1VCVA 1WE5A 4JHZA 1MUMA 3MUCA 3MT1A 1V77A 3LG3A 4AIEA 1KGWA 5CSSA 1PX4A 2QV4A 2Y8VA 4FXRA 1TPFA 2V2DA 1SSDA 4LCQA 4FALA 2YB1A 3TYCA 2XVKA 2J7DA 3SCQA 4E5TA 1CTNA 2FLIA 1OFOA 5A6SA 5EMLA 3CZLA 3SUUA 4D6GA 3W7KA 5ABEA 5CPLA 1GVQA 4J3XA 2YDSA 1NF0A 1YXDA 3MMDA 1UW9A 4FR1A 3W7CA 1QPKA 4UB9A 4UOJA 2NWSA 1H0IA 1EIXA 4DXKA 2X7VA 4RPPA 3ZVHB 3B0UX 1W3IA 4OOZA 2NQ9A 2VENA 3VDCA 4PUJA 1BTMA 1MRQA 4RUBA 4GXMA 2WBGA 4Q4KA 1W9XA 1CIUA 3R43A 3SCWA 1MW0A 1FKXA 1H7XA 4HPJA 3M0KA 4RNHA 3SCVA 3D5HA 3EOEA 1J2WA 4M6PA 5A8MA 3ZR5A 4UFIA 4LW7A 3PUDA 4MKVA 1JVNA 1TJRA 3O1NA 1FWSA 5G4HC 4HMEA 1DTNA 3RLVA 1A53A 2GK1B 3E12A 5TAOA 4NAEA 2FPVA 1TV8A 3BGAA 3EX6A 3VDHA 2VDGA 1X38A 2QCHA 1JYWA 2V3FA 1M53A 1GPWA 1NOUA 1W31A 4F0RA 4I5RA 1PXGA 5LXEA 1TTJA 2ZUMA 2DDXA 4WRHA 1BFNA 3N9RA 2J62A 3G1FA 3PJXA 1I0DA 3R0UA 2CW6A 4Q22A 4L56A 3KRUA 2OKTA 3QVQA 2B7QA 3W7OA 1VKFA 4FZIA 5HUPA 3C8FA 4G7FA 2Y70A 2B7OA 3M1ZA 3DFHA 3U2ZA 1DVJA 1I2RA 1QBAA 4S2BA 3UYIA 2HRWA 1P1XA 3QTPA 1R3SA 4IGNA 7A3HA 2IQ0A 4GNKB 5CQ1A 2C14A 5DBTA 4YVPA 4DNMA 4NT0A 1N8WA 5F2IA 2PWHA 3D46A 3GR4A 3WQGA 3PULA 2I1OA 3F5KA 4LUYA 1NWRA 2OZTA 4AZIA 4W84A 3ES8A 4KEZA 4J40A 2J66A 3MMUA 4HYWA 3C2FA 5FJPA 1OINA 1MXSA 1XFCA 1MW3A 1OK6A 3SECA 3O15A 3UWZA 1VPQA 3LSCA 4IGSA 3VFLA 1EEPA 1HKJA 3WD2A 1DL3A 2V68A 4G56A 1GG1A 4GWEA 3SSJA 2X2YA 4GVGA 1U5JA 4GVIA 2NX9A 4D8LA 4IHCA 1QPQA 1IZCA 1SFSA 2ZZ1A 4BQ4A 4Q4PA 1YPFA 2GQ3A 3KHJA 3SADA 3TTOA 2J9YA 3WUBA 1ME7A 4LY8A 1LDCA 2JGYA 3GB6A 3ZJ8A 2FPYA 3RILA 4NZCA 3ITLA 3GXDA 2OTDA 3BWWA 3GKAA 3QHNA 1H41A 3OB8A 7CGTA 3GSMA 3R0KA 1FOBA 4CNPA 3QZ6A 2DT2A 4FA3A 1XM3A 4O53A 3TLLA 1LBMA 3EYPA 3VIMA 4S3FA 4FX6M 3KVLA 1R3QA 5LIUX 5M2FX 3SQMA 4H83A 4IJBA 2QDDA 4GGBA 3LBOA 3B97A 4TR9A 4X3ZA 1YTKA 1RK6A 4ZGYA 4LUSA 2ZXDA 2V5KA 3T81A 2XVLA 3BO9A 4FHAA 3D0CA 2OWCA 3ZYZA 1TG7A 3RG6A 1A5KC 1A5CA 3P0XA 3O6YX 3PM6A 1IZJA 1KBJA 5AC6A 4I90A 3OP2A 2G3IA 2C18A 1XX1A 1WZAA 4J7RA 4UTTA 3V0TA 3WDPP 2MNRA 5REQA 3A6OA 1QOXA 1SO6A 2IPJA 4ZO8A 2O0TA 5C7VA 1FRBA 2J88A 3FHQA 1C29A 4F3HA 4JKMA 1GZJA 3R13A 