2F77X

Solution structure of the r55f mutant of m-pmv matrix protein (p10)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKFWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
molecule keywords Core protein p10
total genus 28
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f77X00
2F77X 2F76X
chains in the Genus database with same CATH superfamily
9ICVA 2PI5A 2ASJA 3EW9A 5AK4A 1BNPA 3WK9A 2ZTCA 2WF6A 1WYGA 1TE2A 4YMOA 5AM1A 4K4IA 3SV4A 4IR1A 4FBTA 4BJQA 3MR5A 4C0ZA 4KLMA 2Q0ZX 3C1YA 3QXGA 1WWUA 2H3FA 1XS9D 3SZ2A 5T14A 9ICKA 3HKZC 1X9MA 3MBYA 2JHDA 4U7CA 1PK1B 5ALMA 1KSPA 3M9MB 4DQQA 3PMNA 8ICYA 1SXDA 4NJ8A 5ALFA 3E2EA 4DLEA 5KFMA 2IHMA 3QX7A 9ICAA 1TVAA 2AU0A 1V85A 3IV6A 7ICGA 3N97B 9ICMA 5B5EU 3BZKA 4FZNA 1DRGA 1ZQEA 3LVWA 2ZIUA 2HOIA 2B6GA 4KLUA 2VA2A 1RPLA 1MQ2A 2LYHA 4RQ4A 5KG1A 5J0RA 2I5HA 1T94A 1ZQXA 4Z6FA 1N62A 1UCVA 2KZ3A 4JWMA 1CRXA 4CNQA 3WKEA 1XO0A 4CF3A 1WG8A 1X9WA 4QWDA 2KFZA 2XI9A 4OJ5A 5AKYA 3M1YA 2ATLA 3WKAA 4ECRA 2PFOA 8ICCA 4PHDA 4C8LA 3Q8PB 3M7DA 1FEZA 3ZDAA 4P0PB 5AI6A 5ALSA 4RQ7A 3T5LA 3EUB2 3AU2A 4GFJA 5DQIA 1X2IA 2NRVA 1ZQVA 3G6XA 1IXRA 3WK7A 4F2SA 1A77A 3PNCA 1COOA 3D2NA 3B9JA 2ZUDA 5CB1A 4ED3A 1CUKA 5KL8B 1ZD2P 1LV5A 3BDPA 4DSJA 1KRPA 3F2CA 3QUCA 5KG5A 2AH5A 4KLIA 1ZYQA 3GIJA 2Q4TA 4P0QB 3R9KA 7ICNA 1NOMA 4QZ9A 5CP2A 5L1MA 2KMDA 2W8KA 3ISCA 5IILA 5KFXA 4KLLA 2D8CA 5KFPA 2KOBA 4P2HA 1IIPA 3LWLA 2NRXA 4DOCA 2JV3A 2NO5A 2WF8A 1NK6A 5J8YC 4C4SA 4AYBF 5IINA 2JEGA 2ASDA 5K4LA 5HHHA 2R18A 1FIQA 2OH2A 1PK1A 3QUBA 4ECYA 2XGPA 2BCUA 8ICBA 5J2GA 3T5JA 1BPXA 3FM9A 3RRHA 2WF9A 1KW4A 3PW7A 2LHTA 3KZXA 5KFLA 5KG4A 3MGHA 5BOLA 3JPTA 2OWOA 4Y2TA 3Q8LA 7ICUA 3PSIA 5ALEA 2R8GA 7ICVA 2WHEA 4J03A 2JRZA 3B0XA 3ETLA 3OSNA 9ICPA 1L3TA 1TAMA 5DBBA 4FS2A 3TFSA 2RLTA 4Q43A 5AM3A 4NL9A 4F5QA 4JB3A 1BPZA 5KG6A 4DL6A 1C7YA 1BPDA 3V7LA 3MGVA 5D49A 3G6VA 4DL4A 1N48A 3O0FA 3C21A 3EPIA 2NRWA 1NJWA 2WB1C 3I76A 2PFNA 5FP0A 2HHVA 3BQTA 4R8UA 4BDPA 4RQNA 4IS7A 1RYUA 4MF8A 1U48A 4B6JA 5DG8A 4JV0A 3GV8B 4F5RA 1ZQJA 3LVVA 3IDWA 2IOHA 2HOQA 4UATA 4YN4A 2ZJAA 3K1ZA 4NL9C 5IIJA 1ZQ1C 5IIOA 4O3MA 4O3NA 1VLBA 1L7NA 2KEYA 4IRKA 5DDMA 2W3SA 3PZPA 9ICTA 3MR3A 4QNLA 3ALRA 1V9PA 3BS5B 1URJA 3PW5A 2IOFA 1YZ7A 2YY6A 5CRXA 3D2SA 3HT3A 1ZQSA 1N61A 2W7OA 3U26A 4DWIA 5ALKA 1ZQDA 5F3XB 4CF4A 3OSPA 4O5KA 4DOBA 2LM1A 3H7IA 1PVRA 4F4WA 4KLGA 4PL1A 1TFRA 1Z4NA 1F44A 4F4XA 1NNLA 4NY8A 5IIMA 4TUQA 3ICXA 8ICGA 3ZDBA 9ICRA 3RB3A 4GIBA 3H40A 3UQ0A 2W43A 4QZEA 1XSPA 3F2BA 1MN8A 4Z6CA 5AKKA 1ZQTA 4QZAA 3PV8A 1SL0A 5G5GA 1ZQFA 3SENA 3IG8A 4A8EA 4PPXA 1N5WA 1Y88A 3WKCA 1JX4A 3TFRA 2OHFA 1S8OA 1WCLA 3GIMA 3JPNA 5JUMA 4GXIA 2Y1IA 4YXMA 4DSKA 5DBAA 3M6KA 3HILA 1RQLA 4YFKA 4QWEA 4QWAA 2LM4A 2JGAA 4C8NA 9ICQA 3V72A 4JWNA 5ALDA 5DBCA 1FFVA 3Q8QB 2XCPA 3K1RB 5KFJA 8ICWA 1NK8A 3SYZA 3SAHA 8ICRA 4PHEA 4UARA 2WFAA 1LKYB 5GTHU 3T5KA 5JRTA 3BS5A 5KFDA 5AI5A 2ZIXB 8ICEA 4PZOA 2KIVA 3T5HA 2DGZA 1IV8A 1ED1A 3KZIU 4I2FA 5G5HA 4I2EA 9ICOA 3MR2A 4PHPA 2WAQF 3ZD8A 1BPBA 1ZQOA 2XVTA 2VA8A 1D9DA 2BHNA 1PVPA 1ZRMA 1ZD4A 1QH9A 2FJ6A 2C2EA 2BQRA 4BXOB 3AU6A 2AJQA 5BOMA 2UVVA 5ALJA 2BPCA 5IIIA 5BPCA 2BGWA 2W9CB 4DFJA 2DQNB 4OJ6A 2DFLA 1BVSA 5AM2A 3H8MA 5DGAA 4EBEA 2YX8A 3WU2U 5L1IA 1X6IA 3C1ZA 3OJUA 3QEAZ 3OPXA 2JMGA 1L3VA 2BDPA 2HBMA 2KG5A 2ZUCA 4M6WB 7ICLA 3AM9A 3TADA 1SKRA 4KLSA 2K60A 1HIWA 2F1JA 4RQ2A 2AQ0A 2PKEA 4UW9A 4J9KA 1PVQA 1NK0A 4ELVA 4R63A 1V97A 2MUTA 4KMUA 3GDXA 2C2DA 1N56A 3C2KA 1N5XA 4ELTA 5HMMA 4DL5A 5HP4A 1UQVA 4UBCA 1BPEA 5J8YA 2VKQA 1KFTA 2W9BA 4O3RA 1RYRA 3BQ1A 1S76D 1OUQA 5KFGA 5B66U 1XNSA 4KLHA 2G07A 8ICJA 5KFCA 5KFEA 4GXJA 5KFYA 1Q3UA 3JPRA 1KTQA 2J6SA 1J2MA 2K4PA 4AYBC 1XC9A 5KFKA 3HX0A 3LDAA 5AI0A 5ALHA 2HHTA 2L5YA 5HR6A 7ICOA 2W9CA 5J0QA 1HEKA 1SV0C 3F53A 2YTUA 4DS5A 3KTQA 2F2AB 1D9FA 2Z7JA 4KLFA 1U45A 2EZXA 5KT4A 4M04A 1KQQA 2QARA 3KHHA 1NZPA 3G6YA 4IRCA 1UT8A 4I2CA 1SB3C 4KITB 4M2YA 2HMXA 4MFAA 4QZFA 3GQCA 1U9LA 3C5GA 2JEFA 4K4GA 5ALUA 4ECTA 5J2AA 5J2EA 5KFTA 3UPQA 3AUOA 9ICSA 2F1IA 2P35A 4FS1A 2HDOA 2PI4A 2YB4A 1UA1A 3QU9A 4KN4A 5A0LA 3QE9Y 5ALVA 4ZH4A 3HP6A 1A76A 1RDFA 1RG6A 4M9GA 4YR0A 1NZBA 1SXEA 9ICUA 4TUSA 4ED1A 