2F6MB

Structure of a vps23-c:vps28-n subcomplex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
b'MDISQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFADTYNITASNAITRLERG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 33
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.200 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2f6mB00
2P22B 2F6MB 2F66B 2CAZB
chains in the Genus database with same CATH superfamily
2BL7A 2V6EA 4OAVB 2ZW3A 4O1PA 2ZRRA 4I1TA 2ETDA 2F66B 4G75A 2XTQA 4YZDA 1JQOA 2XMXA 4Z7HA 2QGMA 3DA4A 4HFVA 4GXTA 3LJ2A 4DWLA 3JSBA 2GSCA 4AS3A 2K19A 3F4MA 4PL5A 2YFBA 4HEA1 4JCVE 2V1CC 2A2DA 3DO9A 2FUG1 3FBVA 3P23A 4OAUC 3AJFA 2F6MB 2YFAA 3LJ0A 3SDJA 4NV2A 4YZ9A 3I9V1 2RLDA 4Z7GA 3KP9A 2QZGA 2JB1A 2A2CA 2RADA 3LJ1A 2MJFB 5LNK1 2P22B 3VA9A 2BL8A 1YO7A 2L1LB 2IP6A 4O1OA 2JB2A 4NV5A 3IAM1 2E8GA 2JAEA 3DA3A 4U6RA 4Q9VA 3FNBA 2FU2A 1W3SA 3IAS1 4PL3A 2QSBA 4PL4A 1SJ8A 3FVVA 3Q8DA 2JBWA 1U5KA 2HGKA 3B55A 4YZCA 2KKMA 1TDPA 2XTRA 3UITA 3L0IA 2CAZB 4G76A 5HGIA 2FEFA 4AS2A 2RIOA 2JB3A
chains in the Genus database with same CATH topology
2V6EA 4OAVB 4O1PA 2ZRRA 4I1TA 2F66B 4G75A 2XTQA 4YZDA 2XMXA 4Z7HA 3DA4A 4HFVA 4GXTA 3LJ2A 4DWLA 4AS3A 3JSBA 2K19A 3F4MA 4PL5A 2YFBA 4HEA1 4JCVE 2V1CC 2A2DA 3DO9A 2FUG1 3FBVA 3P23A 4OAUC 3AJFA 2F6MB 2YFAA 3LJ0A 3SDJA 4NV2A 4YZ9A 3I9V1 4Z7GA 3KP9A 2JB1A 2A2CA 3LJ1A 2MJFB 5LNK1 2P22B 3VA9A 1YO7A 2L1LB 2IP6A 4O1OA 2JB2A 4NV5A 3IAM1 2E8GA 2JAEA 3DA3A 4U6RA 4Q9VA 1W3SA 3IAS1 4PL3A 4PL4A 1SJ8A 3Q8DA 1U5KA 4YZCA 2KKMA 2XTRA 3UITA 3L0IA 2CAZB 4G76A 5HGIA 4AS2A 2RIOA 2JB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P22 B;  2F6M B;  2F66 B;  2CAZ B; 
#chains in the Genus database with same CATH topology
 2BL7 A;  2V6E A;  4OAV B;  2ZW3 A;  4O1P A;  2ZRR A;  4I1T A;  2ETD A;  2F66 B;  4G75 A;  2XTQ A;  4YZD A;  1JQO A;  2XMX A;  4Z7H A;  2QGM A;  3DA4 A;  4HFV A;  4GXT A;  3LJ2 A;  4DWL A;  3JSB A;  2GSC A;  4AS3 A;  2K19 A;  3F4M A;  4PL5 A;  2YFB A;  4HEA 1;  4JCV E;  2V1C C;  2A2D A;  3DO9 A;  2FUG 1;  3FBV A;  3P23 A;  4OAU C;  3AJF A;  2F6M B;  2YFA A;  3LJ0 A;  3SDJ A;  4NV2 A;  4YZ9 A;  3I9V 1;  2RLD A;  4Z7G A;  3KP9 A;  2QZG A;  2JB1 A;  2A2C A;  2RAD A;  3LJ1 A;  2MJF B;  5LNK 1;  2P22 B;  3VA9 A;  2BL8 A;  1YO7 A;  2L1L B;  2IP6 A;  4O1O A;  2JB2 A;  4NV5 A;  3IAM 1;  2E8G A;  2JAE A;  3DA3 A;  4U6R A;  4Q9V A;  3FNB A;  2FU2 A;  1W3S A;  3IAS 1;  4PL3 A;  2QSB A;  4PL4 A;  1SJ8 A;  3FVV A;  3Q8D A;  2JBW A;  1U5K A;  2HGK A;  3B55 A;  4YZC A;  2KKM A;  1TDP A;  2XTR A;  3UIT A;  3L0I A;  2CAZ B;  4G76 A;  5HGI A;  2FEF A;  4AS2 A;  2RIO A;  2JB3 A; 
#chains in the Genus database with same CATH homology
 2V6E A;  4OAV B;  4O1P A;  2ZRR A;  4I1T A;  2F66 B;  4G75 A;  2XTQ A;  4YZD A;  2XMX A;  4Z7H A;  3DA4 A;  4HFV A;  4GXT A;  3LJ2 A;  4DWL A;  4AS3 A;  3JSB A;  2K19 A;  3F4M A;  4PL5 A;  2YFB A;  4HEA 1;  4JCV E;  2V1C C;  2A2D A;  3DO9 A;  2FUG 1;  3FBV A;  3P23 A;  4OAU C;  3AJF A;  2F6M B;  2YFA A;  3LJ0 A;  3SDJ A;  4NV2 A;  4YZ9 A;  3I9V 1;  4Z7G A;  3KP9 A;  2JB1 A;  2A2C A;  3LJ1 A;  2MJF B;  5LNK 1;  2P22 B;  3VA9 A;  1YO7 A;  2L1L B;  2IP6 A;  4O1O A;  2JB2 A;  4NV5 A;  3IAM 1;  2E8G A;  2JAE A;  3DA3 A;  4U6R A;  4Q9V A;  1W3S A;  3IAS 1;  4PL3 A;  4PL4 A;  1SJ8 A;  3Q8D A;  1U5K A;  4YZC A;  2KKM A;  2XTR A;  3UIT A;  3L0I A;  2CAZ B;  4G76 A;  5HGI A;  4AS2 A;  2RIO A;  2JB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...