2F77X

Solution structure of the r55f mutant of m-pmv matrix protein (p10)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKFWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
molecule keywords Core protein p10
total genus 28
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f77X00
2F76X 2F77X
chains in the Genus database with same CATH superfamily
3EUB2 1RXVA 2HBLA 2PMZF 4MFFA 3C2LA 2EAMA 4KLOA 1LKYB 5A0LA 4KLGA 1HUZA 1VLBA 3ISCA 5AICA 5J2EA 1BPZA 3C28A 4CDGA 2LM4A 2V9WA 5AHXA 5AKXA 1A77A 7ICVA 4QWBA 3TI0A 2Z7JA 2HCFA 2E1EA 1UA0A 8ICTA 2C2RA 1DGSA 5HMLA 5DQIA 5TISU 4JV0A 4KLLA 3RH6A 1DXSA 2JZBB 3GZFA 3T79A 2A19A 2HOFA 2UVVA 2VJ5A 4UB3A 1XU4A 5IINA 2BCVA 2EANA 1L3TA 2LYAA 1H38A 2PFOA 2W03A 4Q8FA 5CEHA 4EBDA 3RJFA 2YTUA 4ED8A 1S5LU 2FLLA 4Z6DA 2HVHA 1SZHA 4UQGA 1N63A 4PHAA 2R8HA 2LMRA 3ISBA 1ZQOA 1WYGA 5CB1A 1V85A 5KFOA 1KW4A 9ICAA 3RB3A 2YB4A 2WHEA 5KFXA 2WB1F 3ONNA 1CEZA 2VIXA 1Z1VA 2AQ4A 4F93B 1FFUA 5EE3A 3SQIA 2MAXA 1BNPA 3FDSA 2C2DA 2KVSA 1KFTA 4WJ3B 1A6SA 1ZQXA 2W11A 5KT6A 3SV3A 4NJ8A 1ZQJA 1FFVA 1ZQ1C 9ICVA 1KLNA 4DL3A 4EX6A 3F53A 1ZRMA 4RNOA 5AK5A 3HT3A 5KFBA 1Q46A 2XY5A 2AU0A 1MQ2A 3PY8A 5IIJA 1F0MA 5KT3A 5CRXA 4I2DA 5AIBA 4I2JA 3UPQA 4PGQA 4EEYA 4KTQA 3C5FA 4Q8EA 4ECVA 1A0PA 4NV0A 2KEYA 4EYIB 3QEBZ 4R66A 3OJUA 5AI0A 1DRGA 4OJ5A 5J2FA 4PZOA 5KFRA 1MSWD 3M9MB 1V9PA 1NJZA 3PW0A 3MC1A 2QB0B 5AI6A 3IM1A 3EZ5A 4F4XA 8ICEA 4BUGA 5G5GA 4FE3A 4JUZA 4YN4A 2RQ5A 4O3QA 4YQWA 1Y88A 1NK9A 4JK1A 2L5YA 1T4GA 4DQRA 4J9OA 1ZQEA 5AK3A 1N2XA 1B43A 4UASA 3QX7A 3EPIA 4AYBF 3TACB 5AM2A 4P0PA 5DBCA 3ETLA 5HMMA 4BWMA 5KFGA 4QZ9A 2OM6A 3H8SA 1ZQYA 3BS7A 1U49A 4M9JA 5HR7A 2W9AA 2Y1IA 4DL4A 4LVSA 3V6HA 1BGXT 2H3ZA 1YZ7A 3G6YA 5J2GA 3PR5B 1BPXA 1B22A 1ZQTA 3MGHA 3V7JA 1JX4A 2UVRA 2KSOA 5ALTA 3KD3A 1Z00A 5IILA 4DWIA 4ECXA 3RH4A 5ALWA 2FMPA 4P0QB 4MFAA 2C22A 9ICWA 1P7DA 2HVIA 4LJXA 5J2BA 4ECZA 4O0IA 8ICXA 2OCEA 5HP4A 5KL1B 3SMVA 4DO9A 4EBCA 9ICPA 4C8LA 4MFCA 1S0NA 3QEAZ 9ICFA 5AM4A 4R64A 2DPJA 1JI7A 1N60A 5HNKA 4QZDA 3FAHA 2FE9A 9ICHA 2JEIA 5CR0A 5AKHA 3MABA 1A76A 4TUQA 3T5JA 5EOZA 3C5GA 5ALRA 5KFAA 4XUSA 4UAUA 2K8AA 1T8EA 2KVCA 3PZPA 1QQ6A 2F1JA 3SAHA 2QLTA 2PI4A 5ALQA 3AM9A 2D3DA 3Q8MA 2AXTU 2J6SA 3H7IA 4JV1A 2F8LA 3K1ZA 4YXJA 5J8YC 2LBOA 3WK8A 3GIJA 3IHQB 1T3NA 5DKWA 1SKSA 4PZNA 5TZVA 2VA3A 2MUTB 3CNHA 2BR0A 5KFPA 4B9SA 3KTQA 3BS5A 3HILA 3ZDDA 5J8YA 2BKEA 2DKZA 2WF5A 2CPRA 4K4GA 4F71A 5BOLA 3OTQA 4PGXA 1ZQGA 2IHNA 1SB3C 4J9SA 4TUPA 4UB2A 1WUDA 1TV9A 3M6KA 3HRDD 1XWLA 2DFLA 2G09A 4F72A 4FBTA 1X9WA 3HJEA 4Y2TA 3KBBA 3GFKB 4RUAA 2BCRA 1AQ6A 4BX9C 3M8RA 5AKYA 2JRZA 3RFAA 1MN8A 1NZPA 5KTQA 4BXOA 3GQCA 2HHXA 4KLUA 2P6UA 1N5XA 3CW2C 2FMSA 5KFZA 4I2EA 3RAXA 2BDPA 2XGQA 8ICCA 5ALIA 2OHFA 2BCSA 4UATA 1XC9A 3Q8QB 4I2HA 4OD0A 3CP8A 5J0OA 5EWEA 2BQRA 4RQ2A 3C2KA 3HKZF 1BNOA 2KMDA 4C7ZA 4IC9A 3GIMA 2G5IB 2DUYA 5J2DA 2Y9UA 4I2AA 1TK0A 4I2FA 4DLEA 4M0AA 7ICKA 3SAGA 3CRXA 3ZDEA 4DQSA 2LYBA 4RPYA 3RAQA 3BQTA 3JPOA 1QQ7A 8ICQA 2CXYA 3F2BA 1HJPA 4EEKA 4KX3A 2W3SA 4J9KA 2KV2A 4B9TA 3SAFA 4DS5A 5L1IA 3MR6A 1ZJMA 1Z00B 2W9MA 4X5VA 1YT3A 1ZRNA 1X6JA 1TFRA 4CCHA 1XO1A 3VCBA 4B9LA 5ALGA 5DGBA 2B0CA 3NVZA 4ED0A 3KZIU 1KKXA 3WU2U 3AU2A 4PH5A 4YMOA 1JROA 3HW8A 1L7NA 2W7OA 4OJLA 1XS9D 3PR4A 2BQUA 3JPRA 4CF4A 5J2AA 4M04A 5AKLA 2K89A 2PXIA 2VA2A 4Q45A 1SZPA 3CYMA 3E0FA 4FS2A 5BPCA 4JB3A 2W9CB 1NK0A 2HMXA 1COOA 4GFJA 3ETRA 4CRXA 4NY8A 1U9LA 1PVQA 4O9MA 2ZIXA 2W9BA 4F91B 2VANA 3OPXA 2F2AB 8ICYA 4DOBA 5AM1A 2KHQA 2ZIUB 1SGGA 1VJ5A 1D9FA 5KFTA 1NJYA 4YVZA 4KITB 4Y2QA 3EWAA 4ELTA 1FEZA 1MA7A 3MR5A 2HHTA 4DQQA 2GLEA 5AIAA 4NXZA 5J0PA 3RB0A 1SXDA 1UT8A 2YMQA 1M6YA 2ZIXB 4RU9A 4P0QA 1BPDA 5J0XA 3H4BA 5ALFA 3PNCA 9ICLA 1ZD5A 1WWUA 3PX6A 2ODGA 4QWAA 8ICRA 4F5RA 2ATLA 3LVWA 4Y2VA 3HP6A 4M9LA 4UAVA 1KRPA 2ISPA 2KK0A 1L3VA 2H3VA 2IHMA 1U4BA 1UT5A 2AQ0A 3N7SC 4RQ0A 1V38A 5IIIA 2KJ5A 4OCZA 4NLNA 2JEJA 5AM3A 3JPNA 1XSNA 4NLGA 3IV6A 4MF2A 4UB1A 4C0ZA 5EWFA 8ICKA 4KMOB 2G07A 2K4EA 4O3PA 5ALMA 5EE0A 4BGDA 1BPYA 5AKEA 5KL8B 5ALNA 5HHIA 5DLGA 2YX8A 4F3OA 7ICEA 1JMSA 3RRGA 2QARA 4IS7A 1UCVA 2E8PA 1KFSA 2PFQA 3QU9A 3T3FA 3WKEA 5J0WA 4FZMA 3GV5B 2R18A 