2F77X

Solution structure of the r55f mutant of m-pmv matrix protein (p10)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKFWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core protein p10
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
total genus 28
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f77X00
2F77X 2F76X
chains in the Genus database with same CATH superfamily
3SV4A 1L7PA 3H0RB 4KN4A 2W9AA 2BDUA 1UA1A 1NKCA 4US9A 2OH2A 2W3SA 1SV0A 5EE3A 4M9GA 8ICZA 1A0PA 3UM9A 3PX0A 2XICA 5HHIA 5BOMA 5KG1A 1KW4A 4UB2A 1LKYA 8ICBA 2NO4A 5CJ7A 8ICPA 2LYBA 2EAPA 2Z7JA 3MGIA 4G3IA 4KLUA 3QEAZ 9ICQA 3ETLA 1ZD4A 5L9XA 2JXJA 4ECWA 8ICSA 4DL7A 1YT3A 3BQ7A 8ICKA 2FDRA 2KOBA 1UQVA 2XCPA 5D49A 2YX8A 4IL6U 3SQIA 1ZQPA 3ZDEA 1BPXA 3N4MB 3ALRA 1U49A 5DQIA 3WKBA 5ALZA 5EOZA 7ICPA 3SI8A 2G5HB 1X6JA 2IOFK 3C29A 3V7JA 4IQTA 3NVVA 3H4DA 3RR7A 1WWVA 1ZJNA 4Q8EA 2BR0A 4Y2YA 1N61A 4F72A 3SZ2A 2IOHA 2KVCA 3PW4A 1C7YA 4DFMA 1LV5A 4PZOA 4O3MA 2R18A 3BQ2A 4RNMA 2G09A 4EELA 1COOA 2ODGA 3LWLA 5DDYA 3RRGA 4UB5A 3JPNA 3NRZA 2GOLA 9ICFA 1A6SA 4C8OA 1L8LA 3PNCA 4EENA 5KG6A 4NV0A 2DKZA 2R8HA 3TKAA 4B9LA 2HHQA 4J9LA 2KTQA 4KLHA 1Z4OA 3DEEA 5HR6A 3WKAA 2PI4A 1SL1A 2Y0SC 5KFBA 4FZNA 9ICUA 3UMBA 1Q8KA 2BCSA 3GQCA 2KD1A 2ALZA 5AI4A 4DLEA 5AK4A 1OXJA 4J9QA 1V85A 3BJYA 1O08A 5DLGA 2O6KA 4F5NA 4Y2UA 3B0XA 4ELTA 2KE7A 1DK2A 5EWEA 2BCUA 4Z6DA 4B6JA 4C4SA 4MF8A 2MSNA 2HHTA 4EYIB 1OUQA 7ICGA 5BOLA 4JWMA 2KIVA 4I2BA 3KTQA 1HJPA 3Q8RB 4GXJA 3KHRA 1QQ5A 2WAQF 5KFWA 4K4HA 1NK7A 5KFFA 8ICTA 4DSKA 4Y2VA 1J2MA 4O3NA 5KFDA 4CF5A 3KOOA 1PVPA 2FPLA 2KZMA 3KHGA 5ALOA 1CUKA 2ASDA 4IQWA 1ECWA 2KP7A 3QU9A 2MA1A 1NK4A 2G08A 2W03A 7ICVA 4NM2A 4B9MA 1TAMA 3M8RA 5L1LA 5CHGA 3H40A 2WF7A 3SYZA 4RU9A 4F4WA 8ICUA 2ZIWA 1WCLA 1LVHA 2RQ5A 1ZRMA 1YZ6A 4NLGA 1ZQSA 1JALA 4QW9A 2C2EA 1XO0A 2F76X 5CEHA 1X9WA 4R64A 3OSNA 4Z6FA 2W55A 1ZQZA 4RQ1A 3G6VA 2ZIVA 3HJEA 4ED8A 4OD0A 3PX4A 2ZJ8A 3ZDAA 4TQRA 2KICA 3EPGA 9ICIA 1DXSA 4RQ0A 1OW5A 3RJKA 1NK5A 3KZXA 2E1EA 3H8MA 2YMPA 3MR6A 2BPCA 4WJ3B 3AU2A 4QZDA 7ICSA 3J81j 8ICRA 2AGOA 2BDPA 3WKEA 4RPYA 3GV8B 4YFKA 1N60A 4M9LA 1T4GA 3BS5A 1ZQQA 5ALXA 1N63A 3O0FA 1ZQAA 2Y9TA 4NLNA 4RZRA 5AKIA 2EANA 1XC9A 4PGXA 5J0WA 4IR9A 1SZPA 3DV9A 3D2SA 2W3RA 1TK8A 4QZCA 2YN4A 4R63A 1RG6A 1BVSA 3LVWA 1Z3EB 4I2GA 4P0QB 4FZMA 4DCCA 4OJPA 2DL0A 5J2FA 4BJQA 1ZQGA 2AQ0A 1S0VA 2IMWP 2HHXA 2GLEA 3A0BU 1CRXA 3C28A 2IHNA 3FC4A 4EBDA 5KFMA 5KAFU 2WAQC 4O0IA 2OWOA 5CRXA 4Q45A 2BQ3A 3AMZA 2QARB 2XY7A 4CDGA 2IA6A 5KT6A 3V6KA 4IRKA 3V7KA 2ASLA 3WKDA 4YQWA 3ZDCA 5DGBA 3MGVA 5J2IA 4KLQA 4RPXA 3C5GA 4R8UA 1VJ5A 2DWQA 4M0AA 4ECYA 4O3QA 2K8BB 4XQ8A 3OSPA 2G0AA 3SAFA 2A1JB 3SR6A 2H3ZA 3OTQA 3QNMA 1NK8A 2BPGA 2UVVA 3QEBZ 5HP4A 8ICYA 4J9NA 4RQNA 5AKXA 5D46A 1YZ7A 2VJ5A 7ICHA 4YCXA 5KT5A 1L7MA 2NO5A 2KSOB 1ZQBA 5G5HA 4F5QA 4YN4A 1NKEA 4F2RA 3C1YA 1ZQVA 4F92B 2E8NA 4P4OA 1S10A 3EPIA 1HUOA 2KK0A 2KFNA 3IG5A 4RQ7A 3EUB2 5GTHU 3TACB 5EE0A 2W7PA 2F77X 5ALVA 3BS7A 2KFZA 2P6UA 2HCFA 2LBOA 1MA7A 2ZXIA 1CEZA 3DDHA 1C20A 3Q8KA 3AUOA 5AKZA 5HMLA 5EWFA 1IG6A 4UB3A 7ICRA 5IILA 5KG0A 2W7OA 9ICLA 2ZJ5A 2R8KA 4UAUA 3EYZA 4ED1A 8ICWA 3AQFA 1JROA 2D6FC 3QYPA 1UT5A 4UATA 9ICBA 2NRWA 1L8OA 4UB4A 3WK7A 5AKGA 1QSYA 4NLCA 1ZQUA 1S77D 1FFUA 4ECVA 3C1ZA 9ICEA 4NLZA 5AI9A 3KZIU 1N5XA 5KFRA 2CN1A 8ICXA 2KN7A 5KL8B 3FYHA 4QW8A 1RZTA 4GC6A 2K4HA 1S0OA 2XVTA 4M9HA 4KN7A 2PFQA 4Q8FA 4J9OA 1T3QA 5KFKA 4RQ2A 2BCVA 3ZDDA 3EWAA 4DWIA 3F5AA 2BCRA 1ZETA 1D8LA 3QE9Y 2K4IA 5DGAA 7ICJA 3OPXA 9ICHA 2BQUA 1S8OA 5KT3A 1SZHA 1Z1BA 4NJ8A 1PUZA 4P4PA 9ICPA 2J6SA 1N2XA 2XIDA 2GO7A 5KFTA 4FE3A 4YR3A 4P0PB 3JPRA 1AQ6A 2IHMA 3HP6A 2AGPA 4BWMA 3PO4A 4R66A 2HHVA 4KX5A 3NGDA 2ESEA 3D6JA 5AKJA 4J9RA 5AM4A 2NRXA 1Z00B 5KG2A 1ZQYA 4RUCA 1ZD3A 3G6YA 3FDSA 2K89A 3UXOA 3RAXA 4MEXA 1SXEA 3SV3A 4B9VA 4Y2TA 3OJUA 4UASA 3K4GA 3IN5A 5J0SA 4C4RA 3C5FA 1RYSA 4UAZA 3UQ2A 3PW2A 4UAVA 1AROP 3ISBA 1T3NA 3QZ8A 1ZQIA 3RH5A 2FJ6A 4GXIA 4TURA 3GU3A 1ZQHA 2CPRA 8ICCA 3GIJA 4PHAA 4NL9C 2F2AB 1S76D 4NY8A 1QCKA 3FM9A 3KKAC 5B66U 1RXVA 3G6XA 1MQ2A 1SWWA 1RYRA 2HHSA 3PR4A 3HKZF 1KSPA 4KLDA 1ZD2P 5ALKA 2QB0B 3MFIA 2D8CA 3ETRA 3T5JA 