1AQ6A 1T3NA 4Y2YA 2XCAA 1T7PA 2NYVA 1NI3A 5AKEA 4KMOB 4O3PA 4ED2A 1KFSA 4RPYA 2EAOA 3K4GA 4UB4A 8ICOA 4IQUA 7ICRA 3QU2A 4LZGA 2KE7A 2PMZF 1ZQAA 2E1FA 1SV4A 4M9LA 5TZVA 2BDUA 2RHFA 2R8KA 1HUZA 3KD3A 1L3SA 3RJEA 3TI0A 1M6YA 2P66A 2VJ4A 3PVXA 2R8HA 7ICMA 4J9SA 5C5JA 4J9LA 2AGQA 4DCCA 4NXZA 5HMLA 4KN7A 5TISU 2YMMA 1QCKA 2NRTA 3AMZA 4QZIA 2V4RA 4PL2A 2RRDA 1TK0A 2E8OA 4BUGA 4GC7A 4P0PA 2QARB 4Y2VA 2XY7A 3SAFA 5J2IA 3ZI4A 3PSTA 3M9NB 3AQFA 9ICEA 2V9WA 5J0TA 1H38A 1Z3EB 2M0NA 2MU2A 4DLGA 5J0YA 8ICLA 5KFBA 4IRDA 3KOOA 5J0UA 4EYIB 4O3OA 1MQ3A 4ECXA 4G3IA 2KSOB 3NVZA 3RR7A 5CR0A 3ISDA 3UXPA 1SL1A 2KVSA 4NLCA 2UVWA 2JEIA 3TANA 3V6KA 2HHQA 4AP9A 4RQMA 1NK5A 4PGYA 1CI4A 2RP5A 5KFOA 5AI9A 5EWFA 3DV9A 2JH7A 2C2RA 4BXOA 2ZIWA 5J29A 2K4IA 3TAPA 3RB6A 4O5CA 2LKYA 3ZDEA 4QW8A 1RZTA 4DSFA 2EANA 9ICXA 5DB6A 4ACOA 2R8IA 3PR4A 4ED6A 2LYBA 2BPGA 2BR0A 2W7PA 5ALTA 4UB1A 1L7OA 3RJKA 1PK3A 4YMMA 2AQ4A 2AGOA 3T3FA 3THVA 1QQ7A 4F50A 3PMLA 3TADC 3DEEA 5AM4A 2CRXA 4QWCA 4F5PA 3MGIA 1T8EA 4MFFA 1Z1BA 1A0PA 3RH6A 5DQHA 2E8NA 3NS1A 4UAVA 3KHRA 3KKAA 5H2FU 3GV7B 2I1QA 4KLEA 4US8A 4RPZA 3D6JA 2J6UA 1D8LA 3RTVA 4B9NA 4K4HA 2LMRA 2KP7A 3CP8A 2Y1JA 5J2KA 1WWVA 2DKXA 5HNKA 3C2LA 3V6HA 8ICTA 3MC1A 1TV9A 1EXNA 3JPPA 1PZNA 3IN5A 5AIBA 2BPFA 1S77D 3H4BA 1SZPA 3KKAC 3SD7A 3MFHA 4FZMA 1NK7A 2PMZC 8ICMA 4Y2QA 2EDUA 2VANA 2KNJA 2CXYA 4QWBA 4Q8EA 4YR2A 2ZTDA 2FLPA 1B22A 5AKZA 2ZG6A 2ZTEA 2FMQA 2Y0SC 4RU9A 2W54A 1QTMA 2N1RA 3B0YA 3QEBZ 4QW9A 3Q8KA 2H3VA 4YMNA 4ICAA 1MSWD 2B21A 1JIHA 1ZD5A 2G0AA 2IA6A 2HI0A 1X9SA 2KZMA 4KX5A 2JH1A 5DQGA 2MRLA 2F1HA 3RH4A 1DK2A 4PZNA 1MC8A 4O3QA 2HBKA 1ZQYA 3L5KA 4RNNA 4DF4A 1B0XA 2FMSA 3GIIA 1DXSA 3PY8A 4MEXA 3RBDA 5KFHA 2QB0B 2YMQA 3NASA 2FPMA 5ALZA 3IP4B 3SR6A 4UB8U 4F71A 2V4QA 2W3RA 3M6ZA 4Y2UA 2W9AA 4EYHB 2ZIVA 4I2AA 4RQ1A 5AKLA 2E8MA 2RDIA 3E0FA 3KHLA 5ALQA 3C28A 2DKZA 2P6RA 3UMGA 4J9RA 4MFCA 2EQYA 5KT3A 2KHQA 4YR3A 1NKBA 1TKDA 3OHAA 4RZRA 4TQRA 2OEHA 3DDHA 3PO4A 4B9MA 4XRHA 2JXJA 4NWIA 4UAUA 1IG6A 2ZIXA 1ECWA 4PH5A 2E8PA 4GLXA 2W9MA 2WTFA 4OO1J 2GLEA 4UAZA 3PR5B 2G09A 8ICAA 4B9TA 4EX6A 2B0CA 4JMUA 3JPQA 2ZXIA 1ZD3A 3QUTA 1F0MA 1TK5A 3QU7A 3PW2A 1RQNA 2W8LA 1SL2A 5E79U 4QZHA 5CA7A 3TQ1A 2W03A 2R8JA 5GTIU 2YMPA 2HBLA 4ECVA 4DS4A 4J9MA 1NKEA 2ISOA 2O6KA 4IL6U 4O9MA 7ICKA 3ED5A 2K8AA 3IM1A 2YQEA 4F4ZA 1ZQGA 1ZJMA 1X9XA 3QYPA 5KG0A 1X6JA 5J0WA 2XICA 1QSLA 1VJ5A 4NM1A 4EEKA 2EAPA 1KBUA 9ICIA 1NJZA 5ALGA 3UMBA 2ZIUB 5AI4A 2NV3A 4KLOA 2JZBB 3L3FX 2JR5A 2QLTA 3WKBA 3RJHA 2YN4A 1OW5A 3BJYA 2KIWA 3RB0A 1FFUA 4YD1A 2BCQA 3RB4A 4RQ5A 1QQ5A 4ZOHC 2M9NA 2LBOA 2FPKA 1J97A 3PO5A 4Z6DA 1ZQCA 2XIDA 3NRZA 1JN3A 2XC9A 1BPYA 1SGGA 1L7PA 5AHXA 4KLQA 1SWVA 4UB2A 3TKAA 1ZOLA 2QB1A 5L9XA 4KLDA 2ZIWB 3IRUA 1FO4A 5KG2A 2KN7A 3WK8A 3K75D 9ICHA 3H0MB 4RUAA 3MABA 4EX7A 4JV1A 2HHXA 1LVHA 4M47A 4F2RA 1JRPA 4C80A 2XGQA 3NVYA 1XSLA 1QLNA 3BS7A 4QJFB 4KLJA 2A1AA 7ICJA 2MAXA 4F72A 3M8RA 4LVSA 1U47A 5HR7A 2A19A 1Z00A 1S0OA 5EE3A 3NVWA 1L5UA 3MDAA 9ICFA 2G08A 4IQTA 1SZHA 5AM5A 1BNOA 4C7ZA 2PFPA 2HVIA 1ZQNA 5DLFA 2IHNA 1S10A 2HHSA 4EEYA 9ICWA 4DSLA 3QNMA 2CN1A 5J0OA 2G06A 3EWAA 1J2NA 1HJPA 2JZBA 5ALWA 1QSSA 3UXNA 4X5VA 4O5EA 5DB9A 4XQ8A 2BCSA 4IR9A 2MSNA 2F77X 2K89A 5F9NA 3BQ0A 3TARA 1K5OA 1ZRNA 4RQ3A 1KKXA 3EPGA 2C22A 3FC4A 4O3SA 4R65A 2GH1A 3F5AA 4LZDA 3N7SC 2G5IB 3HJEA 4DQRA 2EH9A 5HHIA 4I27A 2P6UA 3GIKA 1K1QA 1O08A 3ZD9A 1T3QA 4QZ8A 4R64A 5KFSA 1KLNA 2DBYA 4O0IA 2FMPA 5AM0A 4DEZA 4Q45A 4I29A 4ELUA 4QZBA 3V7KA 4I2JA 4OJLA 4NM2A 9ICGA 2VA3A 4F4KA 4DF8A 2BQ3A 4DQPA 1JXLA 5EE0A 2A3VA 1SWWA 2HVHA 2LI6A 3N28A 2E1EA 3BZCA 8ICIA 2LYAA 2KD1A 4B9UA 2KFNA 3IG5A 4R66A 4R8UB 2HW3A 5CJ7A 2NO4A 1U49A 3E58A 3SAGA 5JU5A 5DG9A 3GV5B 2DPIA 2BCRA 2XY6A 4DO9A 2FI1A 4CRXA 5KG3A 3OJSA 4JUZA 1BGXT 2HCFA 1ZQWA 4F8RA 1N60A 2ZIVB 1SV0A 2G5HB 4M9HA 2I6XA 4YG2A 4U6PA 1UPHA 4RQ8A 3L4PA 1CEZA 1OXJA 5KFRA 4MHVA 3HKZF 3KFUF 4I2GA 1WUDA 2FLLA 4ECWA 1X40A 2KKVA 4YVZA 1YZ6A 5EWEA 4M0AA 2F8LA 2KKPA 4GC6A 2ASLA 4RT3A 4RPXA 3RH5A 2ESEA 3ZDDA 2A1JB 4M6WA 1ZQPA 3V7JA 3RAXA 3I1YA 1SIJA 3VC8A 4ED8A 3WK4A 7ICTA 1SKSA 8ICVA 8ICNA 1Z4OA 3I28A 5CEHA 5AIAA 4Q8FA 3WK5A 5ALIA 5KFQA 