2F6MB

Structure of a vps23-c:vps28-n subcomplex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
MDISQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFADTYNITASNAITRLERG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
total genus 33
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.200 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2f6mB00
2F66B 2F6MB 2P22B 2CAZB
chains in the Genus database with same CATH superfamily
3B55A 3KP9A 2XTQA 3LJ0A 3IAS1 3IAM1 4JCVE 3Q8DA 2XMXA 4PL5A 2FEFA 2YFAA 2F6MB 4Z7GA 2RLDA 3SDJA 4YZCA 1U5KA 1JQOA 4HEA1 4U6RA 3DA3A 3AJFA 2A2CA 3UITA 3FNBA 2ZRRA 4NV2A 5LNK1 4PL3A 2FUG1 1TDPA 2L1LB 2RIOA 4G75A 2JAEA 2V6EA 1YO7A 4O1PA 2QSBA 1SJ8A 4YZ9A 4DWLA 3JSBA 2IP6A 1W3SA 3LJ2A 2JB3A 2YFBA 2V1CC 2E8GA 4Z7HA 4G76A 2BL7A 2BL8A 2XTRA 2K19A 4Q9VA 5HGIA 3DA4A 4I1TA 2FU2A 2P22B 2RADA 2HGKA 2CAZB 4AS3A 2A2DA 3FVVA 3VA9A 3LJ1A 4GXTA 2ETDA 3DO9A 4NV5A 4HFVA 2JBWA 2MJFB 4O1OA 2KKMA 2JB2A 3I9V1 3FBVA 2ZW3A 4OAVB 2GSCA 3L0IA 4OAUC 2F66B 2QGMA 4AS2A 3F4MA 4PL4A 4YZDA 2JB1A 2QZGA 3P23A
chains in the Genus database with same CATH topology
1W3SA 3KP9A 2XTQA 2ZRRA 4NV2A 5LNK1 3LJ1A 3LJ0A 4PL3A 2FUG1 3JSBA 3IAS1 3IAM1 4JCVE 4GXTA 3LJ2A 2JB3A 2YFBA 3Q8DA 2V1CC 3DO9A 2XMXA 2L1LB 4NV5A 4HFVA 2RIOA 4PL5A 2E8GA 4Z7HA 4G75A 4G76A 2MJFB 2YFAA 2KKMA 2F6MB 2JAEA 4O1OA 2XTRA 2JB2A 3I9V1 2K19A 3FBVA 4Q9VA 2V6EA 5HGIA 4OAVB 3DA4A 4I1TA 3L0IA 2P22B 4OAUC 2F66B 4AS2A 4Z7GA 1YO7A 3F4MA 4O1PA 3SDJA 4PL4A 4YZCA 1U5KA 2CAZB 4HEA1 1SJ8A 4AS3A 4U6RA 4YZ9A 4YZDA 4DWLA 2A2DA 2JB1A 3AJFA 3DA3A 2A2CA 2IP6A 3UITA 3VA9A 3P23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F66 B;  2F6M B;  2P22 B;  2CAZ B; 
#chains in the Genus database with same CATH topology
 3B55 A;  3KP9 A;  2XTQ A;  3LJ0 A;  3IAS 1;  3IAM 1;  4JCV E;  3Q8D A;  2XMX A;  4PL5 A;  2FEF A;  2YFA A;  2F6M B;  4Z7G A;  2RLD A;  3SDJ A;  4YZC A;  1U5K A;  1JQO A;  4HEA 1;  4U6R A;  3DA3 A;  3AJF A;  2A2C A;  3UIT A;  3FNB A;  2ZRR A;  4NV2 A;  5LNK 1;  4PL3 A;  2FUG 1;  1TDP A;  2L1L B;  2RIO A;  4G75 A;  2JAE A;  2V6E A;  1YO7 A;  4O1P A;  2QSB A;  1SJ8 A;  4YZ9 A;  4DWL A;  3JSB A;  2IP6 A;  1W3S A;  3LJ2 A;  2JB3 A;  2YFB A;  2V1C C;  2E8G A;  4Z7H A;  4G76 A;  2BL7 A;  2BL8 A;  2XTR A;  2K19 A;  4Q9V A;  5HGI A;  3DA4 A;  4I1T A;  2FU2 A;  2P22 B;  2RAD A;  2HGK A;  2CAZ B;  4AS3 A;  2A2D A;  3FVV A;  3VA9 A;  3LJ1 A;  4GXT A;  2ETD A;  3DO9 A;  4NV5 A;  4HFV A;  2JBW A;  2MJF B;  4O1O A;  2KKM A;  2JB2 A;  3I9V 1;  3FBV A;  2ZW3 A;  4OAV B;  2GSC A;  3L0I A;  4OAU C;  2F66 B;  2QGM A;  4AS2 A;  3F4M A;  4PL4 A;  4YZD A;  2JB1 A;  2QZG A;  3P23 A; 
#chains in the Genus database with same CATH homology
 1W3S A;  3KP9 A;  2XTQ A;  2ZRR A;  4NV2 A;  5LNK 1;  3LJ1 A;  3LJ0 A;  4PL3 A;  2FUG 1;  3JSB A;  3IAS 1;  3IAM 1;  4JCV E;  4GXT A;  3LJ2 A;  2JB3 A;  2YFB A;  3Q8D A;  2V1C C;  3DO9 A;  2XMX A;  2L1L B;  4NV5 A;  4HFV A;  2RIO A;  4PL5 A;  2E8G A;  4Z7H A;  4G75 A;  4G76 A;  2MJF B;  2YFA A;  2KKM A;  2F6M B;  2JAE A;  4O1O A;  2XTR A;  2JB2 A;  3I9V 1;  2K19 A;  3FBV A;  4Q9V A;  2V6E A;  5HGI A;  4OAV B;  3DA4 A;  4I1T A;  3L0I A;  2P22 B;  4OAU C;  2F66 B;  4AS2 A;  4Z7G A;  1YO7 A;  3F4M A;  4O1P A;  3SDJ A;  4PL4 A;  4YZC A;  1U5K A;  2CAZ B;  4HEA 1;  1SJ8 A;  4AS3 A;  4U6R A;  4YZ9 A;  4YZD A;  4DWL A;  2A2D A;  2JB1 A;  3AJF A;  3DA3 A;  2A2C A;  2IP6 A;  3UIT A;  3VA9 A;  3P23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...