2XGPA 5ALYA 3WKBA 4CF3A 1RQNA 3MR3A 2N1RA 2EH9A 2JHDA 3TAQA 3N7PD 5IIMA 5DB8A 1IM4A 4NM1A 4JWNA 5EE9A 3SENA 1T3QA 1COKA 4PJ0U 3ZDCA 1PUZA 3BZKA 3NGDA 4OJPA 3FM9A 3RB6A 4U6PA 3PO5A 2GWSA 2ZJAA 4DOAA 4DFKA 4K4HA 5F9LA 8ICVA 4UB8U 3QXGA 4I2IA 3PV8A 4O5EA 5J2IA 1MQ3A 3ZD8A 2NRXA 4KLTA 1PK1A 5ALZA 3GDXA 2BCUA 2PFPA 1XNSA 4C7YA 2E5SA 1KTQA 2BCQA 5ALPA 2KD1A 1HUOA 4O5CA 4CNQA 5H2FU 1BPBA 1UQVA 1ZETA 5D49A 4Y2RA 2VA8A 5ALSA 2DBYA 2NO5A 3V6JA 4KMUA 1QSYA 1QTMA 4IL6U 4GXIA 1L8OA 7ICJA 3F5AA 4PL1A 3SZ2A 8ICUA 4TQRA 1Z4OA 3SR6A 1S8OA 2NRWA 5JRTA 4M47A 7ICMA 8ICGA 3KHGA 1T94A 4KLMA 5EE1A 2W8KA 4YMMA 9ICJA 2R8IA 7ICRA 3T5KA 4YG2A 1X9SA 1SV4A 2FLNA 1J2MA 1S10A 2ZXIA 2ZIUA 1B0XA 3U26A 2A1JB 4ECRA 2WAQF 4QJFB 2Y0SF 3EPGA 3QE9Y 2KZMA 4B9UA 7ICGA 2KZZA 1JALA 5KFQA 4RNNA 3RB4A 3M7DA 2W8LA 4KLQA 2KP7A 3PSTA 1ZQQA 1PZNA 2ALZA 2YB1A 4J03A 2ZTDA 4ELUA 1D8BA 9ICOA 5D46A 4F2RA 4RQ1A 1NKBA 5J0QA 3R9KA 2YQEA 3ZDAA 1BPEA 4M9GA 1TAQA 5AI8A 4RQ5A 4JV2A 2FPMA 5ALKA 2OXOA 5AKJA 4P4OA 4IRDA 2A1JA 2P35A 4TQSA 3BDPA 4I28A 2ZTCA 3ORYA 2KJ8A 5KFWA 2XVTA 3MR2A 1N48A 2NYVA 3NVVA 1S76D 3GU3A 1SV0A 1BVSA 3H8MA 9ICIA 3PVXA 4CF5A 3H0RB 2J6UA 1L7PA 4C8MA 3F2DA 1MC8A 9ICSA 1L7OA 2JR5A 5AI9A 3C23A 5ALOA 4UB6U 5DG9A 5L1JA 1KEJA 3E58A 3IN5A 5IIOA 2C2EA 1C7YA 1WWVA 4CE6A 5DB7A 4F4ZA 4O5KA 9ICNA 4RT2A 3RH5A 4PGYA 1OW5A 4DQPA 3N28A 8ICPA 4UARA 3TADA 1ZQUA 2HHSA 2ASJA 5J29A 7ICQA 3OSPA 4IQWA 2IBKA 3PSFA 2PKEA 1PVPA 3GIIA 3JPSA 5JUMA 4NLBA 3GIKA 3C21A 2NRZA 4B6JA 2KOBA 2WF9A 1O03A 3KHLA 3AQEA 3QUCA 9ICBA 1SWWA 4ECTA 2ZTEA 3O0FA 2NRTA 4YD2A 2QB0A 1NK5A 1RDFA 3Q8SB 3KFUF 1NNLA 2H3FA 3B0YA 4DSFA 4QZAA 1ZQIA 4E0DA 4C8NA 8ICOA 2K4HA 2IOFA 3ISDA 5L9XA 5BOMA 8ICFA 4KX5A 4TURA 1TK5A 3UQ2A 2KZ3A 3NRWA 2XO7A 3AEVA 3V72A 5G5HA 1L7MA 3TFSA 5D4BA 2KKVA 5GTHU 3MGVA 1RYUA 2IMWP 5J0RA 4J9LA 2OEHA 3BQ7A 4I29A 1NK6A 5KFDA 5L1LA 3RJHA 4FS1A 3KHRA 4DSKA 4YFKA 1X40A 4YCXA 3QZ8A 1CRXA 2KSOB 5DQHA 2QKQA 4ED7A 2BQ3A 2V4QA 4RNMA 1KSPA 1TAMA 3A0HU 4I2BA 9ICTA 2BHNA 2OH2A 4ED3A 2WFAA 1KN5A 4KLSA 5DG8A 3UXPA 4F4WA 9ICGA 1ZQVA 2DKXA 5DDMA 3KHHA 3THVA 3SD7A 1TKDA 3BQ1A 4QW8A 2DPIA 1ZD4A 4UBBA 5KT2A 4B9VA 3IG8A 4ECUA 1Z4NA 2AGQA 4QZEA 3N4MB 3NUQA 5AI5A 2MA1A 7ICTA 7ICOA 4O3SA 3MDCA 1NK7A 3NRZA 4RQ6A 3WK4A 4I2CA 9ICXA 4Z6FA 1TE2A 4KN4A 4DFMA 2F3NA 4QZIA 7ICLA 4DSLA 4C4RA 3GV7B 4QZHA 4OJOA 3PSIA 3WKDA 1ZQKA 3AN1A 5KG2A 5AM0A 3H40A 4C80A 2JEGA 1TK8A 2XC9A 4QW9A 1F44A 3H8WA 3OHBA 3M6ZA 5KG6A 1ED1A 2HI0A 8ICAA 1KL9A 4NLKA 4AP9A 2QB1A 1FO4A 1NKEA 2DQNB 1K1QA 4LZDA 1ZQZA 1ZQMA 2BDUA 4QZ8A 3UM9A 1OUQA 2YMLA 3UXNA 2ZJ8A 3BQ0A 4AYBC 5AKKA 2HHVA 5KFUA 2MU2A 4DSIA 5CP2A 1WG8A 4DLGA 4ED2A 4DCCA 4QWEA 3JPPA 3TADC 3QU5A 1OXJA 1ZD2P 3KOOA 4NL9A 5AK6A 4XQ8A 3MFIA 4DQIA 1ZQRA 3PW5A 4IQUA 1UPHA 1XSLA 2HBKA 3LWMA 2M0NA 2DWQA 2R8KA 2KN7A 1KDHA 5AKGA 1X66A 2WTFA 3BQ2A 1IIPA 2M9NA 2ZIVB 1S77D 4P4MA 4MF8A 5J2KA 2RDJA 1IG6A 3F5EA 2IA6A 4F5OA 2IOHA 3DV9A 3RR7A 4DL6A 2G06A 1X6IA 1CUKA 3RR8A 2KKPA 4R63A 3QUTA 1ZQDA 4BXOB 3C1ZA 4DEZA 2KICA 5KFVA 4ED6A 3V7LA 5B66U 4RZRA 2HOQA 4IQVA 3GV8B 2FLPA 2DF4B 2VKQA 3NS1A 4Q43A 1F5SA 5DQGA 1PK1B 3RJGA 4GXKA 8ICNA 4J9PA 4MEYA 1QLNA 4QNLA 3F2CA 4QZBA 4UW9A 1D8YA 3ZD9A 3ZI4A 3Q8PB 7ICPA 2F77X 4DOCA 4KLFA 1NOMA 3K1RB 5EWGA 2W54A 3ED5A 1L3UA 2ZUDA 3DDHA 5L1KA 4P0PB 4UBCA 1LKYA 4P4PA 4MEXA 2AJQA 4YR2A 2BZFA 2A3VA 1JIHA 4F5QA 3IRUA 1D8LA 2WB1C 3J81j 2KJ9A 3H4DA 1U48A 4R65A 7ICFA 1ZQHA 1RQLA 2WF8A 3OJSA 1Q3UA 4IR9A 2H3IA 4OO1J 4QWCA 3KKAC 4JWMA 1C20A 3C2MA 5B5EU 2W43A 2CN1A 4YXMA 2FPLA 1DK2A 1ZQNA 2PFNA 1PK3A 4RQ7A 5J2CA 4ICAA 2YMPA 4YR0A 4QIWC 5F3XB 1ZQSA 4U7CA 4CGZA 2W7PA 5KFYA 1RXWA 3V7KA 2HOIA 4NLCA 4PPXA 5KFLA 2YMMA 1RPLA 5J2HA 1ZQFA 2EZXA 3LVVA 9ICEA 1DOQA 3UMCA 2G0AA 2KHVA 4ECYA 2RP5A 2Y0SC 2B6GA 1TVAA 5KAFU 3L5KA 4J9QA 2YN4A 3VC8A 2JV3A 1SL0A 2ZG6A 3MGIA 4GC6A 2ZIWA 2YY6A 3K75D 1ZJNA 5AK4A 5KT5A 1ZQLA 3G6VA 4J9NA 7ICHA 3QUBA 3WK6A 2KIWA 1AROP 4GXJA 2FPKA 1QCKA 1YZ6A 4DF4A 2AH5A 2FI1A 2NRVA 5J0SA 1SL1A 4F5PA 5KFIA 4R8UA 4UAZA 2LKYA 1S0VA 3H8JA 4Y2UA 5ALLA 4RPXA 4FO6A 3QYPA 5ALHA 2JGAA 1X42A 1QH9A 4KLEA 4ED1A 8ICLA 3UXOA 7ICSA 3T5LA 1ZQCA 4Z6EA 5ALXA 5KFFA 3TARA 