3FDSA 2AGPA 2FPLA 2FLNA 4EENA 2NRZA 1SKWA 2EAMA 2MA1A 4DL7A 2LPEA 4I2IA 2F76X 3PW0A 3MDCA 3A0BU 3ETRA 4Y2RA 5AKHA 4UASA 3RJJA 4G9BA 4ECZA 3CRXA 4FBUA 3AL0B 2BQUA 2MUTB 4JK1A 1TK8A 1S9FA 9ICJA 5KL1B 2ZXHA 1N63A 2I9GA 5C0YA 4UAWA 5ALXA 3KHGA 3HPOA 4KLTA 1XWLA 1XO1A 4PHAA 1NK4A 9ICBA 5KT7A 2IBKA 1ZQBA 3S6JA 1NKCA 2VIXA 2J6TA 4FZLA 2IOFK 3WK6A 4CDGA 4EZ9A 5KFZA 3PSPA 3OHBA 1TAUA 1ZETA 4BX9C 4BWJA 2K8BB 4C4TA 1ZQHA 1UT5A 3RBEA 5J2BA 3AEVA 2W55A 1XSNA 1Z19A 3VCBA 5L1JA 4MF2A 3PX6A 2DUYA 2KSOA 1NJXA 3M8SA 2UVRA 3CNHA 2GOLA 2QB0A 3HWTA 2DWQA 9ICCA 5J2CA 3HW8A 5KFVA 8ICPA 1LB2B 2VJ5A 2F8KA 4DFMA 3CW2C 4IC9A 1P7DA 5EWGA 4B9VA 4QZGA 5EE9A 2EZYA 4FO6A 4DSIA 1YT3A 3C2MA 5ALLA 3PX4A 4J9OA 3AN1A 5ALOA 2OYYA 2FDRA 3QU4A 2D3DA 1TAQA 1L8LA 3RJGA 7ICIA 1T4GA 1Q46A 3SMVA 5KT2A 4NLGA 3KBBA 7ICPA 5CWRA 1JXEA 5EE1A 1PUZA 5DKWA 1QQ6A 4DFDA 3M9OB 3RRGA 5ALYA 1RXVA 3GZFA 1VDVA 3SV3A 4NV0A 2KTQA 2QKQA 3UMCA 4UQGA 3RR8A 4LJXA 3LWMA 1RYSA 4RQ6A 4UBBA 2ZJ5A 5KT6A 4EBCA 2ISPA 5DLGA 3V6JA 2HOFA 3RF9A 9ICNA 4USAA 4HYKA 5DDYA 4TURA 2YB1A 3NRWA 2E5SA 2K4HA 3GU3A 2C28A 2RQ5A 2DF4B 4OJPA 5J0PA 4Q44A 4BWMA 4HAIA 3GFKB 3N7PD 4F5OA 4CGZA 2D6FC 1ZJNA 4DFPA 5AICA 3PSFA 3NUQA 2E3TA 5AK6A 1ZQMA 2KHVA 2F3NA 3UXOA 4DFKA 4NLKA 1QSYA 4C8OA 7ICSA 1Z1VA 2KK0A 4NLBA 2OCEA 3Q8RB 5L1LA 1ZQLA 2XO7A 3H8SA 1JMSA 8ICHA 2Y9TA 2KZZA 1ZQKA 1MA7A 5F9LA 4RNOA 5CHGA 1S97A 2BZFA 1Q8KA 4PGXA 4P0QA 4E0DA 3ISBA 2WAQC 5KAFU 3OTQA 5J2JA 3HRDD 4DSEA 2KJ9A 5EOZA 2H3ZA 5JTIA 3NTUA 4I2BA 3C5FA 3EYZA 2W11A 1S0VA 4WJ3B 8ICZA 8ICKA 1UHUA 3RFAA 3PW4A 1N2XA 4M9NA 3GILA 1O03A 4TQSA 4DL3A 2JEJA 4EZ6A 4J9PA 5L1KA 3QU5A 5AI8A 4QZCA 2Y0SF 4I2HA 5ALNA 1X66A 3LK9A 2ZJ8A 4RQ0A 3WKDA 5KG7A 4OJOA 7ICQA 2AXTU 1B4FA 1GO3F 1Z00B 1ZQQA 2BCVA 4B9LA 2K8CB 1S0NA 4KTQA 3UQ2A 1RM6C 1NJYA 1ZQUA 5DGBA 4IQVA 1JI7A 5IIKA 3SQIA 2KVCA 3AQEA 1L3UA 1D8YA 1LKYA 3JPOA 4EELA 3Q8MA 1JROA 2FE9A 2RDJA 4P4OA 2W9BB 1S0MA 2F44A 3SI8A 2WF7A 4I2DA 4DQIA 4C4RA 2H5XA 2XY5A 4FE3A 4F5NA 1JALA 4PGQA 5ALRA 2HHUA 5AKXA 4Y2PA 4TUPA 4YQWA 4F3OA 2HSZA 2ODGA 4ECUA 4Y2SA 1S5LU 4ECQA 2WF5A 3TACB 4UB5A 5KFWA 4MEYA 1COKA 2KJ5A 3H0LB 5KAIU 1L8OA 5KNIA 8ICXA 8ICSA 1ZXIA 2CPRA 4F91B 5D46A 3QZ8A 1HUOA 4RT2A 1KN5A 3MFIA 2A1JA 4XA5A 1DK3A 1AROP 1L6NA 3PX0A 1NK9A 2ES6A 1RXWA 4J9NA 4C8MA 3H8WA 4US9A 4GXKA 7ICFA 2KJ8A 4C7YA 5J0XA 4BGDA 2Y9UA 3D2QA 4DQSA 2OXOA 3C23A 3T79A 3RAQA 4I28A 4CF5A 4QZDA 4RNMA 4P4PA 1X42A 5J2DA 5KFIA 3FAHA 4YP3A 3C29A 3ORYA 1ZQRA 2H3IA 2EZZA 5ALPA 5KT5A 1F5SA 4Z6EA 7ICEA 5DG7A 5KFFA 2W04A 3RJIA 3A0HU 2PFQA 4P4MA 1L7MA 5KFUA 3TAQA 2KV2A 1Q3VA 5AK5A 3JPSA 2K4EA 3NGDA 5DB7A 1ZQIA 4YCXA 3OGUA 3N4MB 3ONNA 7ICHA 3N7RC 2GO7A 8ICQA 1IM4A 1C20A 5AKJA 3FYHA 1A6SA 1KEJA 1KL9A 4YXJA 8ICUA 3RJFA 3F2DA 1WCNA 3H8JA 4UB3A 2HHWA 2HBJA 4CE6A 4RUCA 4J9QA 2BKEA 3LYSA 4IQWA 3BQ2A 1DGJA 4ED0A 2IMWP 4CCHA 4F92B 5KTQA 4JV2A 5AKGA 2KICA 5AK3A 4ECSA 3Q8SB 3H0RB 1UA0A 4XUSA 4ED7A 4C8KA 4DOAA 2ALZA 1KDHA 4B9SA 4UAYA 5AKIA 5D4BA 4NLNA 4OCZA 5KFAA 4NLZA 1V38A 4QIWC 3BQ7A 2OM6A 1K1SA 4F93B 3QZ7A 3F5EA 9ICLA 4UB6U 2WB1F 3SEIA 4KX3A 4DL2A 4FFDA 3UM9A 3MR6A 4QIWF 2DL0A 3ZDCA 3QUQA 2GWSA 4Y2JA 5DB8A 4YD2A 1ZQZA 2ZUBA 5KFNA 1B43A 2YMLA 1KFDA 4M9JA 3H4DA 2DPJA 4OD0A 1DOQA 3NVVA 3EZ5A 4PJ0U 1XU4A 2PXIA 2UVUA 2AHOB 5J0SA 5J2HA 4EBDA 1D8BA 4F4YA 1U4BA 1DGSA 3CYMA 1JUDA 2H3QA 3IHQB 4Y2XA 3J81j 8ICFA 5J2FA
chains in the Genus database with same CATH topology
3PSFA 3NUQA 3ONNA 1PVPA 3N7RC 1TAMA 1Z1BA 1A0PA 1KBUA 2KHVA 4BX9C 2F2AB 2K8BB 1PVRA 4FE3A 2CN1A 2ZIVB 2Z7JA 4PL2A 4PL1A 2RRDA 2G06A 2G5HB 3IP4B 1F44A 2ZIUB 4NLBA 3F53A 2NV3A 3M7DA 1A6SA 4BUGA 4U6PA 4P0PA 1UPHA 1Z19A 4P0PB 3VCBA 3L3FX 3M6ZA 2DQNB 4OJ6A 4BJQA 3SAFA 3ICXA 4GFJA 3HKZF 1MA7A 3KFUF 4C0ZA 2HMXA 2F77X 2ZIVA 3F2DA 1WUDA 2GOLA 2KIWA 2YX8A 3CP8A 3MGVA 2K89A 3PSTA 2HBJA 2KKVA 3AQFA 3O0FA 4P0QA 3D2NA 2F8LA 2KJ5A 2KKPA 3H0LB 3E0FA 2H3FA 3LYSA 2WB1C 3F2BA 2M0NA 3C28A 5KL8B 3OPXA 2WAQC 5T14A 2JMGA 2KICA 2VJ5A 2LBOA 3VC8A 3HKZC 2KHQA 4IC9A 3IG8A 1P7DA 2HBMA 2JHDA 3IN5A 2CPRA 4A8EA 2GH1A 3H0RB 3F5AA 2KJ9A 4U7CA 2H3ZA 3N7SC 3F2CA 4P0QB 1YT3A 2Q4TA 2XIDA 4NWIA 2YB4A 1HIWA 4FZMA 2ZIXA 2PMZC 