2F77X

Solution structure of the r55f mutant of m-pmv matrix protein (p10)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
b'MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKFWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core protein p10
publication title D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
pubmed doi rcsb
source organism Simian retrovirus 1
molecule tags Viral protein
total genus 28
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02337 Gag_p10 Retroviral GAG p10 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.490 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f77X00
2F77X 2F76X
chains in the Genus database with same CATH superfamily
5ALGA 2W54A 1QSYA 5IILA 3T5JA 4ACOA 3BQTA 1NK0A 3SD7A 3PVXA 1L3VA 2LYAA 4US9A 4ECVA 5KTQA 3RB4A 3FDSA 3UQ2A 3J81j 3T79A 3D2NA 5ALHA 3H4BA 4P4MA 1LB2B 3ZDCA 5DDMA 3N7SC 2WF8A 5J0XA 3KKAA 2KJ8A 4RQ1A 7ICMA 2KHVA 2C28A 2ZIUA 5KL8B 4OJ5A 4P0QB 4FS1A 2W7OA 1V38A 2ZG6A 3TFSA 3HW8A 2JV3A 2DPJA 1ZQPA 5L1KA 1UT8A 2L5YA 3D2SA 2BCUA 1COKA 3EWAA 7ICVA 2E8OA 3SI8A 4Z6EA 2DFLA 3M7DA 2W9CA 3QX7A 5AKGA 1TKDA 1CUKA 3I28A 1D9FA 1PK1A 3PSPA 2W43A 1X9WA 5B5EU 9ICBA 4UB3A 4HAIA 7ICUA 1DOQA 7ICQA 2BCRA 1Z3EB 4G3IA 2MSNA 4J9LA 1L3UA 5ALKA 2CPRA 2XY6A 4F50A 4C8NA 4NLZA 4TUSA 1IV8A 3MGHA 4F72A 1BNOA 4IR1A 4M6WA 4KN7A 4KLMA 2AGPA 4OJLA 4B6JA 4QZEA 1UA1A 8ICCA 3Q8MA 2C2RA 2DKZA 5KG3A 5KFRA 1O08A 3E0FA 1KRPA 2HHXA 4PJ0U 2H3VA 2ZUCA 1VLBA 1MSWD 5AKEA 2E3TA 5J2BA 3C5GA 2KFNA 2DF4B 7ICPA 2AGQA 5CRXA 3TAQA 4NXZA 4B9SA 1BPYA 4F2RA 1F5SA 3C29A 8ICSA 1KL9A 1QQ7A 3ISCA 3C28A 1U9LA 5ALRA 4G9BA 2Q0ZX 3EUB2 4KLOA 1NK6A 3F2BA 2NV3A 4I2GA 5AICA 1TAQA 9ICEA 5J2EA 1NK8A 5KFPA 1ZQAA 2B6GA 3G6XA 3WK9A 1ZQYA 2PFQA 4UAVA 5ALUA 2FMPA 4B9MA 4M2YA 1NJYA 2MU2A 9ICIA 4NLGA 3QEAZ 2ESEA 1S77D 2LMRA 2E8MA 1SKSA 3B9JA 2YB1A 2P35A 5B66U 3V7JA 2AXTU 5DLFA 4AYBF 3C2KA 4FZLA 2KKPA 2HDOA 3ALRA 2FLNA 1B22A 1Z1BA 4F93B 4E0DA 2KD1A 4Q43A 1RPLA 1Z00B 3EYZA 3FC4A 4O5EA 2OYYA 4RPYA 3RH5A 1XS9D 4BUGA 3KHGA 3QU9A 1H38A 3ZD8A 2ASJA 5DBCA 3M9NB 5JU5A 4PGQA 4DSFA 2HHVA 2D6FC 1JUDA 3GIMA 5J8YC 3F2CA 1RYRA 3E2EA 8ICVA 5J0QA 2HBLA 1ZQLA 2HSZA 3PW2A 2E8NA 2H5XA 4QZCA 3RB6A 4DF4A 1QTMA 4YMOA 4CE6A 3K75D 1PVRA 3SENA 3MC1A 3U26A 4J9MA 3IRUA 4UAWA 2KJ5A 1U49A 4CRXA 2OHFA 5DBAA 3GZFA 4OO1J 7ICKA 2YX8A 2PFPA 3QUBA 3F5EA 4J9RA 2BCVA 4CF5A 4IR9A 1L5UA 2DKXA 2Y1IA 3H0RB 4IRDA 3HILA 3CYMA 1TV9A 4P2HA 5KNIA 3QEBZ 1JN3A 5A0LA 2BCSA 4GFJA 4F71A 2LKYA 5KT5A 4M9JA 2BDPA 2ZXIA 5ALNA 5JTIA 3ISBA 3RJHA 4IQTA 2G5IB 5GTIU 1ZQCA 2R8IA 4DOBA 7ICEA 1MQ3A 2W3RA 5EOZA 4PGXA 2A3VA 5KFYA 2W9AA 5AHXA 3MDAA 1S0VA 1PZNA 2VA3A 1X2IA 4O3QA 4KLIA 4MHVA 2OWOA 3JPSA 2NRXA 1ZQNA 2WB1F 1NJZA 3AU6A 4RQ7A 1BPZA 2I6XA 3CW2C 4Y2QA 3RH4A 4UB4A 5KAIU 2NRWA 4BXOA 4I2EA 4O3OA 3PSTA 5KT7A 2HVHA 4RQ4A 3NASA 2NYVA 4DQQA 2KTQA 3KZXA 3T5HA 3RJKA 3K1ZA 2LYHA 8ICNA 3HKZF 1RQLA 3SZ2A 2OCEA 3GU3A 3Q8RB 3H7IA 3N97B 2P6RA 9ICGA 2W9MA 3IHQB 4YXMA 5KFTA 5KFCA 2B21A 1BPEA 1ZETA 5J2DA 1HUOA 3TADA 4ECYA 3TFRA 1ZQQA 3PX4A 2VIXA 4Q44A 4DQIA 1ZQFA 1ZQRA 5HHIA 2F2AB 4CCHA 1NK4A 2R8KA 1NI3A 1KQQA 3RJIA 4MF8A 4J9NA 5KFOA 3QUCA 3PO4A 8ICUA 5DB8A 7ICNA 1JXLA 3TQ1A 5J2FA 1WG8A 4O3NA 3BJYA 2BPFA 3SYZA 1V9PA 2JH7A 2LBOA 1RYUA 3TKAA 4HYKA 3GILA 2UVRA 5ALYA 4DF8A 1X40A 3EPIA 2EAMA 1TAMA 1GO3F 3H8WA 5KG1A 2JH1A 2ATLA 4PHAA 3IV6A 2ZIXB 1KFTA 5DB7A 2W8LA 3C1ZA 4TURA 2VJ4A 8ICAA 2K4IA 5KFXA 5KFWA 4WJ3B 3BS7A 1L7PA 4ECXA 1RDFA 3M9OB 4TUPA 5BOMA 3GV7B 9ICHA 4LJXA 2D3DA 3PSIA 1NKEA 5TISU 4PZNA 2FPMA 3ETLA 4AP9A 3V6JA 3RRGA 3RFAA 1N60A 5D49A 4F2SA 2PFOA 4O3MA 2EZZA 5CEHA 2G5HB 1DK2A 1ZQHA 4UB1A 3H40A 2UVVA 3RR7A 2ISOA 2LM1A 1CRXA 5ALDA 2XO7A 4GXKA 1NKBA 4XA5A 1T4GA 1LVHA 5DGAA 3LDAA 1N5WA 5DB6A 3EZ5A 2A1AA 4DSEA 5AK5A 3CNHA 4RZRA 4R64A 2J6UA 4DL5A 1S8OA 8ICQA 4Y2UA 2PI4A 4ZH4A 1WWUA 2W9BB 1SV0A 1WYGA 4J9QA 5BPCA 2WB1C 1A77A 2AJQA 4IQWA 4M9GA 3ICXA 4QWDA 1S0NA 3SMVA 2R8JA 2OEHA 5BOLA 4NL9C 2F1HA 1ZJMA 4Y2RA 2W3SA 4YMMA 5KT2A 3PV8A 4EENA 4GLXA 1NOMA 8ICMA 2AHOB 9ICFA 3VC8A 4QWEA 2W9CB 3L5KA 1N62A 5AKLA 4DLGA 4YD1A 4M0AA 2Y0SF 5J2AA 1ZQKA 1PK1B 3QYPA 3VCBA 3JPQA 1A0PA 4TQRA 1N5XA 3HKZC 2A1JA 3BQ1A 2BGWA 