2PMZF 2G07A 3F2DA 8ICJA 2AQ4A 1SKRA 3TFRA 3SEIA 1TE2A 2AGQA 1WG8A 5CWRA 3F2CA 3UMCA 2EDUA 2OCEA 4QWAA 4GC7A 4QZ8A 7ICUA 5ALJA 4KITB 4LZGA 5HMMA 1B0XA 4C8MA 2XI9A 4ELUA 1Y88A 3OGUA 2A3VA 4K4GA 3KHHA 2ISOA 2P66A 1KKXA 1U48A 2VJ4A 3RFAA 4G9BA 3C21A 2DPIA 1IM4A 3V6JA 2L5YA 2F8LA 4DL5A 2YTUA 2BCQA 5DB7A 2HOFA 1MC8A 4F3OA 2AXTU 2F1JA 1JXLA 5DB9A 4F5PA 2Y1JA 4KLSA 1UCVA 3V7LA 3Q8QB 1JIHA 4MEYA 5KFNA 4B9NA 1NOMA 4NXZA 3BZCA 3QUQA 1L3UA 1D9DA 3I76A 2LM1A 2V4QA 3H4BA 9ICSA 3N7RC 1SKWA 1KN5A 4UAWA 4P0QA 2KJ5A 1QSSA 8ICHA 2DUYA 5AI8A 1BNOA 4PPXA 1RPLA 2CXYA 1PVQA 1JMSA 2QLTA 4UARA 5KFVA 4EEKA 1B43A 4LZDA 1NI3A 4TUPA 5AI6A 1ZJMA 1ZQXA 3GZFA 1XSPA 2WF9A 3CW2C 4EBCA 4KMOB 2QARA 2YMMA 3MGHA 4ACOA 5KT7A 2PFNA 3IG8A 4ELVA 2HHWA 3C23A 1QH9A 2JEJA 8ICEA 4F4XA 1X9XA 4DOAA 3ZI4A 2ZUDA 4C80A 1X42A 3GIKA 1SV4A 3TAQA 3NASA 4YMNA 5KFGA 2W11A 3HRDD 2XC9A 3HKZC 3LWMA 1GO3F 3L3FX 3TI0A 2HOIA 2ES6A 1S97A 1SGGA 2A1JA 4KTQA 5L1IA 1KQQA 1SXDA 3H8JA 2PMZC 4R65A 4ECUA 1N62A 2NV3A 3AN1A 4DQPA 4DFDA 3GFKB 4RQ3A 4HYKA 4U7CA 3CRXA 5ALMA 2DFLA 2KIWA 3ONNA 4KX3A 3PVXA 2KJ8A 1HUZA 3TFSA 1ZQKA 2C22A 4HAIA 3H0LB 1K1QA 1IXRA 4O3RA 5AM2A 2KSOA 2EZYA 3E0FA 1NJWA 5AHXA 3TANA 3WU2U 4DSFA 4C8KA 4PHPA 4MFFA 3WKCA 5J2EA 4M47A 3BQ1A 2JHDA 1JUDA 1JXEA 5J2AA 3HX0A 5JRTA 2WTFA 1TK0A 4KLGA 1MSWD 3JPSA 3T79A 4RT2A 4I28A 2LYAA 5AKLA 5J8YC 2G06A 1L6NA 2PXIA 2OHFA 3M9MB 1NKBA 1U9LA 4QZEA 5L1MA 5DB6A 1L7OA 4YR2A 5HR7A 4QZBA 7ICIA 5KFXA 4DQQA 2MUTA 2PI5A 2KKVA 4J9PA 4BGDA 2OEHA 5J0RA 2JH7A 5AKYA 3QU5A 4O3PA 1N56A 5DBCA 1KFTA 1PK1B 3IRUA 5KFLA 3RJFA 4KLMA 2Q0ZX 5E79U 3PW0A 3E58A 1CI4A 3ORYA 4MFAA 1WYGA 4RQ4A 1XSLA 5CB1A 3TADC 1ZQDA 2KZ3A 3RAQA 2BPFA 2IBKA 2F1HA 2KMDA 5EE9A 4Y2QA 5KG5A 4CF4A 3M6ZA 1LKYB 4E0DA 3LDAA 1QTMA 2IOFA 3RB0A 4KLEA 1MQ3A 3RTVA 5IINA 1X9MA 5J0YA 4ED6A 4Y2XA 2F1IA 2VA2A 4ICAA 1BNPA 1QLNA 2W9CB 4O5EA 4YVZA 2E8PA 3HWTA 3RJEA 8ICAA 4EZ9A 3M1YA 1J97A 3CYMA 5ALUA 3QZ7A 5J0QA 1TFRA 2W04A 1D9FA 4YMMA 4LVSA 5KG7A 2PKEA 5J2BA 3AU6A 3BZKA 5CR0A 2MU2A 4PGQA 4Y2SA 7ICFA 2KG5A 3RJGA 3F53A 4OJLA 4JWNA 3ZD8A 3JPQA 1QSLA 4P0PA 4PHDA 2FLLA 2ZIUB 3HT3A 4USAA 2DQNB 1BPEA 4JUZA 4UBBA 4F8RA 3D2QA 5F3XB 4RT3A 5C5JA 4DL4A 4YP3A 4KLTA 4QZFA 1Z00A 2MRLA 1DOQA 1IIPA 1IV8A 1NJXA 4MF2A 2RRDA 3TQ1A 3MR5A 2WF6A 4C7ZA 4DL6A 4QZ9A 5IIOA 2E8MA 1HEKA 4Q43A 3AM9A 8ICOA 2Y1IA 3IV6A 2XGPA 2J6TA 4UAYA 2ISPA 3ISCA 4DLGA 4NLKA 5KAIU 3TARA 5TISU 2JEGA 1U45A 5J0PA 3GDXA 3M7DA 4EX6A 4IRCA 3V72A 4PH5A 1SL0A 5A0LA 3UXNA 4DFKA 2FPKA 2QB0A 3F5EA 4CE6A 2HVIA 5KFZA 1RYUA 4OJ6A 1Z19A 3IM1A 3U26A 5JU5A 4QNLA 3GIIA 4BXOB 3MC1A 2JZBB 3PV8A 4QWDA 4KMUA 4EEYA 4GFJA 3JPTA 5J0TA 1PZNA 1TAQA 2PFOA 2WHEA 4UQGA 3K1RB 1H38A 5J8YA 2E1FA 5ALDA 3UQ0A 3TAPA 2NRTA 3RF9A 2LPEA 2HSZA 2B6GA 1KTQA 4AYBF 4O9MA 5J2CA 2YMLA 2W9MA 4F4KA 2NYVA 4EBEA 2FMPA 4BWJA 3OHAA 4J9SA 2ZTDA 5ALEA 4Y2PA 4XA5A 9ICKA 4DSEA 2QKQA 5KT4A 4JV1A 3T5LA 1HIWA 1ZQOA 4DFJA 2W43A 5AICA 2M9NA 3MBYA 8ICQA 4BUGA 2QB1A 3T5KA 3TADA 2J6UA 5GTIU 4QZIA 2D3DA 2V4RA 1XO1A 2R8JA 4I2DA 4GLXA 4IC9A 4ECZA 3MR3A 2XY5A 2VA3A 2B0CA 4RQ6A 2BGWA 5J0XA 1DRGA 2G5IB 1SIJA 2H3VA 5AM0A 4CGZA 4UW9A 4QWCA 4DQRA 3N7PD 9ICMA 1QQ6A 1S5LU 1ZQ1C 4YMOA 3RB6A 1U4BA 4F2SA 3NVWA 3UPQA 4F50A 4KLLA 1L5UA 4OJOA 1JRPA 2LI6A 3WK5A 1JN3A 2W9BB 2FI1A 3MDCA 2JV3A 7ICQA 5KFHA 4O3OA 4DS5A 4DL2A 1K5OA 4IRDA 2FLPA 1ZYQA 4UB1A 2R8GA 1B4FA 1ZQLA 1X6IA 1ZOLA 2I5HA 4C7YA 3S6JA 5ALTA 3BS5B 5T14A 1S0NA 2A19A 2KKPA 4C8LA 3LYSA 4RQ5A 4P2HA 2FMSA 2XCAA 3PSFA 1KFDA 3PY8A 1UA0A 2AJQA 5ALWA 3AL0B 4C8NA 2E3TA 5AKHA 5ALYA 4KLIA 5DQGA 2HOQA 1N5WA 1TAUA 4IR1A 3RB3A 1S9FA 1TVAA 7ICKA 4I2JA 2HMXA 3K1ZA 4EYHB 2AH5A 1NNLA 3WK6A 1XS9D 3QX7A 2HBLA 1F0MA 4DF4A 4I2EA 1EXNA 3C2LA 5J2DA 4JV0A 2JRZA 3NTUA 1ZQMA 3Q8MA 7ICNA 4AYBC 2JMGA 2ATLA 1F5SA 2H3IA 5AI5A 2KJ9A 2BQRA 4PJ0U 2YY6A 5AM3A 2RLTA 2RP5A 4DQSA 4PHEA 1NZPA 3PR5B 5ALSA 3MFHA 3KBBA 4F93B 2ZIXB 1B22A 4YG2A 4FO6A 2BHNA 2N1RA 3HW8A 2M0NA 3B0YA 2EH9A 1ZQNA 3KHLA 4R8UB 3Q8LA 1PK1A 3SAHA 4DO9A 1X9SA 8ICVA 1Q3VA 5AKEA 3WK8A 5DG7A 5J2KA 8ICMA 4IQVA 4F4YA 2HBMA 2HBJA 5HHHA 2EZXA 2Y9UA 1TV9A 2HVHA 3M9NB 3RJJA 4I27A 3ISDA 2ZUCA 2A1AA 2E5SA 1L3VA 2I9GA 