2G5IB 1ECWA 1L6NA 5A0LA 2OYYA 1PVQA 4WJ3B 2KNJA 4QIWC 4OO1J 3LVVA 3RFAA 4NLCA 2OM6A 4FZNA 2KOBA 3F5EA 3SMVA 2KJ8A 2ZIWB 3M6KA 1IIPA 2HOQA 2MA1A 2WB1F 2ZG6A 1NZBA 1DRGA 2Y0SC 2G09A 3K1ZA 2F76X 4KX3A 4OJLA 3LVWA 1ZQ1C 2ZIUA 3H0MB 4QIWF 3D2QA 2HOIA 2RP5A 4O3MA 2Y0SF 2VKQA 2A3VA 2JGAA 2JH7A 4JMUA 4KMOB 2ZXIA 3GZFA 4AYBF 1XO0A 3CRXA 2N1RA 2OXOA 2E1EA 2KEYA 4NV0A 1OUQA 2ZIWA 2LYAA 3T79A 2K4IA 2KD1A 3AL0B 1XNSA 2G07A 2LKYA 2R18A 2H3VA 2OH2A 1T94A 4ICAA 3SAHA 4QJFB 3PZPA 3IG5A 4ACOA 5KL1B 2ZXHA 4OJOA 1Q3UA 4QNLA 1GO3F 2LYBA 2W03A 3C29A 2G0AA 2W7PA 5C0YA 2PMZF 2H3IA 3ALRA 2E1FA 3RF9A 3SAGA 1CRXA 4KX5A 2HBLA 2HOFA 2K8CB 5HR7A 2ZIXB 2JH1A 2BDUA 2RHFA 1URJA 2YB1A 2E5SA 2MRLA 3NRWA 4AYBC 2LHTA 3KZXA 2K4HA 2W04A 3GU3A 2DGZA 3SQIA 1ED1A 2KVCA 1D8BA 5CRXA 3AQEA 3D2SA 2G08A 2DF4B 4OJPA 4CRXA 2VJ4A 1SZHA 2VIXA 5HR6A 2HBKA 2KV2A 2K8AA 1Q3VA 2XI9A 3DEEA 4FZLA 2WAQF 3CYMA 3PSIA 4OJ5A 2CRXA 2K4EA 2H3QA 3N7PD 4CDGA 2W7OA 4CGZA 2D6FC 1HEKA 2XVTA 2XICA 3PSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F77 X;  2F76 X; 
#chains in the Genus database with same CATH topology
 9ICV A;  2PI5 A;  2ASJ A;  3EW9 A;  5AK4 A;  1BNP A;  3WK9 A;  2ZTC A;  2WF6 A;  1WYG A;  1TE2 A;  4YMO A;  5AM1 A;  4K4I A;  3SV4 A;  4IR1 A;  4FBT A;  4BJQ A;  3MR5 A;  4C0Z A;  4KLM A;  2Q0Z X;  3C1Y A;  3QXG A;  1WWU A;  2H3F A;  1XS9 D;  3SZ2 A;  5T14 A;  9ICK A;  3HKZ C;  1X9M A;  3MBY A;  2JHD A;  4U7C A;  1PK1 B;  5ALM A;  1KSP A;  3M9M B;  4DQQ A;  3PMN A;  8ICY A;  1SXD A;  4NJ8 A;  5ALF A;  3E2E A;  4DLE A;  5KFM A;  2IHM A;  3QX7 A;  9ICA A;  1TVA A;  2AU0 A;  1V85 A;  3IV6 A;  7ICG A;  3N97 B;  9ICM A;  5B5E U;  3BZK A;  4FZN A;  1DRG A;  1ZQE A;  3LVW A;  2ZIU A;  2HOI A;  2B6G A;  4KLU A;  2VA2 A;  1RPL A;  1MQ2 A;  2LYH A;  4RQ4 A;  5KG1 A;  5J0R A;  2I5H A;  1T94 A;  1ZQX A;  4Z6F A;  1N62 A;  1UCV A;  2KZ3 A;  4JWM A;  1CRX A;  4CNQ A;  3WKE A;  1XO0 A;  4CF3 A;  1WG8 A;  1X9W A;  4QWD A;  2KFZ A;  2XI9 A;  4OJ5 A;  5AKY A;  3M1Y A;  2ATL A;  3WKA A;  4ECR A;  2PFO A;  8ICC A;  4PHD A;  4C8L A;  3Q8P B;  3M7D A;  1FEZ A;  3ZDA A;  4P0P B;  5AI6 A;  5ALS A;  4RQ7 A;  3T5L A;  3EUB 2;  3AU2 A;  4GFJ A;  5DQI A;  1X2I A;  2NRV A;  1ZQV A;  3G6X A;  1IXR A;  3WK7 A;  4F2S A;  1A77 A;  3PNC A;  1COO A;  3D2N A;  3B9J A;  2ZUD A;  5CB1 A;  4ED3 A;  1CUK A;  5KL8 B;  1ZD2 P;  1LV5 A;  3BDP A;  4DSJ A;  1KRP A;  3F2C A;  3QUC A;  5KG5 A;  2AH5 A;  4KLI A;  1ZYQ A;  3GIJ A;  2Q4T A;  4P0Q B;  3R9K A;  7ICN A;  1NOM A;  4QZ9 A;  5CP2 A;  5L1M A;  2KMD A;  2W8K A;  3ISC A;  5IIL A;  5KFX A;  4KLL A;  2D8C A;  5KFP A;  2KOB A;  4P2H A;  1IIP A;  3LWL A;  2NRX A;  4DOC A;  2JV3 A;  2NO5 A;  2WF8 A;  1NK6 A;  5J8Y C;  4C4S A;  4AYB F;  5IIN A;  2JEG A;  2ASD A;  5K4L A;  5HHH A;  2R18 A;  1FIQ A;  2OH2 A;  1PK1 A;  3QUB A;  4ECY A;  2XGP A;  2BCU A;  8ICB A;  5J2G A;  3T5J A;  1BPX A;  3FM9 A;  3RRH A;  2WF9 A;  1KW4 A;  3PW7 A;  2LHT A;  3KZX A;  5KFL A;  5KG4 A;  3MGH A;  5BOL A;  3JPT A;  2OWO A;  4Y2T A;  3Q8L A;  7ICU A;  3PSI A;  5ALE A;  2R8G A;  7ICV A;  2WHE A;  4J03 A;  2JRZ A;  3B0X A;  3ETL A;  3OSN A;  9ICP A;  1L3T A;  1TAM A;  5DBB A;  4FS2 A;  3TFS A;  2RLT A;  4Q43 A;  5AM3 A;  4NL9 A;  4F5Q A;  4JB3 A;  1BPZ A;  5KG6 A;  4DL6 A;  1C7Y A;  1BPD A;  3V7L A;  3MGV A;  5D49 A;  3G6V A;  4DL4 A;  1N48 A;  3O0F A;  3C21 A;  3EPI A;  2NRW A;  1NJW A;  2WB1 C;  3I76 A;  2PFN A;  5FP0 A;  2HHV A;  3BQT A;  4R8U A;  4BDP A;  4RQN A;  4IS7 A;  1RYU A;  4MF8 A;  1U48 A;  4B6J A;  5DG8 A;  4JV0 A;  3GV8 B;  4F5R A;  1ZQJ A;  3LVV A;  3IDW A;  2IOH A;  2HOQ A;  4UAT A;  4YN4 A;  2ZJA A;  3K1Z A;  4NL9 C;  5IIJ A;  1ZQ1 C;  5IIO A;  4O3M A;  4O3N A;  1VLB A;  1L7N A;  2KEY A;  4IRK A;  5DDM A;  2W3S A;  3PZP A;  9ICT A;  3MR3 A;  4QNL A;  3ALR A;  1V9P A;  3BS5 B;  1URJ A;  3PW5 A;  2IOF A;  1YZ7 A;  2YY6 A;  5CRX A;  3D2S A;  3HT3 A;  1ZQS A;  1N61 A;  2W7O A;  3U26 A;  4DWI A;  5ALK A;  1ZQD A;  5F3X B;  4CF4 A;  3OSP A;  4O5K A;  4DOB A;  2LM1 A;  3H7I A;  1PVR A;  4F4W A;  4KLG A;  4PL1 A;  1TFR A;  1Z4N A;  1F44 A;  4F4X A;  