2F7BA

Catm effector binding domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
214
structure length
214
Chain Sequence
b'QTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRRIVLHKEQLKLAIHKHHHPNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Effector-binding Sites Enable Synergistic Transcriptional Activation by BenM, a LysR-type Regulator.
pubmed doi rcsb
molecule keywords HTH-type transcriptional regulator catM
source organism Acinetobacter baylyi
molecule tags Gene regulation
total genus 66
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f7bA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f7bA02
2G29A 3A3CA 3MP8A 1Y4CA 4G4PA 1B0HA 1BKAA 2ZYMA 5DTBA 1SI0A 4F29A 1LCFA 1DTGA 2GH9A 4JXIA 2ESNA 3EQ1A 5L9MA 5I58B 1N76A 5H8FA 5CBSA 4FECA 1H3DA 1UIVA 3VVFA 3E3KA 1B3GA 3TTLA 2RKMA 3FJGA 3TUSA 3FVNA 3PPNA 4BDQA 4WEDA 3TQLA 1H44A 3QUFA 3E13X 4BDLA 5J1DA 3O2AA 4N13A 1USYE 3QUJA 4FAJA 3L6HA 4RXLA 3C31A 2DXYA 5I56A 4ELOA 3U93A 1D4NA 3TKDA 1S50A 1N0TA 3TODA 3PD9A 1DSNA 2ZNTA 4XTCQ 1MQJA 4MLVA 4YB5A 1MXVA 4BDRA 1BP5A 4JBZA 3T96B 1EZOA 2XX8A 1XT8A 1A8FA 3H6VA 5AE4A 3B6TA 2UYEA 3P7IA 1SI1A 3JYRA 1IXCA 2Z8FA 3MZ1A 4U4SA 3PUVE 3VLVA 3OO7A 1NH7A 1AMFA 2H99A 4ZEBA 4KHZE 3RPWA 2D21A 1N3WA 2OCUA 1QUKA 4IO7A 5I2KA 4IY5A 4FORA 4PP0A 3ILTB 5BWJA 5A5XB 4NEDA 2VGQA 1XOCA 4U1ZA 4KPTA 4XKQA 1MM7A 1ZIUA 3PMWA 5I59B 1LLSA 3VDFA 1MQDA 5ELVA 1JEVA 3T66A 5FTIA 5HBCA 4KYEA 3ZS6A 5H8NB 2REGA 4YMAA 4NF8A 5FHMA 2DVZA 4NF8B 1A8EA 1IITA 3K4UA 3S4UA 4YZZA 3W9WA 4GIZA 1AIVA 3SEUA 4JWOA 1QUJA 1Y1MA 3CVGA 3CFXA 3IX1A 5JTYB 1MY3A 2P1SA 5DEXA 4OQOA 4IB2A 1CE2A 1B3FA 3C4MA 1Q35A 1GR2A 2QRYA 3TTRA 2W7YA 3CG1A 1MY2A 3N94A 3RY3A 2UVGA 1B0LA 4IO6A 1A7LA 2I48A 3U1OA 3HSTA 3R6UA 3IO6A 4EXKA 4RPOA 4KCCA 5CC2A 2NXOA 1BTJA 1LAHE 3RLFE 1O7TA 4F3PA 1R9LA 2Z23A 2YJPA 3L6GA 5L9OA 4NWCA 3KGCA 2GHBA 3V5AA 3SEXA 2O69A 3ONMA 3IK6B 4XKNA 3MP6A 3K1PA 4F2QA 2OK2A 1R1NA 4I62A 1GVCA 5EHSA 3TCGA 2AL5A 3FV1A 4IY6A 2H4IA 4X1DA 4XXUA 2PX1A 4FEDA 2VOZA 4IGRA 4OFJA 2NVUB 5IKBA 2GRVA 2A5TA 3MP1A 1UTHA 2A5TB 3I3VA 4R6HA 4Z0IA 2H9BA 4QFLA 3IR1A 2XX7A 5I2NA 2CZLA 3UGWA 1H76A 2HZKA 5I2NB 1JEUA 4GXSB 3RUMA 3TCHA 1NMUA 3RTWB 1TFDA 4ZE8A 3IB0A 1VE4A 3FGSA 4YB6A 2DXRA 2M8CA 3C33A 1I6AA 5DYHA 4U23A 2QS3A 1ZMGA 3IB1A 3PMXA 4K3FA 4WKMA 3KN3A 1I69A 4OFLA 1FQFA 1JW5A 3RNNA 1LB9A 5DT6A 1B6HA 2F7BA 3MZBA 2DQVA 1VSOA 3IB2A 3K01A 5F7VA 4QSEA 2RF1A 1XC1A 3BFTA 4C0RA 3I5OA 1BLFA 2HZLA 4DXBA 5B7DA 3S2VA 2QPQA 1UQWA 3I6VA 3N6UA 4JSDA 5HM4B 4X1BA 1IIWA 2OLBA 1B5HA 2Z8DA 2HCAA 2Q9TA 3K6VA 3KG2A 4BDOA 4U2RA 1QKBA 1YAEA 4OESA 2P0SA 2DE4A 3LUYA 4KD5A 2NOOA 1FQDA 2D5WA 2RC9A 2I3VA 2Y7WA 5H8HA 3HO7A 1URSA 5H8HB 2XD2A 5AA4A 3O6IA 3OO6A 2XXVA 5AA4B 3N6TA 4C1UA 2DSFA 4YKPA 3M3KA 1R9QA 1OMPA 4EF2A 4OVJA 2ZYNA 5AA2D 4R72A 3FVGA 1B3EA 3SETA 4LZ7A 1MPBA 1WODA 2WKYA 4JWYA 4YMBA 4LVQA 5CMMA 3GZGA 4TLLB 1EH3A 1LCTA 4ZECA 3MVYA 2PT2A 5I84A 4ECFA 5I57B 4KFQA 1T0KA 5AA2A 2I4BA 1MPCA 3C35A 5JEIA 1QKAA 3TEPA 3OELA 2PMSA 3SEYA 4N6PA 3R7XA 3E9XA 3TDJA 2QS2A 4H5FA 4F22A 1URGA 3H4ZA 3PPQA 3QAXA 3O66A 3G3IA 2IEEA 2V3QA 3KJTA 4E0WA 1QVSA 1YPNA 3FVKA 1Y4TA 3UIFA 4U4XA 4ZZEA 1A40A 4NF5B 2O1LA 3H6WA 1QULA 1II5A 2O7UA 4FE8A 3V8XB 4LZ8A 4OYVA 1M5FA 4YICA 2XXPA 3CRBA 1ATGA 3T9UA 2O68A 3A09A 3GBAA 1LAXA 1PC3A 2OJTA 3QIMA 2BJJX 2UVHA 3O6GA 4JWXA 1HSLA 4KI0E 4MBPA 3G3GA 3IOWA 2HAUA 3PU5A 3MC2A 3MPKA 3V83A 5TU0A 3U94A 1FQEA 3N26A 4QFNA 3KN7A 5CI5A 4XIGQ 4RK2A 2OWTA 2Y84A 4YU0A 3ODBA 4GVOA 4G77A 2XXWA 5H8FB 4FATA 1GV8A 2QS1A 3FXRA 1MQGA 1F9BA 1MQHA 2KLFA 3IAZA 1BIYA 3EHUA 4KYDA 3VXCA 2V84A 4PETA 3A3UA 4JSOA 3RGYA 3UA8A 4QF9A 5I56B 1EZPA 3OSRA 4QSDA 2F97A 5KZTA 4F1VA 2ZXTA 1D9VA 2XXTA 4EF1A 4F3BA 3H3GA 4U22A 4ZE9A 2OBGA 1P1UA 1Y9UA 3VLUA 4F3GA 1LFGA 1PEBA 4N07A 3K6WA 3HHGA 4NMYA 3ZSFA 3JV9A 1GGGA 1JQFA 4EXLA 2I58A 2XXIA 2XHDA 4GD5A 3H03A 1YCJA 3PV0E 2I3WA 1ZKBA 3TMGA 1NNKA 3HPIA 3SEVA 5I2KB 3MBPA 3OMBA 1NH8A 3C36A 3IOTA 1IQ7A 3CFLA 4LP2B 3HCQA 4R73A 2F78A 2QL3A 2H25A 3PUXE 3M8UA 3K1NA 3FJMA 1FQAA 1OVBA 1QW0A 2A5SA 1XS5A 1FTMA 4YKJA 4EQ9A 3G7WA 1POY1 3VVEA 4H65A 1FQBA 4IO3A 1IEJA 3T9XB 1HSEA 4RY1A 2NUVA 2PBWA 4R6YA 1B1HA 1Y3PA 1N7WA 3IO4A 3PUYE 2XD3A 3PPOA 2XXUA 3S9MC 1YTVA 4G68A 4H5GA 4THIA 2REJA 3FATA 4ZZAA 1FTOA 1WVJA 2AIXA 4EUOA 3PPPA 1MM6A 5DEXB 2FA7A 4QSCA 4RPNA 1EU8A 1SQYA 3UK4A 3TELA 1NFTA 3MQ9A 3B6QA 1M5BA 4G8NA 2ONKE 5JK4A 3MVXA 4GOTA 4HCYA 1SW4A 2UVIA 4I1DA 1LAFE 2Y7KA 4NF6A 4JDFA 4YB7A 3O97A 4PE5B 1GTKA 4QFPA 4Z7EA 1DOTA 4JB7A 4LQ5A 2THIA 4NTLA 3VFJA 1AOVA 3T9HB 3JZJA 2PYYA 4WEPA 2DYXA 3IJOB 2I6EA 3SKPA 3CFZA 5TP9A 3OEKA 4ZS9A 3G3HA 3PUWE 3OO9A 4ELPA 4H0WA 3DELB 5K2XA 1P1NA 1UTBA 1N84A 2R9JA 5KDTA 1B51A 3T93B 2HEUA 1ZLQA 5ITPA 1PB9A 3EHSA 1OLAA 1UTHB 1EZ9A 1TT1A 3MVZA 3LSLA 4LATA 5F1QA 4HTGA 3DLNA 2XXHA 5M2VA 3FZVA 4BLAA 4IO4A 4POWA 2F34A 3D4CA 4F19A 5CBRA 4ELRA 2HAVA 4Q5TA 5DVIA 1JETA 1LSTA 3DP4A 4FJPA 3G3FA 4Q8RA 1MDP1 2GFEA 5H8QA 3MZ9A 1OQHA 3TCFA 1N7XA 2FYIA 3OSQA 4OFOA 1B46A 2XXRA 4R75A 4G68C 3K02A 1AL3A 4YAHX 2E0SA 2Q2CA 1MXXA 1ELJA 4H1XA 1LAGE 1R6ZA 1PBQA 1FCKA 5K2YA 2Q2AA 2V25A 4ONYA 2Y7PA 4F18A 2ABHA 4P11A 5CMBA 3FXQA 1URDA 4DE8A 4GLIA 5BUUA 4OWDA 4RNSA 4YKKA 4R9GA 4PFUA 3TFLA 5ICQA 2F36A 3VE1B 3CIJA 3SDFA 2OZZA 1PDAA 1M5DA 1DMBA 4G8HA 1FTLA 3RT6B 2ZYOA 2B65A 4DZ1A 3KEIA 3M3FA 1ANFA 1B40A 3F11A 3MUQA 4EDPA 1IZ1A 4C1TA 2LAOA 4O3BA 3KSJA 1MQIA 3PUZE 1LBBA 4DDDA 3FUZA 1JVYA 1B2HA 4NWDA 4OTEA 3EPEA 2X7QA 4H8IA 5CMKA 4XKRA 3QSLA 1MXZA 5TPAA 2F5XA 1DTZA 5TPAB 3CG3A 2Z8EA 2HFBA 3IOVA 2UYFA 1VR5A 1B32A 2RINA 3TAJA 4GXAA 1Z7NE 4OZ9A 3TZAA 3TYHA 3QK6A 5AA2B 3S9EA 4HW8A 3TQWA 1ZU0A 3CR9A 1MXWA 