2PMZC 5ALEA 4KLIA 1T7PA 4QZCA 1SV0C 3QUQA 1CI4A 3HWTA 4GLXA 1X9MA 5FP0A 4F92B 5CJ7A 1JXLA 4O3RA 5J2JA 4DSEA 5KNIA 9ICRA 2Y1JA 2KFZA 3M1YA 1J2NA 4M6WA 4ZOHC 2V4RA 4DSJA 1RYSA 2W3RA 3MBYA 1DK3A 5AKIA 2AHOB 2JXJA 3LK9A 3WKCA 3MDAA 5T14A 2R8JA 2Q4TA 2QARB 2G08A 4TUSA 3D2SA 2ZUCA 4I27A 3Q8LA 2ISOA 3TQ1A 2WF7A 3L4PA 4A8EA 2C28A 5KT7A 4M9NA 3RJKA 3V6KA 2HDOA 2XCPA 1LVHA 4G3IA 4RT3A 1SWVA 3D6JA 3QU7A 4FBUA 2ASLA 5KG4A 3RF9A 4UAWA 4UB4A 4YR3A 3T5HA 2HSZA 2EZYA 5J0UA 3H0MB 2JH7A 2BPFA 2G5HB 3D2NA 3LWLA 2XI9A 1ZQWA 3L3FX 2DL0A 1Z3EB 1QSLA 2D8CA 4RQNA 2KG5A 3RJEA 2XY7A 1HEKA 4K4IA 4ELVA 2FMQA 3B9JA 2JMGA 2OYYA 5J0YA 4RQ8A 3MFHA 4JMUA 1VDVA 2H3QA 5DDYA 2KFNA 7ICNA 1U47A 4O3NA 1Z1BA 2BPGA 5L1MA 5HHHA 5KG5A 4XRHA 4HYKA 1X2IA 5KFCA 4QZGA 3JPQA 4UAYA 4EBEA 2UVWA 5ALUA 3AU6A 4ECWA 4Y2PA 5KT4A 4C4SA 2ZJ5A 3PX4A 1DGJA 2P66A 1SIJA 2HBJA 2MUTA 5CHGA 1GO3F 9ICMA 2A1AA 2NO4A 3PW2A 2HHWA 3S6JA 2CRXA 1X9XA 3IP4B 3SEIA 2W04A 5J0TA 3Q8KA 4DF8A 4MHVA 3QU4A 1SKRA 2I1QA 1N56A 2W55A 3HX0A 2EZZA 1IV8A 5DBAA 4YP3A 2H5XA 5GTIU 4PHDA 3C1YA 3WKAA 3M9OB 1NK8A 4RUCA 1U45A 1QQ5A 5KG0A 2ZIWB 3I1YA 2K60A 4XA5A 3TFRA 4BWJA 4DL5A 3RJJA 3IG5A 3QU2A 2B21A 4M6WB 1L6NA 2K8BB 4FZLA 2FJ6A 5KG7A 1O08A 4IRCA 1SL2A 5KFSA 1IXRA 5AI4A 4R8UB 2HBMA 1RZTA 4KLDA 1KFDA 1LV5A 2ESEA 3TANA 2E3TA 5C0YA 5DB9A 4BDPA 4ACOA 5CA7A 4KN7A 3H0LB 3PX0A 3AUOA 4EENA 3A0BU 3FC4A 5E79U 3BS5B 4RQMA 2R8GA 3WK9A 1K5OA 2OWOA 1XO0A 2KIVA 2EAOA 4PL2A 5CWRA 5KFEA 2BPCA 3LYSA 4O3OA 1Z19A 1FIQA 2XICA 3ZDBA 9ICQA 4Y2SA 2W9BB 3N97B 5KG1A 4QWDA 2JZBA 3PW7A 2K8CB 1LB2B 9ICCA 2LPEA 2E1FA 1JRPA 3B0XA 3M9NB 4ZH4A 3QZ7A 4DFDA 4UB5A 1RM6C 5JTIA 3HPOA 4RQ3A 1JN3A 4EZ6A 2HHQA 4DL2A 1ZQPA 2FDRA 4Y2JA 5F9NA 1ZD3A 3RJIA 2O6KA 3PSPA 2LI6A 3UMGA 4C8KA 2F76X 3KKAA 3SYZA 1UA1A 4NWIA 3ALRA 3FYHA 3DEEA 3EW9A 1HIWA 2RRDA 3G6XA 3PMLA 1V97A 2D6FC 8ICBA 4GC7A 4RPZA 4OJ6A 3RBEA 4F4YA 4BJQA 2MRLA 2HW3A 1JUDA 8ICMA 4J9MA 4ECSA 3C29A 3EYZA 4FZNA 2EDUA 1RYRA 3QNMA 4USAA 1S0MA 4C8OA 5DGAA 3NVYA 3Q8RB 1ZOLA 1PVRA 2UVUA 2PI5A 4F50A 5DBBA 2JH1A 1Q3VA 2XCAA 2Y9TA 1NK4A 2F8KA 4QZFA 5AKZA 2J6TA 4B9NA 1SXEA 3OHAA 3PMNA 3RBDA 2I5HA 1ZQAA 3E2EA 4Y2YA 4Y2XA 5C5JA 3N7RC 4B9MA 2E8NA 2RDIA 4YMNA 4IRKA 1NJXA 2JEFA 4HAIA 3KZXA 4J9RA 1JXEA 2RLTA 4Q44A 3AMZA 1KBUA 9ICUA 3NASA 3NVWA 2AGPA 5KFHA 4NLZA 1K1SA 5HR6A 1ECWA 2GH1A 2ASDA 4PHPA 2GO7A 1UHUA 7ICUA 4ECQA 2E8MA 2XY6A 4M2YA 1Q8KA 4M9HA 5IIKA 3GILA 5JU5A 4DFJA 5DLFA 4P2HA 2HHUA 2I6XA 4EZ9A 2GOLA 3AQFA 4Z6CA 1ZQBA 2EQYA 4RQ4A 3PO4A 2W9CA 5K4LA 4IQTA 1N5WA 2ZUBA 2E8OA 8ICSA 3WK7A 1N62A 3BJYA 4FFDA 4F8RA 1NZBA 4F5NA 4NL9C 1WCNA 4GIBA 8ICIA 3M8SA 1QSSA 3RTVA 3RRHA 8ICWA 4DFPA 1ZYQA 1NI3A 5ALDA 5ALJA 2WAQC 4US8A 3WK5A 1TAUA 8ICHA 1B4FA 4I2GA 4QIWF 3PW4A 3JPTA 3K4GA 4IR1A 1S0OA 9ICKA 3HKZC 4O3MA 3I76A 2Q0ZX 5DB6A 2KE7A 3LDAA 5KFKA 1L8LA 2ES6A 2IOFK 2ZXHA 5KFJA 4PHEA 3OGUA 1D9DA 3TKAA 2P6RA 1NJWA 3OSNA 3ICXA 2KNJA 3SV4A 3UQ0A 2LM1A 1XSPA 3I28A 1N61A 3IDWA 2KTQA 3SI8A 1URJA 4G9BA 5KAIU 1J97A 2MSNA 3UMBA 2RHFA 5KG3A 4F2SA 5DG7A 5KFMA 2K4PA 2K4IA 4EELA 4US9A 4EX7A 2NV3A 2I9GA 3NTUA 5AM5A 1RG6A 2XIDA 3BZCA 4F4KA 2EAPA 1S97A 2F1IA 2LYHA 2WF6A 1ZXIA 2F1HA 1EXNA 2ZIVA 2VJ4A 4DS4A 5KFNA 3TAPA 2BGWA 1KQQA 4NM2A 2LHTA 4YD1A 4LZGA 2AGOA 4DL7A 3D2QA 1L5UA 1WCLA 3AL0B 1S9FA 5ALVA 4C4TA 4EYHB 8ICZA 2DGZA 1L3SA 1NKCA 7ICIA 2F44A 4KLHA 4KLJA 8ICJA 1SKWA
chains in the Genus database with same CATH topology
3RF9A 2K8BB 2HBLA 2PMZF 4KMOB 5KL1B 2OH2A 2G07A 3SMVA 2K4EA 2ZIXA 4FZLA 5CRXA 3C29A 2KIWA 4FZNA 3OPXA 5A0LA 2F2AB 3H0MB 2JH7A 5KL8B 2G5HB 3D2NA 2KHQA 2YX8A 3PSFA 2WAQC 1PVPA 1A0PA 4NV0A 2ZXIA 2XI9A 2KEYA 2ZIUA 2A3VA 4QIWF 4NLBA 2ZIUB 3L3FX 3C28A 1PVRA 2HBMA 3CP8A 4CDGA 1HEKA 2WAQF 2LKYA 2KOBA 2JH1A 3IG8A 2WB1C 4FZMA 1Q3VA 3HKZC 3AQEA 3HKZF 1DRGA 4O3MA 2KJ9A 2R18A 4OJ5A 4QJFB 2Y0SF 4ACOA 4IC9A 2Z7JA 3NUQA 2G5IB 2JMGA 2OYYA 3H0LB 3O0FA 2N1RA 2E1EA 2MA1A 2JHDA 2JGAA 4P0PB 3N7PD 2K8AA 3N7RC 4JMUA 2ZXHA 2H3QA 2KVCA 3PZPA 1XO0A 2H3IA 1Q3UA 1UPHA 4PL2A 1MA7A 4OO1J 3M7DA 3SAHA 3SAGA 4BUGA 2HBKA 1Z1BA 4FE3A 3KFUF 2H3FA 3ICXA 3LYSA 2M0NA 1Z19A 2KNJA 3T79A 3GZFA 3PSTA 3CRXA 4OJPA 2HOFA 2LYBA 1IIPA 