1NNL A;  4NY8 A;  5IIM A;  4TUQ A;  3ICX A;  8ICG A;  3ZDB A;  9ICR A;  3RB3 A;  4GIB A;  3H40 A;  3UQ0 A;  2W43 A;  4QZE A;  1XSP A;  3F2B A;  1MN8 A;  4Z6C A;  5AKK A;  1ZQT A;  4QZA A;  3PV8 A;  1SL0 A;  5G5G A;  1ZQF A;  3SEN A;  3IG8 A;  4A8E A;  4PPX A;  1N5W A;  1Y88 A;  3WKC A;  1JX4 A;  3TFR A;  2OHF A;  1S8O A;  1WCL A;  3GIM A;  3JPN A;  5JUM A;  4GXI A;  2Y1I A;  4YXM A;  4DSK A;  5DBA A;  3M6K A;  3HIL A;  1RQL A;  4YFK A;  4QWE A;  4QWA A;  2LM4 A;  2JGA A;  4C8N A;  9ICQ A;  3V72 A;  4JWN A;  5ALD A;  5DBC A;  1FFV A;  3Q8Q B;  2XCP A;  3K1R B;  5KFJ A;  8ICW A;  1NK8 A;  3SYZ A;  3SAH A;  8ICR A;  4PHE A;  4UAR A;  2WFA A;  1LKY B;  5GTH U;  3T5K A;  5JRT A;  3BS5 A;  5KFD A;  5AI5 A;  2ZIX B;  8ICE A;  4PZO A;  2KIV A;  3T5H A;  2DGZ A;  1IV8 A;  1ED1 A;  3KZI U;  4I2F A;  5G5H A;  4I2E A;  9ICO A;  3MR2 A;  4PHP A;  2WAQ F;  3ZD8 A;  1BPB A;  1ZQO A;  2XVT A;  2VA8 A;  1D9D A;  2BHN A;  1PVP A;  1ZRM A;  1ZD4 A;  1QH9 A;  2FJ6 A;  2C2E A;  2BQR A;  4BXO B;  3AU6 A;  2AJQ A;  5BOM A;  2UVV A;  5ALJ A;  2BPC A;  5III A;  5BPC A;  2BGW A;  2W9C B;  4DFJ A;  2DQN B;  4OJ6 A;  2DFL A;  1BVS A;  5AM2 A;  3H8M A;  5DGA A;  4EBE A;  2YX8 A;  3WU2 U;  5L1I A;  1X6I A;  3C1Z A;  3OJU A;  3QEA Z;  3OPX A;  2JMG A;  1L3V A;  2BDP A;  2HBM A;  2KG5 A;  2ZUC A;  4M6W B;  7ICL A;  3AM9 A;  3TAD A;  1SKR A;  4KLS A;  2K60 A;  1HIW A;  2F1J A;  4RQ2 A;  2AQ0 A;  2PKE A;  4UW9 A;  4J9K A;  1PVQ A;  1NK0 A;  4ELV A;  4R63 A;  1V97 A;  2MUT A;  4KMU A;  3GDX A;  2C2D A;  1N56 A;  3C2K A;  1N5X A;  4ELT A;  5HMM A;  4DL5 A;  5HP4 A;  1UQV A;  4UBC A;  1BPE A;  5J8Y A;  2VKQ A;  1KFT A;  2W9B A;  4O3R A;  1RYR A;  3BQ1 A;  1S76 D;  1OUQ A;  5KFG A;  5B66 U;  1XNS A;  4KLH A;  2G07 A;  8ICJ A;  5KFC A;  5KFE A;  4GXJ A;  5KFY A;  1Q3U A;  3JPR A;  1KTQ A;  2J6S A;  1J2M A;  2K4P A;  4AYB C;  1XC9 A;  5KFK A;  3HX0 A;  3LDA A;  5AI0 A;  5ALH A;  2HHT A;  2L5Y A;  5HR6 A;  7ICO A;  2W9C A;  5J0Q A;  1HEK A;  1SV0 C;  3F53 A;  2YTU A;  4DS5 A;  3KTQ A;  2F2A B;  1D9F A;  2Z7J A;  4KLF A;  1U45 A;  2EZX A;  5KT4 A;  4M04 A;  1KQQ A;  2QAR A;  3KHH A;  1NZP A;  3G6Y A;  4IRC A;  1UT8 A;  4I2C A;  1SB3 C;  4KIT B;  4M2Y A;  2HMX A;  4MFA A;  4QZF A;  3GQC A;  1U9L A;  3C5G A;  2JEF A;  4K4G A;  5ALU A;  4ECT A;  5J2A A;  5J2E A;  5KFT A;  3UPQ A;  3AUO A;  9ICS A;  2F1I A;  2P35 A;  4FS1 A;  2HDO A;  2PI4 A;  2YB4 A;  1UA1 A;  3QU9 A;  4KN4 A;  5A0L A;  3QE9 Y;  5ALV A;  4ZH4 A;  3HP6 A;  1A76 A;  1RDF A;  1RG6 A;  4M9G A;  4YR0 A;  1NZB A;  1SXE A;  9ICU A;  4TUS A;  4ED1 A;  1AQ6 A;  1T3N A;  4Y2Y A;  2XCA A;  1T7P A;  2NYV A;  1NI3 A;  5AKE A;  4KMO B;  4O3P A;  4ED2 A;  1KFS A;  4RPY A;  2EAO A;  3K4G A;  4UB4 A;  8ICO A;  4IQU A;  7ICR A;  3QU2 A;  4LZG A;  2KE7 A;  2PMZ F;  1ZQA A;  2E1F A;  1SV4 A;  4M9L A;  5TZV A;  2BDU A;  2RHF A;  2R8K A;  1HUZ A;  3KD3 A;  1L3S A;  3RJE A;  3TI0 A;  1M6Y A;  2P66 A;  2VJ4 A;  3PVX A;  2R8H A;  7ICM A;  4J9S A;  5C5J A;  4J9L A;  2AGQ A;  4DCC A;  4NXZ A;  5HML A;  4KN7 A;  5TIS U;  2YMM A;  1QCK A;  2NRT A;  3AMZ A;  4QZI A;  2V4R A;  4PL2 A;  2RRD A;  1TK0 A;  2E8O A;  4BUG A;  4GC7 A;  4P0P A;  2QAR B;  4Y2V A;  2XY7 A;  3SAF A;  5J2I A;  3ZI4 A;  3PST A;  3M9N B;  3AQF A;  9ICE A;  2V9W A;  5J0T A;  1H38 A;  1Z3E B;  2M0N A;  2MU2 A;  4DLG A;  5J0Y A;  8ICL A;  5KFB A;  4IRD A;  3KOO A;  5J0U A;  4EYI B;  4O3O A;  1MQ3 A;  4ECX A;  4G3I A;  2KSO B;  3NVZ A;  3RR7 A;  5CR0 A;  3ISD A;  3UXP A;  1SL1 A;  2KVS A;  4NLC A;  2UVW A;  2JEI A;  3TAN A;  3V6K A;  2HHQ A;  4AP9 A;  4RQM A;  1NK5 A;  4PGY A;  1CI4 A;  2RP5 A;  5KFO A;  5AI9 A;  5EWF A;  3DV9 A;  2JH7 A;  2C2R A;  4BXO A;  2ZIW A;  5J29 A;  2K4I A;  3TAP A;  3RB6 A;  4O5C A;  2LKY A;  3ZDE A;  4QW8 A;  1RZT A;  4DSF A;  2EAN A;  9ICX A;  5DB6 A;  4ACO A;  2R8I A;  3PR4 A;  4ED6 A;  2LYB A;  2BPG A;  2BR0 A;  2W7P A;  5ALT A;  4UB1 A;  1L7O A;  3RJK A;  1PK3 A;  4YMM A;  2AQ4 A;  2AGO A;  3T3F A;  3THV A;  1QQ7 A;  4F50 A;  3PML A;  3TAD C;  3DEE A;  5AM4 A;  2CRX A;  4QWC A;  4F5P A;  3MGI A;  