1NKXA 3KN8A 4GF8A 4NF4A 4NF4B 3VXBA 2B3FA 3EHTA 1L5TA 4F3SA 3SERA 4KYSA 3U8QA 5ICTA 2I0BA 4XKPA 1RYXA 3MJNA 4OEUA 3Q25A 1NNPA 2ONRA 4P0IA 2ALUA 3HV1A 4X9TA 4DLDA 2YLNA 2QJEA 3RN8A 2XXXA 1Y20A 3CSBA 5DVFA 2XXYA 3CSGA 1B7ZA 1RYOA 4ELQA 3V89B 2X7PA 1SYIA 4R74A 1KWHA 1S7YA 4AB6A 2YPNA 2GHAA 1NL5A 4RA1A 1LFHA 2VP1A 1Q1KA 4ESXA 2X26A 5ISUA 4OETA 3UP9A 1IXGA 1TXFA 1OIBA 2DOJA 1B3LA 4OMBA 3KFMA 3EF7A 3D4GA 2ZNUA 3RQTA 3R26A 1SD3A 2RCAA 3LBSA 3UN6A 5CM6A 2ONSA 4AB5A 4HS7A 3U92A 2OWSA 4ZEFA 4NE4A 5I58A 3K00A 3H06B 3B7DA 3W9VA 1MH4A 4RJZA 4UA8A 3MPLA 3ECRA 4BDMA 5AA1A 1AH5A 4FEBA 4MLQA 4ZDMA 2V3UA 4Q30B 3B6WA 4ZEKA 3VV5A 3DP8A 2O1MA 1NNFA 1Y3QA 2RCBA 2VD2A 2D3IA 1SW5A 4PFYA 3FJ7A 1USYH 3K6UA 1MXYA 1LB8A 3GXAA 4R6KA 4KQPA 1LFIA 3S9NC 4IO5A 4ZEDA 3OEMA 4DCXA 4F39A 1SW1A 3EN3A 4M1VA 1FTKA 3OENA 3E4RA 1A54A 3OXNA 4OXVA 1PBPA 4OENA 4QRZA 4BDNA 1WDNA 3FVOA 2XXQA 4O3CA 3TTNA 2DWAA 2O84X 5LOMA 1ZJLA 4DIGA 4MH5A 4QFKA 4GQOA 1P1QA 4UACA 1RKMA 1MDQA 2O6AA 2DE3A 5AA3A 3GBBA 5A5XA 2DWHA 1MS7A 1H43A 4PFWA 5I59A 1FTJA 4HCWA 5FTHA 1M5EA 2QMWA 3TPAA 1H45A 2ZMBA 4ESWA 1SW2A 1FW0A 2Q89A 5H8NA 2I0CA 4I9DA 1Z7ME 1M5CA 1Y1ZA 4LUBA 1IXIA 4G68B 2XX9A 3Q29A 2DS9A 1QJMA 5CMCA 2F6GA 2RC7A 2Q88A 1NNTA 4QFOA 2Q8JA 1SBPA 1VFEA 1D9YA 3C32A 3WAFA 1IXHA 3DP6A 2O51A 4IO2A 5JTYA 3G3JA 4GRKA 1P1OA 1B5JA 4P0GA 1Y3NA 4AQ4A 4E0XA 5IAIA 4R2FA 1S9TA 2F35A 4NF6B 3SESA 3KJ7A 1FQCA 4DXCA 2F8DA 1OQGA 2Y7IA 4H6DA 1B7UA 3C9HA 1B1XA 4LA9A 4H67A 1JVXA 3W15C 3H6TA 2ZNSA 1ZTYA 1MY0A 1UIUA 3FIRA 3OOAA 3O28A 5EHMA 4ND9A 4RYAA 3PD8A 1B4ZA 4F2OA 4LQ2A 5TP9B 1P1WA 4PFTA 1OVTA 4TOZA 4PQJA 4O3AA 5B70A 4ISUA 3Q26A 1TFAA 3Q27A 4KCDA 3LSWA 1N04A 1UTBB 3AXFA 4FIMA 3O9PA 2HXWA 1B4HA 5FHOA 5KDTB 3LSFB 1OLCA 4GFRA 3H7MA 3HN0A 5CRYA 2V93A 4Q0CA 2Z22A 3S9LC 1XVYA 1XVXA 3K1MA 5H8SA 2R6GE 2G93A 5FHNA 1N3XA 3RTFB 3MAMA 3KZGA 3K6XA 3MVWA 4KR5A 3WAEA 5H8QB 4LZ5A 1MXUA 4TLMB 2DWJA 3CI8A 2P2AA 1B5IA 2ANJA 2V3TA 4ZEIA 4F1UA 1MY4A 2FNCA 1LGBC 3O6HA 3LR1A 1B58A 4G8MA 3TTMA 1JW4A 3PMVA 2VD3A 4OEVA 3G3KA 3K0VA 2QMXA 1B7HA 1MH3A 1QUIA 3U72A 3IOUA 3KBRA 2AYSA 4X48A 2AL4A 3UORA 4GWOA 1IUDA 4F31B 2I49A 3BFUA 3OD7A 1SYHA 1MG1A 4U21A 2F7CA 4MFIA 2B3BA 5EYFA 1O64A 4L17A 5DVJA 1US5A 1B3HA 3H6UA 3ZKKA 5ITOA 4DCYA 2ZYKA 4YKIA 2UXAA 2PVUA 1B52A 1ZBMA 2F6PA 4RK9A 5L9SA 2R71A 3GLBA 3IL1B 3MWBA 3K2DA 2DVCA 3VLWA 3SEWA 1I6BA 1MRPA 1SVXB 2DWIA 1TWYA 3BKIB 2HQ0A 4R9FA 4R2BA 4DXUA 4GL0A 3M3LA 3FASA 4OERA 4EQ7A 2QS4A 1I6QA 1PB8A 3MW0A 1HSJA 2E1SA 4OHNA 2O7IA 1A55A 2F7AA 3IORA 3N5LA 5I57A 3FXUA 1JNFA 5KCJA 4U1OA 4WXJA 3RT8A 5KCJB 1B9JA 5L8DA 2NWJA 1B05A 3PPRA 3FV2A 1P99A 3QYTA 1DPEA 2RC8A 2I4CA 3LC8A 3ZKLA 2DE2A 4GL8A 2DP8A 1LBCA 1US4A 3T22A 3DM0A 4EQBA 1MPDA 3QXMA 1VFDA 4M4GA 1POTA 3O29A 1DPPA 4QHQA 2UVJA 3ILUB 2VHAA 2IA4A 1O63A 3USDA 3T9VA 3KOTA 3LSXA 4H8JA 1JW1A 1PB7A 2Y7RA 3OO8A 3KOSA 3THIA 5HPQA 3FD3A 2H98A 4NF5A 3TTKA 1XHYA 3PGFA 2CMOA 4LONB 2H5YA 2PT1A 3BBRA 4IGTA 3HHFA 1J1NA 4POXA 1D3KA 4MF3A 4I8CA 4G2ZA 1A99A 1MY1A 3Q28A 1SDXA 3C34A 4TQUQ 3VVDA 1CB6A 2QSXA 3IJXB 4F1YA 3KSXA
chains in the Genus database with same CATH superfamily
2G29A 1NV7A 3A3CA 3MP8A 1Y4CA 4G4PA 1B0HA 1BKAA 2ZYMA 1FPGA 5DTBA 1SI0A 4F29A 1LCFA 1DTGA 2GH9A 4JXIA 2ESNA 3EQ1A 5L9MA 5I58B 1N76A 5H8FA 5CBSA 4FECA 1H3DA 1UIVA 4P47A 3VVFA 3E3KA 1B3GA 3TTLA 2RKMA 2B4LA 3FJGA 3TUSA 3FVNA 3PPNA 4DI3D 4BDQA 2XXKA 4WEDA 3TQLA 1H44A 3QUFA 5A5LA 3E13X 4BDLA 5J1DA 3O2AA 4N13A 1USYE 3QUJA 4FAJA 3L6HA 4RXLA 3C31A 2DXYA 5I56A 4OANA 4ELOA 3U93A 4HE2A 3D1RA 1D4NA 3TKDA 1NV2A 1S50A 2Y5KA 3LUZA 1N0TA 3TODA 3PD9A 2P3NA 1DSNA 2ZNTA 4XTCQ 1MQJA 1FPFA 3SZPA 4MLVA 1BK4A 4YB5A 1MXVA 4BDRA 1BP5A 4JBZA 3T96B 1EZOA 2XX8A 1XT8A 1A8FA 1FPEA 3H6VA 5AE4A 3B6TA 2UYEA 3BIGA 3P7IA 1SI1A 3JYRA 5EQ7A 1IXCA 3MYUA 2Z8FA 3MZ1A 4U4SA 3PUVE 3VLVA 3OO7A 1NH7A 1AMFA 2H99A 4ZEBA 4KHZE 3RPWA 2D21A 1N3WA 2OCUA 1QUKA 4IO7A 1YZ0A 5IZ1A 5I2KA 4IY5A 4FORA 4PP0A 4GWUA 3ILTB 5BWJA 5A5XB 4NEDA 2VGQA 1XOCA 4U1ZA 4KPTA 4XKQA 1MM7A 1ZIUA 3PMWA 5I59B 1LLSA 3VDFA 1MQDA 5ELVA 4PE3A 2XWVA 1JEVA 3T66A 5FTIA 5HBCA 4KYEA 3ZS6A 5H8NB 4MNPA 2REGA 1AWBA 4YMAA 4NF8A 5FHMA 2DVZA 5DW8A 4NF8B 1A8EA 5T3JA 1IITA 3K4UA 3S4UA 4YZZA 3W9WA 4GIZA 1AIVA 3SEUA 1FJ9A 4JWOA 1QUJA 2XWKA 1Y1MA 3CVGA 3CFXA 3NOHA 5IZ3A 3IX1A 5JTYB 1MY3A 2P1SA 5DEXA 4OQOA 4IB2A 5EQAA 1CE2A 1B3FA 3C4MA 1Q35A 2WYPA 1GR2A 2QRYA 3TTRA 2KR0A 2W7YA 3CG1A 4PAKA 1MY2A 3N94A 3RY3A 1FTAA 2UVGA 1B0LA 4IO6A 4AS5A 1A7LA 2I48A 5I3SA 3U1OA 3HSTA 3R6UA 3IO6A 4X8RA 3U65A 4EXKA 4RPOA 4KCCA 5CC2A 2NXOA 1BTJA 1LAHE 3RLFE 1O7TA 4F3PA 1R9LA 2Z23A 2YJPA 3L6GA 5L9OA 1RDYA 4NWCA 3KGCA 2GHBA 3V5AA 3SEXA 2O69A 3ONMA 5LDZA 3RPLB 3IK6B 4XKNA 3MP6A 3K1PA 4F2QA 2OK2A 1R1NA 5F24A 4I62A 1GVCA 5EHSA 3TCGA 2AL5A 3FV1A 4IY6A 2H4IA 4X1DA 4XXUA 2PX1A 3BIHA 4FEDA 4NG7A 2VOZA 4IGRA 4OFJA 2NVUB 5IKBA 2GRVA 2A5TA 3MP1A 1UTHA 2A5TB 3I3VA 4HE0A 4R6HA 4Z0IA 2H9BA 4QFLA 3IR1A 2XX7A 5I2NA 2CZLA 3UGWA 1H76A 2HZKA 5I2NB 1INPA 1NV5A 1JEUA 4GXSB 3RUMA 3TCHA 1NMUA 3RTWB 1TFDA 4ZE8A 3IB0A 1VE4A 3FGSA 4YB6A 2DXRA 2M8CA 3C33A 2QFLA 4PF8A 1I6AA 5DYHA 4U23A 3T1BA 2QS3A 1NV4A 1ZMGA 3IB1A 3PMXA 4K3FA 4MX6A 4WKMA 3KN3A 4NGUA 1I69A 4OFLA 1FQFA 1JW5A 3RNNA 1LB9A 5DT6A 1B6HA 2F7BA 3MZBA 2DQVA 1VSOA 3IB2A 3K01A 5F7VA 4QSEA 2RF1A 1XC1A 3BFTA 4C0RA 3I5OA 4GX3A 1BLFA 2HZLA 4DI4B 4DXBA 2WX9A 5B7DA 3S2VA 1NI9A 2QPQA 4GX6A 1UQWA 3I6VA 1FBHA 3N6UA 1LEVA 4JSDA 5HM4B 4PAFA 4X1BA 1IIWA 2OLBA 1FBGA 1B5HA 2Z8DA 2HCAA 2Q9TA 3K6VA 3KG2A 4BDOA 4U2RA 3ROJA 1QKBA 1YAEA 4OESA 2P0SA 2DE4A 3LUYA 4KD5A 2NOOA 1NUWA 1FQDA 2D5WA 2RC9A 2I3VA 2Y7WA 5H8HA 2XWIA 3HO7A 1URSA 4OA4A 5H8HB 2XD2A 5AA4A 3O6IA 3OO6A 2XXVA 5AA4B 