1D8YA 3LVVA 3Q8SB 4QIWF 4DS4A 2YQEA 2K4PA 5B5EU 1Z4NA 4RQMA 4RUAA 2K8CB 4ZH4A 4RPZA 2W9CA 4DSLA 2JGAA 4UB6U 8ICFA 2LM4A 1WWUA 3GV5B 2VANA 5KFAA 3THVA 4RNNA 4I2FA 5KFIA 3M6KA 5AM1A 4MHVA 2KEYA 3R9KA 2K60A 1ZQCA 3QUBA 1KRPA 2EAOA 4M2YA 3QU4A 4OJ5A 4Z6CA 1PVRA 1S0MA 2ZG6A 3OJSA 4GXKA 1DK3A 3QUCA 1VDVA 7ICEA 2ZIUA 2VKQA 2DF4B 4QZGA 1FFVA 3D2NA 4M9JA 4KLOA 4KLFA 3L5KA 5CP2A 3LK9A 5DBBA 3H0MB 2ZUBA 4ECQA 5AIBA 1Q3UA 5L1KA 2HW3A 3BQTA 1WCNA 5J0UA 4DQIA 5ALQA 3NVYA 5KFPA 3PSTA 1BPYA 2F44A 4CNQA 3GV7B 2OYYA 3K75D 2FMQA 1UT8A 8ICIA 4FS2A 4NM1A 1A77A 3H7IA 4ZOHC 4O5CA 9ICAA 2W54A 3NUQA 2UVWA 1URJA 5KTQA 3UXPA 4A8EA 2FE9A 2R8IA 4JK1A 3PMNA 3L4PA 3SMVA 5DDMA 1RQLA 2UVUA 4JV2A 4DL3A 1T8EA 1FEZA 2NRZA 5EWGA 4YR0A 4PL2A 1X66A 4ECSA 4CCHA 1ZRNA 4M6WB 2EAMA 5ALHA 4C0ZA 1RDFA 2HI0A 4NLBA 2W8LA 3ZDBA 2YB1A 3V6HA 1KBUA 1COKA 2LYHA 1SB3C 5BPCA 5J29A 4BXOA 3JPOA 2JZBA 2FPMA 2F8KA 3SENA 4F91B 3N28A 2ZTEA 3HILA 1BGXT 2V9WA 3SD7A 1ZQEA 4QIWC 3PX6A 4LJXA 2F3NA 3AQEA 5DG8A 2WFAA 2H5XA 2BZFA 4IS7A 5AKKA 5ALGA 4NL9A 2K8AA 4GIBA 5K4LA 3IP4B 1SKSA 3KKAA 2WB1F 1DGJA 2AU0A 4CF3A 4JB3A 1V9PA 4YD1A 4YXMA 4F4ZA 1FIQA 2JR5A 3T3FA 5DKWA 4O5KA 3AEVA 3HPOA 1UHUA 3M8SA 1BPDA 9ICWA 5ALIA 4XUSA 9ICJA 5H2FU 1F44A 8ICNA 1Z1VA 3NRWA 1NJYA 1K1SA 5ALFA 3T5HA 4K4IA 2BKEA 4PL1A 9ICNA 5AIAA 4FBUA 2RDIA 3NS1A 3RBEA 4DFPA 3ICXA 4MFCA 3OHBA 1RM6C 4ECXA 5HNKA 3WK9A 2ZXHA 5KFQA 3CP8A 3PMLA 3WK4A 3FAHA 2GWSA 2XO7A 4FS1A 4F5RA 2LKYA 2HDOA 3PW5A 1PK3A 4ECRA 4ED0A 4IQUA 5IIJA 4I29A 1T7PA 5F9LA 1NZBA 2W9BA 9ICXA 1DGSA 5TZVA 2K4EA 4B9UA 5J2HA 1NK0A 2I6XA 1ZQWA 4DEZA 3KFUF 1XNSA 3QXGA 4US8A 2E8OA 9ICVA 2W8KA 3UMGA 9ICTA 4J03A 4DF8A 4FBTA 3H8SA 2DKXA 4Q44A 2H3FA 3Q8PB 2HHUA 8ICGA 2OXOA 5AK5A 4QZHA 7ICLA 2CRXA 1KLNA 4PZNA 3VC8A 5KFYA 3QUTA 9ICGA 1NK6A 4X5VA 3RJIA 1UPHA 1X40A 5AI0A 5ALPA 1L3SA 1V97A 5KFCA 3MDAA 5KFUA 3QU2A 1L7NA 5IIKA 3PSIA 5ALRA 5DG9A 3H8WA 1RQNA 2WB1C 3QU7A 4B9TA 1WUDA 3A0HU 1M6YA 4U6PA 2ZJAA 2KVSA 4ED3A 2UVRA 4C4TA 5FP0A 2ZIXA 5KFSA 4EZ6A 4TUQA 3C2MA 1KDHA 3N7SC 4KLJA 1JX4A 4QZAA 4J9KA 2B21A 5KNIA 3IHQB 5DQHA 4RQ8A 3VCBA 4F71A 4AP9A 4UB8U 1VLBA 3PO5A 2OM6A 1J2NA 7ICTA 2WF8A 1SV0C 4QWEA 2KV2A 4M9NA 7ICMA 3MR2A 2YMQA 2XGQA 5KG4A 2JEIA 3BQ0A 4XRHA 1P7DA 2P35A 1SL2A 1XU4A 4DOBA 4BDPA 9ICCA 2YB4A 4ED7A 1JI7A 5G5GA 5JTIA 5CA7A 2DBYA 4NWIA 2C28A 1V38A 3RR8A 3ZD9A 4I2CA 4I2HA 4B9SA 1ZXIA 3KD3A 2DGZA 4OO1J 5ALLA 3M9OB 2C2DA 1RXWA 2GH1A 2Q4TA 4I2IA 2RDJA 2FLNA 3F2BA 2LHTA 4PGYA 4ECTA 2ZIWB 4Y2RA 2MUTB 4OCZA 3RRHA 2P6RA 1N48A 3IDWA 5DBAA 2H3QA 2ASJA 2RHFA 4YD2A 3C2KA 1BPZA 4QJFB 4UBCA 3N97B 1O03A 2ZIVB 2WF5A 1ZQRA 2JH1A 1L3TA 4O3SA 1BPBA 9ICOA 1U47A 1D8BA 5L1JA 3GIMA 5DLFA 5JUMA 2NRVA 7ICOA 2VA8A 4FZLA 1NJZA 1T94A 2JEFA 4Z6EA 3E2EA 5KFOA 4I2AA 3MABA 4CRXA 2DPJA 3RBDA 1ZD5A 4DSJA 3I1YA 3NVZA 3GILA 5KT2A 8ICLA 3RH6A 2MAXA 4TUSA 1A76A 3CNHA 1TKDA 4TQSA 1KEJA 5KFJA 5EE1A 3B9JA 4FFDA 5AK6A 4P4MA 2XY6A 5ALNA 4ED2A 1XSNA 1X2IA 2LMRA 4M6WA 4YXJA 3RB4A 2ZTCA 2VIXA 1ED1A 4EX7A 3ED5A 4DSIA 3I28A 5KL1B 4J9MA 1ZQJA 3EZ5A 5C0YA 1TK5A 2KNJA 5J2JA 1ZQTA 2KHVA 3PZPA 2PFPA 3PSPA 3JPPA 5KG3A 5J0OA 1KFSA 5IIIA 5D4BA 1NK9A 4QWBA 5F9NA 4RNOA 1Q46A 5DB8A 1LB2B 3EW9A 1SWVA 2C2RA 4Y2JA 3BDPA 5AM5A 4DOCA 2EQYA 5J2GA 2KHQA 2I1QA 5IIMA 5AK3A 4BX9C 3RH4A 1ZQFA 4M04A 1KL9A 4JMUA 1QQ7A 3RJHA 4F5OA 2KZZA 3SAGA 3PW7A 9ICRA 1FO4A 5KFEA 2HBKA 2AHOB 1MN8A 1XWLA 2EZZA 2Y0SF
chains in the Genus database with same CATH topology
1D8BA 2KKPA 1CRXA 3F53A 4OJLA 3LYSA 3H0RB 2JHDA 2ZIWA 2BDUA 2W7OA 2WAQC 2E1FA 3VCBA 4C0ZA 2OH2A 3PSFA 2K8CB 4NLBA 5CRXA 4FZLA 2YB1A 3AQFA 3RF9A 3IN5A 1NZBA 2GOLA 1T94A 4P0PA 1A6SA 1KBUA 2D6FC 3T79A 1A0PA 2JGAA 3AL0B 2ZIUB 4CDGA 2XICA 4CRXA 2K4EA 4AYBF 2DQNB 1XO0A 2F76X 2LYAA 4NV0A 2G06A 2OM6A 3N7RC 1L6NA 2HOQA 3D2QA 4NLCA 3GU3A 2KV2A 4P0QA 2KJ5A 3KFUF 3M6KA 2CPRA 2HMXA 3K1ZA 3DEEA 2LYBA 2ZIVA 3MGVA 1XNSA 5T14A 2KEYA 5HR6A 2Z7JA 2F2AB 1P7DA 5HR7A 2Y0SC 4QIWC 1HIWA 2MRLA 4FZNA 2KICA 2HBLA 2KKVA 4OJ5A 2K8BB 1IIPA 4PL2A 1PVQA 2CN1A 3AQEA 2JH7A 2KD1A 3HKZF 1PVRA 4BUGA 2G0AA 2H3FA 3KZXA 3SAFA 2RRDA 1YT3A 2E1EA 2ZG6A 2H3ZA 2YB4A 3N7SC 3GZFA 5KL8B 1HEKA 2KOBA 4WJ3B 2PMZF 