2XICA 2YB1A 2VJ5A 3KZXA 2ZIVB 2PMZC 4U6PA 2CN1A 1D8BA 2K4HA 2LYAA 3F2BA 4KX3A 3F5EA 2W03A 2KV2A 2F8LA 3K1ZA 2ZIXB 3SAFA 1KBUA 1URJA 2K8CB 4AYBF 2LBOA 4KX5A 4ICAA 2E1FA 4OJOA 4P0PA 4P0QA 2G06A 2RHFA 3NRWA 4QIWC 1SZHA 1ECWA 2KKPA 3PSIA 4U7CA 5HR6A 1YT3A 4CGZA 2GH1A 2W7PA 4CRXA 2K4IA 2HBJA 1GO3F 2OXOA 2KICA 2NV3A 2OM6A 2KKVA 3MGVA 1XNSA 3VCBA 2HOQA 3LVWA 2HOIA 1F44A 2XIDA 5HR7A 4NLCA 2E5SA 2YB4A 2CRXA 2CPRA 2KJ8A 2XVTA 3IP4B 3M6ZA 1ED1A 2WB1F 2DF4B 2KD1A 2W04A 2H3ZA 3GU3A 2ZIVA 3ONNA 5T14A 2VIXA 2VJ4A 2VKQA 3SQIA 2GOLA 2Q4TA 3AQFA 3LVVA 3PSPA 2W7OA 2G0AA 3H0RB 2G08A 4WJ3B 2F76X 2KHVA 1WUDA 3D2SA 1A6SA 2H3VA 2DQNB 2LHTA 2RP5A 3M6KA 4OJLA 2G09A 3F2DA 1CRXA 2Y0SC 4NWIA 1ZQ1C 2BDUA 3ALRA 3N7SC 3D2QA 4QNLA 3F5AA 2KJ5A 4PL1A 3F2CA 1OUQA 3AL0B 3F53A 2K89A 3DEEA 1HIWA 1NZBA 2RRDA 3VC8A 4BX9C 3CYMA 4A8EA 2F77X 3E0FA 5C0YA 3IN5A 4P0QB 2DGZA 2D6FC 4AYBC 2ZG6A 1TAMA 2ZIWB 3RFAA 4OJ6A 2ZIWA 1P7DA 2HMXA 3IG5A 4C0ZA 1T94A 4GFJA 4BJQA 1L6NA 2MRLA 1PVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F76 X;  2F77 X; 
#chains in the Genus database with same CATH topology
 3EUB 2;  1RXV A;  2HBL A;  2PMZ F;  4MFF A;  3C2L A;  2EAM A;  4KLO A;  1LKY B;  5A0L A;  4KLG A;  1HUZ A;  1VLB A;  3ISC A;  5AIC A;  5J2E A;  1BPZ A;  3C28 A;  4CDG A;  2LM4 A;  2V9W A;  5AHX A;  5AKX A;  1A77 A;  7ICV A;  4QWB A;  3TI0 A;  2Z7J A;  2HCF A;  2E1E A;  1UA0 A;  8ICT A;  2C2R A;  1DGS A;  5HML A;  5DQI A;  5TIS U;  4JV0 A;  4KLL A;  3RH6 A;  1DXS A;  2JZB B;  3GZF A;  3T79 A;  2A19 A;  2HOF A;  2UVV A;  2VJ5 A;  4UB3 A;  1XU4 A;  5IIN A;  2BCV A;  2EAN A;  1L3T A;  2LYA A;  1H38 A;  2PFO A;  2W03 A;  4Q8F A;  5CEH A;  4EBD A;  3RJF A;  2YTU A;  4ED8 A;  1S5L U;  2FLL A;  4Z6D A;  2HVH A;  1SZH A;  4UQG A;  1N63 A;  4PHA A;  2R8H A;  2LMR A;  3ISB A;  1ZQO A;  1WYG A;  5CB1 A;  1V85 A;  5KFO A;  1KW4 A;  9ICA A;  3RB3 A;  2YB4 A;  2WHE A;  5KFX A;  2WB1 F;  3ONN A;  1CEZ A;  2VIX A;  1Z1V A;  2AQ4 A;  4F93 B;  1FFU A;  5EE3 A;  3SQI A;  2MAX A;  1BNP A;  3FDS A;  2C2D A;  2KVS A;  1KFT A;  4WJ3 B;  1A6S A;  1ZQX A;  2W11 A;  5KT6 A;  3SV3 A;  4NJ8 A;  1ZQJ A;  1FFV A;  1ZQ1 C;  9ICV A;  1KLN A;  4DL3 A;  4EX6 A;  3F53 A;  1ZRM A;  4RNO A;  5AK5 A;  3HT3 A;  5KFB A;  1Q46 A;  2XY5 A;  2AU0 A;  1MQ2 A;  3PY8 A;  5IIJ A;  1F0M A;  5KT3 A;  5CRX A;  4I2D A;  5AIB A;  4I2J A;  3UPQ A;  4PGQ A;  4EEY A;  4KTQ A;  3C5F A;  4Q8E A;  4ECV A;  1A0P A;  4NV0 A;  2KEY A;  4EYI B;  3QEB Z;  4R66 A;  3OJU A;  5AI0 A;  1DRG A;  4OJ5 A;  5J2F A;  4PZO A;  5KFR A;  1MSW D;  3M9M B;  1V9P A;  1NJZ A;  3PW0 A;  3MC1 A;  2QB0 B;  5AI6 A;  3IM1 A;  3EZ5 A;  4F4X A;  8ICE A;  4BUG A;  5G5G A;  4FE3 A;  4JUZ A;  4YN4 A;  2RQ5 A;  4O3Q A;  4YQW A;  1Y88 A;  1NK9 A;  4JK1 A;  2L5Y A;  1T4G A;  4DQR A;  4J9O A;  1ZQE A;  5AK3 A;  1N2X A;  1B43 A;  4UAS A;  3QX7 A;  3EPI A;  4AYB F;  3TAC B;  5AM2 A;  4P0P A;  5DBC A;  3ETL A;  5HMM A;  4BWM A;  5KFG A;  4QZ9 A;  2OM6 A;  3H8S A;  1ZQY A;  3BS7 A;  1U49 A;  4M9J A;  5HR7 A;  2W9A A;  2Y1I A;  4DL4 A;  4LVS A;  3V6H A;  1BGX T;  2H3Z A;  1YZ7 A;  3G6Y A;  5J2G A;  3PR5 B;  1BPX A;  1B22 A;  1ZQT A;  3MGH A;  3V7J A;  1JX4 A;  2UVR A;  2KSO A;  5ALT A;  3KD3 A;  1Z00 A;  5IIL A;  4DWI A;  4ECX A;  3RH4 A;  5ALW A;  2FMP A;  4P0Q B;  4MFA A;  2C22 A;  9ICW A;  1P7D A;  2HVI A;  4LJX A;  5J2B A;  4ECZ A;  4O0I A;  8ICX A;  2OCE A;  5HP4 A;  5KL1 B;  3SMV A;  4DO9 A;  4EBC A;  9ICP A;  4C8L A;  4MFC A;  1S0N A;  3QEA Z;  9ICF A;  5AM4 A;  4R64 A;  2DPJ A;  1JI7 A;  1N60 A;  5HNK A;  4QZD A;  3FAH A;  2FE9 A;  9ICH A;  2JEI A;  5CR0 A;  5AKH A;  3MAB A;  1A76 A;  4TUQ A;  3T5J A;  5EOZ A;  3C5G A;  5ALR A;  5KFA A;  4XUS A;  4UAU A;  2K8A A;  1T8E A;  2KVC A;  3PZP A;  1QQ6 A;  2F1J A;  3SAH A;  2QLT A;  2PI4 A;  5ALQ A;  3AM9 A;  2D3D A;  3Q8M A;  2AXT U;  2J6S A;  3H7I A;  4JV1 A;  2F8L A;  3K1Z A;  4YXJ A;  5J8Y C;  2LBO A;  3WK8 A;  3GIJ A;  3IHQ B;  1T3N A;  5DKW A;  1SKS A;  4PZN A;  5TZV A;  2VA3 A;  2MUT B;  3CNH A;  2BR0 A;  5KFP A;  4B9S A;  3KTQ A;  3BS5 A;  3HIL A;  3ZDD A;  5J8Y A;  2BKE A;  