3N28A 3C2LA 4C7YA 4KTQA 3PW0A 8ICXA 1Q46A 2KHQA 1WWVA 5DG8A 1J2NA 3TARA 4DS4A 5ALIA 1T7PA 1KKXA 3PW4A 3ZDDA 4I2CA 2F3NA 3M9MB 2KG5A 1SXDA 3ETRA 3H0MB 4M6WB 2NRVA 2P66A 2PMZF 2ZJ5A 3WKBA 1L8LA 2JGAA 2MUTA 1ZQEA 4C7ZA 5J2IA 2RQ5A 3OPXA 4FZMA 2G07A 3JPRA 1RM6C 2YY6A 4J9PA 4F4XA 3QE9Y 5DG7A 2MRLA 2YMLA 1OW5A 2HBKA 2WF6A 4F4KA 1Y88A 3Q8SB 4Y2JA 4CF4A 1JRPA 5G5GA 5AIAA 5AM1A 1AROP 5L1IA 3HPOA 4IS7A 5AKYA 5J0SA 1MC8A 1S97A 1KFSA 2EZYA 4RPXA 2XICA 4RT3A 9ICCA 2V4QA 9ICPA 1HUZA 1NJXA 4NLNA 4F8RA 1KTQA 1ZQTA 4DWIA 2VA2A 2AH5A 4IRCA 4CDGA 1L7NA 2W7PA 5AM2A 3PZPA 4Q45A 2W9BA 4YXJA 5L1MA 1B0XA 3BQ7A 2Q4TA 1L7OA 5C5JA 5KG0A 4RQ3A 2D8CA 3NVZA 2KVCA 4MEYA 1ZXIA 3GFKB 4O5CA 3Q8KA 8ICIA 4I2BA 4NLKA 3AU2A 2KVSA 2IHNA 8ICZA 8ICLA 5TZVA 5AKIA 2H3IA 5ALTA 8ICPA 2IOFK 5ALPA 2KN7A 3PX0A 5AI6A 2ZTEA 1TK5A 2JEFA 2GLEA 5KT4A 2HW3A 3M1YA 1TK0A 4F91B 1NK9A 3JPTA 4Z6CA 4KN4A 5D46A 1ZRNA 3SQIA 4NY8A 3F53A 1NNLA 1U48A 5AK4A 3ED5A 4ELVA 1AQ6A 4YG2A 4JV1A 5DBBA 2FMQA 8ICEA 3GIKA 5G5HA 2LYBA 3QU7A 7ICFA 1FFVA 3KHRA 1N56A 4EYIB 3NUQA 4KLUA 4FS2A 2ODGA 3M6ZA 1JIHA 3MFHA 4UB5A 3KTQA 4JV0A 2LI6A 1M6YA 4QZAA 2KICA 1ZQJA 1QSSA 2ZUBA 5ALLA 3AQEA 5AI0A 3UPQA 3V7LA 5AKZA 3N7PD 1J97A 4ELUA 5AKKA 2LHTA 2K8CB 1NJWA 5KFMA 4I2JA 2HOIA 2FJ6A 4GXJA 4I29A 1KN5A 4DL7A 3IG8A 1D8YA 2WFAA 5KG4A 3ZDAA 3G6VA 1B4FA 4DQRA 2R8HA 3QU4A 4ELTA 1PVPA 2JMGA 4DEZA 5AI5A 4IQUA 5J0TA 1XU4A 5KFFA 4JB3A 1LV5A 3AM9A 2DWQA 1WCLA 3KBBA 4ED0A 5H2FU 4F5NA 4YFKA 4K4GA 1VDVA 4KITB 5KFJA 2K4HA 1SZPA 5KFHA 1C20A 1K1SA 3IM1A 4RQMA 4B9LA 4NL9A 3F5AA 1SV4A 4U6PA 3QUQA 3SR6A 4B9NA 3ONNA 4ED1A 9ICQA 1JI7A 3IN5A 3KD3A 2NRZA 4NWIA 4F3OA 4USAA 1ZQGA 1UHUA 3PW7A 4BXOB 2GWSA 7ICRA 2N1RA 1BPBA 5J0RA 2JRZA 5L1LA 4FFDA 4DQSA 3WKCA 4C80A 4EX7A 3WK6A 4C4RA 3T5LA 3V7KA 4OCZA 4F4WA 1J2MA 3PY8A 5AKJA 1U47A 4QJFB 1X9MA 1PVQA 1DRGA 4Y2TA 2BPCA 2G08A 5KFAA 2ALZA 3OTQA 7ICTA 1JMSA 5CHGA 3SEIA 4RQ8A 4A8EA 2HHWA 2K8AA 1JALA 3H8SA 1S10A 3T5KA 4JUZA 5KFLA 3QU5A 5JRTA 1ZQOA 4BWMA 1T8EA 5KFIA 5DB9A 2DGZA 4O3PA 3MR2A 1SWWA 4PH5A 3L4PA 4C4TA 4C8OA 1XSLA 2FLLA 2KFZA 4Y2XA 2VKQA 4O9MA 4O0IA 1WUDA 1SXEA 3I1YA 3V72A 1B43A 4Q8FA 3JPNA 5F9LA 5J0WA 5KAFU 2WF7A 4KX3A 1XO0A 1KSPA 4RNMA 4US8A 4QIWF 2J6SA 4OD0A 1RYSA 5IIJA 3RBDA 3N7RC 8ICHA 2BDUA 4DL4A 3NTUA 3A0BU 4YP3A 1S76D 4PHPA 4QW9A 5ALQA 4RQ0A 4UAYA 3TI0A 5F9NA 3WK8A 2DUYA 2CRXA 2QARB 1S0MA 2WAQF 4C4SA 9ICLA 1N2XA 3AQFA 1L3SA 1F44A 5K4LA 3Q8PB 3JPPA 1NK7A 4KLLA 3DDHA 3WKAA 1ZQVA 1UCVA 5HHHA 9ICSA 2O6KA 3GQCA 2F44A 4EZ9A 5AI9A 4O3SA 5EE3A 4RQ6A 3BQ2A 3SV4A 4QZ9A 4KMOB 3HWTA 2KOBA 3K4GA 4K4IA 2ZUDA 4RNNA 1QQ5A 1N48A 1XWLA 1FO4A 3H0LB 8ICBA 3MABA 3ISDA 1MN8A 3ORYA 5KG5A 2AQ4A 3THVA 4P0PA 1NK5A 1K5OA 2Z7JA 4YQWA 2R8GA 1ZQDA 3MDCA 9ICOA 5EWFA 2FPKA 3RJFA 4KLHA 2IOFA 1NZPA 1KEJA 2BPGA 2K89A 7ICIA 1V97A 5KFQA 5DLGA 2ZTCA 4U7CA 2KSOA 2QKQA 5KFUA 2RDJA 4UBCA 4ECUA 5HP4A 5KFSA 1SL2A 2XGPA 3RJJA 9ICUA 2WF5A 5KFVA 3PO5A 2BCQA 3KZIU 4AYBC 4RQNA 1L6NA 5CA7A 3SAHA 3PW5A 1XC9A 5HMLA 3KKAC 2HHTA 3OJUA 4QZBA 1A6SA 1HEKA 4ED7A 4P4OA 1S9FA 4R8UA 3H8MA 4PZOA 3M8SA 3MR6A 3RAXA 2IA6A 2ZIWA 4F5PA 2AQ0A 2QB1A 2A1JB 8ICJA 1FIQA 3FYHA 2XVTA 4F4YA 2DQNB 2VA8A 2QB0A 4OJ6A 1C7YA 5KFBA 1Z19A 2MAXA 3BDPA 1T3QA 2QLTA 1JX4A 4O5KA 2G0AA 1LKYA 3I76A 3LVWA 4Y2YA 1RG6A 3M8RA 1X66A 4RT2A 2Y1JA 4RUAA 3S6JA 3ZD9A 2QARA 2P6UA 1ZQWA 2F76X 4YN4A 4IL6U 4M47A 5KFDA 2XIDA 2MUTB 1D9DA 4QW8A 2XCAA 8ICRA 2HHQA 4DFDA 5CJ7A 5IIKA 8ICGA 2GO7A 5AM5A 1SKWA 2OXOA 2W03A 1N61A 1P7DA 4IC9A 1CEZA 2HOQA 5J8YA 3RF9A 4LVSA 5HR6A 3OSPA 4M9NA 1ZJNA 1KBUA 4DOAA 3LWMA 2EH9A 3RR8A 4DS5A 4DSJA 4DLEA 2ZIVA 5KG7A 1QLNA 1TFRA 4QZGA 5AM3A 1ZQBA 4J9SA 4ED8A 4Y2VA 2E1FA 3QZ8A 2JZBA 4QZDA 2F1IA 4ECSA 4Y2SA 4B9TA 8ICYA 1DGSA 4JWNA 4QWAA 2RLTA 4F5OA 4PHEA 2V9WA 4NM2A 4DSIA 5KFKA 3RJEA 4ZOHC 2HBMA 3R9KA 5CWRA 2AU0A 1KLNA 2CXYA 4QZ8A 4YR0A 2KZZA 4EELA 2W04A 2G06A 3UMCA 2GOLA 3NRZA 1X42A 4DFJA 4PPXA 2K4EA 3HP6A 1ZQMA 2JXJA 1UQVA 4BJQA 3UXPA 4TUQA 4OJOA 5ALSA 5J2GA 4EYHB 5DQIA 4I27A 9ICVA 2NO4A 4UW9A 5IINA 3AEVA 2HHSA 3SV3A 5L9XA 4R65A 4Y2PA 5AK6A 4BGDA 2HMXA 5J0YA 4KLSA 2F1JA 2IBKA 1TAUA 2OH2A 4DFKA 2JEGA 2PI5A 1X9SA 3H8JA 4R63A 1XSPA 2DL0A 4I2HA 3OHAA 2Y9UA 4EBDA 4I28A 