2G07A 2K8AA 2OXOA 2K4HA 1ED1A 2VIXA 2XVTA 3IP4B 4KMOB 3F2DA 4NWIA 2ZIUA 2WB1F 4AYBC 2JMGA 2YX8A 4ACOA 2H3IA 2VKQA 2DF4B 3IG8A 4IC9A 3SQIA 3D2NA 2KJ9A 2CRXA 3F5AA 5KL1B 3VC8A 2DGZA 4OO1J 5C0YA 2VJ5A 3ALRA 3F2CA 2KNJA 2K4IA 2RP5A 3H0MB 3C28A 3M6ZA 2KHVA 3PZPA 3OPXA 1DRGA 1OUQA 2G5IB 2GH1A 2Q4TA 2ZIXB 2H3VA 1UPHA 3PSPA 3O0FA 3M7DA 3F2BA 2LHTA 4CGZA 1SZHA 3N7PD 1Z1BA 1Q3UA 2N1RA 1ZQ1C 2M0NA 3HKZC 1GO3F 3L3FX 2HOIA 2G5HB 2XI9A 3PSTA 2ZIWB 5A0LA 3C29A 2XIDA 1F44A 4OJOA 3PSIA 2OYYA 3NRWA 2WAQF 3F5EA 4ICAA 3SAHA 2PMZC 3D2SA 4FE3A 2A3VA 4P0PB 2NV3A 4PL1A 1Q3VA 2WB1C 4OJ6A 1Z19A 2H3QA 1WUDA 2RHFA 3NUQA 1URJA 3CYMA 3IG5A 2VJ4A 2KVCA 4QNLA 4A8EA 4U7CA 4U6PA 2KHQA 3CRXA 1PVPA 3RFAA 4QJFB 2W04A 3ICXA 2HBMA 3LVWA 2HBJA 4BX9C 3ONNA 2KIWA 4O3MA 4KX3A 4KX5A 2KJ8A 3SMVA 4P0QB 1ECWA 2R18A 4FZMA 2W7PA 2F77X 4JMUA 2MA1A 4OJPA 2F8LA 3H0LB 2ZIVB 2ZXHA 2G08A 3CP8A 1MA7A 2LBOA 4BJQA 2W03A 3SAGA 2HOFA 2JH1A 2ZXIA 4GFJA 2HBKA 1TAMA 2ZIXA 2E5SA 2G09A 3E0FA 2LKYA 3LVVA 2K89A 2Y0SF 4QIWF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F77 X;  2F76 X; 
#chains in the Genus database with same CATH topology
 3SV4 A;  1L7P A;  3H0R B;  4KN4 A;  2W9A A;  2BDU A;  1UA1 A;  1NKC A;  4US9 A;  2OH2 A;  2W3S A;  1SV0 A;  5EE3 A;  4M9G A;  8ICZ A;  1A0P A;  3UM9 A;  3PX0 A;  2XIC A;  5HHI A;  5BOM A;  5KG1 A;  1KW4 A;  4UB2 A;  1LKY A;  8ICB A;  2NO4 A;  5CJ7 A;  8ICP A;  2LYB A;  2EAP A;  2Z7J A;  3MGI A;  4G3I A;  4KLU A;  3QEA Z;  9ICQ A;  3ETL A;  1ZD4 A;  5L9X A;  2JXJ A;  4ECW A;  8ICS A;  4DL7 A;  1YT3 A;  3BQ7 A;  8ICK A;  2FDR A;  2KOB A;  1UQV A;  2XCP A;  5D49 A;  2YX8 A;  4IL6 U;  3SQI A;  1ZQP A;  3ZDE A;  1BPX A;  3N4M B;  3ALR A;  1U49 A;  5DQI A;  3WKB A;  5ALZ A;  5EOZ A;  7ICP A;  3SI8 A;  2G5H B;  1X6J A;  2IOF K;  3C29 A;  3V7J A;  4IQT A;  3NVV A;  3H4D A;  3RR7 A;  1WWV A;  1ZJN A;  4Q8E A;  2BR0 A;  4Y2Y A;  1N61 A;  4F72 A;  3SZ2 A;  2IOH A;  2KVC A;  3PW4 A;  1C7Y A;  4DFM A;  1LV5 A;  4PZO A;  4O3M A;  2R18 A;  3BQ2 A;  4RNM A;  2G09 A;  4EEL A;  1COO A;  2ODG A;  3LWL A;  5DDY A;  3RRG A;  4UB5 A;  3JPN A;  3NRZ A;  2GOL A;  9ICF A;  1A6S A;  4C8O A;  1L8L A;  3PNC A;  4EEN A;  5KG6 A;  4NV0 A;  2DKZ A;  2R8H A;  3TKA A;  4B9L A;  2HHQ A;  4J9L A;  2KTQ A;  4KLH A;  1Z4O A;  3DEE A;  5HR6 A;  3WKA A;  2PI4 A;  1SL1 A;  2Y0S C;  5KFB A;  4FZN A;  9ICU A;  3UMB A;  1Q8K A;  2BCS A;  3GQC A;  2KD1 A;  2ALZ A;  5AI4 A;  4DLE A;  5AK4 A;  1OXJ A;  4J9Q A;  1V85 A;  3BJY A;  1O08 A;  5DLG A;  2O6K A;  4F5N A;  4Y2U A;  3B0X A;  4ELT A;  2KE7 A;  1DK2 A;  5EWE A;  2BCU A;  4Z6D A;  4B6J A;  4C4S A;  4MF8 A;  2MSN A;  2HHT A;  4EYI B;  1OUQ A;  7ICG A;  5BOL A;  4JWM A;  2KIV A;  4I2B A;  3KTQ A;  1HJP A;  3Q8R B;  4GXJ A;  3KHR A;  1QQ5 A;  2WAQ F;  5KFW A;  4K4H A;  1NK7 A;  5KFF A;  8ICT A;  4DSK A;  4Y2V A;  1J2M A;  4O3N A;  5KFD A;  4CF5 A;  3KOO A;  1PVP A;  2FPL A;  2KZM A;  3KHG A;  5ALO A;  1CUK A;  2ASD A;  4IQW A;  1ECW A;  2KP7 A;  3QU9 A;  2MA1 A;  1NK4 A;  2G08 A;  2W03 A;  7ICV A;  4NM2 A;  4B9M A;  1TAM A;  3M8R A;  5L1L A;  5CHG A;  3H40 A;  2WF7 A;  3SYZ A;  4RU9 A;  4F4W A;  8ICU A;  2ZIW A;  1WCL A;  1LVH A;  2RQ5 A;  1ZRM A;  1YZ6 A;  4NLG A;  1ZQS A;  1JAL A;  4QW9 A;  2C2E A;  1XO0 A;  2F76 X;  5CEH A;  1X9W A;  4R64 A;  3OSN A;  4Z6F A;  2W55 A;  1ZQZ A;  4RQ1 A;  3G6V A;  2ZIV A;  3HJE A;  4ED8 A;  4OD0 A;  3PX4 A;  2ZJ8 A;  3ZDA A;  4TQR A;  2KIC A;  3EPG A;  9ICI A;  1DXS A;  4RQ0 A;  1OW5 A;  3RJK A;  1NK5 A;  3KZX A;  2E1E A;  3H8M A;  2YMP A;  3MR6 A;  2BPC A;  4WJ3 B;  3AU2 A;  4QZD A;  7ICS A;  3J81 j;  8ICR A;  2AGO A;  2BDP A;  3WKE A;  4RPY A;  3GV8 B;  4YFK A;  1N60 A;  4M9L A;  1T4G A;  3BS5 A;  1ZQQ A;  5ALX A;  1N63 A;  3O0F A;  1ZQA A;  2Y9T A;  4NLN A;  4RZR A;  5AKI A;  2EAN A;  1XC9 A;  4PGX A;  5J0W A;  4IR9 A;  1SZP A;  3DV9 A;  3D2S A;  2W3R A;  1TK8 A;  4QZC A;  2YN4 A;  4R63 A;  1RG6 A;  1BVS A;  3LVW A;  1Z3E B;  4I2G A;  4P0Q B;  4FZM A;  4DCC A;  4OJP A;  2DL0 A;  5J2F A;  4BJQ A;  1ZQG A;  2AQ0 A;  1S0V A;  2IMW P;  2HHX A;  2GLE A;  3A0B U;  1CRX A;  3C28 A;  