2DKZ A;  2WF5 A;  2CPR A;  4K4G A;  4F71 A;  5BOL A;  3OTQ A;  4PGX A;  1ZQG A;  2IHN A;  1SB3 C;  4J9S A;  4TUP A;  4UB2 A;  1WUD A;  1TV9 A;  3M6K A;  3HRD D;  1XWL A;  2DFL A;  2G09 A;  4F72 A;  4FBT A;  1X9W A;  3HJE A;  4Y2T A;  3KBB A;  3GFK B;  4RUA A;  2BCR A;  1AQ6 A;  4BX9 C;  3M8R A;  5AKY A;  2JRZ A;  3RFA A;  1MN8 A;  1NZP A;  5KTQ A;  4BXO A;  3GQC A;  2HHX A;  4KLU A;  2P6U A;  1N5X A;  3CW2 C;  2FMS A;  5KFZ A;  4I2E A;  3RAX A;  2BDP A;  2XGQ A;  8ICC A;  5ALI A;  2OHF A;  2BCS A;  4UAT A;  1XC9 A;  3Q8Q B;  4I2H A;  4OD0 A;  3CP8 A;  5J0O A;  5EWE A;  2BQR A;  4RQ2 A;  3C2K A;  3HKZ F;  1BNO A;  2KMD A;  4C7Z A;  4IC9 A;  3GIM A;  2G5I B;  2DUY A;  5J2D A;  2Y9U A;  4I2A A;  1TK0 A;  4I2F A;  4DLE A;  4M0A A;  7ICK A;  3SAG A;  3CRX A;  3ZDE A;  4DQS A;  2LYB A;  4RPY A;  3RAQ A;  3BQT A;  3JPO A;  1QQ7 A;  8ICQ A;  2CXY A;  3F2B A;  1HJP A;  4EEK A;  4KX3 A;  2W3S A;  4J9K A;  2KV2 A;  4B9T A;  3SAF A;  4DS5 A;  5L1I A;  3MR6 A;  1ZJM A;  1Z00 B;  2W9M A;  4X5V A;  1YT3 A;  1ZRN A;  1X6J A;  1TFR A;  4CCH A;  1XO1 A;  3VCB A;  4B9L A;  5ALG A;  5DGB A;  2B0C A;  3NVZ A;  4ED0 A;  3KZI U;  1KKX A;  3WU2 U;  3AU2 A;  4PH5 A;  4YMO A;  1JRO A;  3HW8 A;  1L7N A;  2W7O A;  4OJL A;  1XS9 D;  3PR4 A;  2BQU A;  3JPR A;  4CF4 A;  5J2A A;  4M04 A;  5AKL A;  2K89 A;  2PXI A;  2VA2 A;  4Q45 A;  1SZP A;  3CYM A;  3E0F A;  4FS2 A;  5BPC A;  4JB3 A;  2W9C B;  1NK0 A;  2HMX A;  1COO A;  4GFJ A;  3ETR A;  4CRX A;  4NY8 A;  1U9L A;  1PVQ A;  4O9M A;  2ZIX A;  2W9B A;  4F91 B;  2VAN A;  3OPX A;  2F2A B;  8ICY A;  4DOB A;  5AM1 A;  2KHQ A;  2ZIU B;  1SGG A;  1VJ5 A;  1D9F A;  5KFT A;  1NJY A;  4YVZ A;  4KIT B;  4Y2Q A;  3EWA A;  4ELT A;  1FEZ A;  1MA7 A;  3MR5 A;  2HHT A;  4DQQ A;  2GLE A;  5AIA A;  4NXZ A;  5J0P A;  3RB0 A;  1SXD A;  1UT8 A;  2YMQ A;  1M6Y A;  2ZIX B;  4RU9 A;  4P0Q A;  1BPD A;  5J0X A;  3H4B A;  5ALF A;  3PNC A;  9ICL A;  1ZD5 A;  1WWU A;  3PX6 A;  2ODG A;  4QWA A;  8ICR A;  4F5R A;  2ATL A;  3LVW A;  4Y2V A;  3HP6 A;  4M9L A;  4UAV A;  1KRP A;  2ISP A;  2KK0 A;  1L3V A;  2H3V A;  2IHM A;  1U4B A;  1UT5 A;  2AQ0 A;  3N7S C;  4RQ0 A;  1V38 A;  5III A;  2KJ5 A;  4OCZ A;  4NLN A;  2JEJ A;  5AM3 A;  3JPN A;  1XSN A;  4NLG A;  3IV6 A;  4MF2 A;  4UB1 A;  4C0Z A;  5EWF A;  8ICK A;  4KMO B;  2G07 A;  2K4E A;  4O3P A;  5ALM A;  5EE0 A;  4BGD A;  1BPY A;  5AKE A;  5KL8 B;  5ALN A;  5HHI A;  5DLG A;  2YX8 A;  4F3O A;  7ICE A;  1JMS A;  3RRG A;  2QAR A;  4IS7 A;  1UCV A;  2E8P A;  1KFS A;  2PFQ A;  3QU9 A;  3T3F A;  3WKE A;  5J0W A;  4FZM A;  3GV5 B;  2R18 A;  2XGP A;  5ALY A;  3WKB A;  4CF3 A;  1RQN A;  3MR3 A;  2N1R A;  2EH9 A;  2JHD A;  3TAQ A;  3N7P D;  5IIM A;  5DB8 A;  1IM4 A;  4NM1 A;  4JWN A;  5EE9 A;  3SEN A;  1T3Q A;  1COK A;  4PJ0 U;  3ZDC A;  1PUZ A;  3BZK A;  3NGD A;  4OJP A;  3FM9 A;  3RB6 A;  4U6P A;  3PO5 A;  2GWS A;  2ZJA A;  4DOA A;  4DFK A;  4K4H A;  5F9L A;  8ICV A;  4UB8 U;  3QXG A;  4I2I A;  3PV8 A;  4O5E A;  5J2I A;  1MQ3 A;  3ZD8 A;  2NRX A;  4KLT A;  1PK1 A;  5ALZ A;  3GDX A;  2BCU A;  2PFP A;  1XNS A;  4C7Y A;  2E5S A;  1KTQ A;  2BCQ A;  5ALP A;  2KD1 A;  1HUO A;  4O5C A;  4CNQ A;  5H2F U;  1BPB A;  1UQV A;  1ZET A;  5D49 A;  4Y2R A;  2VA8 A;  5ALS A;  2DBY A;  2NO5 A;  3V6J A;  4KMU A;  1QSY A;  1QTM A;  4IL6 U;  4GXI A;  1L8O A;  7ICJ A;  3F5A A;  4PL1 A;  3SZ2 A;  8ICU A;  4TQR A;  1Z4O A;  3SR6 A;  1S8O A;  2NRW A;  5JRT A;  4M47 A;  7ICM A;  8ICG A;  3KHG A;  1T94 A;  4KLM A;  5EE1 A;  2W8K A;  4YMM A;  9ICJ A;  2R8I A;  7ICR A;  3T5K A;  4YG2 A;  1X9S A;  1SV4 A;  2FLN A;  1J2M A;  1S10 A;  2ZXI A;  2ZIU A;  1B0X A;  3U26 A;  2A1J B;  4ECR A;  2WAQ F;  4QJF B;  2Y0S F;  3EPG A;  3QE9 Y;  2KZM A;  4B9U A;  7ICG A;  2KZZ A;  1JAL A;  5KFQ A;  4RNN A;  3RB4 A;  3M7D A;  2W8L A;  4KLQ A;  2KP7 A;  3PST A;  1ZQQ A;  1PZN A;  2ALZ A;  2YB1 A;  4J03 A;  2ZTD A;  4ELU A;  1D8B A;  9ICO A;  5D46 A;  4F2R A;  4RQ1 A;  1NKB A;  5J0Q A;  3R9K A;  2YQE A;  3ZDA A;  1BPE A;  4M9G A;  1TAQ A;  5AI8 A;  4RQ5 A;  4JV2 A;  2FPM A;  5ALK A;  2OXO A;  5AKJ A;  4P4O A;  