1Z1VA 4B9UA 3UMGA 4K4HA 3ZDEA 2AGOA 2KZ3A 3BZCA 4EBCA 4RU9A 5F3XB 4RNOA 4QNLA 2BQ3A 2NRTA 4OJPA 4J03A 5KFNA 2KP7A 4FZNA 3V6HA 4DSKA 1ZD2P 1ZQIA 8ICOA 3EPGA 4MFAA 5J29A 8ICKA 2ZXHA 1ZQZA 2J6TA 3WKEA 1RXWA 2FMSA 5AI4A 2FE9A 3B0YA 3NVVA 1MA7A 1UPHA 9ICWA 4KLJA 3WU2U 2EAOA 2RRDA 3GDXA 1IIPA 4NM1A 1XSNA 4UASA 2G09A 4ICAA 4UBBA 2I1QA 5J2JA 4QZFA 1RZTA 2F77X 4C0ZA 2UVUA 2YB4A 5HNKA 5IIIA 1COOA 2ZJAA 2HI0A 4QWCA 4DFMA 5EE9A 3AN1A 2E8PA 4TQSA 3GV8B 3M6KA 7ICHA 4QZIA 5J0PA 1QQ6A 2V4RA 4YR3A 1Q3UA 3RB0A 3OHBA 5KG2A 3WK7A 1ZQUA 4M04A 3UXOA 3RBEA 4O3RA 5FP0A 2A19A 4KLDA 2E5SA 4M9LA 4XRHA 2KV2A 2C2EA 5J0UA 1DGJA 2R18A 2ZJ8A 5HR7A 1SKRA 5KFGA 4F5RA 3QNMA 4KLTA 3GV5B 5C0YA 1X9XA 4JV2A 1XO1A 3UXNA 2YTUA 4YMNA 1Q3VA 3G6YA 4Z6FA 2KZMA 2H3ZA 3BQ0A 4YVZA 2ZTDA 4RUCA 2RP5A 3LK9A 2F8KA 5DG9A 2PFNA 1ZRMA 2ISPA 5AIBA 3EW9A 4XQ8A 1BVSA 1IG6A 1ZD4A 3TADC 4F4ZA 2Y0SC 3E58A 1T3NA 2EQYA 5AM4A 4BDPA 5EE0A 4DCCA 2KE7A 3AUOA 2VJ5A 1S5LU 9ICJA 1SZHA 1XNSA 3BS5B 3RB3A 1KFDA 2KKVA 4EZ6A 4X5VA 4R66A 2LPEA 7ICLA 2W55A 3C1YA 3UM9A 3C5FA 3ZI4A 4KLGA 1ZD3A 1SGGA 1FEZA 4RQ5A 1D8LA 2PMZC 5ALVA 5IIMA 1ZYQA 4DQPA 2BZFA 1OXJA 2HCFA 5T14A 4MFCA 4P0QA 7ICGA 5EWGA 4EEYA 9ICNA 5J2HA 5DQHA 2IMWP 3QZ7A 4UAZA 1TVAA 4GIBA 4MFFA 4UATA 1ED1A 2WF9A 1U4BA 4JWMA 2HBJA 1L8OA 1D8BA 2KIVA 3MGIA 2PXIA 2ASDA 2RHFA 1TK8A 2JR5A 3MR5A 1NZBA 2ASLA 3NS1A 5KL1B 2EANA 1ZQXA 4YD2A 3TACB 4FO6A 2YMMA 4ECZA 8ICTA 9ICTA 1SL0A 2NO5A 3IG5A 1QCKA 4P0PB 2KK0A 4NV0A 4IRKA 3PMNA 3AL0B 1A76A 5ALFA 4DOCA 3F2DA 1X6IA 5AI8A 1EXNA 5DQGA 5L1JA 1S0OA 2KSOB 2FLPA 2IOHA 5J0OA 4RQ2A 2Y9TA 3PR4A 1ZQ1C 7ICJA 9ICXA 3MGVA 3AMZA 4BWJA 1RXVA 3IDWA 4P4PA 3Q8QB 1HJPA 2W11A 3LVVA 5ALXA 5D4BA 4UB2A 1DXSA 4ECTA 3RJGA 4C8LA 1SIJA 3LYSA 2W8KA 5AKHA 2HVIA 3CRXA 4YCXA 2XC9A 3TANA 2PKEA 3QUTA 9ICMA 2RDIA 3DV9A 1JXEA 2VANA 1WCNA 4J9KA 4R8UB 5ALOA 1SV0C 3BS5A 4UAUA 2ZIWB 3SAFA 2KNJA 1YZ6A 5DKWA 3NGDA 5DGBA 2QB0B 4Q8EA 3C21A 3KOOA 1N63A 5AM0A 2M9NA 1L3TA 1Z4OA 4I2DA 1LKYB 3C2MA 3PNCA 4CF3A 2BHNA 4KX5A 4ED2A 1ZOLA 2M0NA 4PL1A 1UT5A 2XY5A 3WK5A 3UQ0A 3NRWA 2WHEA 5ALEA 2K4PA 4UB6U 4FBUA 1NKCA 4EBEA 5CB1A 2MA1A 2DPIA 2BQUA 2YQEA 1K1QA 3L3FX 4QWBA 3N4MB 2BR0A 9ICAA 5J2KA 2XCPA 4KLQA 4B9VA 1V85A 2JEJA 3PSFA 4RPZA 3OSNA 3HT3A 5KFZA 3RRHA 5KT3A 2GH1A 2ZIVB 1Z00A 2JEIA 1IM4A 4IQVA 5IIOA 2EDUA 3CP8A 7ICSA 5GTHU 1U45A 2LM4A 1IXRA 4DL3A 3OGUA 2WTFA 2JZBB 1BNPA 2DBYA 2K8BB 1BGXT 5JUMA 1UA0A 2H3QA 3B0XA 1KDHA 1TE2A 3ZDBA 1QSLA 2XI9A 2I5HA 3NVYA 1SWVA 4EX6A 4NLCA 3KHLA 4DL2A 5ALMA 1RQNA 1BPDA 4PL2A 3RAQA 5AK3A 4I2AA 2EZXA 3OJSA 1O03A 2BKEA 4CNQA 4LZGA 2BQRA 1F0MA 4JK1A 4FBTA 3RH6A 4ED3A 3O0FA 1X6JA 1HIWA 4UARA 3FM9A 3KHHA 5ALWA 5CR0A 3WK4A 3MFIA 4NLBA 3BZKA 3K1RB 1SL1A 4C8KA 3FAHA 3T3FA 1Z4NA 3RTVA 5ALZA 2UVWA 1L7MA 2H3FA 4ECRA 4MEXA 3PMLA 3MBYA 4UQGA 3D2QA 4DO9A 4ECQA 5AKXA 2B0CA 4GC6A 1OUQA 3GIIA 4I2FA 4Z6DA 5HMMA 4QIWC 2FDRA 4QZHA 5J2CA 2YMQA 4C8MA 4BX9C 1MQ2A 1SB3C 4YR2A 1CI4A 1QH9A 4DL6A 1KW4A 3PX6A 5KT6A 1ZQSA 2CN1A 5E79U 4DFPA 5EE1A 5KFEA 4XUSA 2HOFA 2OM6A 4KLFA 3A0HU 2C2DA 4F92B 1Q8KA 4GC7A 4NJ8A 5DDYA 5ALJA 1JROA 1YT3A 2FI1A 2YMPA 5CP2A 3MR3A 1BPXA 2WAQC 5EWEA 3WKDA 3TAPA 2ES6A 3SAGA 9ICKA 4KLEA 1YZ7A 2KEYA 3QXGA 1T94A 3V6KA 4EEKA 2XGQA 4I2IA 2I9GA 2ZIUB 2XY7A 4FE3A 2C22A 2EAPA 4DSLA 3PR5B 3KFUF 7ICOA 1URJA 9ICRA 1ZD5A 2KIWA 4LZDA 4GXIA 4J9OA 4F5QA 8ICFA 3C23A 1FFUA 2HHUA 3GIJA 4JMUA 4PGYA 3NVWA 1PK3A 3LWLA 4M9HA 3HX0A 1ECWA 1PUZA 2IHMA 2F8LA 3HRDD 4ECWA 4CGZA 2JHDA 2ZIXA 3HJEA 2FPLA 3QU2A 2KJ9A 1DK3A 1VJ5A 3UMBA 2YN4A 4KMUA 3D6JA 4ED6A 2KMDA 4MF2A 3IP4B 2K60A 3H4DA 3DEEA 4PHDA 8ICWA 4UB8U 3JPOA 3Q8LA 2E1EA 5KG6A
chains in the Genus database with same CATH topology