2IHN A;  3FC4 A;  4EBD A;  5KFM A;  5KAF U;  2WAQ C;  4O0I A;  2OWO A;  5CRX A;  4Q45 A;  2BQ3 A;  3AMZ A;  2QAR B;  2XY7 A;  4CDG A;  2IA6 A;  5KT6 A;  3V6K A;  4IRK A;  3V7K A;  2ASL A;  3WKD A;  4YQW A;  3ZDC A;  5DGB A;  3MGV A;  5J2I A;  4KLQ A;  4RPX A;  3C5G A;  4R8U A;  1VJ5 A;  2DWQ A;  4M0A A;  4ECY A;  4O3Q A;  2K8B B;  4XQ8 A;  3OSP A;  2G0A A;  3SAF A;  2A1J B;  3SR6 A;  2H3Z A;  3OTQ A;  3QNM A;  1NK8 A;  2BPG A;  2UVV A;  3QEB Z;  5HP4 A;  8ICY A;  4J9N A;  4RQN A;  5AKX A;  5D46 A;  1YZ7 A;  2VJ5 A;  7ICH A;  4YCX A;  5KT5 A;  1L7M A;  2NO5 A;  2KSO B;  1ZQB A;  5G5H A;  4F5Q A;  4YN4 A;  1NKE A;  4F2R A;  3C1Y A;  1ZQV A;  4F92 B;  2E8N A;  4P4O A;  1S10 A;  3EPI A;  1HUO A;  2KK0 A;  2KFN A;  3IG5 A;  4RQ7 A;  3EUB 2;  5GTH U;  3TAC B;  5EE0 A;  2W7P A;  2F77 X;  5ALV A;  3BS7 A;  2KFZ A;  2P6U A;  2HCF A;  2LBO A;  1MA7 A;  2ZXI A;  1CEZ A;  3DDH A;  1C20 A;  3Q8K A;  3AUO A;  5AKZ A;  5HML A;  5EWF A;  1IG6 A;  4UB3 A;  7ICR A;  5IIL A;  5KG0 A;  2W7O A;  9ICL A;  2ZJ5 A;  2R8K A;  4UAU A;  3EYZ A;  4ED1 A;  8ICW A;  3AQF A;  1JRO A;  2D6F C;  3QYP A;  1UT5 A;  4UAT A;  9ICB A;  2NRW A;  1L8O A;  4UB4 A;  3WK7 A;  5AKG A;  1QSY A;  4NLC A;  1ZQU A;  1S77 D;  1FFU A;  4ECV A;  3C1Z A;  9ICE A;  4NLZ A;  5AI9 A;  3KZI U;  1N5X A;  5KFR A;  2CN1 A;  8ICX A;  2KN7 A;  5KL8 B;  3FYH A;  4QW8 A;  1RZT A;  4GC6 A;  2K4H A;  1S0O A;  2XVT A;  4M9H A;  4KN7 A;  2PFQ A;  4Q8F A;  4J9O A;  1T3Q A;  5KFK A;  4RQ2 A;  2BCV A;  3ZDD A;  3EWA A;  4DWI A;  3F5A A;  2BCR A;  1ZET A;  1D8L A;  3QE9 Y;  2K4I A;  5DGA A;  7ICJ A;  3OPX A;  9ICH A;  2BQU A;  1S8O A;  5KT3 A;  1SZH A;  1Z1B A;  4NJ8 A;  1PUZ A;  4P4P A;  9ICP A;  2J6S A;  1N2X A;  2XID A;  2GO7 A;  5KFT A;  4FE3 A;  4YR3 A;  4P0P B;  3JPR A;  1AQ6 A;  2IHM A;  3HP6 A;  2AGP A;  4BWM A;  3PO4 A;  4R66 A;  2HHV A;  4KX5 A;  3NGD A;  2ESE A;  3D6J A;  5AKJ A;  4J9R A;  5AM4 A;  2NRX A;  1Z00 B;  5KG2 A;  1ZQY A;  4RUC A;  1ZD3 A;  3G6Y A;  3FDS A;  2K89 A;  3UXO A;  3RAX A;  4MEX A;  1SXE A;  3SV3 A;  4B9V A;  4Y2T A;  3OJU A;  4UAS A;  3K4G A;  3IN5 A;  5J0S A;  4C4R A;  3C5F A;  1RYS A;  4UAZ A;  3UQ2 A;  3PW2 A;  4UAV A;  1ARO P;  3ISB A;  1T3N A;  3QZ8 A;  1ZQI A;  3RH5 A;  2FJ6 A;  4GXI A;  4TUR A;  3GU3 A;  1ZQH A;  2CPR A;  8ICC A;  3GIJ A;  4PHA A;  4NL9 C;  2F2A B;  1S76 D;  4NY8 A;  1QCK A;  3FM9 A;  3KKA C;  5B66 U;  1RXV A;  3G6X A;  1MQ2 A;  1SWW A;  1RYR A;  2HHS A;  3PR4 A;  3HKZ F;  1KSP A;  4KLD A;  1ZD2 P;  5ALK A;  2QB0 B;  3MFI A;  2D8C A;  3ETR A;  3T5J A;  2PMZ F;  2G07 A;  3F2D A;  8ICJ A;  2AQ4 A;  1SKR A;  3TFR A;  3SEI A;  1TE2 A;  2AGQ A;  1WG8 A;  5CWR A;  3F2C A;  3UMC A;  2EDU A;  2OCE A;  4QWA A;  4GC7 A;  4QZ8 A;  7ICU A;  5ALJ A;  4KIT B;  4LZG A;  5HMM A;  1B0X A;  4C8M A;  2XI9 A;  4ELU A;  1Y88 A;  3OGU A;  2A3V A;  4K4G A;  3KHH A;  2ISO A;  2P66 A;  1KKX A;  1U48 A;  2VJ4 A;  3RFA A;  4G9B A;  3C21 A;  2DPI A;  1IM4 A;  3V6J A;  2L5Y A;  2F8L A;  4DL5 A;  2YTU A;  2BCQ A;  5DB7 A;  2HOF A;  1MC8 A;  4F3O A;  2AXT U;  2F1J A;  1JXL A;  5DB9 A;  4F5P A;  2Y1J A;  4KLS A;  1UCV A;  3V7L A;  3Q8Q B;  1JIH A;  4MEY A;  5KFN A;  4B9N A;  1NOM A;  4NXZ A;  3BZC A;  3QUQ A;  1L3U A;  1D9D A;  3I76 A;  2LM1 A;  2V4Q A;  3H4B A;  9ICS A;  3N7R C;  1SKW A;  1KN5 A;  4UAW A;  4P0Q A;  2KJ5 A;  1QSS A;  8ICH A;  2DUY A;  5AI8 A;  1BNO A;  4PPX A;  1RPL A;  2CXY A;  1PVQ A;  1JMS A;  2QLT A;  4UAR A;  5KFV A;  4EEK A;  1B43 A;  4LZD A;  1NI3 A;  4TUP A;  5AI6 A;  1ZJM A;  1ZQX A;  3GZF A;  1XSP A;  2WF9 A;  3CW2 C;  4EBC A;  4KMO B;  2QAR A;  2YMM A;  3MGH A;  4ACO A;  5KT7 A;  2PFN A;  3IG8 A;  4ELV A;  2HHW A;  3C23 A;  1QH9 A;  2JEJ A;  8ICE A;  4F4X A;  1X9X A;  4DOA A;  3ZI4 A;  2ZUD A;  4C80 A;  1X42 A;  3GIK A;  1SV4 A;  3TAQ A;  3NAS A;  4YMN A;  5KFG A;  2W11 A;  3HRD D;  2XC9 A;  3HKZ C;  3LWM A;  1GO3 F;  3L3F X;  3TI0 A;  2HOI A;  2ES6 A;  1S97 A;  1SGG A;  2A1J A;  4KTQ A;  5L1I A;  1KQQ A;  1SXD A;  3H8J A;  2PMZ C;  4R65 A;  4ECU A;  1N62 A;  2NV3 A;  3AN1 A;  4DQP A;  4DFD A;  3GFK B;  4RQ3 