3N6TA 4C1UA 2Q74A 2DSFA 4YKPA 2XA5A 3M3KA 1R9QA 1OMPA 4EF2A 4OVJA 2ZYNA 5AA2D 4R72A 3FVGA 1B3EA 3SETA 4LZ7A 1MPBA 1WODA 2WKYA 4JWYA 4O7IA 4YMBA 4LVQA 5CMMA 3GZGA 4TLLB 1EH3A 1LCTA 4ZECA 3MVYA 2PT2A 1QGXA 5I84A 4ECFA 4PTKA 5I57B 4KFQA 1T0KA 3B8BA 5AA2A 2I4BA 1MPCA 3C35A 5JEIA 3E78A 1QKAA 1KA0A 3TEPA 3OELA 2PMSA 3SEYA 4GWSA 4N6PA 3R7XA 3E9XA 3TDJA 2QS2A 4H5FA 4F22A 1URGA 3H4ZA 3PPQA 3QAXA 3O66A 3G3IA 2FHYA 2Q8MA 2IEEA 2V3QA 3KJTA 4E0WA 1QVSA 1YPNA 2WEFA 1Y4TA 3FVKA 1RDXA 4LN5A 3UIFA 5ESYA 4U4XA 4MEVA 4ZZEA 1A40A 1NV6A 4NF5B 2O1LA 3H6WA 1QULA 1II5A 2O7UA 4FE8A 3V8XB 4LZ8A 4UABA 4OYVA 1M5FA 4YICA 2XXPA 4HXVA 4XF5A 3CRBA 1FJ6A 1ATGA 3T9UA 2O68A 3A09A 3GBAA 1LAXA 1PC3A 2OJTA 3QIMA 4MNCA 2BJJX 2UVHA 3O6GA 4JWXA 1HSLA 4KI0E 4MMPA 2V4CA 4MBPA 3G3GA 3IOWA 2HAUA 3PU5A 3MC2A 3MPKA 3V83A 1LBWA 5TU0A 3U94A 1FQEA 4AS4A 3N26A 2P3VA 4QFNA 3KN7A 5CI5A 4XIGQ 4RK2A 2OWTA 2Y84A 4YU0A 4NX1A 3ODBA 4GVOA 4G77A 2CZIA 2XXWA 5H8FB 4FATA 1GV8A 3HFUA 2MKZA 2QS1A 3FXRA 1MQGA 1F9BA 1MQHA 2KLFA 3IAZA 2HXRA 1BIYA 3FBPA 3EHUA 4HE1A 4KYDA 3VXCA 4OVQA 1DCUA 2V84A 4PETA 3A3UA 4JSOA 3RGYA 3UA8A 4QF9A 4GWZA 5I56B 1EZPA 3OSRA 4QSDA 2F97A 5KZTA 4F1VA 2ZXTA 1D9VA 2XXTA 4EF1A 4F3BA 3H3GA 4PBHA 4U22A 4ZE9A 2OBGA 1P1UA 1Y9UA 3VLUA 4OVPA 4F3GA 1LFGA 1PEBA 4N07A 3K6WA 2PFZA 3HHGA 4NMYA 3ZSFA 3JV9A 1GGGA 1JQFA 4EXLA 2I58A 2XXIA 2XHDA 4GD5A 3H03A 1YCJA 3PV0E 2I3WA 4PDHA 1ZKBA 3TMGA 1YYZA 1NNKA 4OVRA 3HPIA 4PF6A 4NN3A 3SEVA 1K9YA 5I2KB 3MBPA 3OMBA 1NH8A 3C36A 3IOTA 1IQ7A 3CFLA 5FBPA 4LP2B 3HCQA 4R73A 2F78A 2QL3A 2CEYA 2H25A 4PGNA 3PUXE 3M8UA 3K1NA 3FJMA 1FQAA 5EQ9A 1OVBA 1QW0A 2A5SA 3QMFA 1XS5A 1FTMA 4YKJA 4EQ9A 3G7WA 1POY1 3VVEA 4H65A 1FQBA 2PCRA 4GWWA 4IO3A 1FPKA 1IEJA 3T9XB 5LTCA 1HSEA 4RY1A 2NUVA 2PBWA 4R6YA 1B1HA 1Y3PA 1CNQA 1N7WA 3IO4A 3PUYE 2XD3A 3PPOA 2XXUA 3S9MC 1YTVA 4G68A 4H5GA 4THIA 4NF0A 2REJA 3FATA 4ZZAA 1FTOA 1WVJA 2AIXA 5IZ3B 3PPPA 4EUOA 1MM6A 5DEXB 2FA7A 4QSCA 4RPNA 1EU8A 1SQYA 3UK4A 4XEQA 3TELA 3B50A 1K9ZA 1NFTA 3MQ9A 3B6QA 1M5BA 4G8NA 2ONKE 4N8YA 5JK4A 3MVXA 4GOTA 4HCYA 1SW4A 2UVIA 2GQ1A 1LAFE 2Y7KA 4I1DA 4JDFA 4NF6A 4YB7A 3O97A 4PE5B 1GTKA 4P1EA 4QFPA 4Z7EA 1DOTA 3ISPA 4JB7A 4LQ5A 2THIA 4NTLA 3VFJA 3A29A 1FRPA 4NHBA 1LBXA 5J16A 1AOVA 2ZZWA 3T9HB 3JZJA 2PYYA 4WEPA 2DYXA 3IJOB 2I6EA 3SKPA 2FIXA 3CFZA 5TP9A 4QXDA 3OEKA 4ZS9A 3G3HA 3PUWE 3OO9A 4ELPA 1VDWA 4H0WA 3DELB 5K2XA 1P1NA 1NV3A 1UTBA 1N84A 2R9JA 4I3YA 5KDTA 2VPOA 1B51A 3T93B 2HEUA 1ZLQA 5ITPA 1PB9A 3EHSA 5EYGA 1OLAA 1UTHB 1EZ9A 1TT1A 3MVZA 3LSLA 4LATA 5F1QA 4HTGA 3DLNA 2XXHA 5M2VA 3FZVA 4BLAA 4IO4A 4POWA 2F34A 3D4CA 4F19A 5CBRA 4H45A 4ELRA 2HAVA 4Q5TA 5DVIA 1KZ8A 1JETA 1LSTA 3DP4A 4FJPA 3G3FA 4Q8RA 1MDP1 2GFEA 5H8QA 3MZ9A 1OQHA 3TCFA 1N7XA 2FYIA 3OSQA 4OFOA 1B46A 2XXRA 4R75A 4G68C 3FXBA 3K02A 3KC0A 1AL3A 4YAHX 2E0SA 2HHMA 2Q2CA 1MXXA 1ELJA 4H1XA 1LAGE 1R6ZA 1PBQA 1FCKA 3PTYA 5K2YA 2Q2AA 1FPBA 2V25A 4ONYA 2Y7PA 4F18A 2ABHA 4P11A 5CMBA 4PFRA 3FXQA 4P8BA 1URDA 4DE8A 4GLIA 5BUUA 4OWDA 4RNSA 4YKKA 4R9GA 4PFUA 3TFLA 5ICQA 4GWXA 2F36A 3VE1B 3CIJA 3SDFA 4MNIA 1FSAA 2OZZA 1PDAA 1M5DA 1DMBA 4FBPA 4G8HA 1FTLA 3RT6B 2ZYOA 4N91A 2B65A 2QVUA 2ZZVA 4DZ1A 3KEIA 3M3FA 1IMAA 1ANFA 1B40A 3F11A 3MUQA 4EDPA 1IZ1A 4GBVA 4C1TA 4X04A 2LAOA 4O3BA 3KSJA 4PDDA 1MQIA 1NUZA 3PUZE 1LBBA 4DDDA 4N15A 3FUZA 1JVYA 1B2HA 4NWDA 4OTEA 3EPEA 2X7QA 4H8IA 5CMKA 4XKRA 3QSLA 1MXZA 5TPAA 2F5XA 1DTZA 1IMFA 1NUYA 5TPAB 3CG3A 2Z8EA 2HFBA 3IOVA 2UYFA 1VR5A 1B32A 2RINA 3TAJA 4GXAA 1Z7NE 4OZ9A 3TZAA 3TYHA 3QK6A 5AA2B 3S9EA 4HW8A 3TQWA 4I3EA 1ZU0A 3CR9A 4PFIA 1MXWA 1NKXA 3KN8A 4GF8A 1XI6A 4NF4A 4PBQA 4NF4B 3VXBA 2B3FA 3EHTA 1L5TA 4F3SA 3SERA 4KYSA 3U8QA 5ICTA 2I0BA 4XKPA 1RYXA 3MJNA 4OEUA 4GWYA 3Q25A 1NNPA 2ONRA 4P0IA 1JP4A 1EYIA 2BJIA 2ALUA 3HV1A 1FBDA 4X9TA 4DLDA 2YLNA 2QJEA 3RN8A 1FPDA 2ZZXA 4P56A 2XXXA 5ET7A 1Y20A 3CSBA 5DVFA 2XXYA 3CSGA 1B7ZA 1RYOA 3V89B 4ELQA 2X7PA 3CHGA 1SYIA 4R74A 1KWHA 1S7YA 2JJKA 4AB6A 4GBWA 2DDKA 2YPNA 2GHAA 1NL5A 4RA1A 1LFHA 2VP1A 1Q1KA 4ESXA 2HPGA 2X26A 5ISUA 2OX3A 4OETA 3UP9A 2B4MA 1DBZA 1IXGA 1TXFA 1OIBA 2QVVA 2DOJA 1B3LA 4OMBA 3KFMA 3EF7A 2WBBA 3D4GA 5ET8A 2ZNUA 3RQTA 3R26A 1SD3A 2RCAA 5EQ8A 1Q9DA 3LBSA 3UN6A 5CM6A 2ONSA 4AB5A 1G0IA 4HS7A 3U92A 2OWSA 4ZEFA 1G0HA 4NE4A 5I58A 3K00A 3E79A 3H06B 3B7DA 3W9VA 1MH4A 4RJZA 4UA8A 3MPLA 4PFBA 2WYKA 3ECRA 4BDMA 5AA1A 1AH5A 4FEBA 4MLQA 4ZDMA 2V3UA 4Q30B 3B6WA 4ZEKA 3VV5A 3DP8A 2O1MA 1NNFA 2CZHA 1Y3QA 4O8MA 2RCBA 2VD2A 2D3IA 1SW5A 3IFAA 3RYDA 1FPIA 5ET6A 4PFYA 3FJ7A 1USYH 4P3LA 3K6UA 1MXYA 1LB8A 3GXAA 4R6KA 4IR8A 4KQPA 1LFIA 3S9NC 4IO5A 4ZEDA 3OEMA 4MCOA 4DCXA 4F39A 1LBZA 1SW1A 3EN3A 4M1VA 1FTKA 3OENA 1LBYA 4O94A 3E4RA 1A54A 4PCDA 3OXNA 4OXVA 1PBPA 4OENA 4QRZA 4BDNA 1WDNA 3FVOA 2XXQA 4O3CA 3TTNA 2FIEA 2R8TA 5EYHA 2DWAA 1DK4A 2O84X 5LOMA 1ZJLA 4DIGA 4MH5A 4QFKA 4GQOA 1P1QA 4UACA 2FBPA 2Y5LA 1RKMA 1MDQA 2O6AA 2DE3A 3KC1A 1NUXA 5AA3A 3GBBA 5A5XA 3EKIA 2DWHA 1MS7A 1RDZA 1H43A 4PFWA 5I59A 1FTJA 4HCWA 5FTHA 1M5EA 2QMWA 3TPAA 1H45A 2ZMBA 4ESWA 1SW2A 4N81A 1FW0A 2Q89A 5H8NA 2I0CA 4I9DA 1Z7ME 1M5CA 1Y1ZA 4O7MA 4LUBA 1IXIA 4G68B 1IMBA 2XX9A 3Q29A 2KQZA 2DS9A 1QJMA 5CMCA 2F6GA 5IM2A 2RC7A 2Q88A 1NNTA 4QFOA 2Q8JA 1SBPA 4NQ8A 1FBEA 1VFEA 1D9YA 3C32A 3GYYA 3WAFA 1IXHA 2XWOA 3DP6A 2O51A 4IO2A 5JTYA 3G3JA 4GRKA 1P1OA 1B5JA 4QBAA 4P0GA 4N6DA 1Y3NA 4GX4A 4AQ4A 4N8GA 3MSTA 4E0XA 5IAIA 4R2FA 1S9TA 2F35A 4NF6B 3SESA 3KJ7A 1FQCA 2L5VA 4DXCA 2F8DA 1OQGA 2Y7IA 4H6DA 1B7UA 3C9HA 1B1XA 4LA9A 4H67A 1JVXA 3W15C 4PGPA 3H6TA 3IFCA 2ZNSA 1ZTYA 4MAGA 1MY0A 1UIUA 3FIRA 3OOAA 3O28A 5EHMA 4ND9A 4RYAA 3PD8A 4P9KA 1B4ZA 3RPLA 4F2OA 4LQ2A 2FVZA 5TP9B 2VT5A 1P1WA 4PFTA 1OVTA 4TOZA 4PQJA 1NV0A 