1T8E A;  4MFF A;  1Z1B A;  1A0P A;  3RH6 A;  5DQH A;  2E8N A;  3NS1 A;  4UAV A;  3KHR A;  3KKA A;  5H2F U;  3GV7 B;  2I1Q A;  4KLE A;  4US8 A;  4RPZ A;  3D6J A;  2J6U A;  1D8L A;  3RTV A;  4B9N A;  4K4H A;  2LMR A;  2KP7 A;  3CP8 A;  2Y1J A;  5J2K A;  1WWV A;  2DKX A;  5HNK A;  3C2L A;  3V6H A;  8ICT A;  3MC1 A;  1TV9 A;  1EXN A;  3JPP A;  1PZN A;  3IN5 A;  5AIB A;  2BPF A;  1S77 D;  3H4B A;  1SZP A;  3KKA C;  3SD7 A;  3MFH A;  4FZM A;  1NK7 A;  2PMZ C;  8ICM A;  4Y2Q A;  2EDU A;  2VAN A;  2KNJ A;  2CXY A;  4QWB A;  4Q8E A;  4YR2 A;  2ZTD A;  2FLP A;  1B22 A;  5AKZ A;  2ZG6 A;  2ZTE A;  2FMQ A;  2Y0S C;  4RU9 A;  2W54 A;  1QTM A;  2N1R A;  3B0Y A;  3QEB Z;  4QW9 A;  3Q8K A;  2H3V A;  4YMN A;  4ICA A;  1MSW D;  2B21 A;  1JIH A;  1ZD5 A;  2G0A A;  2IA6 A;  2HI0 A;  1X9S A;  2KZM A;  4KX5 A;  2JH1 A;  5DQG A;  2MRL A;  2F1H A;  3RH4 A;  1DK2 A;  4PZN A;  1MC8 A;  4O3Q A;  2HBK A;  1ZQY A;  3L5K A;  4RNN A;  4DF4 A;  1B0X A;  2FMS A;  3GII A;  1DXS A;  3PY8 A;  4MEX A;  3RBD A;  5KFH A;  2QB0 B;  2YMQ A;  3NAS A;  2FPM A;  5ALZ A;  3IP4 B;  3SR6 A;  4UB8 U;  4F71 A;  2V4Q A;  2W3R A;  3M6Z A;  4Y2U A;  2W9A A;  4EYH B;  2ZIV A;  4I2A A;  4RQ1 A;  5AKL A;  2E8M A;  2RDI A;  3E0F A;  3KHL A;  5ALQ A;  3C28 A;  2DKZ A;  2P6R A;  3UMG A;  4J9R A;  4MFC A;  2EQY A;  5KT3 A;  2KHQ A;  4YR3 A;  1NKB A;  1TKD A;  3OHA A;  4RZR A;  4TQR A;  2OEH A;  3DDH A;  3PO4 A;  4B9M A;  4XRH A;  2JXJ A;  4NWI A;  4UAU A;  1IG6 A;  2ZIX A;  1ECW A;  4PH5 A;  2E8P A;  4GLX A;  2W9M A;  2WTF A;  4OO1 J;  2GLE A;  4UAZ A;  3PR5 B;  2G09 A;  8ICA A;  4B9T A;  4EX6 A;  2B0C A;  4JMU A;  3JPQ A;  2ZXI A;  1ZD3 A;  3QUT A;  1F0M A;  1TK5 A;  3QU7 A;  3PW2 A;  1RQN A;  2W8L A;  1SL2 A;  5E79 U;  4QZH A;  5CA7 A;  3TQ1 A;  2W03 A;  2R8J A;  5GTI U;  2YMP A;  2HBL A;  4ECV A;  4DS4 A;  4J9M A;  1NKE A;  2ISO A;  2O6K A;  4IL6 U;  4O9M A;  7ICK A;  3ED5 A;  2K8A A;  3IM1 A;  2YQE A;  4F4Z A;  1ZQG A;  1ZJM A;  1X9X A;  3QYP A;  5KG0 A;  1X6J A;  5J0W A;  2XIC A;  1QSL A;  1VJ5 A;  4NM1 A;  4EEK A;  2EAP A;  1KBU A;  9ICI A;  1NJZ A;  5ALG A;  3UMB A;  2ZIU B;  5AI4 A;  2NV3 A;  4KLO A;  2JZB B;  3L3F X;  2JR5 A;  2QLT A;  3WKB A;  3RJH A;  2YN4 A;  1OW5 A;  3BJY A;  2KIW A;  3RB0 A;  1FFU A;  4YD1 A;  2BCQ A;  3RB4 A;  4RQ5 A;  1QQ5 A;  4ZOH C;  2M9N A;  2LBO A;  2FPK A;  1J97 A;  3PO5 A;  4Z6D A;  1ZQC A;  2XID A;  3NRZ A;  1JN3 A;  2XC9 A;  1BPY A;  1SGG A;  1L7P A;  5AHX A;  4KLQ A;  1SWV A;  4UB2 A;  3TKA A;  1ZOL A;  2QB1 A;  5L9X A;  4KLD A;  2ZIW B;  3IRU A;  1FO4 A;  5KG2 A;  2KN7 A;  3WK8 A;  3K75 D;  9ICH A;  3H0M B;  4RUA A;  3MAB A;  4EX7 A;  4JV1 A;  2HHX A;  1LVH A;  4M47 A;  4F2R A;  1JRP A;  4C80 A;  2XGQ A;  3NVY A;  1XSL A;  1QLN A;  3BS7 A;  4QJF B;  4KLJ A;  2A1A A;  7ICJ A;  2MAX A;  4F72 A;  3M8R A;  4LVS A;  1U47 A;  5HR7 A;  2A19 A;  1Z00 A;  1S0O A;  5EE3 A;  3NVW A;  1L5U A;  3MDA A;  9ICF A;  2G08 A;  4IQT A;  1SZH A;  5AM5 A;  1BNO A;  4C7Z A;  2PFP A;  2HVI A;  1ZQN A;  5DLF A;  2IHN A;  1S10 A;  2HHS A;  4EEY A;  9ICW A;  4DSL A;  3QNM A;  2CN1 A;  5J0O A;  2G06 A;  3EWA A;  1J2N A;  1HJP A;  2JZB A;  5ALW A;  1QSS A;  3UXN A;  4X5V A;  4O5E A;  5DB9 A;  4XQ8 A;  2BCS A;  4IR9 A;  2MSN A;  2F77 X;  2K89 A;  5F9N A;  3BQ0 A;  3TAR A;  1K5O A;  1ZRN A;  4RQ3 A;  1KKX A;  3EPG A;  2C22 A;  3FC4 A;  4O3S A;  4R65 A;  2GH1 A;  3F5A A;  4LZD A;  3N7S C;  2G5I B;  3HJE A;  4DQR A;  2EH9 A;  5HHI A;  4I27 A;  2P6U A;  3GIK A;  1K1Q A;  1O08 A;  3ZD9 A;  1T3Q A;  4QZ8 A;  4R64 A;  5KFS A;  1KLN A;  2DBY A;  4O0I A;  2FMP A;  5AM0 A;  4DEZ A;  4Q45 A;  4I29 A;  4ELU A;  4QZB A;  3V7K A;  4I2J A;  4OJL A;  4NM2 A;  9ICG A;  2VA3 A;  4F4K A;  4DF8 A;  2BQ3 A;  4DQP A;  1JXL A;  5EE0 A;  2A3V A;  1SWW A;  2HVH A;  2LI6 A;  3N28 A;  2E1E A;  3BZC A;  8ICI A;  2LYA A;  2KD1 A;  4B9U A;  2KFN A;  3IG5 A;  4R66 A;  4R8U B;  2HW3 A;  5CJ7 A;  2NO4 A;  1U49 A;  3E58 A;  3SAG A;  5JU5 A;  5DG9 A;  3GV5 B;  2DPI A;  2BCR A;  2XY6 A;  4DO9 A;  2FI1 A;  4CRX A;  5KG3 A;  3OJS A;  4JUZ A;  1BGX T;  2HCF A;  1ZQW