4B15A 4ZO6A 2OQYA 3NZRA 3WH9A 1HFBA 2B7NA 2GWNA 3GUWA 1V03A 3LCIA 4U5IA 3T0BA 3V75A 2VWTA 5BOFA 1LOQA 2Y0FA 3BAJA 2D3LA 5EFDA 5BXTA 4PMVA 1OGSA 1G1YA 3R25A 2QUNA 4W86A 2WW5A 4DWSC 3MDWA 1EQPA 4GI9A 1PV8A 3OGSA 4O0ZA 2I16A 5A6LA 3IK4A 4RW5A 1RVGA 2VRJA 4JHMA 1YX1A 3S5OA 3IUHA 1W3TA 1I9CB 2GGGA 5DF0A 2VVNA 1DV7A 1F5ZA 3ARWA 2VEGA 3MVTA 3E02A 1FUYA 3AXIA 2I9EA 3N15A 1T40A 4LBSA 1O5XA 3FIGA 1XGDA 4CD5A 3VAVA 4CVUA 1VFFA 3W2NA 2PCQA 1PZ2A 3GXNA 3K2GA 2P76A 2VL4A 3PB2A 3W75A 2Y1HA 3SGUA 4ZTXA 3QMTA 2H9AA 3PHAA 1W1VA 4UOQA 3QJAA 4B5TA 4PR4A 4B9YA 1XG3A 3GWQA 2ONEA 2CLLA 1C92A 1F8IA 4DYJA 2O9RA 3VA8A 1A5AA 1F2JA 3MPGA 3AHXA 4OVXA 2ZUWA 1M3UA 2VFFA 3EGJA 1SUXA 2HE8A 4IGMA 1ONXA 4XSLA 1A49A 3N18A 2V3GA 4DAIA 4D6HA 3WF3A 5AB3A 5LIXX 3N04A 2YSWA 2CC0A 4GJ1A 2F2HA 1QO2A 1QI0A 4Q7IA 1G67A 1P4CA 1WDPA 4O11A 4CN4A 3TWBA 3MWAA 2XN0A 1S2VA 4KEVA 3GG0A 3W7RA 1PIFA 5A6TC 5KMYA 4R7WA 3SRDA 1V3IA 4JCMA 3LPOA 4QR6A 1LWHA 2ZZ4A 4ILSA 3ZXWA 2BB0A 3BCFA 3N2XA 2WMKA 5IFPA 3NO3A 1A5LC 1FWTA 4JY8A 4UQDA 4H8UA 1E0TA 2A7NA 1QFEA 3WDQA 2I5GA 1UQZA 1QTWA 1TRIA 3KOYA 3G3MA 1MQQA 3L4ZA 5F1VA 1OM0A 2R14A 3WBXA 4XAPA 3GY1A 1KFBA 3JR2A 3GR8A 3SRFA 3B05A 3ITCA 3WDRA 1GJWA 4A8RA 3HU7A 3OA3A 2EPOA 3AFBA 1Q6EA 3DC8A 1I2PA 3GHSA 3M0JA 2BOGX 3O06A 4HVXA 2EG7A 1DJXA 4O1CA 4LAKA 1Z89A 2QJNA 1BF6A 4WGXA 2DIEA 4WXYA 4DAFA 1THFD 4RNJA 4JTKA 2WVVB 2VUNA 1JGMA 2VXNA 3H24A 4N9BA 4U31A 4JYFA 5SWUA 3M5XA 7TIMA 5DEZA 4AD5A 3AHYA 1LOSA 2WYSA 3F2BA 4IL0A 2BHZA 3SUVA 5A6AA 4PMYA 1GVOA 3BVJA 3EDEA 2YBTA 3SQSA 4XV0A 3ZT6A 1EZWA 3WQEA 3N1AA 3WQDA 2WVSA 3NQCA 3NQVA 4QS5A 1V3HA 1B3XA 4LYKA 5CLTA 2VC7A 4AIOA 3DG6A 3EKLA 3L4TA 2GPTA 1UG6A 1KKOA 4C5YA 1M1BA 1ZRQA 2WPBA 4L6DA 1R0MA 3EOOA 3W1TA 2E40A 2WSQA 3GKFA 1UA3A 3FVMA 4TX9A 2EPHA 4IGHA 2CLEA 3E2RA 2Y89A 4W5ZA 5GVJA 4YPJA 2ZZ7A 3IIZA 3E0LA 2CERA 4Z0JA 2OLAA 3I7SA 5F2MA 2DZXA 4UWMA 3IRSA 2O56A 2Q01A 2VDIA 2QPUA 3C0SA 5FAJA 1ZJHA 4IMFA 2C15A 4J35A 2HVMA 3W6MA 4XUYA 4H9UA 3WBAA 1EHNA 4DBUA 3GH7A 1VHCA 1T8QA 4NNCA 2FB2A 3LHYA 2VX4A 3MI3A 1LG1A 1O1HA