A;  4HYK A;  4U7C A;  3CRX A;  5ALM A;  2DFL A;  2KIW A;  3ONN A;  4KX3 A;  3PVX A;  2KJ8 A;  1HUZ A;  3TFS A;  1ZQK A;  2C22 A;  4HAI A;  3H0L B;  1K1Q A;  1IXR A;  4O3R A;  5AM2 A;  2KSO A;  2EZY A;  3E0F A;  1NJW A;  5AHX A;  3TAN A;  3WU2 U;  4DSF A;  4C8K A;  4PHP A;  4MFF A;  3WKC A;  5J2E A;  4M47 A;  3BQ1 A;  2JHD A;  1JUD A;  1JXE A;  5J2A A;  3HX0 A;  5JRT A;  2WTF A;  1TK0 A;  4KLG A;  1MSW D;  3JPS A;  3T79 A;  4RT2 A;  4I28 A;  2LYA A;  5AKL A;  5J8Y C;  2G06 A;  1L6N A;  2PXI A;  2OHF A;  3M9M B;  1NKB A;  1U9L A;  4QZE A;  5L1M A;  5DB6 A;  1L7O A;  4YR2 A;  5HR7 A;  4QZB A;  7ICI A;  5KFX A;  4DQQ A;  2MUT A;  2PI5 A;  2KKV A;  4J9P A;  4BGD A;  2OEH A;  5J0R A;  2JH7 A;  5AKY A;  3QU5 A;  4O3P A;  1N56 A;  5DBC A;  1KFT A;  1PK1 B;  3IRU A;  5KFL A;  3RJF A;  4KLM A;  2Q0Z X;  5E79 U;  3PW0 A;  3E58 A;  1CI4 A;  3ORY A;  4MFA A;  1WYG A;  4RQ4 A;  1XSL A;  5CB1 A;  3TAD C;  1ZQD A;  2KZ3 A;  3RAQ A;  2BPF A;  2IBK A;  2F1H A;  2KMD A;  5EE9 A;  4Y2Q A;  5KG5 A;  4CF4 A;  3M6Z A;  1LKY B;  4E0D A;  3LDA A;  1QTM A;  2IOF A;  3RB0 A;  4KLE A;  1MQ3 A;  3RTV A;  5IIN A;  1X9M A;  5J0Y A;  4ED6 A;  4Y2X A;  2F1I A;  2VA2 A;  4ICA A;  1BNP A;  1QLN A;  2W9C B;  4O5E A;  4YVZ A;  2E8P A;  3HWT A;  3RJE A;  8ICA A;  4EZ9 A;  3M1Y A;  1J97 A;  3CYM A;  5ALU A;  3QZ7 A;  5J0Q A;  1TFR A;  2W04 A;  1D9F A;  4YMM A;  4LVS A;  5KG7 A;  2PKE A;  5J2B A;  3AU6 A;  3BZK A;  5CR0 A;  2MU2 A;  4PGQ A;  4Y2S A;  7ICF A;  2KG5 A;  3RJG A;  3F53 A;  4OJL A;  4JWN A;  3ZD8 A;  3JPQ A;  1QSL A;  4P0P A;  4PHD A;  2FLL A;  2ZIU B;  3HT3 A;  4USA A;  2DQN B;  1BPE A;  4JUZ A;  4UBB A;  4F8R A;  3D2Q A;  5F3X B;  4RT3 A;  5C5J A;  4DL4 A;  4YP3 A;  4KLT A;  4QZF A;  1Z00 A;  2MRL A;  1DOQ A;  1IIP A;  1IV8 A;  1NJX A;  4MF2 A;  2RRD A;  3TQ1 A;  3MR5 A;  2WF6 A;  4C7Z A;  4DL6 A;  4QZ9 A;  5IIO A;  2E8M A;  1HEK A;  4Q43 A;  3AM9 A;  8ICO A;  2Y1I A;  3IV6 A;  2XGP A;  2J6T A;  4UAY A;  2ISP A;  3ISC A;  4DLG A;  4NLK A;  5KAI U;  3TAR A;  5TIS U;  2JEG A;  1U45 A;  5J0P A;  3GDX A;  3M7D A;  4EX6 A;  4IRC A;  3V72 A;  4PH5 A;  1SL0 A;  5A0L A;  3UXN A;  4DFK A;  2FPK A;  2QB0 A;  3F5E A;  4CE6 A;  2HVI A;  5KFZ A;  1RYU A;  4OJ6 A;  1Z19 A;  3IM1 A;  3U26 A;  5JU5 A;  4QNL A;  3GII A;  4BXO B;  3MC1 A;  2JZB B;  3PV8 A;  4QWD A;  4KMU A;  4EEY A;  4GFJ A;  3JPT A;  5J0T A;  1PZN A;  1TAQ A;  2PFO A;  2WHE A;  4UQG A;  3K1R B;  1H38 A;  5J8Y A;  2E1F A;  5ALD A;  3UQ0 A;  3TAP A;  2NRT A;  3RF9 A;  2LPE A;  2HSZ A;  2B6G A;  1KTQ A;  4AYB F;  4O9M A;  5J2C A;  2YML A;  2W9M A;  4F4K A;  2NYV A;  4EBE A;  2FMP A;  4BWJ A;  3OHA A;  4J9S A;  2ZTD A;  5ALE A;  4Y2P A;  4XA5 A;  9ICK A;  4DSE A;  2QKQ A;  5KT4 A;  4JV1 A;  3T5L A;  1HIW A;  1ZQO A;  4DFJ A;  2W43 A;  5AIC A;  2M9N A;  3MBY A;  8ICQ A;  4BUG A;  2QB1 A;  3T5K A;  3TAD A;  2J6U A;  5GTI U;  4QZI A;  2D3D A;  2V4R A;  1XO1 A;  2R8J A;  4I2D A;  4GLX A;  4IC9 A;  4ECZ A;  3MR3 A;  2XY5 A;  2VA3 A;  2B0C A;  4RQ6 A;  2BGW A;  5J0X A;  1DRG A;  2G5I B;  1SIJ A;  2H3V A;  5AM0 A;  4CGZ A;  4UW9 A;  4QWC A;  4DQR A;  3N7P D;  9ICM A;  1QQ6 A;  1S5L U;  1ZQ1 C;  4YMO A;  3RB6 A;  1U4B A;  4F2S A;  3NVW A;  3UPQ A;  4F50 A;  4KLL A;  1L5U A;  4OJO A;  1JRP A;  2LI6 A;  3WK5 A;  1JN3 A;  2W9B B;  2FI1 A;  3MDC A;  2JV3 A;  7ICQ A;  5KFH A;  4O3O A;  4DS5 A;  4DL2 A;  1K5O A;  4IRD A;  2FLP A;  1ZYQ A;  4UB1 A;  2R8G A;  1B4F A;  1ZQL A;  1X6I A;  1ZOL A;  2I5H A;  4C7Y A;  3S6J A;  5ALT A;  3BS5 B;  5T14 A;  1S0N A;  2A19 A;  2KKP A;  4C8L A;  3LYS A;  4RQ5 A;  4P2H A;  2FMS A;  2XCA A;  3PSF A;  1KFD A;  3PY8 A;  1UA0 A;  2AJQ A;  5ALW A;  3AL0 B;  4C8N A;  2E3T A;  5AKH A;  5ALY A;  4KLI A;  5DQG A;  2HOQ A;  1N5W A;  1TAU A;  4IR1 A;  3RB3 A;  1S9F A;  1TVA A;  7ICK A;  4I2J A;  2HMX A;  3K1Z A;  4EYH B;  2AH5 A;  1NNL A;  3WK6 A;  1XS9 D;  3QX7 A;  2HBL A;  1F0M A;  4DF4 A;  4I2E A;  1EXN A;  3C2L A;  5J2D A;  4JV0 A;  2JRZ A;  3NTU A;  1ZQM A;  3Q8M A;  7ICN A;  4AYB C;  2JMG A;  2ATL A;  1F5S A;  2H3I A;  5AI5 A;  2KJ9 A;  2BQR A;  4PJ0 U;  