4O3AA 5B70A 4ISUA 3KBZA 3Q26A 1TFAA 3Q27A 4KCDA 3LSWA 1N04A 1UTBB 1EYJA 3AXFA 3O9PA 4FIMA 2HXWA 1B4HA 5FHOA 5KDTB 3LSFB 1OLCA 4GFRA 3H7MA 3HN0A 5CRYA 2V93A 4Q0CA 2Z22A 3S9LC 1XVYA 1XVXA 3K1MA 5H8SA 2R6GE 2G93A 5FHNA 1N3XA 3RTFB 3MAMA 3KZGA 1YXIA 4OVSA 3K6XA 3MVWA 4KR5A 3WAEA 5H8QB 4LZ5A 1MXUA 4TLMB 2DWJA 3CI8A 4MHFA 2P2AA 5IZZA 1B5IA 2ANJA 2V3TA 4N4UA 4ZEIA 1IMDA 4F1UA 1MY4A 2FNCA 1LGBC 3O6HA 3LR1A 5IGAA 1B58A 4G8MA 5I7IA 3TTMA 1JW4A 3PMVA 2VD3A 4OEVA 1FBCA 3G3KA 3K0VA 2QMXA 1B7HA 4H46A 1MH3A 2CZKA 4PC9A 1QUIA 3U72A 3IOUA 3KBRA 2AYSA 4X48A 1LBVA 2AL4A 3UORA 1FBPA 4GWOA 1IUDA 4F31B 2I49A 3BFUA 3OD7A 2QVRA 1SYHA 1SPIA 1MG1A 4U21A 2F7CA 4MFIA 2B3BA 3LV0A 5EYFA 1O64A 2WBDA 4L17A 5DVJA 1US5A 1B3HA 3H6UA 3ZKKA 5ITOA 4DCYA 2ZYKA 4YKIA 2UXAA 2PVUA 4XFEA 1B52A 1ZBMA 2F6PA 4RK9A 5L9SA 4PAIA 4JVDA 1IMEA 2R71A 3GLBA 4OVTA 3IL1B 2CEXA 3MWBA 1D9QA 3K2DA 4I40A 2DVCA 3VLWA 3SEWA 1I6BA 1MRPA 1SVXB 2DWIA 1TWYA 3BKIB 2OWZA 2HQ0A 4R9FA 4R2BA 4NAPA 4DXUA 4GL0A 1FPJA 3M3LA 3FASA 4OERA 4EQ7A 2QS4A 1I6QA 1PB8A 3MW0A 5ET5A 2F3BA 1HSJA 2E1SA 4OHNA 2O7IA 1A55A 2F7AA 3IORA 3N5LA 5I57A 3FXUA 1JNFA 1KA1A 3T0JA 4JVCA 1FBFA 5KCJA 4U1OA 4WXJA 3RT8A 5KCJB 4N17A 1B9JA 5L8DA 2NWJA 1B05A 3PPRA 3FV2A 1P99A 3QYTA 1DPEA 2RC8A 4G61A 4KXPA 2I4CA 3LC8A 3ZKLA 2DE2A 4GL8A 4JVIA 2DP8A 1LBCA 1US4A 3T22A 3DM0A 4EQBA 1MPDA 3QXMA 1VFDA 4M4GA 1POTA 1FPLA 3O29A 1DPPA 4QHQA 2UVJA 3ILUB 2VHAA 2IA4A 1O63A 3USDA 3T9VA 3KOTA 1IMCA 3LSXA 4H8JA 1JW1A 1PB7A 2Y7RA 3OO8A 3KOSA 3THIA 5HPQA 3FD3A 2H98A 4NF5A 4MIJA 2PFYA 3TTKA 1XHYA 1NV1A 3PGFA 2CMOA 4LONB 2H5YA 2PT1A 3BBRA 1EYKA 4IGTA 3HHFA 1J1NA 4POXA 1D3KA 4MF3A 4I8CA 4G2ZA 5I5PA 2F3DA 4P1LA 1A99A 1MY1A 3Q28A 1SDXA 3C34A 4TQUQ 4N6KA 3VVDA 1CB6A 4MJOA 2QSXA 3IJXB 4F1YA 2VPNA 3KSXA
chains in the Genus database with same CATH topology
2G29A 3A3CA 3MP8A 1Y4CA 4G4PA 1B0HA 1BKAA 2ZYMA 5DTBA 1SI0A 4F29A 1LCFA 1DTGA 2GH9A 4JXIA 2ESNA 3EQ1A 5L9MA 5I58B 1N76A 5H8FA 5CBSA 4FECA 1H3DA 1UIVA 3VVFA 3E3KA 1B3GA 3TTLA 2RKMA 3FJGA 3TUSA 3FVNA 3PPNA 4BDQA 4WEDA 3TQLA 1H44A 3QUFA 3E13X 4BDLA 5J1DA 3O2AA 4N13A 1USYE 3QUJA 4FAJA 3L6HA 4RXLA 3C31A 2DXYA 5I56A 4ELOA 3U93A 1D4NA 3TKDA 1S50A 1N0TA 3TODA 3PD9A 1DSNA 2ZNTA 4XTCQ 1MQJA 4MLVA 4YB5A 1MXVA 4BDRA 1BP5A 4JBZA 3T96B 1EZOA 2XX8A 1XT8A 1A8FA 3H6VA 5AE4A 3B6TA 2UYEA 3P7IA 1SI1A 3JYRA 1IXCA 2Z8FA 3MZ1A 4U4SA 3PUVE 3VLVA 3OO7A 1NH7A 1AMFA 2H99A 4ZEBA 4KHZE 3RPWA 2D21A 1N3WA 2OCUA 1QUKA 4IO7A 5I2KA 4IY5A 4FORA 4PP0A 3ILTB 5BWJA 5A5XB 4NEDA 2VGQA 1XOCA 4U1ZA 4KPTA 4XKQA 1MM7A 1ZIUA 3PMWA 5I59B 1LLSA 3VDFA 1MQDA 5ELVA 1JEVA 3T66A 5FTIA 5HBCA 4KYEA 3ZS6A 5H8NB 2REGA 4YMAA 4NF8A 5FHMA 2DVZA 4NF8B 1A8EA 1IITA 3K4UA 3S4UA 4YZZA 3W9WA 4GIZA 1AIVA 3SEUA 4JWOA 1QUJA 1Y1MA 3CVGA 3CFXA 3IX1A 5JTYB 1MY3A 2P1SA 5DEXA 4OQOA 4IB2A 1CE2A 1B3FA 3C4MA 1Q35A 1GR2A 2QRYA 3TTRA 2W7YA 3CG1A 1MY2A 3N94A 3RY3A 2UVGA 1B0LA 4IO6A 1A7LA 2I48A 3U1OA 3HSTA 3R6UA 3IO6A 4EXKA 4RPOA 4KCCA 5CC2A 2NXOA 1BTJA 1LAHE 3RLFE 1O7TA 4F3PA 1R9LA 2Z23A 2YJPA 3L6GA 5L9OA 4NWCA 3KGCA 2GHBA 3V5AA 3SEXA 2O69A 3ONMA 3IK6B 4XKNA 3MP6A 3K1PA 4F2QA 2OK2A 1R1NA 4I62A 1GVCA 5EHSA 3TCGA 2AL5A 3FV1A 4IY6A 2H4IA 4X1DA 4XXUA 2PX1A 4FEDA 2VOZA 4IGRA 4OFJA 2NVUB 5IKBA 2GRVA 2A5TA 3MP1A 1UTHA 2A5TB 3I3VA 4R6HA 4Z0IA 2H9BA 4QFLA 3IR1A 2XX7A 5I2NA 2CZLA 3UGWA 1H76A 2HZKA 5I2NB 1JEUA 4GXSB 3RUMA 3TCHA 1NMUA 3RTWB 1TFDA 4ZE8A 3IB0A 1VE4A 3FGSA 4YB6A 2DXRA 2M8CA 3C33A 1I6AA 5DYHA 4U23A 2QS3A 1ZMGA 3IB1A 3PMXA 4K3FA 4WKMA 3KN3A 1I69A 4OFLA 1FQFA 1JW5A 3RNNA 1LB9A 5DT6A 1B6HA 2F7BA 3MZBA 2DQVA 1VSOA 3IB2A 3K01A 5F7VA 4QSEA 2RF1A 1XC1A 3BFTA 4C0RA 3I5OA 1BLFA 2HZLA 4DXBA 5B7DA 3S2VA 2QPQA 1UQWA 3I6VA 3N6UA 4JSDA 5HM4B 4X1BA 1IIWA 2OLBA 1B5HA 2Z8DA 2HCAA 2Q9TA 3K6VA 3KG2A 4BDOA 4U2RA 1QKBA 1YAEA 4OESA 2P0SA 2DE4A 3LUYA 4KD5A 2NOOA 1FQDA 2D5WA 2RC9A 2I3VA 2Y7WA 5H8HA 3HO7A 1URSA 5H8HB 2XD2A 5AA4A 3O6IA 3OO6A 2XXVA 5AA4B 3N6TA 4C1UA 2DSFA 4YKPA 3M3KA 1R9QA 1OMPA 4EF2A 4OVJA 2ZYNA 5AA2D 4R72A 3FVGA 1B3EA 3SETA 4LZ7A 1MPBA 1WODA 2WKYA 4JWYA 4YMBA 4LVQA 5CMMA 3GZGA 4TLLB 1EH3A 1LCTA 4ZECA 3MVYA 2PT2A 5I84A 4ECFA 5I57B 4KFQA 1T0KA 5AA2A 2I4BA 1MPCA 3C35A 5JEIA 1QKAA 3TEPA 3OELA 2PMSA 3SEYA 4N6PA 3R7XA 3E9XA 3TDJA 2QS2A 4H5FA 4F22A 1URGA 3H4ZA 3PPQA 3QAXA 3O66A 3G3IA 2IEEA 2V3QA 3KJTA 4E0WA 1QVSA 1YPNA 3FVKA 1Y4TA 3UIFA 4U4XA 4ZZEA 1A40A 4NF5B 2O1LA 3H6WA 1QULA 1II5A 2O7UA 4FE8A 3V8XB 4LZ8A 4OYVA 1M5FA 4YICA 2XXPA 3CRBA 1ATGA 3T9UA 2O68A 3A09A 3GBAA 1LAXA 1PC3A 2OJTA 3QIMA 2BJJX 2UVHA 3O6GA 4JWXA 1HSLA 4KI0E 4MBPA 3G3GA 3IOWA 2HAUA 3PU5A 3MC2A 3MPKA 3V83A 5TU0A 3U94A 1FQEA 3N26A 4QFNA 3KN7A 5CI5A 4XIGQ 4RK2A 2OWTA 2Y84A 4YU0A 3ODBA 4GVOA 4G77A 2XXWA 5H8FB 4FATA 1GV8A 2QS1A 3FXRA 1MQGA 1F9BA 1MQHA 2KLFA 3IAZA 1BIYA 3EHUA 4KYDA 3VXCA 2V84A 4PETA 3A3UA 4JSOA 3RGYA 3UA8A 4QF9A 5I56B 1EZPA 3OSRA 4QSDA 2F97A 5KZTA 4F1VA 2ZXTA 1D9VA 2XXTA 4EF1A 4F3BA 3H3GA 4U22A 4ZE9A 2OBGA 1P1UA 1Y9UA 3VLUA 4F3GA 1LFGA 1PEBA 4N07A 3K6WA 3HHGA 4NMYA 3ZSFA 3JV9A 1GGGA 1JQFA 4EXLA 2I58A 2XXIA 2XHDA 4GD5A 3H03A 1YCJA 3PV0E 2I3WA 1ZKBA 3TMGA 1NNKA 3HPIA 3SEVA 5I2KB 3MBPA 3OMBA 1NH8A 3C36A 3IOTA 1IQ7A 3CFLA 4LP2B 3HCQA 4R73A 2F78A 2QL3A 2H25A 3PUXE 3M8UA 3K1NA 3FJMA 1FQAA 1OVBA 1QW0A 2A5SA 1XS5A 1FTMA 4YKJA 4EQ9A 3G7WA 1POY1 3VVEA 4H65A 1FQBA 4IO3A 1IEJA 3T9XB 1HSEA 4RY1A 2NUVA 2PBWA 4R6YA 1B1HA 1Y3PA 1N7WA 3IO4A 3PUYE 2XD3A 3PPOA 2XXUA 3S9MC 1YTVA 4G68A 4H5GA 4THIA 2REJA 3FATA 4ZZAA 1FTOA 1WVJA 2AIXA 4EUOA 3PPPA 1MM6A 5DEXB 2FA7A 4QSCA 4RPNA 1EU8A 1SQYA 3UK4A 3TELA 1NFTA 3MQ9A 3B6QA 1M5BA 4G8NA 2ONKE 5JK4A 3MVXA 4GOTA 4HCYA 1SW4A 2UVIA 4I1DA 1LAFE 2Y7KA 4NF6A 4JDFA 4YB7A 3O97A 