3PSIA 2KHQA 2RRDA 2CN1A 1IIPA 4NWIA 3PSTA 2G09A 4ICAA 1SZHA 1XNSA 3LYSA 2HOFA 2ZIWA 2OM6A 2W04A 4ACOA 3RFAA 2H3QA 2KKVA 2G06A 3CRXA 2F77X 4C0ZA 2D6FC 4OJLA 2GOLA 3F2CA 3SQIA 2XVTA 2YB4A 2DQNB 4O3MA 2LYAA 3KZXA 3K1ZA 4OJ6A 3F53A 2K4EA 2HBLA 2N1RA 2XI9A 1Z19A 2CRXA 1YT3A 3H0MB 3HKZF 2WAQF 4BJQA 2ZIWB 3SAFA 2G5HB 4NLCA 2PMZF 2WAQC 3AQFA 2KNJA 3E0FA 3GU3A 2G0AA 3LVWA 2JGAA 4OJOA 2PMZC 1F44A 3M6KA 3SAGA 2LYBA 3OPXA 2H3VA 2G07A 4FZMA 3D2NA 4PL2A 3T79A 1PVRA 2KEYA 3NUQA 1T94A 1CRXA 3M6ZA 4QJFB 5T14A 1PVQA 2ZIUB 2F76X 4P0QA 1DRGA 1D8BA 4FE3A 3N7SC 2MRLA 1Q3UA 2G08A 2VIXA 2DF4B 2XIDA 2KJ5A 5CRXA 2KJ8A 2HMXA 2KICA 4KX5A 2HBKA 4CRXA 3KFUF 1URJA 4KMOB 2F2AB 3GZFA 2M0NA 3C29A 4PL1A 2KHVA 4OO1J 2KOBA 2OH2A 3C28A 3AQEA 2YX8A 3N7PD 3F5EA 2KIWA 1ED1A 2ZIUA 5KL8B 4OJ5A 4P0QB 3NRWA 2W7OA 4A8EA 2HBJA 2E5SA 2LHTA 3O0FA 2OXOA 2KV2A 2K8CB 2W03A 2K8AA 3H0LB 3CYMA 2NV3A 3H0RB 2R18A 2ZG6A 1HIWA 3F2BA 2HOIA 1P7DA 4IC9A 2HOQA 5HR7A 3RF9A 2XICA 5A0LA 2MA1A 2RHFA 5HR6A 4GFJA 1NZBA 3IG8A 4JMUA 5C0YA 1KBUA 2JH7A 4NLBA 2DGZA 2LBOA 4P0PA 3L3FX 3D2SA 2Z7JA 2LKYA 5KL1B 1Q3VA 2ZXIA 1PVPA 2JMGA 2H3ZA 2WB1C 1ECWA 2G5IB 2ZIVA 4CDGA 3ICXA 2F8LA 2K89A 2H3FA 4QNLA 2W7PA 2RP5A 4CGZA 3M7DA 2VKQA 4U7CA 2A3VA 3IG5A 4OJPA 3PZPA 2JHDA 2ZIXA 3SMVA 4P0PB 3PSFA 1WUDA 2Q4TA 4NV0A 2KJ9A 4FZNA 3PSPA 1TAMA 2YB1A 3D2QA 1GO3F 3AL0B 2E1FA 2K4HA 2GH1A 2ZIVB 2KVCA 1XO0A 4KX3A 3F2DA 2JH1A 3VC8A 4AYBF 2ZXHA 4FZLA 1OUQA 2KKPA 3IP4B 2ZIXB 4QIWF 4AYBC 2Y0SF 3CP8A 1L6NA 3ALRA 4QIWC 2WB1F 2Y0SC 1Z1BA 3VCBA 3SAHA 1A0PA 3DEEA 3F5AA 2VJ4A 2KD1A 2K4IA 2CPRA 3HKZC 1ZQ1C 3N7RC 4WJ3B 2HBMA 4U6PA 2BDUA 4BX9C 1UPHA 1MA7A 3MGVA 1A6SA 2H3IA 1HEKA 2E1EA 3ONNA 2OYYA 3LVVA 2K8BB 3IN5A 4BUGA 2VJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F77 X;  2F76 X; 
#chains in the Genus database with same CATH topology
 5ALG A;  2W54 A;  1QSY A;  5IIL A;  3T5J A;  4ACO A;  3BQT A;  1NK0 A;  3SD7 A;  3PVX A;  1L3V A;  2LYA A;  4US9 A;  4ECV A;  5KTQ A;  3RB4 A;  3FDS A;  3UQ2 A;  3J81 j;  3T79 A;  3D2N A;  5ALH A;  3H4B A;  4P4M A;  1LB2 B;  3ZDC A;  5DDM A;  3N7S C;  2WF8 A;  5J0X A;  3KKA A;  2KJ8 A;  4RQ1 A;  7ICM A;  2KHV A;  2C28 A;  2ZIU A;  5KL8 B;  4OJ5 A;  4P0Q B;  4FS1 A;  2W7O A;  1V38 A;  2ZG6 A;  3TFS A;  3HW8 A;  2JV3 A;  2DPJ A;  1ZQP A;  5L1K A;  1UT8 A;  2L5Y A;  3D2S A;  2BCU A;  1COK A;  3EWA A;  7ICV A;  2E8O A;  3SI8 A;  4Z6E A;  2DFL A;  3M7D A;  2W9C A;  3QX7 A;  5AKG A;  1TKD A;  1CUK A;  3I28 A;  1D9F A;  1PK1 A;  3PSP A;  2W43 A;  1X9W A;  5B5E U;  9ICB A;  4UB3 A;  4HAI A;  7ICU A;  1DOQ A;  7ICQ A;  2BCR A;  1Z3E B;  4G3I A;  2MSN A;  4J9L A;  1L3U A;  5ALK A;  2CPR A;  2XY6 A;  4F50 A;  4C8N A;  4NLZ A;  4TUS A;  1IV8 A;  3MGH A;  4F72 A;  1BNO A;  4IR1 A;  4M6W A;  4KN7 A;  4KLM A;  2AGP A;  4OJL A;  4B6J A;  4QZE A;  1UA1 A;  8ICC A;  3Q8M A;  2C2R A;  2DKZ A;  5KG3 A;  5KFR A;  1O08 A;  3E0F A;  1KRP A;  2HHX A;  4PJ0 U;  2H3V A;  2ZUC A;  1VLB A;  1MSW D;  5AKE A;  2E3T A;  5J2B A;  3C5G A;  2KFN A;  2DF4 B;  7ICP A;  2AGQ A;  5CRX A;  3TAQ A;  4NXZ A;  4B9S A;  1BPY A;  4F2R A;  1F5S A;  3C29 A;  8ICS A;  1KL9 A;  1QQ7 A;  3ISC A;  3C28 A;  1U9L A;  5ALR A;  4G9B A;  2Q0Z X;  3EUB 2;  4KLO A;  1NK6 A;  3F2B A;  2NV3 A;  4I2G A;  5AIC A;  1TAQ A;  9ICE A;  5J2E A;  1NK8 A;  5KFP A;  1ZQA A;  2B6G A;  3G6X A;  3WK9 A;  1ZQY A;  2PFQ A;  4UAV A;  5ALU A;  2FMP A;  4B9M A;  4M2Y A;  1NJY A;  2MU2 A;  9ICI A;  4NLG A;  3QEA Z;  2ESE A;  1S77 D;  2LMR A;  2E8M A;  1SKS A;  3B9J A;  2YB1 A;  2P35 A;  5B66 U;  3V7J A;  2AXT U;  5DLF A;  4AYB F;  3C2K A;  4FZL A;  2KKP A;  2HDO A;  3ALR A;  2FLN A;  1B22 A;  1Z1B A;  4F93 B;  4E0D A;  2KD1 A;  4Q43 A;  1RPL A;  1Z00 B;  3EYZ A;  3FC4 A;  4O5E A;  2OYY A;  4RPY A;  3RH5 A;  1XS9 D;  4BUG A;  3KHG A;  3QU9 A;  1H38 A;  3ZD8 A;  2ASJ A;  5DBC A;  3M9N B;  5JU5 A;  4PGQ A;  4DSF A;  2HHV A;  2D6F C;  1JUD A;  3GIM A;  5J8Y C;  3F2C A;  1RYR A;  3E2E A;  8ICV A;  5J0Q A;  2HBL A;  1ZQL A;  2HSZ A;  3PW2 A;  2E8N A;  2H5X A;  4QZC A;  3RB6 A;  4DF4 A;  1QTM A;  4YMO A;  4CE6 A;  3K75 D;  1PVR A;  3SEN A;  3MC1 A;  3U26 A;  4J9M A;  3IRU A;  4UAW A;  2KJ5 A;  1U49 A;  4CRX A;  2OHF A;  5DBA A;  3GZF A;  4OO1 J;  7ICK A;  2YX8 A;  2PFP A;  3QUB A;  3F5E A;  4J9R A;  2BCV A;  4CF5 A;  4IR9 A;  1L5U A;  2DKX A;  2Y1I A;  3H0R B;  4IRD A;  3HIL A;  3CYM A;  1TV9 A;  4P2H A;  5KNI A;  3QEB Z;  1JN3 A;  5A0L A;  2BCS A;  4GFJ A;  4F71 A;  2LKY A;  5KT5 A;  4M9J A;  2BDP A;  2ZXI A;  5ALN A;  5JTI A;  3ISB A;  3RJH A;  4IQT A;  2G5I B;  5GTI U;  1ZQC A;  2R8I A;  4DOB A;  7ICE A;  1MQ3 A;  2W3R A;  5EOZ A;  4PGX A;  2A3V A;  