4IRD A;  2A1J A;  2P35 A;  4TQS A;  3BDP A;  4I28 A;  2ZTC A;  3ORY A;  2KJ8 A;  5KFW A;  2XVT A;  3MR2 A;  1N48 A;  2NYV A;  3NVV A;  1S76 D;  3GU3 A;  1SV0 A;  1BVS A;  3H8M A;  9ICI A;  3PVX A;  4CF5 A;  3H0R B;  2J6U A;  1L7P A;  4C8M A;  3F2D A;  1MC8 A;  9ICS A;  1L7O A;  2JR5 A;  5AI9 A;  3C23 A;  5ALO A;  4UB6 U;  5DG9 A;  5L1J A;  1KEJ A;  3E58 A;  3IN5 A;  5IIO A;  2C2E A;  1C7Y A;  1WWV A;  4CE6 A;  5DB7 A;  4F4Z A;  4O5K A;  9ICN A;  4RT2 A;  3RH5 A;  4PGY A;  1OW5 A;  4DQP A;  3N28 A;  8ICP A;  4UAR A;  3TAD A;  1ZQU A;  2HHS A;  2ASJ A;  5J29 A;  7ICQ A;  3OSP A;  4IQW A;  2IBK A;  3PSF A;  2PKE A;  1PVP A;  3GII A;  3JPS A;  5JUM A;  4NLB A;  3GIK A;  3C21 A;  2NRZ A;  4B6J A;  2KOB A;  2WF9 A;  1O03 A;  3KHL A;  3AQE A;  3QUC A;  9ICB A;  1SWW A;  4ECT A;  2ZTE A;  3O0F A;  2NRT A;  4YD2 A;  2QB0 A;  1NK5 A;  1RDF A;  3Q8S B;  3KFU F;  1NNL A;  2H3F A;  3B0Y A;  4DSF A;  4QZA A;  1ZQI A;  4E0D A;  4C8N A;  8ICO A;  2K4H A;  2IOF A;  3ISD A;  5L9X A;  5BOM A;  8ICF A;  4KX5 A;  4TUR A;  1TK5 A;  3UQ2 A;  2KZ3 A;  3NRW A;  2XO7 A;  3AEV A;  3V72 A;  5G5H A;  1L7M A;  3TFS A;  5D4B A;  2KKV A;  5GTH U;  3MGV A;  1RYU A;  2IMW P;  5J0R A;  4J9L A;  2OEH A;  3BQ7 A;  4I29 A;  1NK6 A;  5KFD A;  5L1L A;  3RJH A;  4FS1 A;  3KHR A;  4DSK A;  4YFK A;  1X40 A;  4YCX A;  3QZ8 A;  1CRX A;  2KSO B;  5DQH A;  2QKQ A;  4ED7 A;  2BQ3 A;  2V4Q A;  4RNM A;  1KSP A;  1TAM A;  3A0H U;  4I2B A;  9ICT A;  2BHN A;  2OH2 A;  4ED3 A;  2WFA A;  1KN5 A;  4KLS A;  5DG8 A;  3UXP A;  4F4W A;  9ICG A;  1ZQV A;  2DKX A;  5DDM A;  3KHH A;  3THV A;  3SD7 A;  1TKD A;  3BQ1 A;  4QW8 A;  2DPI A;  1ZD4 A;  4UBB A;  5KT2 A;  4B9V A;  3IG8 A;  4ECU A;  1Z4N A;  2AGQ A;  4QZE A;  3N4M B;  3NUQ A;  5AI5 A;  2MA1 A;  7ICT A;  7ICO A;  4O3S A;  3MDC A;  1NK7 A;  3NRZ A;  4RQ6 A;  3WK4 A;  4I2C A;  9ICX A;  4Z6F A;  1TE2 A;  4KN4 A;  4DFM A;  2F3N A;  4QZI A;  7ICL A;  4DSL A;  4C4R A;  3GV7 B;  4QZH A;  4OJO A;  3PSI A;  3WKD A;  1ZQK A;  3AN1 A;  5KG2 A;  5AM0 A;  3H40 A;  4C80 A;  2JEG A;  1TK8 A;  2XC9 A;  4QW9 A;  1F44 A;  3H8W A;  3OHB A;  3M6Z A;  5KG6 A;  1ED1 A;  2HI0 A;  8ICA A;  1KL9 A;  4NLK A;  4AP9 A;  2QB1 A;  1FO4 A;  1NKE A;  2DQN B;  1K1Q A;  4LZD A;  1ZQZ A;  1ZQM A;  2BDU A;  4QZ8 A;  3UM9 A;  1OUQ A;  2YML A;  3UXN A;  2ZJ8 A;  3BQ0 A;  4AYB C;  5AKK A;  2HHV A;  5KFU A;  2MU2 A;  4DSI A;  5CP2 A;  1WG8 A;  4DLG A;  4ED2 A;  4DCC A;  4QWE A;  3JPP A;  3TAD C;  3QU5 A;  1OXJ A;  1ZD2 P;  3KOO A;  4NL9 A;  5AK6 A;  4XQ8 A;  3MFI A;  4DQI A;  1ZQR A;  3PW5 A;  4IQU A;  1UPH A;  1XSL A;  2HBK A;  3LWM A;  2M0N A;  2DWQ A;  2R8K A;  2KN7 A;  1KDH A;  5AKG A;  1X66 A;  2WTF A;  3BQ2 A;  1IIP A;  2M9N A;  2ZIV B;  1S77 D;  4P4M A;  4MF8 A;  5J2K A;  2RDJ A;  1IG6 A;  3F5E A;  2IA6 A;  4F5O A;  2IOH A;  3DV9 A;  3RR7 A;  4DL6 A;  2G06 A;  1X6I A;  1CUK A;  3RR8 A;  2KKP A;  4R63 A;  3QUT A;  1ZQD A;  4BXO B;  3C1Z A;  4DEZ A;  2KIC A;  5KFV A;  4ED6 A;  3V7L A;  5B66 U;  4RZR A;  2HOQ A;  4IQV A;  3GV8 B;  2FLP A;  2DF4 B;  2VKQ A;  3NS1 A;  4Q43 A;  1F5S A;  5DQG A;  1PK1 B;  3RJG A;  4GXK A;  8ICN A;  4J9P A;  4MEY A;  1QLN A;  4QNL A;  3F2C A;  4QZB A;  4UW9 A;  1D8Y A;  3ZD9 A;  3ZI4 A;  3Q8P B;  7ICP A;  2F77 X;  4DOC A;  4KLF A;  1NOM A;  3K1R B;  5EWG A;  2W54 A;  3ED5 A;  1L3U A;  2ZUD A;  3DDH A;  5L1K A;  4P0P B;  4UBC A;  1LKY A;  4P4P A;  4MEX A;  2AJQ A;  4YR2 A;  2BZF A;  2A3V A;  1JIH A;  4F5Q A;  3IRU A;  1D8L A;  2WB1 C;  3J81 j;  2KJ9 A;  3H4D A;  1U48 A;  4R65 A;  7ICF A;  1ZQH A;  1RQL A;  2WF8 A;  3OJS A;  1Q3U A;  4IR9 A;  2H3I A;  4OO1 J;  4QWC A;  3KKA C;  4JWM A;  1C20 A;  3C2M A;  5B5E U;  2W43 A;  2CN1 A;  4YXM A;  2FPL A;  1DK2 A;  1ZQN A;  2PFN A;  1PK3 A;  4RQ7 A;  5J2C A;  4ICA A;  2YMP A;  4YR0 A;  4QIW C;  5F3X B;  1ZQS A;  4U7C A;  4CGZ A;  2W7P A;  5KFY A;  1RXW A;  3V7K A;  2HOI A;  4NLC A;  4PPX A;  5KFL A;  2YMM A;  1RPL A;  5J2H A;  1ZQF A;  2EZX A;  3LVV A;  9ICE A;  1DOQ A;  3UMC A;  2G0A A;  2KHV A;  4ECY A;  2RP5 A;  2Y0S C;  2B6G A;  1TVA A;  5KAF U;  3L5K