4PE5B 1GTKA 4QFPA 4Z7EA 1DOTA 4JB7A 4LQ5A 2THIA 4NTLA 3VFJA 1AOVA 3T9HB 3JZJA 2PYYA 4WEPA 2DYXA 3IJOB 2I6EA 3SKPA 3CFZA 5TP9A 3OEKA 4ZS9A 3G3HA 3PUWE 3OO9A 4ELPA 4H0WA 3DELB 5K2XA 1P1NA 1UTBA 1N84A 2R9JA 5KDTA 1B51A 3T93B 2HEUA 1ZLQA 5ITPA 1PB9A 3EHSA 1OLAA 1UTHB 1EZ9A 1TT1A 3MVZA 3LSLA 4LATA 5F1QA 4HTGA 3DLNA 2XXHA 5M2VA 3FZVA 4BLAA 4IO4A 4POWA 2F34A 3D4CA 4F19A 5CBRA 4ELRA 2HAVA 4Q5TA 5DVIA 1JETA 1LSTA 3DP4A 4FJPA 3G3FA 4Q8RA 1MDP1 2GFEA 5H8QA 3MZ9A 1OQHA 3TCFA 1N7XA 2FYIA 3OSQA 4OFOA 1B46A 2XXRA 4R75A 4G68C 3K02A 1AL3A 4YAHX 2E0SA 2Q2CA 1MXXA 1ELJA 4H1XA 1LAGE 1R6ZA 1PBQA 1FCKA 5K2YA 2Q2AA 2V25A 4ONYA 2Y7PA 4F18A 2ABHA 4P11A 5CMBA 3FXQA 1URDA 4DE8A 4GLIA 5BUUA 4OWDA 4RNSA 4YKKA 4R9GA 4PFUA 3TFLA 5ICQA 2F36A 3VE1B 3CIJA 3SDFA 2OZZA 1PDAA 1M5DA 1DMBA 4G8HA 1FTLA 3RT6B 2ZYOA 2B65A 4DZ1A 3KEIA 3M3FA 1ANFA 1B40A 3F11A 3MUQA 4EDPA 1IZ1A 4C1TA 2LAOA 4O3BA 3KSJA 1MQIA 3PUZE 1LBBA 4DDDA 3FUZA 1JVYA 1B2HA 4NWDA 4OTEA 3EPEA 2X7QA 4H8IA 5CMKA 4XKRA 3QSLA 1MXZA 5TPAA 2F5XA 1DTZA 5TPAB 3CG3A 2Z8EA 2HFBA 3IOVA 2UYFA 1VR5A 1B32A 2RINA 3TAJA 4GXAA 1Z7NE 4OZ9A 3TZAA 3TYHA 3QK6A 5AA2B 3S9EA 4HW8A 3TQWA 1ZU0A 3CR9A 1MXWA 1NKXA 3KN8A 4GF8A 4NF4A 4NF4B 3VXBA 2B3FA 3EHTA 1L5TA 4F3SA 3SERA 4KYSA 3U8QA 5ICTA 2I0BA 4XKPA 1RYXA 3MJNA 4OEUA 3Q25A 1NNPA 2ONRA 4P0IA 2ALUA 3HV1A 4X9TA 4DLDA 2YLNA 2QJEA 3RN8A 2XXXA 1Y20A 3CSBA 5DVFA 2XXYA 3CSGA 1B7ZA 1RYOA 4ELQA 3V89B 2X7PA 1SYIA 4R74A 1KWHA 1S7YA 4AB6A 2YPNA 2GHAA 1NL5A 4RA1A 1LFHA 2VP1A 1Q1KA 4ESXA 2X26A 5ISUA 4OETA 3UP9A 1IXGA 1TXFA 1OIBA 2DOJA 1B3LA 4OMBA 3KFMA 3EF7A 3D4GA 2ZNUA 3RQTA 3R26A 1SD3A 2RCAA 3LBSA 3UN6A 5CM6A 2ONSA 4AB5A 4HS7A 3U92A 2OWSA 4ZEFA 4NE4A 5I58A 3K00A 3H06B 3B7DA 3W9VA 1MH4A 4RJZA 4UA8A 3MPLA 3ECRA 4BDMA 5AA1A 1AH5A 4FEBA 4MLQA 4ZDMA 2V3UA 4Q30B 3B6WA 4ZEKA 3VV5A 3DP8A 2O1MA 1NNFA 1Y3QA 2RCBA 2VD2A 2D3IA 1SW5A 4PFYA 3FJ7A 1USYH 3K6UA 1MXYA 1LB8A 3GXAA 4R6KA 4KQPA 1LFIA 3S9NC 4IO5A 4ZEDA 3OEMA 4DCXA 4F39A 1SW1A 3EN3A 4M1VA 1FTKA 3OENA 3E4RA 1A54A 3OXNA 4OXVA 1PBPA 4OENA 4QRZA 4BDNA 1WDNA 3FVOA 2XXQA 4O3CA 3TTNA 2DWAA 2O84X 5LOMA 1ZJLA 4DIGA 4MH5A 4QFKA 4GQOA 1P1QA 4UACA 1RKMA 1MDQA 2O6AA 2DE3A 5AA3A 3GBBA 5A5XA 2DWHA 1MS7A 1H43A 4PFWA 5I59A 1FTJA 4HCWA 5FTHA 1M5EA 2QMWA 3TPAA 1H45A 2ZMBA 4ESWA 1SW2A 1FW0A 2Q89A 5H8NA 2I0CA 4I9DA 1Z7ME 1M5CA 1Y1ZA 4LUBA 1IXIA 4G68B 2XX9A 3Q29A 2DS9A 1QJMA 5CMCA 2F6GA 2RC7A 2Q88A 1NNTA 4QFOA 2Q8JA 1SBPA 1VFEA 1D9YA 3C32A 3WAFA 1IXHA 3DP6A 2O51A 4IO2A 5JTYA 3G3JA 4GRKA 1P1OA 1B5JA 4P0GA 1Y3NA 4AQ4A 4E0XA 5IAIA 4R2FA 1S9TA 2F35A 4NF6B 3SESA 3KJ7A 1FQCA 4DXCA 2F8DA 1OQGA 2Y7IA 4H6DA 1B7UA 3C9HA 1B1XA 4LA9A 4H67A 1JVXA 3W15C 3H6TA 2ZNSA 1ZTYA 1MY0A 1UIUA 3FIRA 3OOAA 3O28A 5EHMA 4ND9A 4RYAA 3PD8A 1B4ZA 4F2OA 4LQ2A 5TP9B 1P1WA 4PFTA 1OVTA 4TOZA 4PQJA 4O3AA 5B70A 4ISUA 3Q26A 1TFAA 3Q27A 4KCDA 3LSWA 1N04A 1UTBB 3AXFA 4FIMA 3O9PA 2HXWA 1B4HA 5FHOA 5KDTB 3LSFB 1OLCA 4GFRA 3H7MA 3HN0A 5CRYA 2V93A 4Q0CA 2Z22A 3S9LC 1XVYA 1XVXA 3K1MA 5H8SA 2R6GE 2G93A 5FHNA 1N3XA 3RTFB 3MAMA 3KZGA 3K6XA 3MVWA 4KR5A 3WAEA 5H8QB 4LZ5A 1MXUA 4TLMB 2DWJA 3CI8A 2P2AA 1B5IA 2ANJA 2V3TA 4ZEIA 4F1UA 1MY4A 2FNCA 1LGBC 3O6HA 3LR1A 1B58A 4G8MA 3TTMA 1JW4A 3PMVA 2VD3A 4OEVA 3G3KA 3K0VA 2QMXA 1B7HA 1MH3A 1QUIA 3U72A 3IOUA 3KBRA 2AYSA 4X48A 2AL4A 3UORA 4GWOA 1IUDA 4F31B 2I49A 3BFUA 3OD7A 1SYHA 1MG1A 4U21A 2F7CA 4MFIA 2B3BA 5EYFA 1O64A 4L17A 5DVJA 1US5A 1B3HA 3H6UA 3ZKKA 5ITOA 4DCYA 2ZYKA 4YKIA 2UXAA 2PVUA 1B52A 1ZBMA 2F6PA 4RK9A 5L9SA 2R71A 3GLBA 3IL1B 3MWBA 3K2DA 2DVCA 3VLWA 3SEWA 1I6BA 1MRPA 1SVXB 2DWIA 1TWYA 3BKIB 2HQ0A 4R9FA 4R2BA 4DXUA 4GL0A 3M3LA 3FASA 4OERA 4EQ7A 2QS4A 1I6QA 1PB8A 3MW0A 1HSJA 2E1SA 4OHNA 2O7IA 1A55A 2F7AA 3IORA 3N5LA 5I57A 3FXUA 1JNFA 5KCJA 4U1OA 4WXJA 3RT8A 5KCJB 1B9JA 5L8DA 2NWJA 1B05A 3PPRA 3FV2A 1P99A 3QYTA 1DPEA 2RC8A 2I4CA 3LC8A 3ZKLA 2DE2A 4GL8A 2DP8A 1LBCA 1US4A 3T22A 3DM0A 4EQBA 1MPDA 3QXMA 1VFDA 4M4GA 1POTA 3O29A 1DPPA 4QHQA 2UVJA 3ILUB 2VHAA 2IA4A 1O63A 3USDA 3T9VA 3KOTA 3LSXA 4H8JA 1JW1A 1PB7A 2Y7RA 3OO8A 3KOSA 3THIA 5HPQA 3FD3A 2H98A 4NF5A 3TTKA 1XHYA 3PGFA 2CMOA 4LONB 2H5YA 2PT1A 3BBRA 4IGTA 3HHFA 1J1NA 4POXA 1D3KA 4MF3A 4I8CA 4G2ZA 1A99A 1MY1A 3Q28A 1SDXA 3C34A 4TQUQ 3VVDA 1CB6A 2QSXA 3IJXB 4F1YA 3KSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G29 A;  3A3C A;  3MP8 A;  1Y4C A;  4G4P A;  1B0H A;  1BKA A;  2ZYM A;  5DTB A;  1SI0 A;  4F29 A;  1LCF A;  1DTG A;  2GH9 A;  4JXI A;  2ESN A;  3EQ1 A;  5L9M A;  5I58 B;  1N76 A;  5H8F A;  5CBS A;  4FEC A;  1H3D A;  1UIV A;  3VVF A;  3E3K A;  1B3G A;  3TTL A;  2RKM A;  3FJG A;  3TUS A;  3FVN A;  3PPN A;  4BDQ A;  4WED A;  3TQL A;  1H44 A;  3QUF A;  3E13 X;  4BDL A;  5J1D A;  3O2A A;  4N13 A;  1USY E;  3QUJ A;  4FAJ A;  3L6H A;  4RXL A;  3C31 A;  2DXY A;  5I56 A;  4ELO A;  3U93 A;  1D4N A;  3TKD A;  1S50 A;  1N0T A;  3TOD A;  3PD9 A;  1DSN A;  2ZNT A;  4XTC Q;  1MQJ A;  4MLV A;  4YB5 A;  1MXV A;  4BDR A;  1BP5 A;  4JBZ A;  3T96 B;  1EZO A;  2XX8 A;  1XT8 A;  1A8F A;  3H6V A;  5AE4 A;  3B6T A;  2UYE A;  3P7I A;  1SI1 A;  3JYR A;  1IXC A;  2Z8F A;  3MZ1 A;  4U4S A;  3PUV E;  3VLV A;  3OO7 A;  1NH7 A;  1AMF A;  2H99 A;  4ZEB A;  4KHZ E;  3RPW A;  2D21 A;  1N3W A;  2OCU A;  1QUK A;  4IO7 A;  5I2K A;  4IY5 A;  4FOR A;  4PP0 A;  3ILT B;  5BWJ A;  5A5X B;  4NED A;  2VGQ A;  1XOC A;  4U1Z A;  4KPT A;  4XKQ A;  1MM7 A;  1ZIU A;  3PMW A;  5I59 B;  1LLS A;  3VDF A;  1MQD A;  5ELV A;  1JEV A;  3T66 A;  5FTI A;  5HBC A;  4KYE A;  3ZS6 A;  5H8N B;  2REG A;  4YMA A;  4NF8 A;  5FHM A;  2DVZ A;  4NF8 B;  1A8E A;  1IIT A;  3K4U A;  3S4U A;  4YZZ A;  3W9W A;  4GIZ A;  1AIV A;  3SEU A;  4JWO A;  