5KFY A;  2W9A A;  5AHX A;  3MDA A;  1S0V A;  1PZN A;  2VA3 A;  1X2I A;  4O3Q A;  4KLI A;  4MHV A;  2OWO A;  3JPS A;  2NRX A;  1ZQN A;  2WB1 F;  1NJZ A;  3AU6 A;  4RQ7 A;  1BPZ A;  2I6X A;  3CW2 C;  4Y2Q A;  3RH4 A;  4UB4 A;  5KAI U;  2NRW A;  4BXO A;  4I2E A;  4O3O A;  3PST A;  5KT7 A;  2HVH A;  4RQ4 A;  3NAS A;  2NYV A;  4DQQ A;  2KTQ A;  3KZX A;  3T5H A;  3RJK A;  3K1Z A;  2LYH A;  8ICN A;  3HKZ F;  1RQL A;  3SZ2 A;  2OCE A;  3GU3 A;  3Q8R B;  3H7I A;  3N97 B;  2P6R A;  9ICG A;  2W9M A;  3IHQ B;  4YXM A;  5KFT A;  5KFC A;  2B21 A;  1BPE A;  1ZET A;  5J2D A;  1HUO A;  3TAD A;  4ECY A;  3TFR A;  1ZQQ A;  3PX4 A;  2VIX A;  4Q44 A;  4DQI A;  1ZQF A;  1ZQR A;  5HHI A;  2F2A B;  4CCH A;  1NK4 A;  2R8K A;  1NI3 A;  1KQQ A;  3RJI A;  4MF8 A;  4J9N A;  5KFO A;  3QUC A;  3PO4 A;  8ICU A;  5DB8 A;  7ICN A;  1JXL A;  3TQ1 A;  5J2F A;  1WG8 A;  4O3N A;  3BJY A;  2BPF A;  3SYZ A;  1V9P A;  2JH7 A;  2LBO A;  1RYU A;  3TKA A;  4HYK A;  3GIL A;  2UVR A;  5ALY A;  4DF8 A;  1X40 A;  3EPI A;  2EAM A;  1TAM A;  1GO3 F;  3H8W A;  5KG1 A;  2JH1 A;  2ATL A;  4PHA A;  3IV6 A;  2ZIX B;  1KFT A;  5DB7 A;  2W8L A;  3C1Z A;  4TUR A;  2VJ4 A;  8ICA A;  2K4I A;  5KFX A;  5KFW A;  4WJ3 B;  3BS7 A;  1L7P A;  4ECX A;  1RDF A;  3M9O B;  4TUP A;  5BOM A;  3GV7 B;  9ICH A;  4LJX A;  2D3D A;  3PSI A;  1NKE A;  5TIS U;  4PZN A;  2FPM A;  3ETL A;  4AP9 A;  3V6J A;  3RRG A;  3RFA A;  1N60 A;  5D49 A;  4F2S A;  2PFO A;  4O3M A;  2EZZ A;  5CEH A;  2G5H B;  1DK2 A;  1ZQH A;  4UB1 A;  3H40 A;  2UVV A;  3RR7 A;  2ISO A;  2LM1 A;  1CRX A;  5ALD A;  2XO7 A;  4GXK A;  1NKB A;  4XA5 A;  1T4G A;  1LVH A;  5DGA A;  3LDA A;  1N5W A;  5DB6 A;  3EZ5 A;  2A1A A;  4DSE A;  5AK5 A;  3CNH A;  4RZR A;  4R64 A;  2J6U A;  4DL5 A;  1S8O A;  8ICQ A;  4Y2U A;  2PI4 A;  4ZH4 A;  1WWU A;  2W9B B;  1SV0 A;  1WYG A;  4J9Q A;  5BPC A;  2WB1 C;  1A77 A;  2AJQ A;  4IQW A;  4M9G A;  3ICX A;  4QWD A;  1S0N A;  3SMV A;  2R8J A;  2OEH A;  5BOL A;  4NL9 C;  2F1H A;  1ZJM A;  4Y2R A;  2W3S A;  4YMM A;  5KT2 A;  3PV8 A;  4EEN A;  4GLX A;  1NOM A;  8ICM A;  2AHO B;  9ICF A;  3VC8 A;  4QWE A;  2W9C B;  3L5K A;  1N62 A;  5AKL A;  4DLG A;  4YD1 A;  4M0A A;  2Y0S F;  5J2A A;  1ZQK A;  1PK1 B;  3QYP A;  3VCB A;  3JPQ A;  1A0P A;  4TQR A;  1N5X A;  3HKZ C;  2A1J A;  3BQ1 A;  2BGW A;  3N28 A;  3C2L A;  4C7Y A;  4KTQ A;  3PW0 A;  8ICX A;  1Q46 A;  2KHQ A;  1WWV A;  5DG8 A;  1J2N A;  3TAR A;  4DS4 A;  5ALI A;  1T7P A;  1KKX A;  3PW4 A;  3ZDD A;  4I2C A;  2F3N A;  3M9M B;  2KG5 A;  1SXD A;  3ETR A;  3H0M B;  4M6W B;  2NRV A;  2P66 A;  2PMZ F;  2ZJ5 A;  3WKB A;  1L8L A;  2JGA A;  2MUT A;  1ZQE A;  4C7Z A;  5J2I A;  2RQ5 A;  3OPX A;  4FZM A;  2G07 A;  3JPR A;  1RM6 C;  2YY6 A;  4J9P A;  4F4X A;  3QE9 Y;  5DG7 A;  2MRL A;  2YML A;  1OW5 A;  2HBK A;  2WF6 A;  4F4K A;  1Y88 A;  3Q8S B;  4Y2J A;  4CF4 A;  1JRP A;  5G5G A;  5AIA A;  5AM1 A;  1ARO P;  5L1I A;  3HPO A;  4IS7 A;  5AKY A;  5J0S A;  1MC8 A;  1S97 A;  1KFS A;  2EZY A;  4RPX A;  2XIC A;  4RT3 A;  9ICC A;  2V4Q A;  9ICP A;  1HUZ A;  1NJX A;  4NLN A;  4F8R A;  1KTQ A;  1ZQT A;  4DWI A;  2VA2 A;  2AH5 A;  4IRC A;  4CDG A;  1L7N A;  2W7P A;  5AM2 A;  3PZP A;  4Q45 A;  2W9B A;  4YXJ A;  5L1M A;  1B0X A;  3BQ7 A;  2Q4T A;  1L7O A;  5C5J A;  5KG0 A;  4RQ3 A;  2D8C A;  3NVZ A;  2KVC A;  4MEY A;  1ZXI A;  3GFK B;  4O5C A;  3Q8K A;  8ICI A;  4I2B A;  4NLK A;  3AU2 A;  2KVS A;  2IHN A;  8ICZ A;  8ICL A;  5TZV A;  5AKI A;  2H3I A;  5ALT A;  8ICP A;  2IOF K;  5ALP A;  2KN7 A;  3PX0 A;  5AI6 A;  2ZTE A;  1TK5 A;  2JEF A;  2GLE A;  5KT4 A;  2HW3 A;  3M1Y A;  1TK0 A;  4F91 B;  1NK9 A;  3JPT A;  4Z6C A;  4KN4 A;  5D46 A;  1ZRN A;  3SQI A;  4NY8 A;  3F53 A;  1NNL A;  1U48 A;  5AK4 A;  3ED5 A;  4ELV A;  1AQ6 A;  4YG2 A;  4JV1 A;  5DBB A;  2FMQ A;  8ICE A;  3GIK A;  5G5H A;  2LYB A;  3QU7 A;  7ICF A;  1FFV A;  3KHR A;  1N56 A;  4EYI B;  3NUQ A;  4KLU A;  4FS2 A;  2ODG A;  3M6Z A;  1JIH A;  3MFH A;  4UB5 A;  3KTQ A;  4JV0 A;  2LI6 A;  1M6Y A;  4QZA A;  2KIC A;  1ZQJ A;  1QSS A;  2ZUB A;  5ALL A;  3AQE A;  5AI0 A;  3UPQ A;  3V7L A;  5AKZ A;  3N7P D;  1J97 A;  4ELU A;  5AKK A;  2LHT A;  