A;  4F8R A;  1N60 A;  2ZIV B;  1SV0 A;  2G5H B;  4M9H A;  2I6X A;  4YG2 A;  4U6P A;  1UPH A;  4RQ8 A;  3L4P A;  1CEZ A;  1OXJ A;  5KFR A;  4MHV A;  3HKZ F;  3KFU F;  4I2G A;  1WUD A;  2FLL A;  4ECW A;  1X40 A;  2KKV A;  4YVZ A;  1YZ6 A;  5EWE A;  4M0A A;  2F8L A;  2KKP A;  4GC6 A;  2ASL A;  4RT3 A;  4RPX A;  3RH5 A;  2ESE A;  3ZDD A;  2A1J B;  4M6W A;  1ZQP A;  3V7J A;  3RAX A;  3I1Y A;  1SIJ A;  3VC8 A;  4ED8 A;  3WK4 A;  7ICT A;  1SKS A;  8ICV A;  8ICN A;  1Z4O A;  3I28 A;  5CEH A;  5AIA A;  4Q8F A;  3WK5 A;  5ALI A;  5KFQ A;  3FDS A;  2AGP A;  2FPL A;  2FLN A;  4EEN A;  2NRZ A;  1SKW A;  2EAM A;  2MA1 A;  4DL7 A;  2LPE A;  4I2I A;  2F76 X;  3PW0 A;  3MDC A;  3A0B U;  3ETR A;  4Y2R A;  5AKH A;  4UAS A;  3RJJ A;  4G9B A;  4ECZ A;  3CRX A;  4FBU A;  3AL0 B;  2BQU A;  2MUT B;  4JK1 A;  1TK8 A;  1S9F A;  9ICJ A;  5KL1 B;  2ZXH A;  1N63 A;  2I9G A;  5C0Y A;  4UAW A;  5ALX A;  3KHG A;  3HPO A;  4KLT A;  1XWL A;  1XO1 A;  4PHA A;  1NK4 A;  9ICB A;  5KT7 A;  2IBK A;  1ZQB A;  3S6J A;  1NKC A;  2VIX A;  2J6T A;  4FZL A;  2IOF K;  3WK6 A;  4CDG A;  4EZ9 A;  5KFZ A;  3PSP A;  3OHB A;  1TAU A;  1ZET A;  4BX9 C;  4BWJ A;  2K8B B;  4C4T A;  1ZQH A;  1UT5 A;  3RBE A;  5J2B A;  3AEV A;  2W55 A;  1XSN A;  1Z19 A;  3VCB A;  5L1J A;  4MF2 A;  3PX6 A;  2DUY A;  2KSO A;  1NJX A;  3M8S A;  2UVR A;  3CNH A;  2GOL A;  2QB0 A;  3HWT A;  2DWQ A;  9ICC A;  5J2C A;  3HW8 A;  5KFV A;  8ICP A;  1LB2 B;  2VJ5 A;  2F8K A;  4DFM A;  3CW2 C;  4IC9 A;  1P7D A;  5EWG A;  4B9V A;  4QZG A;  5EE9 A;  2EZY A;  4FO6 A;  4DSI A;  1YT3 A;  3C2M A;  5ALL A;  3PX4 A;  4J9O A;  3AN1 A;  5ALO A;  2OYY A;  2FDR A;  3QU4 A;  2D3D A;  1TAQ A;  1L8L A;  3RJG A;  7ICI A;  1T4G A;  1Q46 A;  3SMV A;  5KT2 A;  4NLG A;  3KBB A;  7ICP A;  5CWR A;  1JXE A;  5EE1 A;  1PUZ A;  5DKW A;  1QQ6 A;  4DFD A;  3M9O B;  3RRG A;  5ALY A;  1RXV A;  3GZF A;  1VDV A;  3SV3 A;  4NV0 A;  2KTQ A;  2QKQ A;  3UMC A;  4UQG A;  3RR8 A;  4LJX A;  3LWM A;  1RYS A;  4RQ6 A;  4UBB A;  2ZJ5 A;  5KT6 A;  4EBC A;  2ISP A;  5DLG A;  3V6J A;  2HOF A;  3RF9 A;  9ICN A;  4USA A;  4HYK A;  5DDY A;  4TUR A;  2YB1 A;  3NRW A;  2E5S A;  2K4H A;  3GU3 A;  2C28 A;  2RQ5 A;  2DF4 B;  4OJP A;  5J0P A;  4Q44 A;  4BWM A;  4HAI A;  3GFK B;  3N7P D;  4F5O A;  4CGZ A;  2D6F C;  1ZJN A;  4DFP A;  5AIC A;  3PSF A;  3NUQ A;  2E3T A;  5AK6 A;  1ZQM A;  2KHV A;  2F3N A;  3UXO A;  4DFK A;  4NLK A;  1QSY A;  4C8O A;  7ICS A;  1Z1V A;  2KK0 A;  4NLB A;  2OCE A;  3Q8R B;  5L1L A;  1ZQL A;  2XO7 A;  3H8S A;  1JMS A;  8ICH A;  2Y9T A;  2KZZ A;  1ZQK A;  1MA7 A;  5F9L A;  4RNO A;  5CHG A;  1S97 A;  2BZF A;  1Q8K A;  4PGX A;  4P0Q A;  4E0D A;  3ISB A;  2WAQ C;  5KAF U;  3OTQ A;  5J2J A;  3HRD D;  4DSE A;  2KJ9 A;  5EOZ A;  2H3Z A;  5JTI A;  3NTU A;  4I2B A;  3C5F A;  3EYZ A;  2W11 A;  1S0V A;  4WJ3 B;  8ICZ A;  8ICK A;  1UHU A;  3RFA A;  3PW4 A;  1N2X A;  4M9N A;  3GIL A;  1O03 A;  4TQS A;  4DL3 A;  2JEJ A;  4EZ6 A;  4J9P A;  5L1K A;  3QU5 A;  5AI8 A;  4QZC A;  2Y0S F;  4I2H A;  5ALN A;  1X66 A;  3LK9 A;  2ZJ8 A;  4RQ0 A;  3WKD A;  5KG7 A;  4OJO A;  7ICQ A;  2AXT U;  1B4F A;  1GO3 F;  1Z00 B;  1ZQQ A;  2BCV A;  4B9L A;  2K8C B;  1S0N A;  4KTQ A;  3UQ2 A;  1RM6 C;  1NJY A;  1ZQU A;  5DGB A;  4IQV A;  1JI7 A;  5IIK A;  3SQI A;  2KVC A;  3AQE A;  1L3U A;  1D8Y A;  1LKY A;  3JPO A;  4EEL A;  3Q8M A;  1JRO A;  2FE9 A;  2RDJ A;  4P4O A;  2W9B B;  1S0M A;  2F44 A;  3SI8 A;  2WF7 A;  4I2D A;  4DQI A;  4C4R A;  2H5X A;  2XY5 A;  4FE3 A;  4F5N A;  1JAL A;  4PGQ A;  5ALR A;  2HHU A;  5AKX A;  4Y2P A;  4TUP A;  4YQW A;  4F3O A;  2HSZ A;  2ODG A;  4ECU A;  4Y2S A;  1S5L U;  4ECQ A;  2WF5 A;  3TAC B;  4UB5 A;  5KFW A;  4MEY A;  1COK A;  2KJ5 A;  3H0L B;  5KAI U;  1L8O A;  5KNI A;  8ICX A;  8ICS A;  1ZXI A;  2CPR A;  4F91 B;  5D46 A;  3QZ8 A;  1HUO A;  4RT2 A;  1KN5 A;  3MFI A;  2A1J A;  4XA5 A;  1DK3 A;  1ARO P;  1L6N A;  3PX0 A;  1NK9 A;  2ES6 A;  1RXW A;  4J9N A;  4C8M A;  3H8W A;  4US9 A;  4GXK A;  7ICF A;  2KJ8 A;  4C7Y A;  5J0X A;  4BGD A;  2Y9U A;  3D2Q A;  4DQS A;  2OXO A;  3C23 A;  3T79 A;  3RAQ A;  4I28 