2YY6 A;  5AM3 A;  2RLT A;  2RP5 A;  4DQS A;  4PHE A;  1NZP A;  3PR5 B;  5ALS A;  3MFH A;  3KBB A;  4F93 B;  2ZIX B;  1B22 A;  4YG2 A;  4FO6 A;  2BHN A;  2N1R A;  3HW8 A;  2M0N A;  3B0Y A;  2EH9 A;  1ZQN A;  3KHL A;  4R8U B;  3Q8L A;  1PK1 A;  3SAH A;  4DO9 A;  1X9S A;  8ICV A;  1Q3V A;  5AKE A;  3WK8 A;  5DG7 A;  5J2K A;  8ICM A;  4IQV A;  4F4Y A;  2HBM A;  2HBJ A;  5HHH A;  2EZX A;  2Y9U A;  1TV9 A;  2HVH A;  3M9N B;  3RJJ A;  4I27 A;  3ISD A;  2ZUC A;  2A1A A;  2E5S A;  1L3V A;  2I9G A;  1D8Y A;  3LVV A;  3Q8S B;  4QIW F;  4DS4 A;  2YQE A;  2K4P A;  5B5E U;  1Z4N A;  4RQM A;  4RUA A;  2K8C B;  4ZH4 A;  4RPZ A;  2W9C A;  4DSL A;  2JGA A;  4UB6 U;  8ICF A;  2LM4 A;  1WWU A;  3GV5 B;  2VAN A;  5KFA A;  3THV A;  4RNN A;  4I2F A;  5KFI A;  3M6K A;  5AM1 A;  4MHV A;  2KEY A;  3R9K A;  2K60 A;  1ZQC A;  3QUB A;  1KRP A;  2EAO A;  4M2Y A;  3QU4 A;  4OJ5 A;  4Z6C A;  1PVR A;  1S0M A;  2ZG6 A;  3OJS A;  4GXK A;  1DK3 A;  3QUC A;  1VDV A;  7ICE A;  2ZIU A;  2VKQ A;  2DF4 B;  4QZG A;  1FFV A;  3D2N A;  4M9J A;  4KLO A;  4KLF A;  3L5K A;  5CP2 A;  3LK9 A;  5DBB A;  3H0M B;  2ZUB A;  4ECQ A;  5AIB A;  1Q3U A;  5L1K A;  2HW3 A;  3BQT A;  1WCN A;  5J0U A;  4DQI A;  5ALQ A;  3NVY A;  5KFP A;  3PST A;  1BPY A;  2F44 A;  4CNQ A;  3GV7 B;  2OYY A;  3K75 D;  2FMQ A;  1UT8 A;  8ICI A;  4FS2 A;  4NM1 A;  1A77 A;  3H7I A;  4ZOH C;  4O5C A;  9ICA A;  2W54 A;  3NUQ A;  2UVW A;  1URJ A;  5KTQ A;  3UXP A;  4A8E A;  2FE9 A;  2R8I A;  4JK1 A;  3PMN A;  3L4P A;  3SMV A;  5DDM A;  1RQL A;  2UVU A;  4JV2 A;  4DL3 A;  1T8E A;  1FEZ A;  2NRZ A;  5EWG A;  4YR0 A;  4PL2 A;  1X66 A;  4ECS A;  4CCH A;  1ZRN A;  4M6W B;  2EAM A;  5ALH A;  4C0Z A;  1RDF A;  2HI0 A;  4NLB A;  2W8L A;  3ZDB A;  2YB1 A;  3V6H A;  1KBU A;  1COK A;  2LYH A;  1SB3 C;  5BPC A;  5J29 A;  4BXO A;  3JPO A;  2JZB A;  2FPM A;  2F8K A;  3SEN A;  4F91 B;  3N28 A;  2ZTE A;  3HIL A;  1BGX T;  2V9W A;  3SD7 A;  1ZQE A;  4QIW C;  3PX6 A;  4LJX A;  2F3N A;  3AQE A;  5DG8 A;  2WFA A;  2H5X A;  2BZF A;  4IS7 A;  5AKK A;  5ALG A;  4NL9 A;  2K8A A;  4GIB A;  5K4L A;  3IP4 B;  1SKS A;  3KKA A;  2WB1 F;  1DGJ A;  2AU0 A;  4CF3 A;  4JB3 A;  1V9P A;  4YD1 A;  4YXM A;  4F4Z A;  1FIQ A;  2JR5 A;  3T3F A;  5DKW A;  4O5K A;  3AEV A;  3HPO A;  1UHU A;  3M8S A;  1BPD A;  9ICW A;  5ALI A;  4XUS A;  9ICJ A;  5H2F U;  1F44 A;  8ICN A;  1Z1V A;  3NRW A;  1NJY A;  1K1S A;  5ALF A;  3T5H A;  4K4I A;  2BKE A;  4PL1 A;  9ICN A;  5AIA A;  4FBU A;  2RDI A;  3NS1 A;  3RBE A;  4DFP A;  3ICX A;  4MFC A;  3OHB A;  1RM6 C;  4ECX A;  5HNK A;  3WK9 A;  2ZXH A;  5KFQ A;  3CP8 A;  3PML A;  3WK4 A;  3FAH A;  2GWS A;  2XO7 A;  4FS1 A;  4F5R A;  2LKY A;  2HDO A;  3PW5 A;  1PK3 A;  4ECR A;  4ED0 A;  4IQU A;  5IIJ A;  4I29 A;  1T7P A;  5F9L A;  1NZB A;  2W9B A;  9ICX A;  1DGS A;  5TZV A;  2K4E A;  4B9U A;  5J2H A;  1NK0 A;  2I6X A;  1ZQW A;  4DEZ A;  3KFU F;  1XNS A;  3QXG A;  4US8 A;  2E8O A;  9ICV A;  2W8K A;  3UMG A;  9ICT A;  4J03 A;  4DF8 A;  4FBT A;  3H8S A;  2DKX A;  4Q44 A;  2H3F A;  3Q8P B;  2HHU A;  8ICG A;  2OXO A;  5AK5 A;  4QZH A;  7ICL A;  2CRX A;  1KLN A;  4PZN A;  3VC8 A;  5KFY A;  3QUT A;  9ICG A;  1NK6 A;  4X5V A;  3RJI A;  1UPH A;  1X40 A;  5AI0 A;  5ALP A;  1L3S A;  1V97 A;  5KFC A;  3MDA A;  5KFU A;  3QU2 A;  1L7N A;  5IIK A;  3PSI A;  5ALR A;  5DG9 A;  3H8W A;  1RQN A;  2WB1 C;  3QU7 A;  4B9T A;  1WUD A;  3A0H U;  1M6Y A;  4U6P A;  2ZJA A;  2KVS A;  4ED3 A;  2UVR A;  4C4T A;  5FP0 A;  2ZIX A;  5KFS A;  4EZ6 A;  4TUQ A;  3C2M A;  1KDH A;  3N7S C;  4KLJ A;  1JX4 A;  4QZA A;  4J9K A;  2B21 A;  5KNI A;  3IHQ B;  5DQH A;  4RQ8 A;  3VCB A;  4F71 A;  4AP9 A;  4UB8 U;  1VLB A;  3PO5 A;  2OM6 A;  1J2N A;  7ICT A;  2WF8 A;  1SV0 C;  4QWE A;  2KV2 A;  4M9N A;  7ICM A;  3MR2 A;  2YMQ A;  2XGQ A;  5KG4 A;  2JEI A;  3BQ0 A;  4XRH A;  1P7D A;  2P35 A;  1SL2 A;  1XU4 A;  4DOB A;  4BDP A;  9ICC A;  2YB4 A;  4ED7 A;  1JI7 A;  5G5G A;  5JTI A;  5CA7 A;  2DBY A;  4NWI A;  2C28 A;  1V38 A;  3RR8 A;  3ZD9 A;  4I2C A;  4I2H A;  4B9S A;  1ZXI A;  3KD3 A;  2DGZ A;  4OO1 J;  5ALL A;  3M9O B;  2C2D A;  1RXW