2K8C B;  1NJW A;  5KFM A;  4I2J A;  2HOI A;  2FJ6 A;  4GXJ A;  4I29 A;  1KN5 A;  4DL7 A;  3IG8 A;  1D8Y A;  2WFA A;  5KG4 A;  3ZDA A;  3G6V A;  1B4F A;  4DQR A;  2R8H A;  3QU4 A;  4ELT A;  1PVP A;  2JMG A;  4DEZ A;  5AI5 A;  4IQU A;  5J0T A;  1XU4 A;  5KFF A;  4JB3 A;  1LV5 A;  3AM9 A;  2DWQ A;  1WCL A;  3KBB A;  4ED0 A;  5H2F U;  4F5N A;  4YFK A;  4K4G A;  1VDV A;  4KIT B;  5KFJ A;  2K4H A;  1SZP A;  5KFH A;  1C20 A;  1K1S A;  3IM1 A;  4RQM A;  4B9L A;  4NL9 A;  3F5A A;  1SV4 A;  4U6P A;  3QUQ A;  3SR6 A;  4B9N A;  3ONN A;  4ED1 A;  9ICQ A;  1JI7 A;  3IN5 A;  3KD3 A;  2NRZ A;  4NWI A;  4F3O A;  4USA A;  1ZQG A;  1UHU A;  3PW7 A;  4BXO B;  2GWS A;  7ICR A;  2N1R A;  1BPB A;  5J0R A;  2JRZ A;  5L1L A;  4FFD A;  4DQS A;  3WKC A;  4C80 A;  4EX7 A;  3WK6 A;  4C4R A;  3T5L A;  3V7K A;  4OCZ A;  4F4W A;  1J2M A;  3PY8 A;  5AKJ A;  1U47 A;  4QJF B;  1X9M A;  1PVQ A;  1DRG A;  4Y2T A;  2BPC A;  2G08 A;  5KFA A;  2ALZ A;  3OTQ A;  7ICT A;  1JMS A;  5CHG A;  3SEI A;  4RQ8 A;  4A8E A;  2HHW A;  2K8A A;  1JAL A;  3H8S A;  1S10 A;  3T5K A;  4JUZ A;  5KFL A;  3QU5 A;  5JRT A;  1ZQO A;  4BWM A;  1T8E A;  5KFI A;  5DB9 A;  2DGZ A;  4O3P A;  3MR2 A;  1SWW A;  4PH5 A;  3L4P A;  4C4T A;  4C8O A;  1XSL A;  2FLL A;  2KFZ A;  4Y2X A;  2VKQ A;  4O9M A;  4O0I A;  1WUD A;  1SXE A;  3I1Y A;  3V72 A;  1B43 A;  4Q8F A;  3JPN A;  5F9L A;  5J0W A;  5KAF U;  2WF7 A;  4KX3 A;  1XO0 A;  1KSP A;  4RNM A;  4US8 A;  4QIW F;  2J6S A;  4OD0 A;  1RYS A;  5IIJ A;  3RBD A;  3N7R C;  8ICH A;  2BDU A;  4DL4 A;  3NTU A;  3A0B U;  4YP3 A;  1S76 D;  4PHP A;  4QW9 A;  5ALQ A;  4RQ0 A;  4UAY A;  3TI0 A;  5F9N A;  3WK8 A;  2DUY A;  2CRX A;  2QAR B;  1S0M A;  2WAQ F;  4C4S A;  9ICL A;  1N2X A;  3AQF A;  1L3S A;  1F44 A;  5K4L A;  3Q8P B;  3JPP A;  1NK7 A;  4KLL A;  3DDH A;  3WKA A;  1ZQV A;  1UCV A;  5HHH A;  9ICS A;  2O6K A;  3GQC A;  2F44 A;  4EZ9 A;  5AI9 A;  4O3S A;  5EE3 A;  4RQ6 A;  3BQ2 A;  3SV4 A;  4QZ9 A;  4KMO B;  3HWT A;  2KOB A;  3K4G A;  4K4I A;  2ZUD A;  4RNN A;  1QQ5 A;  1N48 A;  1XWL A;  1FO4 A;  3H0L B;  8ICB A;  3MAB A;  3ISD A;  1MN8 A;  3ORY A;  5KG5 A;  2AQ4 A;  3THV A;  4P0P A;  1NK5 A;  1K5O A;  2Z7J A;  4YQW A;  2R8G A;  1ZQD A;  3MDC A;  9ICO A;  5EWF A;  2FPK A;  3RJF A;  4KLH A;  2IOF A;  1NZP A;  1KEJ A;  2BPG A;  2K89 A;  7ICI A;  1V97 A;  5KFQ A;  5DLG A;  2ZTC A;  4U7C A;  2KSO A;  2QKQ A;  5KFU A;  2RDJ A;  4UBC A;  4ECU A;  5HP4 A;  5KFS A;  1SL2 A;  2XGP A;  3RJJ A;  9ICU A;  2WF5 A;  5KFV A;  3PO5 A;  2BCQ A;  3KZI U;  4AYB C;  4RQN A;  1L6N A;  5CA7 A;  3SAH A;  3PW5 A;  1XC9 A;  5HML A;  3KKA C;  2HHT A;  3OJU A;  4QZB A;  1A6S A;  1HEK A;  4ED7 A;  4P4O A;  1S9F A;  4R8U A;  3H8M A;  4PZO A;  3M8S A;  3MR6 A;  3RAX A;  2IA6 A;  2ZIW A;  4F5P A;  2AQ0 A;  2QB1 A;  2A1J B;  8ICJ A;  1FIQ A;  3FYH A;  2XVT A;  4F4Y A;  2DQN B;  2VA8 A;  2QB0 A;  4OJ6 A;  1C7Y A;  5KFB A;  1Z19 A;  2MAX A;  3BDP A;  1T3Q A;  2QLT A;  1JX4 A;  4O5K A;  2G0A A;  1LKY A;  3I76 A;  3LVW A;  4Y2Y A;  1RG6 A;  3M8R A;  1X66 A;  4RT2 A;  2Y1J A;  4RUA A;  3S6J A;  3ZD9 A;  2QAR A;  2P6U A;  1ZQW A;  2F76 X;  4YN4 A;  4IL6 U;  4M47 A;  5KFD A;  2XID A;  2MUT B;  1D9D A;  4QW8 A;  2XCA A;  8ICR A;  2HHQ A;  4DFD A;  5CJ7 A;  5IIK A;  8ICG A;  2GO7 A;  5AM5 A;  1SKW A;  2OXO A;  2W03 A;  1N61 A;  1P7D A;  4IC9 A;  1CEZ A;  2HOQ A;  5J8Y A;  3RF9 A;  4LVS A;  5HR6 A;  3OSP A;  4M9N A;  1ZJN A;  1KBU A;  4DOA A;  3LWM A;  2EH9 A;  3RR8 A;  4DS5 A;  4DSJ A;  4DLE A;  2ZIV A;  5KG7 A;  1QLN A;  1TFR A;  4QZG A;  5AM3 A;  1ZQB A;  4J9S A;  4ED8 A;  4Y2V A;  2E1F A;  3QZ8 A;  2JZB A;  4QZD A;  2F1I A;  4ECS A;  4Y2S A;  4B9T A;  8ICY A;  1DGS A;  4JWN A;  4QWA A;  2RLT A;  4F5O A;  4PHE A;  2V9W A;  4NM2 A;  4DSI A;  5KFK A;  3RJE A;  4ZOH C;  2HBM A;  3R9K A;  5CWR A;  2AU0 A;  1KLN A;  2CXY A;  4QZ8 A;  4YR0 A;  2KZZ A;  4EEL A;  2W04 A;  2G06 A;  3UMC A;  2GOL A;  3NRZ A;  1X42 A;  4DFJ A;  4PPX A;  2K4E A;  3HP6 A;  1ZQM A;  2JXJ A;  1UQV A;  4BJQ A;  3UXP A;  4TUQ A;  4OJO A;  5ALS A;  5J2G A;  4EYH B;  5DQI A;  4I27 A;  9ICV A;  2NO4 A;  4UW9 A;  5IIN A;  3AEV A;  2HHS