A;  4CF5 A;  4QZD A;  4RNM A;  4P4P A;  1X42 A;  5J2D A;  5KFI A;  3FAH A;  4YP3 A;  3C29 A;  3ORY A;  1ZQR A;  2H3I A;  2EZZ A;  5ALP A;  5KT5 A;  1F5S A;  4Z6E A;  7ICE A;  5DG7 A;  5KFF A;  2W04 A;  3RJI A;  3A0H U;  2PFQ A;  4P4M A;  1L7M A;  5KFU A;  3TAQ A;  2KV2 A;  1Q3V A;  5AK5 A;  3JPS A;  2K4E A;  3NGD A;  5DB7 A;  1ZQI A;  4YCX A;  3OGU A;  3N4M B;  3ONN A;  7ICH A;  3N7R C;  2GO7 A;  8ICQ A;  1IM4 A;  1C20 A;  5AKJ A;  3FYH A;  1A6S A;  1KEJ A;  1KL9 A;  4YXJ A;  8ICU A;  3RJF A;  3F2D A;  1WCN A;  3H8J A;  4UB3 A;  2HHW A;  2HBJ A;  4CE6 A;  4RUC A;  4J9Q A;  2BKE A;  3LYS A;  4IQW A;  3BQ2 A;  1DGJ A;  4ED0 A;  2IMW P;  4CCH A;  4F92 B;  5KTQ A;  4JV2 A;  5AKG A;  2KIC A;  5AK3 A;  4ECS A;  3Q8S B;  3H0R B;  1UA0 A;  4XUS A;  4ED7 A;  4C8K A;  4DOA A;  2ALZ A;  1KDH A;  4B9S A;  4UAY A;  5AKI A;  5D4B A;  4NLN A;  4OCZ A;  5KFA A;  4NLZ A;  1V38 A;  4QIW C;  3BQ7 A;  2OM6 A;  1K1S A;  4F93 B;  3QZ7 A;  3F5E A;  9ICL A;  4UB6 U;  2WB1 F;  3SEI A;  4KX3 A;  4DL2 A;  4FFD A;  3UM9 A;  3MR6 A;  4QIW F;  2DL0 A;  3ZDC A;  3QUQ A;  2GWS A;  4Y2J A;  5DB8 A;  4YD2 A;  1ZQZ A;  2ZUB A;  5KFN A;  1B43 A;  2YML A;  1KFD A;  4M9J A;  3H4D A;  2DPJ A;  4OD0 A;  1DOQ A;  3NVV A;  3EZ5 A;  4PJ0 U;  1XU4 A;  2PXI A;  2UVU A;  2AHO B;  5J0S A;  5J2H A;  4EBD A;  1D8B A;  4F4Y A;  1U4B A;  1DGS A;  3CYM A;  1JUD A;  2H3Q A;  3IHQ B;  4Y2X A;  3J81 j;  8ICF A;  5J2F A; 
#chains in the Genus database with same CATH homology
 3PSF A;  3NUQ A;  3ONN A;  1PVP A;  3N7R C;  1TAM A;  1Z1B A;  1A0P A;  1KBU A;  2KHV A;  4BX9 C;  2F2A B;  2K8B B;  1PVR A;  4FE3 A;  2CN1 A;  2ZIV B;  2Z7J A;  4PL2 A;  4PL1 A;  2RRD A;  2G06 A;  2G5H B;  3IP4 B;  1F44 A;  2ZIU B;  4NLB A;  3F53 A;  2NV3 A;  3M7D A;  1A6S A;  4BUG A;  4U6P A;  4P0P A;  1UPH A;  1Z19 A;  4P0P B;  3VCB A;  3L3F X;  3M6Z A;  2DQN B;  4OJ6 A;  4BJQ A;  3SAF A;  3ICX A;  4GFJ A;  3HKZ F;  1MA7 A;  3KFU F;  4C0Z A;  2HMX A;  2F77 X;  2ZIV A;  3F2D A;  1WUD A;  2GOL A;  2KIW A;  2YX8 A;  3CP8 A;  3MGV A;  2K89 A;  3PST A;  2HBJ A;  2KKV A;  3AQF A;  3O0F A;  4P0Q A;  3D2N A;  2F8L A;  2KJ5 A;  2KKP A;  3H0L B;  3E0F A;  2H3F A;  3LYS A;  2WB1 C;  3F2B A;  2M0N A;  3C28 A;  5KL8 B;  3OPX A;  2WAQ C;  5T14 A;  2JMG A;  2KIC A;  2VJ5 A;  2LBO A;  3VC8 A;  3HKZ C;  2KHQ A;  4IC9 A;  3IG8 A;  1P7D A;  2HBM A;  2JHD A;  3IN5 A;  2CPR A;  4A8E A;  2GH1 A;  3H0R B;  3F5A A;  2KJ9 A;  4U7C A;  2H3Z A;  3N7S C;  3F2C A;  4P0Q B;  1YT3 A;  2Q4T A;  2XID A;  4NWI A;  2YB4 A;  1HIW A;  4FZM A;  2ZIX A;  2PMZ C;  2G5I B;  1ECW A;  1L6N A;  5A0L A;  2OYY A;  1PVQ A;  4WJ3 B;  2KNJ A;  4QIW C;  4OO1 J;  3LVV A;  3RFA A;  4NLC A;  2OM6 A;  4FZN A;  2KOB A;  3F5E A;  3SMV A;  2KJ8 A;  2ZIW B;  3M6K A;  1IIP A;  2HOQ A;  2MA1 A;  2WB1 F;  2ZG6 A;  1NZB A;  1DRG A;  2Y0S C;  2G09 A;  3K1Z A;  2F76 X;  4KX3 A;  4OJL A;  3LVW A;  1ZQ1 C;  2ZIU A;  3H0M B;  4QIW F;  3D2Q A;  2HOI A;  2RP5 A;  4O3M A;  2Y0S F;  2VKQ A;  2A3V A;  2JGA A;  2JH7 A;  4JMU A;  4KMO B;  2ZXI A;  3GZF A;  4AYB F;  1XO0 A;  3CRX A;  2N1R A;  2OXO A;  2E1E A;  2KEY A;  4NV0 A;  1OUQ A;  2ZIW A;  2LYA A;  3T79 A;  2K4I A;  2KD1 A;  3AL0 B;  1XNS A;  2G07 A;  2LKY A;  2R18 A;  2H3V A;  2OH2 A;  1T94 A;  4ICA A;  3SAH A;  4QJF B;  3PZP A;  3IG5 A;  4ACO A;  5KL1 B;  2ZXH A;  4OJO A;  1Q3U A;  4QNL A;  1GO3 F;  2LYB A;  2W03 A;  3C29 A;  2G0A A;  2W7P A;  5C0Y A;  2PMZ F;  2H3I A;  3ALR A;  2E1F A;  3RF9 A;  3SAG A;  1CRX A;  4KX5 A;  2HBL A;  2HOF A;  2K8C B;  5HR7 A;  2ZIX B;  2JH1 A;  2BDU A;  2RHF A;  1URJ A;  2YB1 A;  2E5S A;  2MRL A;  3NRW A;  4AYB C;  2LHT A;  3KZX A;  2K4H A;  2W04 A;  3GU3 A;  2DGZ A;  3SQI A;  1ED1 A;  2KVC A;  1D8B A;  5CRX A;  3AQE A;  3D2S A;  2G08 A;  2DF4 B;  4OJP A;  4CRX A;  2VJ4 A;  1SZH A;  2VIX A;  5HR6 A;  2HBK A;  2KV2 A;  2K8A A;  1Q3V A;  2XI9 A;  3DEE A;  4FZL A;  2WAQ F;  3CYM A;  3PSI A;  4OJ5 A;  2CRX A;  2K4E A;  2H3Q A;  3N7P D;  4CDG A;  2W7O A;  4CGZ A;  2D6F C;  1HEK A;  2XVT A;  2XIC A;  3PSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...