1QUJ A;  1Y1M A;  3CVG A;  3CFX A;  3IX1 A;  5JTY B;  1MY3 A;  2P1S A;  5DEX A;  4OQO A;  4IB2 A;  1CE2 A;  1B3F A;  3C4M A;  1Q35 A;  1GR2 A;  2QRY A;  3TTR A;  2W7Y A;  3CG1 A;  1MY2 A;  3N94 A;  3RY3 A;  2UVG A;  1B0L A;  4IO6 A;  1A7L A;  2I48 A;  3U1O A;  3HST A;  3R6U A;  3IO6 A;  4EXK A;  4RPO A;  4KCC A;  5CC2 A;  2NXO A;  1BTJ A;  1LAH E;  3RLF E;  1O7T A;  4F3P A;  1R9L A;  2Z23 A;  2YJP A;  3L6G A;  5L9O A;  4NWC A;  3KGC A;  2GHB A;  3V5A A;  3SEX A;  2O69 A;  3ONM A;  3IK6 B;  4XKN A;  3MP6 A;  3K1P A;  4F2Q A;  2OK2 A;  1R1N A;  4I62 A;  1GVC A;  5EHS A;  3TCG A;  2AL5 A;  3FV1 A;  4IY6 A;  2H4I A;  4X1D A;  4XXU A;  2PX1 A;  4FED A;  2VOZ A;  4IGR A;  4OFJ A;  2NVU B;  5IKB A;  2GRV A;  2A5T A;  3MP1 A;  1UTH A;  2A5T B;  3I3V A;  4R6H A;  4Z0I A;  2H9B A;  4QFL A;  3IR1 A;  2XX7 A;  5I2N A;  2CZL A;  3UGW A;  1H76 A;  2HZK A;  5I2N B;  1JEU A;  4GXS B;  3RUM A;  3TCH A;  1NMU A;  3RTW B;  1TFD A;  4ZE8 A;  3IB0 A;  1VE4 A;  3FGS A;  4YB6 A;  2DXR A;  2M8C A;  3C33 A;  1I6A A;  5DYH A;  4U23 A;  2QS3 A;  1ZMG A;  3IB1 A;  3PMX A;  4K3F A;  4WKM A;  3KN3 A;  1I69 A;  4OFL A;  1FQF A;  1JW5 A;  3RNN A;  1LB9 A;  5DT6 A;  1B6H A;  2F7B A;  3MZB A;  2DQV A;  1VSO A;  3IB2 A;  3K01 A;  5F7V A;  4QSE A;  2RF1 A;  1XC1 A;  3BFT A;  4C0R A;  3I5O A;  1BLF A;  2HZL A;  4DXB A;  5B7D A;  3S2V A;  2QPQ A;  1UQW A;  3I6V A;  3N6U A;  4JSD A;  5HM4 B;  4X1B A;  1IIW A;  2OLB A;  1B5H A;  2Z8D A;  2HCA A;  2Q9T A;  3K6V A;  3KG2 A;  4BDO A;  4U2R A;  1QKB A;  1YAE A;  4OES A;  2P0S A;  2DE4 A;  3LUY A;  4KD5 A;  2NOO A;  1FQD A;  2D5W A;  2RC9 A;  2I3V A;  2Y7W A;  5H8H A;  3HO7 A;  1URS A;  5H8H B;  2XD2 A;  5AA4 A;  3O6I A;  3OO6 A;  2XXV A;  5AA4 B;  3N6T A;  4C1U A;  2DSF A;  4YKP A;  3M3K A;  1R9Q A;  1OMP A;  4EF2 A;  4OVJ A;  2ZYN A;  5AA2 D;  4R72 A;  3FVG A;  1B3E A;  3SET A;  4LZ7 A;  1MPB A;  1WOD A;  2WKY A;  4JWY A;  4YMB A;  4LVQ A;  5CMM A;  3GZG A;  4TLL B;  1EH3 A;  1LCT A;  4ZEC A;  3MVY A;  2PT2 A;  5I84 A;  4ECF A;  5I57 B;  4KFQ A;  1T0K A;  5AA2 A;  2I4B A;  1MPC A;  3C35 A;  5JEI A;  1QKA A;  3TEP A;  3OEL A;  2PMS A;  3SEY A;  4N6P A;  3R7X A;  3E9X A;  3TDJ A;  2QS2 A;  4H5F A;  4F22 A;  1URG A;  3H4Z A;  3PPQ A;  3QAX A;  3O66 A;  3G3I A;  2IEE A;  2V3Q A;  3KJT A;  4E0W A;  1QVS A;  1YPN A;  3FVK A;  1Y4T A;  3UIF A;  4U4X A;  4ZZE A;  1A40 A;  4NF5 B;  2O1L A;  3H6W A;  1QUL A;  1II5 A;  2O7U A;  4FE8 A;  3V8X B;  4LZ8 A;  4OYV A;  1M5F A;  4YIC A;  2XXP A;  3CRB A;  1ATG A;  3T9U A;  2O68 A;  3A09 A;  3GBA A;  1LAX A;  1PC3 A;  2OJT A;  3QIM A;  2BJJ X;  2UVH A;  3O6G A;  4JWX A;  1HSL A;  4KI0 E;  4MBP A;  3G3G A;  3IOW A;  2HAU A;  3PU5 A;  3MC2 A;  3MPK A;  3V83 A;  5TU0 A;  3U94 A;  1FQE A;  3N26 A;  4QFN A;  3KN7 A;  5CI5 A;  4XIG Q;  4RK2 A;  2OWT A;  2Y84 A;  4YU0 A;  3ODB A;  4GVO A;  4G77 A;  2XXW A;  5H8F B;  4FAT A;  1GV8 A;  2QS1 A;  3FXR A;  1MQG A;  1F9B A;  1MQH A;  2KLF A;  3IAZ A;  1BIY A;  3EHU A;  4KYD A;  3VXC A;  2V84 A;  4PET A;  3A3U A;  4JSO A;  3RGY A;  3UA8 A;  4QF9 A;  5I56 B;  1EZP A;  3OSR A;  4QSD A;  2F97 A;  5KZT A;  4F1V A;  2ZXT A;  1D9V A;  2XXT A;  4EF1 A;  4F3B A;  3H3G A;  4U22 A;  4ZE9 A;  2OBG A;  1P1U A;  1Y9U A;  3VLU A;  4F3G A;  1LFG A;  1PEB A;  4N07 A;  3K6W A;  3HHG A;  4NMY A;  3ZSF A;  3JV9 A;  1GGG A;  1JQF A;  4EXL A;  2I58 A;  2XXI A;  2XHD A;  4GD5 A;  3H03 A;  1YCJ A;  3PV0 E;  2I3W A;  1ZKB A;  3TMG A;  1NNK A;  3HPI A;  3SEV A;  5I2K B;  3MBP A;  3OMB A;  1NH8 A;  3C36 A;  3IOT A;  1IQ7 A;  3CFL A;  4LP2 B;  3HCQ A;  4R73 A;  2F78 A;  2QL3 A;  2H25 A;  3PUX E;  3M8U A;  3K1N A;  3FJM A;  1FQA A;  1OVB A;  1QW0 A;  2A5S A;  1XS5 A;  1FTM A;  4YKJ A;  4EQ9 A;  3G7W A;  1POY 1;  3VVE A;  4H65 A;  1FQB A;  4IO3 A;  1IEJ A;  3T9X B;  1HSE A;  4RY1 A;  2NUV A;  2PBW A;  4R6Y A;  1B1H A;  1Y3P A;  1N7W A;  3IO4 A;  3PUY E;  2XD3 A;  3PPO A;  2XXU A;  3S9M C;  1YTV A;  4G68 A;  4H5G A;  4THI A;  2REJ A;  3FAT A;  4ZZA A;  1FTO A;  1WVJ A;  2AIX A;  4EUO A;  3PPP A;  1MM6 A;  5DEX B;  2FA7 A;  4QSC A;  4RPN A;  1EU8 A;  1SQY A;  3UK4 A;  3TEL A;  1NFT A;  3MQ9 A;  3B6Q A;  1M5B A;  4G8N A;  2ONK E;  5JK4 A;  3MVX A;  4GOT A;  4HCY A;  1SW4 A;  2UVI A;  4I1D A;  1LAF E;  2Y7K A;  4NF6 A;  4JDF A;  4YB7 A;  3O97 A;  4PE5 B;  1GTK A;  4QFP A;  4Z7E A;  1DOT A;  4JB7 A;  4LQ5 A;  2THI A;  4NTL A;  3VFJ A;  1AOV A;  3T9H B;  3JZJ A;  2PYY A;  4WEP A;  2DYX A;  3IJO B;  2I6E A;  3SKP A;  3CFZ A;  5TP9 A;  3OEK A;  4ZS9 A;  3G3H A;  3PUW E;  3OO9 A;  4ELP A;  4H0W A;  3DEL B;  5K2X A;  1P1N A;  1UTB A;  1N84 A;  2R9J A;  5KDT A;  1B51 A;  3T93 B;  2HEU A;  1ZLQ A;  5ITP A;  1PB9 A;  3EHS A;  1OLA A;  1UTH B;  1EZ9 A;  1TT1 A;  3MVZ A;  3LSL A;  4LAT A;  5F1Q A;  4HTG A;  3DLN A;  2XXH A;  5M2V A;  3FZV A;  4BLA A;  4IO4 A;  4POW A;  2F34 A;  3D4C A;  4F19 A;  5CBR A;  4ELR A;  2HAV A;  4Q5T A;  5DVI A;  1JET A;  1LST A;  3DP4 A;  4FJP A;  3G3F A;  4Q8R A;  1MDP 1;  2GFE A;  5H8Q A;  3MZ9 A;  1OQH A;  3TCF A;  1N7X A;  2FYI A;  3OSQ A;  4OFO A;  1B46 A;  2XXR A;  4R75 A;  4G68 C;  3K02 A;  1AL3 A;  4YAH X;  2E0S A;  2Q2C A;  1MXX A;  1ELJ A;  4H1X A;  1LAG E;  1R6Z A;  1PBQ A;  1FCK A;  5K2Y A;  2Q2A A;  2V25 A;  4ONY A;  2Y7P A;  4F18 A;  2ABH A;  4P11 A;  5CMB A;  3FXQ A;  1URD A;  4DE8 A;  4GLI A;  5BUU A;  4OWD A;  4RNS A;  4YKK A;  4R9G A;  4PFU A;  3TFL A;  5ICQ A;  2F36 A;  3VE1 B;  3CIJ A;  3SDF A;  2OZZ A;  1PDA A;  1M5D A;  1DMB A;  4G8H A;  1FTL A;  3RT6 B;  2ZYO A;  2B65 A;  4DZ1 A;  3KEI A;  3M3F A;  1ANF A;  1B40 