A;  3SV3 A;  5L9X A;  4R65 A;  4Y2P A;  5AK6 A;  4BGD A;  2HMX A;  5J0Y A;  4KLS A;  2F1J A;  2IBK A;  1TAU A;  2OH2 A;  4DFK A;  2JEG A;  2PI5 A;  1X9S A;  3H8J A;  4R63 A;  1XSP A;  2DL0 A;  4I2H A;  3OHA A;  2Y9U A;  4EBD A;  4I28 A;  1Z1V A;  4B9U A;  3UMG A;  4K4H A;  3ZDE A;  2AGO A;  2KZ3 A;  3BZC A;  4EBC A;  4RU9 A;  5F3X B;  4RNO A;  4QNL A;  2BQ3 A;  2NRT A;  4OJP A;  4J03 A;  5KFN A;  2KP7 A;  4FZN A;  3V6H A;  4DSK A;  1ZD2 P;  1ZQI A;  8ICO A;  3EPG A;  4MFA A;  5J29 A;  8ICK A;  2ZXH A;  1ZQZ A;  2J6T A;  3WKE A;  1RXW A;  2FMS A;  5AI4 A;  2FE9 A;  3B0Y A;  3NVV A;  1MA7 A;  1UPH A;  9ICW A;  4KLJ A;  3WU2 U;  2EAO A;  2RRD A;  3GDX A;  1IIP A;  4NM1 A;  1XSN A;  4UAS A;  2G09 A;  4ICA A;  4UBB A;  2I1Q A;  5J2J A;  4QZF A;  1RZT A;  2F77 X;  4C0Z A;  2UVU A;  2YB4 A;  5HNK A;  5III A;  1COO A;  2ZJA A;  2HI0 A;  4QWC A;  4DFM A;  5EE9 A;  3AN1 A;  2E8P A;  4TQS A;  3GV8 B;  3M6K A;  7ICH A;  4QZI A;  5J0P A;  1QQ6 A;  2V4R A;  4YR3 A;  1Q3U A;  3RB0 A;  3OHB A;  5KG2 A;  3WK7 A;  1ZQU A;  4M04 A;  3UXO A;  3RBE A;  4O3R A;  5FP0 A;  2A19 A;  4KLD A;  2E5S A;  4M9L A;  4XRH A;  2KV2 A;  2C2E A;  5J0U A;  1DGJ A;  2R18 A;  2ZJ8 A;  5HR7 A;  1SKR A;  5KFG A;  4F5R A;  3QNM A;  4KLT A;  3GV5 B;  5C0Y A;  1X9X A;  4JV2 A;  1XO1 A;  3UXN A;  2YTU A;  4YMN A;  1Q3V A;  3G6Y A;  4Z6F A;  2KZM A;  2H3Z A;  3BQ0 A;  4YVZ A;  2ZTD A;  4RUC A;  2RP5 A;  3LK9 A;  2F8K A;  5DG9 A;  2PFN A;  1ZRM A;  2ISP A;  5AIB A;  3EW9 A;  4XQ8 A;  1BVS A;  1IG6 A;  1ZD4 A;  3TAD C;  4F4Z A;  2Y0S C;  3E58 A;  1T3N A;  2EQY A;  5AM4 A;  4BDP A;  5EE0 A;  4DCC A;  2KE7 A;  3AUO A;  2VJ5 A;  1S5L U;  9ICJ A;  1SZH A;  1XNS A;  3BS5 B;  3RB3 A;  1KFD A;  2KKV A;  4EZ6 A;  4X5V A;  4R66 A;  2LPE A;  7ICL A;  2W55 A;  3C1Y A;  3UM9 A;  3C5F A;  3ZI4 A;  4KLG A;  1ZD3 A;  1SGG A;  1FEZ A;  4RQ5 A;  1D8L A;  2PMZ C;  5ALV A;  5IIM A;  1ZYQ A;  4DQP A;  2BZF A;  1OXJ A;  2HCF A;  5T14 A;  4MFC A;  4P0Q A;  7ICG A;  5EWG A;  4EEY A;  9ICN A;  5J2H A;  5DQH A;  2IMW P;  3QZ7 A;  4UAZ A;  1TVA A;  4GIB A;  4MFF A;  4UAT A;  1ED1 A;  2WF9 A;  1U4B A;  4JWM A;  2HBJ A;  1L8O A;  1D8B A;  2KIV A;  3MGI A;  2PXI A;  2ASD A;  2RHF A;  1TK8 A;  2JR5 A;  3MR5 A;  1NZB A;  2ASL A;  3NS1 A;  5KL1 B;  2EAN A;  1ZQX A;  4YD2 A;  3TAC B;  4FO6 A;  2YMM A;  4ECZ A;  8ICT A;  9ICT A;  1SL0 A;  2NO5 A;  3IG5 A;  1QCK A;  4P0P B;  2KK0 A;  4NV0 A;  4IRK A;  3PMN A;  3AL0 B;  1A76 A;  5ALF A;  4DOC A;  3F2D A;  1X6I A;  5AI8 A;  1EXN A;  5DQG A;  5L1J A;  1S0O A;  2KSO B;  2FLP A;  2IOH A;  5J0O A;  4RQ2 A;  2Y9T A;  3PR4 A;  1ZQ1 C;  7ICJ A;  9ICX A;  3MGV A;  3AMZ A;  4BWJ A;  1RXV A;  3IDW A;  4P4P A;  3Q8Q B;  1HJP A;  2W11 A;  3LVV A;  5ALX A;  5D4B A;  4UB2 A;  1DXS A;  4ECT A;  3RJG A;  4C8L A;  1SIJ A;  3LYS A;  2W8K A;  5AKH A;  2HVI A;  3CRX A;  4YCX A;  2XC9 A;  3TAN A;  2PKE A;  3QUT A;  9ICM A;  2RDI A;  3DV9 A;  1JXE A;  2VAN A;  1WCN A;  4J9K A;  4R8U B;  5ALO A;  1SV0 C;  3BS5 A;  4UAU A;  2ZIW B;  3SAF A;  2KNJ A;  1YZ6 A;  5DKW A;  3NGD A;  5DGB A;  2QB0 B;  4Q8E A;  3C21 A;  3KOO A;  1N63 A;  5AM0 A;  2M9N A;  1L3T A;  1Z4O A;  4I2D A;  1LKY B;  3C2M A;  3PNC A;  4CF3 A;  2BHN A;  4KX5 A;  4ED2 A;  1ZOL A;  2M0N A;  4PL1 A;  1UT5 A;  2XY5 A;  3WK5 A;  3UQ0 A;  3NRW A;  2WHE A;  5ALE A;  2K4P A;  4UB6 U;  4FBU A;  1NKC A;  4EBE A;  5CB1 A;  2MA1 A;  2DPI A;  2BQU A;  2YQE A;  1K1Q A;  3L3F X;  4QWB A;  3N4M B;  2BR0 A;  9ICA A;  5J2K A;  2XCP A;  4KLQ A;  4B9V A;  1V85 A;  2JEJ A;  3PSF A;  4RPZ A;  3OSN A;  3HT3 A;  5KFZ A;  3RRH A;  5KT3 A;  2GH1 A;  2ZIV B;  1Z00 A;  2JEI A;  1IM4 A;  4IQV A;  5IIO A;  2EDU A;  3CP8 A;  7ICS A;  5GTH U;  1U45 A;  2LM4 A;  1IXR A;  4DL3 A;  3OGU A;  2WTF A;  2JZB B;  1BNP A;  2DBY A;  2K8B B;  1BGX T;  5JUM A;  1UA0 A;  2H3Q A;  3B0X A;  1KDH A;  1TE2 A;  3ZDB A;  1QSL A;  2XI9 A;  2I5H A;  3NVY A;  1SWV A;  4EX6 A;  4NLC A;  3KHL A;  4DL2 A;  5ALM A;  1RQN A;  1BPD A;  4PL2 A;  3RAQ A;  5AK3 A;  4I2A A;  2EZX A;  3OJS A;  1O03 A;  2BKE A;  4CNQ A;  4LZG A;  2BQR A;  1F0M A;  4JK1 A;  4FBT A;  3RH6 A;  4ED3 A;  