A;  4J9Q A;  2YN4 A;  3VC8 A;  2JV3 A;  1SL0 A;  2ZG6 A;  3MGI A;  4GC6 A;  2ZIW A;  2YY6 A;  3K75 D;  1ZJN A;  5AK4 A;  5KT5 A;  1ZQL A;  3G6V A;  4J9N A;  7ICH A;  3QUB A;  3WK6 A;  2KIW A;  1ARO P;  4GXJ A;  2FPK A;  1QCK A;  1YZ6 A;  4DF4 A;  2AH5 A;  2FI1 A;  2NRV A;  5J0S A;  1SL1 A;  4F5P A;  5KFI A;  4R8U A;  4UAZ A;  2LKY A;  1S0V A;  3H8J A;  4Y2U A;  5ALL A;  4RPX A;  4FO6 A;  3QYP A;  5ALH A;  2JGA A;  1X42 A;  1QH9 A;  4KLE A;  4ED1 A;  8ICL A;  3UXO A;  7ICS A;  3T5L A;  1ZQC A;  4Z6E A;  5ALX A;  5KFF A;  3TAR A;  2PMZ C;  5ALE A;  4KLI A;  1T7P A;  4QZC A;  1SV0 C;  3QUQ A;  1CI4 A;  3HWT A;  4GLX A;  1X9M A;  5FP0 A;  4F92 B;  5CJ7 A;  1JXL A;  4O3R A;  5J2J A;  4DSE A;  5KNI A;  9ICR A;  2Y1J A;  2KFZ A;  3M1Y A;  1J2N A;  4M6W A;  4ZOH C;  2V4R A;  4DSJ A;  1RYS A;  2W3R A;  3MBY A;  1DK3 A;  5AKI A;  2AHO B;  2JXJ A;  3LK9 A;  3WKC A;  3MDA A;  5T14 A;  2R8J A;  2Q4T A;  2QAR B;  2G08 A;  4TUS A;  3D2S A;  2ZUC A;  4I27 A;  3Q8L A;  2ISO A;  3TQ1 A;  2WF7 A;  3L4P A;  4A8E A;  2C28 A;  5KT7 A;  4M9N A;  3RJK A;  3V6K A;  2HDO A;  2XCP A;  1LVH A;  4G3I A;  4RT3 A;  1SWV A;  3D6J A;  3QU7 A;  4FBU A;  2ASL A;  5KG4 A;  3RF9 A;  4UAW A;  4UB4 A;  4YR3 A;  3T5H A;  2HSZ A;  2EZY A;  5J0U A;  3H0M B;  2JH7 A;  2BPF A;  2G5H B;  3D2N A;  3LWL A;  2XI9 A;  1ZQW A;  3L3F X;  2DL0 A;  1Z3E B;  1QSL A;  2D8C A;  4RQN A;  2KG5 A;  3RJE A;  2XY7 A;  1HEK A;  4K4I A;  4ELV A;  2FMQ A;  3B9J A;  2JMG A;  2OYY A;  5J0Y A;  4RQ8 A;  3MFH A;  4JMU A;  1VDV A;  2H3Q A;  5DDY A;  2KFN A;  7ICN A;  1U47 A;  4O3N A;  1Z1B A;  2BPG A;  5L1M A;  5HHH A;  5KG5 A;  4XRH A;  4HYK A;  1X2I A;  5KFC A;  4QZG A;  3JPQ A;  4UAY A;  4EBE A;  2UVW A;  5ALU A;  3AU6 A;  4ECW A;  4Y2P A;  5KT4 A;  4C4S A;  2ZJ5 A;  3PX4 A;  1DGJ A;  2P66 A;  1SIJ A;  2HBJ A;  2MUT A;  5CHG A;  1GO3 F;  9ICM A;  2A1A A;  2NO4 A;  3PW2 A;  2HHW A;  3S6J A;  2CRX A;  1X9X A;  3IP4 B;  3SEI A;  2W04 A;  5J0T A;  3Q8K A;  4DF8 A;  4MHV A;  3QU4 A;  1SKR A;  2I1Q A;  1N56 A;  2W55 A;  3HX0 A;  2EZZ A;  1IV8 A;  5DBA A;  4YP3 A;  2H5X A;  5GTI U;  4PHD A;  3C1Y A;  3WKA A;  3M9O B;  1NK8 A;  4RUC A;  1U45 A;  1QQ5 A;  5KG0 A;  2ZIW B;  3I1Y A;  2K60 A;  4XA5 A;  3TFR A;  4BWJ A;  4DL5 A;  3RJJ A;  3IG5 A;  3QU2 A;  2B21 A;  4M6W B;  1L6N A;  2K8B B;  4FZL A;  2FJ6 A;  5KG7 A;  1O08 A;  4IRC A;  1SL2 A;  5KFS A;  1IXR A;  5AI4 A;  4R8U B;  2HBM A;  1RZT A;  4KLD A;  1KFD A;  1LV5 A;  2ESE A;  3TAN A;  2E3T A;  5C0Y A;  5DB9 A;  4BDP A;  4ACO A;  5CA7 A;  4KN7 A;  3H0L B;  3PX0 A;  3AUO A;  4EEN A;  3A0B U;  3FC4 A;  5E79 U;  3BS5 B;  4RQM A;  2R8G A;  3WK9 A;  1K5O A;  2OWO A;  1XO0 A;  2KIV A;  2EAO A;  4PL2 A;  5CWR A;  5KFE A;  2BPC A;  3LYS A;  4O3O A;  1Z19 A;  1FIQ A;  2XIC A;  3ZDB A;  9ICQ A;  4Y2S A;  2W9B B;  3N97 B;  5KG1 A;  4QWD A;  2JZB A;  3PW7 A;  2K8C B;  1LB2 B;  9ICC A;  2LPE A;  2E1F A;  1JRP A;  3B0X A;  3M9N B;  4ZH4 A;  3QZ7 A;  4DFD A;  4UB5 A;  1RM6 C;  5JTI A;  3HPO A;  4RQ3 A;  1JN3 A;  4EZ6 A;  2HHQ A;  4DL2 A;  1ZQP A;  2FDR A;  4Y2J A;  5F9N A;  1ZD3 A;  3RJI A;  2O6K A;  3PSP A;  2LI6 A;  3UMG A;  4C8K A;  2F76 X;  3KKA A;  3SYZ A;  1UA1 A;  4NWI A;  3ALR A;  3FYH A;  3DEE A;  3EW9 A;  1HIW A;  2RRD A;  3G6X A;  3PML A;  1V97 A;  2D6F C;  8ICB A;  4GC7 A;  4RPZ A;  4OJ6 A;  3RBE A;  4F4Y A;  4BJQ A;  2MRL A;  2HW3 A;  1JUD A;  8ICM A;  4J9M A;  4ECS A;  3C29 A;  3EYZ A;  4FZN A;  2EDU A;  1RYR A;  3QNM A;  4USA A;  1S0M A;  4C8O A;  5DGA A;  3NVY A;  3Q8R B;  1ZOL A;  1PVR A;  2UVU A;  2PI5 A;  4F50 A;  5DBB A;  2JH1 A;  1Q3V A;  2XCA A;  2Y9T A;  1NK4 A;  2F8K A;  4QZF A;  5AKZ A;  2J6T A;  4B9N A;  1SXE A;  3OHA A;  3PMN A;  3RBD A;  2I5H A;  1ZQA A;  3E2E A;  4Y2Y A;  4Y2X A;  5C5J A;  3N7R C;  4B9M A;  2E8N A;  2RDI A;  4YMN A;  4IRK A;  1NJX A;  2JEF A;  4HAI A;  3KZX A;  4J9R A;  1JXE A;  2RLT A;  4Q44 A;  3AMZ A;  1KBU A;  9ICU A;  3NAS A;  3NVW A;  2AGP A;  5KFH A;  4NLZ A;  1K1S A;  5HR6 A;  1ECW A;  2GH1 A;  2ASD A;  4PHP A;  2GO7 A;  1UHU A;  7ICU A;  4ECQ A;  2E8M A;  2XY6 A;  4M2Y