A;  2GH1 A;  2Q4T A;  4I2I A;  2RDJ A;  2FLN A;  3F2B A;  2LHT A;  4PGY A;  4ECT A;  2ZIW B;  4Y2R A;  2MUT B;  4OCZ A;  3RRH A;  2P6R A;  1N48 A;  3IDW A;  5DBA A;  2H3Q A;  2ASJ A;  2RHF A;  4YD2 A;  3C2K A;  1BPZ A;  4QJF B;  4UBC A;  3N97 B;  1O03 A;  2ZIV B;  2WF5 A;  1ZQR A;  2JH1 A;  1L3T A;  4O3S A;  1BPB A;  9ICO A;  1U47 A;  1D8B A;  5L1J A;  3GIM A;  5DLF A;  5JUM A;  2NRV A;  7ICO A;  2VA8 A;  4FZL A;  1NJZ A;  1T94 A;  2JEF A;  4Z6E A;  3E2E A;  5KFO A;  4I2A A;  3MAB A;  4CRX A;  2DPJ A;  3RBD A;  1ZD5 A;  4DSJ A;  3I1Y A;  3NVZ A;  3GIL A;  5KT2 A;  8ICL A;  3RH6 A;  2MAX A;  4TUS A;  1A76 A;  3CNH A;  1TKD A;  4TQS A;  1KEJ A;  5KFJ A;  5EE1 A;  3B9J A;  4FFD A;  5AK6 A;  4P4M A;  2XY6 A;  5ALN A;  4ED2 A;  1XSN A;  1X2I A;  2LMR A;  4M6W A;  4YXJ A;  3RB4 A;  2ZTC A;  2VIX A;  1ED1 A;  4EX7 A;  3ED5 A;  4DSI A;  3I28 A;  5KL1 B;  4J9M A;  1ZQJ A;  3EZ5 A;  5C0Y A;  1TK5 A;  2KNJ A;  5J2J A;  1ZQT A;  2KHV A;  3PZP A;  2PFP A;  3PSP A;  3JPP A;  5KG3 A;  5J0O A;  1KFS A;  5III A;  5D4B A;  1NK9 A;  4QWB A;  5F9N A;  4RNO A;  1Q46 A;  5DB8 A;  1LB2 B;  3EW9 A;  1SWV A;  2C2R A;  4Y2J A;  3BDP A;  5AM5 A;  4DOC A;  2EQY A;  5J2G A;  2KHQ A;  2I1Q A;  5IIM A;  5AK3 A;  4BX9 C;  3RH4 A;  1ZQF A;  4M04 A;  1KL9 A;  4JMU A;  1QQ7 A;  3RJH A;  4F5O A;  2KZZ A;  3SAG A;  3PW7 A;  9ICR A;  1FO4 A;  5KFE A;  2HBK A;  2AHO B;  1MN8 A;  1XWL A;  2EZZ A;  2Y0S F; 
#chains in the Genus database with same CATH homology
 1D8B A;  2KKP A;  1CRX A;  3F53 A;  4OJL A;  3LYS A;  3H0R B;  2JHD A;  2ZIW A;  2BDU A;  2W7O A;  2WAQ C;  2E1F A;  3VCB A;  4C0Z A;  2OH2 A;  3PSF A;  2K8C B;  4NLB A;  5CRX A;  4FZL A;  2YB1 A;  3AQF A;  3RF9 A;  3IN5 A;  1NZB A;  2GOL A;  1T94 A;  4P0P A;  1A6S A;  1KBU A;  2D6F C;  3T79 A;  1A0P A;  2JGA A;  3AL0 B;  2ZIU B;  4CDG A;  2XIC A;  4CRX A;  2K4E A;  4AYB F;  2DQN B;  1XO0 A;  2F76 X;  2LYA A;  4NV0 A;  2G06 A;  2OM6 A;  3N7R C;  1L6N A;  2HOQ A;  3D2Q A;  4NLC A;  3GU3 A;  2KV2 A;  4P0Q A;  2KJ5 A;  3KFU F;  3M6K A;  2CPR A;  2HMX A;  3K1Z A;  3DEE A;  2LYB A;  2ZIV A;  3MGV A;  1XNS A;  5T14 A;  2KEY A;  5HR6 A;  2Z7J A;  2F2A B;  1P7D A;  5HR7 A;  2Y0S C;  4QIW C;  1HIW A;  2MRL A;  4FZN A;  2KIC A;  2HBL A;  2KKV A;  4OJ5 A;  2K8B B;  1IIP A;  4PL2 A;  1PVQ A;  2CN1 A;  3AQE A;  2JH7 A;  2KD1 A;  3HKZ F;  1PVR A;  4BUG A;  2G0A A;  2H3F A;  3KZX A;  3SAF A;  2RRD A;  1YT3 A;  2E1E A;  2ZG6 A;  2H3Z A;  2YB4 A;  3N7S C;  3GZF A;  5KL8 B;  1HEK A;  2KOB A;  4WJ3 B;  2PMZ F;  2G07 A;  2K8A A;  2OXO A;  2K4H A;  1ED1 A;  2VIX A;  2XVT A;  3IP4 B;  4KMO B;  3F2D A;  4NWI A;  2ZIU A;  2WB1 F;  4AYB C;  2JMG A;  2YX8 A;  4ACO A;  2H3I A;  2VKQ A;  2DF4 B;  3IG8 A;  4IC9 A;  3SQI A;  3D2N A;  2KJ9 A;  2CRX A;  3F5A A;  5KL1 B;  3VC8 A;  2DGZ A;  4OO1 J;  5C0Y A;  2VJ5 A;  3ALR A;  3F2C A;  2KNJ A;  2K4I A;  2RP5 A;  3H0M B;  3C28 A;  3M6Z A;  2KHV A;  3PZP A;  3OPX A;  1DRG A;  1OUQ A;  2G5I B;  2GH1 A;  2Q4T A;  2ZIX B;  2H3V A;  1UPH A;  3PSP A;  3O0F A;  3M7D A;  3F2B A;  2LHT A;  4CGZ A;  1SZH A;  3N7P D;  1Z1B A;  1Q3U A;  2N1R A;  1ZQ1 C;  2M0N A;  3HKZ C;  1GO3 F;  3L3F X;  2HOI A;  2G5H B;  2XI9 A;  3PST A;  2ZIW B;  5A0L A;  3C29 A;  2XID A;  1F44 A;  4OJO A;  3PSI A;  2OYY A;  3NRW A;  2WAQ F;  3F5E A;  4ICA A;  3SAH A;  2PMZ C;  3D2S A;  4FE3 A;  2A3V A;  4P0P B;  2NV3 A;  4PL1 A;  1Q3V A;  2WB1 C;  4OJ6 A;  1Z19 A;  2H3Q A;  1WUD A;  2RHF A;  3NUQ A;  1URJ A;  3CYM A;  3IG5 A;  2VJ4 A;  2KVC A;  4QNL A;  4A8E A;  4U7C A;  4U6P A;  2KHQ A;  3CRX A;  1PVP A;  3RFA A;  4QJF B;  2W04 A;  3ICX A;  2HBM A;  3LVW A;  2HBJ A;  4BX9 C;  3ONN A;  2KIW A;  4O3M A;  4KX3 A;  4KX5 A;  2KJ8 A;  3SMV A;  4P0Q B;  1ECW A;  2R18 A;  4FZM A;  2W7P A;  2F77 X;  4JMU A;  2MA1 A;  4OJP A;  2F8L A;  3H0L B;  2ZIV B;  2ZXH A;  2G08 A;  3CP8 A;  1MA7 A;  2LBO A;  4BJQ A;  2W03 A;  3SAG A;  2HOF A;  2JH1 A;  2ZXI A;  4GFJ A;  2HBK A;  1TAM A;  2ZIX A;  2E5S A;  2G09 A;  3E0F A;  2LKY A;  3LVV A;  2K89 A;  2Y0S F;  4QIW F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...