3O0F A;  1X6J A;  1HIW A;  4UAR A;  3FM9 A;  3KHH A;  5ALW A;  5CR0 A;  3WK4 A;  3MFI A;  4NLB A;  3BZK A;  3K1R B;  1SL1 A;  4C8K A;  3FAH A;  3T3F A;  1Z4N A;  3RTV A;  5ALZ A;  2UVW A;  1L7M A;  2H3F A;  4ECR A;  4MEX A;  3PML A;  3MBY A;  4UQG A;  3D2Q A;  4DO9 A;  4ECQ A;  5AKX A;  2B0C A;  4GC6 A;  1OUQ A;  3GII A;  4I2F A;  4Z6D A;  5HMM A;  4QIW C;  2FDR A;  4QZH A;  5J2C A;  2YMQ A;  4C8M A;  4BX9 C;  1MQ2 A;  1SB3 C;  4YR2 A;  1CI4 A;  1QH9 A;  4DL6 A;  1KW4 A;  3PX6 A;  5KT6 A;  1ZQS A;  2CN1 A;  5E79 U;  4DFP A;  5EE1 A;  5KFE A;  4XUS A;  2HOF A;  2OM6 A;  4KLF A;  3A0H U;  2C2D A;  4F92 B;  1Q8K A;  4GC7 A;  4NJ8 A;  5DDY A;  5ALJ A;  1JRO A;  1YT3 A;  2FI1 A;  2YMP A;  5CP2 A;  3MR3 A;  1BPX A;  2WAQ C;  5EWE A;  3WKD A;  3TAP A;  2ES6 A;  3SAG A;  9ICK A;  4KLE A;  1YZ7 A;  2KEY A;  3QXG A;  1T94 A;  3V6K A;  4EEK A;  2XGQ A;  4I2I A;  2I9G A;  2ZIU B;  2XY7 A;  4FE3 A;  2C22 A;  2EAP A;  4DSL A;  3PR5 B;  3KFU F;  7ICO A;  1URJ A;  9ICR A;  1ZD5 A;  2KIW A;  4LZD A;  4GXI A;  4J9O A;  4F5Q A;  8ICF A;  3C23 A;  1FFU A;  2HHU A;  3GIJ A;  4JMU A;  4PGY A;  3NVW A;  1PK3 A;  3LWL A;  4M9H A;  3HX0 A;  1ECW A;  1PUZ A;  2IHM A;  2F8L A;  3HRD D;  4ECW A;  4CGZ A;  2JHD A;  2ZIX A;  3HJE A;  2FPL A;  3QU2 A;  2KJ9 A;  1DK3 A;  1VJ5 A;  3UMB A;  2YN4 A;  4KMU A;  3D6J A;  4ED6 A;  2KMD A;  4MF2 A;  3IP4 B;  2K60 A;  3H4D A;  3DEE A;  4PHD A;  8ICW A;  4UB8 U;  3JPO A;  3Q8L A;  2E1E A;  5KG6 A; 
#chains in the Genus database with same CATH homology
 3PSI A;  2KHQ A;  2RRD A;  2CN1 A;  1IIP A;  4NWI A;  3PST A;  2G09 A;  4ICA A;  1SZH A;  1XNS A;  3LYS A;  2HOF A;  2ZIW A;  2OM6 A;  2W04 A;  4ACO A;  3RFA A;  2H3Q A;  2KKV A;  2G06 A;  3CRX A;  2F77 X;  4C0Z A;  2D6F C;  4OJL A;  2GOL A;  3F2C A;  3SQI A;  2XVT A;  2YB4 A;  2DQN B;  4O3M A;  2LYA A;  3KZX A;  3K1Z A;  4OJ6 A;  3F53 A;  2K4E A;  2HBL A;  2N1R A;  2XI9 A;  1Z19 A;  2CRX A;  1YT3 A;  3H0M B;  3HKZ F;  2WAQ F;  4BJQ A;  2ZIW B;  3SAF A;  2G5H B;  4NLC A;  2PMZ F;  2WAQ C;  3AQF A;  2KNJ A;  3E0F A;  3GU3 A;  2G0A A;  3LVW A;  2JGA A;  4OJO A;  2PMZ C;  1F44 A;  3M6K A;  3SAG A;  2LYB A;  3OPX A;  2H3V A;  2G07 A;  4FZM A;  3D2N A;  4PL2 A;  3T79 A;  1PVR A;  2KEY A;  3NUQ A;  1T94 A;  1CRX A;  3M6Z A;  4QJF B;  5T14 A;  1PVQ A;  2ZIU B;  2F76 X;  4P0Q A;  1DRG A;  1D8B A;  4FE3 A;  3N7S C;  2MRL A;  1Q3U A;  2G08 A;  2VIX A;  2DF4 B;  2XID A;  2KJ5 A;  5CRX A;  2KJ8 A;  2HMX A;  2KIC A;  4KX5 A;  2HBK A;  4CRX A;  3KFU F;  1URJ A;  4KMO B;  2F2A B;  3GZF A;  2M0N A;  3C29 A;  4PL1 A;  2KHV A;  4OO1 J;  2KOB A;  2OH2 A;  3C28 A;  3AQE A;  2YX8 A;  3N7P D;  3F5E A;  2KIW A;  1ED1 A;  2ZIU A;  5KL8 B;  4OJ5 A;  4P0Q B;  3NRW A;  2W7O A;  4A8E A;  2HBJ A;  2E5S A;  2LHT A;  3O0F A;  2OXO A;  2KV2 A;  2K8C B;  2W03 A;  2K8A A;  3H0L B;  3CYM A;  2NV3 A;  3H0R B;  2R18 A;  2ZG6 A;  1HIW A;  3F2B A;  2HOI A;  1P7D A;  4IC9 A;  2HOQ A;  5HR7 A;  3RF9 A;  2XIC A;  5A0L A;  2MA1 A;  2RHF A;  5HR6 A;  4GFJ A;  1NZB A;  3IG8 A;  4JMU A;  5C0Y A;  1KBU A;  2JH7 A;  4NLB A;  2DGZ A;  2LBO A;  4P0P A;  3L3F X;  3D2S A;  2Z7J A;  2LKY A;  5KL1 B;  1Q3V A;  2ZXI A;  1PVP A;  2JMG A;  2H3Z A;  2WB1 C;  1ECW A;  2G5I B;  2ZIV A;  4CDG A;  3ICX A;  2F8L A;  2K89 A;  2H3F A;  4QNL A;  2W7P A;  2RP5 A;  4CGZ A;  3M7D A;  2VKQ A;  4U7C A;  2A3V A;  3IG5 A;  4OJP A;  3PZP A;  2JHD A;  2ZIX A;  3SMV A;  4P0P B;  3PSF A;  1WUD A;  2Q4T A;  4NV0 A;  2KJ9 A;  4FZN A;  3PSP A;  1TAM A;  2YB1 A;  3D2Q A;  1GO3 F;  3AL0 B;  2E1F A;  2K4H A;  2GH1 A;  2ZIV B;  2KVC A;  1XO0 A;  4KX3 A;  3F2D A;  2JH1 A;  3VC8 A;  4AYB F;  2ZXH A;  4FZL A;  1OUQ A;  2KKP A;  3IP4 B;  2ZIX B;  4QIW F;  4AYB C;  2Y0S F;  3CP8 A;  1L6N A;  3ALR A;  4QIW C;  2WB1 F;  2Y0S C;  1Z1B A;  3VCB A;  3SAH A;  1A0P A;  3DEE A;  3F5A A;  2VJ4 A;  2KD1 A;  2K4I A;  2CPR A;  3HKZ C;  1ZQ1 C;  3N7R C;  4WJ3 B;  2HBM A;  4U6P A;  2BDU A;  4BX9 C;  1UPH A;  1MA7 A;  3MGV A;  1A6S A;  2H3I A;  1HEK A;  2E1E A;  3ONN A;  2OYY A;  3LVV A;  2K8B B;  3IN5 A;  4BUG A;  2VJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...