A;  1Q8K A;  4M9H A;  5IIK A;  3GIL A;  5JU5 A;  4DFJ A;  5DLF A;  4P2H A;  2HHU A;  2I6X A;  4EZ9 A;  2GOL A;  3AQF A;  4Z6C A;  1ZQB A;  2EQY A;  4RQ4 A;  3PO4 A;  2W9C A;  5K4L A;  4IQT A;  1N5W A;  2ZUB A;  2E8O A;  8ICS A;  3WK7 A;  1N62 A;  3BJY A;  4FFD A;  4F8R A;  1NZB A;  4F5N A;  4NL9 C;  1WCN A;  4GIB A;  8ICI A;  3M8S A;  1QSS A;  3RTV A;  3RRH A;  8ICW A;  4DFP A;  1ZYQ A;  1NI3 A;  5ALD A;  5ALJ A;  2WAQ C;  4US8 A;  3WK5 A;  1TAU A;  8ICH A;  1B4F A;  4I2G A;  4QIW F;  3PW4 A;  3JPT A;  3K4G A;  4IR1 A;  1S0O A;  9ICK A;  3HKZ C;  4O3M A;  3I76 A;  2Q0Z X;  5DB6 A;  2KE7 A;  3LDA A;  5KFK A;  1L8L A;  2ES6 A;  2IOF K;  2ZXH A;  5KFJ A;  4PHE A;  3OGU A;  1D9D A;  3TKA A;  2P6R A;  1NJW A;  3OSN A;  3ICX A;  2KNJ A;  3SV4 A;  3UQ0 A;  2LM1 A;  1XSP A;  3I28 A;  1N61 A;  3IDW A;  2KTQ A;  3SI8 A;  1URJ A;  4G9B A;  5KAI U;  1J97 A;  2MSN A;  3UMB A;  2RHF A;  5KG3 A;  4F2S A;  5DG7 A;  5KFM A;  2K4P A;  2K4I A;  4EEL A;  4US9 A;  4EX7 A;  2NV3 A;  2I9G A;  3NTU A;  5AM5 A;  1RG6 A;  2XID A;  3BZC A;  4F4K A;  2EAP A;  1S97 A;  2F1I A;  2LYH A;  2WF6 A;  1ZXI A;  2F1H A;  1EXN A;  2ZIV A;  2VJ4 A;  4DS4 A;  5KFN A;  3TAP A;  2BGW A;  1KQQ A;  4NM2 A;  2LHT A;  4YD1 A;  4LZG A;  2AGO A;  4DL7 A;  3D2Q A;  1L5U A;  1WCL A;  3AL0 B;  1S9F A;  5ALV A;  4C4T A;  4EYH B;  8ICZ A;  2DGZ A;  1L3S A;  1NKC A;  7ICI A;  2F44 A;  4KLH A;  4KLJ A;  8ICJ A;  1SKW A; 
#chains in the Genus database with same CATH homology
 3RF9 A;  2K8B B;  2HBL A;  2PMZ F;  4KMO B;  5KL1 B;  2OH2 A;  2G07 A;  3SMV A;  2K4E A;  2ZIX A;  4FZL A;  5CRX A;  3C29 A;  2KIW A;  4FZN A;  3OPX A;  5A0L A;  2F2A B;  3H0M B;  2JH7 A;  5KL8 B;  2G5H B;  3D2N A;  2KHQ A;  2YX8 A;  3PSF A;  2WAQ C;  1PVP A;  1A0P A;  4NV0 A;  2ZXI A;  2XI9 A;  2KEY A;  2ZIU A;  2A3V A;  4QIW F;  4NLB A;  2ZIU B;  3L3F X;  3C28 A;  1PVR A;  2HBM A;  3CP8 A;  4CDG A;  1HEK A;  2WAQ F;  2LKY A;  2KOB A;  2JH1 A;  3IG8 A;  2WB1 C;  4FZM A;  1Q3V A;  3HKZ C;  3AQE A;  3HKZ F;  1DRG A;  4O3M A;  2KJ9 A;  2R18 A;  4OJ5 A;  4QJF B;  2Y0S F;  4ACO A;  4IC9 A;  2Z7J A;  3NUQ A;  2G5I B;  2JMG A;  2OYY A;  3H0L B;  3O0F A;  2N1R A;  2E1E A;  2MA1 A;  2JHD A;  2JGA A;  4P0P B;  3N7P D;  2K8A A;  3N7R C;  4JMU A;  2ZXH A;  2H3Q A;  2KVC A;  3PZP A;  1XO0 A;  2H3I A;  1Q3U A;  1UPH A;  4PL2 A;  1MA7 A;  4OO1 J;  3M7D A;  3SAH A;  3SAG A;  4BUG A;  2HBK A;  1Z1B A;  4FE3 A;  3KFU F;  2H3F A;  3ICX A;  3LYS A;  2M0N A;  1Z19 A;  2KNJ A;  3T79 A;  3GZF A;  3PST A;  3CRX A;  4OJP A;  2HOF A;  2LYB A;  1IIP A;  2XIC A;  2YB1 A;  2VJ5 A;  3KZX A;  2ZIV B;  2PMZ C;  4U6P A;  2CN1 A;  1D8B A;  2K4H A;  2LYA A;  3F2B A;  4KX3 A;  3F5E A;  2W03 A;  2KV2 A;  2F8L A;  3K1Z A;  2ZIX B;  3SAF A;  1KBU A;  1URJ A;  2K8C B;  4AYB F;  2LBO A;  4KX5 A;  4ICA A;  2E1F A;  4OJO A;  4P0P A;  4P0Q A;  2G06 A;  2RHF A;  3NRW A;  4QIW C;  1SZH A;  1ECW A;  2KKP A;  3PSI A;  4U7C A;  5HR6 A;  1YT3 A;  4CGZ A;  2GH1 A;  2W7P A;  4CRX A;  2K4I A;  2HBJ A;  1GO3 F;  2OXO A;  2KIC A;  2NV3 A;  2OM6 A;  2KKV A;  3MGV A;  1XNS A;  3VCB A;  2HOQ A;  3LVW A;  2HOI A;  1F44 A;  2XID A;  5HR7 A;  4NLC A;  2E5S A;  2YB4 A;  2CRX A;  2CPR A;  2KJ8 A;  2XVT A;  3IP4 B;  3M6Z A;  1ED1 A;  2WB1 F;  2DF4 B;  2KD1 A;  2W04 A;  2H3Z A;  3GU3 A;  2ZIV A;  3ONN A;  5T14 A;  2VIX A;  2VJ4 A;  2VKQ A;  3SQI A;  2GOL A;  2Q4T A;  3AQF A;  3LVV A;  3PSP A;  2W7O A;  2G0A A;  3H0R B;  2G08 A;  4WJ3 B;  2F76 X;  2KHV A;  1WUD A;  3D2S A;  1A6S A;  2H3V A;  2DQN B;  2LHT A;  2RP5 A;  3M6K A;  4OJL A;  2G09 A;  3F2D A;  1CRX A;  2Y0S C;  4NWI A;  1ZQ1 C;  2BDU A;  3ALR A;  3N7S C;  3D2Q A;  4QNL A;  3F5A A;  2KJ5 A;  4PL1 A;  3F2C A;  1OUQ A;  3AL0 B;  3F53 A;  2K89 A;  3DEE A;  1HIW A;  1NZB A;  2RRD A;  3VC8 A;  4BX9 C;  3CYM A;  4A8E A;  2F77 X;  3E0F A;  5C0Y A;  3IN5 A;  4P0Q B;  2DGZ A;  2D6F C;  4AYB C;  2ZG6 A;  1TAM A;  2ZIW B;  3RFA A;  4OJ6 A;  2ZIW A;  1P7D A;  2HMX A;  3IG5 A;  4C0Z A;  1T94 A;  4GFJ A;  4BJQ A;  1L6N A;  2MRL A;  1PVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...