A;  3F11 A;  3MUQ A;  4EDP A;  1IZ1 A;  4C1T A;  2LAO A;  4O3B A;  3KSJ A;  1MQI A;  3PUZ E;  1LBB A;  4DDD A;  3FUZ A;  1JVY A;  1B2H A;  4NWD A;  4OTE A;  3EPE A;  2X7Q A;  4H8I A;  5CMK A;  4XKR A;  3QSL A;  1MXZ A;  5TPA A;  2F5X A;  1DTZ A;  5TPA B;  3CG3 A;  2Z8E A;  2HFB A;  3IOV A;  2UYF A;  1VR5 A;  1B32 A;  2RIN A;  3TAJ A;  4GXA A;  1Z7N E;  4OZ9 A;  3TZA A;  3TYH A;  3QK6 A;  5AA2 B;  3S9E A;  4HW8 A;  3TQW A;  1ZU0 A;  3CR9 A;  1MXW A;  1NKX A;  3KN8 A;  4GF8 A;  4NF4 A;  4NF4 B;  3VXB A;  2B3F A;  3EHT A;  1L5T A;  4F3S A;  3SER A;  4KYS A;  3U8Q A;  5ICT A;  2I0B A;  4XKP A;  1RYX A;  3MJN A;  4OEU A;  3Q25 A;  1NNP A;  2ONR A;  4P0I A;  2ALU A;  3HV1 A;  4X9T A;  4DLD A;  2YLN A;  2QJE A;  3RN8 A;  2XXX A;  1Y20 A;  3CSB A;  5DVF A;  2XXY A;  3CSG A;  1B7Z A;  1RYO A;  4ELQ A;  3V89 B;  2X7P A;  1SYI A;  4R74 A;  1KWH A;  1S7Y A;  4AB6 A;  2YPN A;  2GHA A;  1NL5 A;  4RA1 A;  1LFH A;  2VP1 A;  1Q1K A;  4ESX A;  2X26 A;  5ISU A;  4OET A;  3UP9 A;  1IXG A;  1TXF A;  1OIB A;  2DOJ A;  1B3L A;  4OMB A;  3KFM A;  3EF7 A;  3D4G A;  2ZNU A;  3RQT A;  3R26 A;  1SD3 A;  2RCA A;  3LBS A;  3UN6 A;  5CM6 A;  2ONS A;  4AB5 A;  4HS7 A;  3U92 A;  2OWS A;  4ZEF A;  4NE4 A;  5I58 A;  3K00 A;  3H06 B;  3B7D A;  3W9V A;  1MH4 A;  4RJZ A;  4UA8 A;  3MPL A;  3ECR A;  4BDM A;  5AA1 A;  1AH5 A;  4FEB A;  4MLQ A;  4ZDM A;  2V3U A;  4Q30 B;  3B6W A;  4ZEK A;  3VV5 A;  3DP8 A;  2O1M A;  1NNF A;  1Y3Q A;  2RCB A;  2VD2 A;  2D3I A;  1SW5 A;  4PFY A;  3FJ7 A;  1USY H;  3K6U A;  1MXY A;  1LB8 A;  3GXA A;  4R6K A;  4KQP A;  1LFI A;  3S9N C;  4IO5 A;  4ZED A;  3OEM A;  4DCX A;  4F39 A;  1SW1 A;  3EN3 A;  4M1V A;  1FTK A;  3OEN A;  3E4R A;  1A54 A;  3OXN A;  4OXV A;  1PBP A;  4OEN A;  4QRZ A;  4BDN A;  1WDN A;  3FVO A;  2XXQ A;  4O3C A;  3TTN A;  2DWA A;  2O84 X;  5LOM A;  1ZJL A;  4DIG A;  4MH5 A;  4QFK A;  4GQO A;  1P1Q A;  4UAC A;  1RKM A;  1MDQ A;  2O6A A;  2DE3 A;  5AA3 A;  3GBB A;  5A5X A;  2DWH A;  1MS7 A;  1H43 A;  4PFW A;  5I59 A;  1FTJ A;  4HCW A;  5FTH A;  1M5E A;  2QMW A;  3TPA A;  1H45 A;  2ZMB A;  4ESW A;  1SW2 A;  1FW0 A;  2Q89 A;  5H8N A;  2I0C A;  4I9D A;  1Z7M E;  1M5C A;  1Y1Z A;  4LUB A;  1IXI A;  4G68 B;  2XX9 A;  3Q29 A;  2DS9 A;  1QJM A;  5CMC A;  2F6G A;  2RC7 A;  2Q88 A;  1NNT A;  4QFO A;  2Q8J A;  1SBP A;  1VFE A;  1D9Y A;  3C32 A;  3WAF A;  1IXH A;  3DP6 A;  2O51 A;  4IO2 A;  5JTY A;  3G3J A;  4GRK A;  1P1O A;  1B5J A;  4P0G A;  1Y3N A;  4AQ4 A;  4E0X A;  5IAI A;  4R2F A;  1S9T A;  2F35 A;  4NF6 B;  3SES A;  3KJ7 A;  1FQC A;  4DXC A;  2F8D A;  1OQG A;  2Y7I A;  4H6D A;  1B7U A;  3C9H A;  1B1X A;  4LA9 A;  4H67 A;  1JVX A;  3W15 C;  3H6T A;  2ZNS A;  1ZTY A;  1MY0 A;  1UIU A;  3FIR A;  3OOA A;  3O28 A;  5EHM A;  4ND9 A;  4RYA A;  3PD8 A;  1B4Z A;  4F2O A;  4LQ2 A;  5TP9 B;  1P1W A;  4PFT A;  1OVT A;  4TOZ A;  4PQJ A;  4O3A A;  5B70 A;  4ISU A;  3Q26 A;  1TFA A;  3Q27 A;  4KCD A;  3LSW A;  1N04 A;  1UTB B;  3AXF A;  4FIM A;  3O9P A;  2HXW A;  1B4H A;  5FHO A;  5KDT B;  3LSF B;  1OLC A;  4GFR A;  3H7M A;  3HN0 A;  5CRY A;  2V93 A;  4Q0C A;  2Z22 A;  3S9L C;  1XVY A;  1XVX A;  3K1M A;  5H8S A;  2R6G E;  2G93 A;  5FHN A;  1N3X A;  3RTF B;  3MAM A;  3KZG A;  3K6X A;  3MVW A;  4KR5 A;  3WAE A;  5H8Q B;  4LZ5 A;  1MXU A;  4TLM B;  2DWJ A;  3CI8 A;  2P2A A;  1B5I A;  2ANJ A;  2V3T A;  4ZEI A;  4F1U A;  1MY4 A;  2FNC A;  1LGB C;  3O6H A;  3LR1 A;  1B58 A;  4G8M A;  3TTM A;  1JW4 A;  3PMV A;  2VD3 A;  4OEV A;  3G3K A;  3K0V A;  2QMX A;  1B7H A;  1MH3 A;  1QUI A;  3U72 A;  3IOU A;  3KBR A;  2AYS A;  4X48 A;  2AL4 A;  3UOR A;  4GWO A;  1IUD A;  4F31 B;  2I49 A;  3BFU A;  3OD7 A;  1SYH A;  1MG1 A;  4U21 A;  2F7C A;  4MFI A;  2B3B A;  5EYF A;  1O64 A;  4L17 A;  5DVJ A;  1US5 A;  1B3H A;  3H6U A;  3ZKK A;  5ITO A;  4DCY A;  2ZYK A;  4YKI A;  2UXA A;  2PVU A;  1B52 A;  1ZBM A;  2F6P A;  4RK9 A;  5L9S A;  2R71 A;  3GLB A;  3IL1 B;  3MWB A;  3K2D A;  2DVC A;  3VLW A;  3SEW A;  1I6B A;  1MRP A;  1SVX B;  2DWI A;  1TWY A;  3BKI B;  2HQ0 A;  4R9F A;  4R2B A;  4DXU A;  4GL0 A;  3M3L A;  3FAS A;  4OER A;  4EQ7 A;  2QS4 A;  1I6Q A;  1PB8 A;  3MW0 A;  1HSJ A;  2E1S A;  4OHN A;  2O7I A;  1A55 A;  2F7A A;  3IOR A;  3N5L A;  5I57 A;  3FXU A;  1JNF A;  5KCJ A;  4U1O A;  4WXJ A;  3RT8 A;  5KCJ B;  1B9J A;  5L8D A;  2NWJ A;  1B05 A;  3PPR A;  3FV2 A;  1P99 A;  3QYT A;  1DPE A;  2RC8 A;  2I4C A;  3LC8 A;  3ZKL A;  2DE2 A;  4GL8 A;  2DP8 A;  1LBC A;  1US4 A;  3T22 A;  3DM0 A;  4EQB A;  1MPD A;  3QXM A;  1VFD A;  4M4G A;  1POT A;  3O29 A;  1DPP A;  4QHQ A;  2UVJ A;  3ILU B;  2VHA A;  2IA4 A;  1O63 A;  3USD A;  3T9V A;  3KOT A;  3LSX A;  4H8J A;  1JW1 A;  1PB7 A;  2Y7R A;  3OO8 A;  3KOS A;  3THI A;  5HPQ A;  3FD3 A;  2H98 A;  4NF5 A;  3TTK A;  1XHY A;  3PGF A;  2CMO A;  4LON B;  2H5Y A;  2PT1 A;  3BBR A;  4IGT A;  3HHF A;  1J1N A;  4POX A;  1D3K A;  4MF3 A;  4I8C A;  4G2Z A;  1A99 A;  1MY1 A;  3Q28 A;  1SDX A;  3C34 A;  4TQU Q;  3VVD A;  1CB6 A;  2QSX A;  3IJX B;  4F1Y A;  3KSX A; 
#chains in the Genus database with same CATH topology
 2G29 A;  1NV7 A;  3A3C A;  3MP8 A;  1Y4C A;  4G4P A;  1B0H A;  1BKA A;  2ZYM A;  1FPG A;  5DTB A;  1SI0 A;  4F29 A;  1LCF A;  1DTG A;  2GH9 A;  4JXI A;  2ESN A;  3EQ1 A;  5L9M A;  5I58 B;  1N76 A;  5H8F A;  5CBS A;  4FEC A;  1H3D A;  1UIV A;  4P47 A;  3VVF A;  3E3K A;  1B3G A;  3TTL A;  2RKM A;  2B4L A;  3FJG A;  3TUS A;  3FVN A;  3PPN A;  4DI3 D;  4BDQ A;  2XXK A;  4WED A;  3TQL A;  1H44 A;  3QUF A;  5A5L A;  3E13 X;  4BDL A;  5J1D A;  3O2A A;  4N13 A;  1USY E;  3QUJ A;  4FAJ A;  3L6H A;  4RXL A;  3C31 A;  2DXY A;  5I56 A;  4OAN A;  4ELO A;  3U93 A;  4HE2 A;  3D1R A;  1D4N A;  3TKD A;  1NV2 A;  1S50 A;  2Y5K A;  3LUZ A;  1N0T A;  3TOD A;  3PD9 A;  2P3N A;  1DSN A;  2ZNT A;  4XTC Q;  1MQJ A;  1FPF A;  3SZP A;  4MLV A;  1BK4 A;  4YB5 A;  1MXV A;  4BDR A;  1BP5 A;  4JBZ A;  3T96 B;  1EZO A;  2XX8 A;  1XT8 A;  1A8F A;  1FPE A;  3H6V A;  5AE4 A;  3B6T A;  2UYE A;  3BIG A;  3P7I A;  1SI1 A;  3JYR A;  5EQ7 A;  1IXC A;  3MYU A;  2Z8F A;  3MZ1 A;  4U4S A;  3PUV E;  3VLV A;  3OO7 A;  1NH7 A;  1AMF A;  2H99 A;  4ZEB A;  4KHZ E;  3RPW A;  2D21 A;  1N3W A;  2OCU A;  1QUK A;  4IO7 A;  1YZ0 A;  5IZ1 A;  5I2K A;  4IY5 A;  4FOR A;  4PP0 A;  4GWU A;  3ILT B;  5BWJ A;  5A5X B;  4NED A;  2VGQ A;  1XOC A;  4U1Z A;  4KPT A;  4XKQ A;  1MM7 A;  1ZIU A;  3PMW A;  5I59 B;  1LLS A;  3VDF A;  1MQD A;  5ELV A;  4PE3 A;  2XWV A;  1JEV A;  3T66 A;  5FTI A;  5HBC A;  4KYE A;  3ZS6 A;  5H8N B;  4MNP A;  2REG A;  1AWB A;  4YMA A;  4NF8 A;  5FHM A;  2DVZ A;  5DW8 A;  4NF8 B;  1A8E A;  5T3J A;  1IIT A;  3K4U A;  3S4U A;  4YZZ A;  3W9W A;  4GIZ A;  1AIV A;  3SEU A;  1FJ9 A;  4JWO A;  1QUJ A;  2XWK A;  1Y1M A;  3CVG A;  3CFX A;  3NOH A;  5IZ3 A;  3IX1 A;  5JTY B;  1MY3 A;  2P1S A;  5DEX A;  4OQO A;  4IB2 A;  5EQA A;  1CE2 A;  1B3F A;  3C4M A;  1Q35 A;  2WYP A;  1GR2 A;  2QRY A;  3TTR A;  2KR0 A;  2W7Y A;  3CG1 A;  4PAK A;  1MY2 A;  3N94 A;  3RY3 A;  1FTA A;  2UVG A;  1B0L A;  4IO6 A;  4AS5 A;  1A7L A;  2I48 A;  5I3S A;  3U1O A;  3HST A;  3R6U A;  3IO6 A;  4X8R A;  3U65 A;  4EXK A;  4RPO A;  4KCC A;  5CC2 A;  2NXO A;  1BTJ A;  1LAH E;  3RLF E;  1O7T A;  4F3P A;  1R9L A;  2Z23 A;  2YJP A;  3L6G A;  5L9O A;  1RDY A;  4NWC A;  3KGC A;  2GHB A;  3V5A A;  3SEX A;  2O69 A;  3ONM A;  5LDZ A;  3RPL B;  3IK6 B;  4XKN A;  3MP6 A;  3K1P A;  4F2Q A;  2OK2 A;  1R1N A;  5F24 A;  4I62 A;  1GVC A;  5EHS A;  3TCG A;  2AL5 A;  3FV1 A;  4IY6 A;  2H4I A;  4X1D A;  4XXU A;  2PX1 A;  3BIH A;  4FED A;  4NG7 A;  2VOZ A;  4IGR A;  4OFJ A;  2NVU B;  5IKB A;  2GRV A;  2A5T A;  3MP1 A;  1UTH A;  2A5T B;  3I3V A;  4HE0 A;  4R6H A;  4Z0I A;  2H9B A;  4QFL A;  3IR1 A;  2XX7 A;  5I2N A;  2CZL A;  3UGW A;  1H76 A;  2HZK A;  5I2N B;  1INP A;  1NV5 A;  1JEU A;  4GXS B;  3RUM A;  3TCH A;  1NMU A;  3RTW B;  1TFD A;  4ZE8 A;  3IB0 A;  1VE4 A;  3FGS A;  4YB6 A;  2DXR A;  2M8C A;  3C33 A;  2QFL A;  4PF8 A;  1I6A A;  5DYH A;  4U23 A;  3T1B A;  2QS3 A;  1NV4 A;  1ZMG A;  3IB1 A;  3PMX A;  4K3F A;  4MX6 A;  4WKM A;  3KN3 A;  4NGU A;  1I69 A;  4OFL A;  1FQF A;  1JW5 A;  3RNN A;  1LB9 A;  5DT6 A;  1B6H A;  2F7B A;  3MZB A;  2DQV A;  1VSO A;  3IB2 A;  3K01 A;  5F7V A;  4QSE A;  2RF1 A;  1XC1 A;  3BFT A;  4C0R A;  3I5O A;  4GX3 A;  1BLF A;  2HZL A;  4DI4 B;  4DXB A;  2WX9 A;  5B7D A;  3S2V A;  1NI9 A;  2QPQ A;  4GX6 A;  1UQW A;  3I6V A;  1FBH A;  3N6U A;  1LEV A;  4JSD A;  5HM4 B;  4PAF A;  4X1B A;  1IIW A;  2OLB A;  1FBG A;  1B5H A;  2Z8D A;  2HCA A;  2Q9T A;  3K6V A;  3KG2 A;  4BDO A;  4U2R A;  3ROJ A;  1QKB A;  1YAE A;  4OES A;  2P0S A;  2DE4 A;  3LUY A;  4KD5 A;  2NOO A;  1NUW A;  1FQD A;  2D5W A;  2RC9 A;  2I3V A;  2Y7W A;  5H8H A;  2XWI A;  3HO7 A;  1URS A;  4OA4 A;  5H8H B;  2XD2 A;  5AA4 A;  3O6I A;  3OO6 A;  2XXV A;  5AA4 B;  3N6T A;  4C1U A;  2Q74 A;  2DSF A;  4YKP A;  2XA5 A;  3M3K A;  1R9Q A;  1OMP A;  4EF2 A;  4OVJ A;  2ZYN A;  5AA2 D;  4R72 A;  3FVG A;  1B3E A;  3SET A;  4LZ7 A;  1MPB A;  1WOD A;  2WKY A;  4JWY A;  4O7I A;  4YMB A;  4LVQ A;  5CMM A;  3GZG A;  4TLL B;  1EH3 A;  1LCT A;  4ZEC A;  3MVY A;  2PT2 A;  1QGX A;  5I84 A;  4ECF A;  4PTK A;  5I57 B;  4KFQ A;  1T0K A;  3B8B A;  5AA2 A;  2I4B A;  1MPC A;  3C35 A;  5JEI A;  3E78 A;  1QKA A;  1KA0 A;  3TEP A;  3OEL A;  2PMS A;  3SEY A;  4GWS A;  4N6P A;  3R7X A;  3E9X A;  3TDJ A;  2QS2 A;  4H5F A;  4F22 A;  1URG A;  3H4Z A;  3PPQ A;  3QAX A;  3O66 A;  3G3I A;  2FHY A;  2Q8M A;  2IEE A;  2V3Q A;  3KJT A;  4E0W A;  1QVS A;  1YPN A;  2WEF A;  1Y4T A;  3FVK A;  1RDX A;  4LN5 A;  3UIF A;  5ESY A;  4U4X A;  4MEV A;  4ZZE A;  1A40 A;  1NV6 A;  4NF5 B;  2O1L A;  3H6W A;  1QUL A;  1II5 A;  2O7U A;  4FE8 A;  3V8X B;  4LZ8 A;  4UAB A;  4OYV A;  1M5F A;  4YIC A;  2XXP A;  4HXV A;  4XF5 A;  3CRB A;  1FJ6 A;  1ATG A;  3T9U A;  2O68 A;  3A09 A;  3GBA A;  1LAX A;  1PC3 A;  2OJT A;  3QIM A;  4MNC A;  2BJJ X;  2UVH A;  3O6G A;  4JWX A;  1HSL A;  4KI0 E;  4MMP A;  2V4C A;  4MBP A;  3G3G A;  3IOW A;  2HAU A;  3PU5 A;  3MC2 A;  3MPK A;  3V83 A;  1LBW A;  5TU0 A;  3U94 A;  1FQE A;  4AS4 A;  3N26 A;  2P3V A;  4QFN A;  3KN7 A;  5CI5 A;  4XIG Q;  4RK2 A;  2OWT A;  2Y84 A;  4YU0 A;  4NX1 A;  3ODB A;  4GVO A;  4G77 A;  2CZI A;  2XXW A;  5H8F B;  4FAT A;  1GV8 A;  3HFU A;  2MKZ A;  2QS1 A;  3FXR A;  1MQG A;  1F9B A;  1MQH A;  2KLF A;  3IAZ A;  2HXR A;  1BIY A;  3FBP A;  3EHU A;  4HE1 A;  4KYD A;  3VXC A;  4OVQ A;  1DCU A;  2V84 A;  4PET A;  3A3U A;  4JSO A;  3RGY A;  3UA8 A;  4QF9 A;  4GWZ A;  5I56 B;  1EZP A;  3OSR A;  4QSD A;  2F97 A;  5KZT A;  4F1V A;  2ZXT A;  1D9V A;  2XXT A;  4EF1 A;  4F3B A;  3H3G A;  4PBH A;  4U22 A;  4ZE9 A;  2OBG A;  1P1U A;  1Y9U A;  3VLU A;  4OVP A;  4F3G A;  1LFG A;  1PEB A;  4N07 A;  3K6W A;  2PFZ A;  3HHG A;  4NMY A;  3ZSF A;  3JV9 A;  1GGG A;  1JQF A;  4EXL A;  2I58 A;  2XXI A;  2XHD A;  4GD5 A;  3H03 A;  1YCJ A;  3PV0 E;  2I3W A;  4PDH A;  1ZKB A;  3TMG A;  1YYZ A;  1NNK A;  4OVR A;  3HPI A;  4PF6 A;  4NN3 A;  3SEV A;  1K9Y A;  5I2K B;  3MBP A;  3OMB A;  1NH8 A;  3C36 A;  3IOT A;  1IQ7 A;  3CFL A;  5FBP A;  4LP2 B;  3HCQ A;  4R73 A;  2F78 A;  2QL3 A;  2CEY A;  2H25 A;  4PGN A;  3PUX E;  3M8U A;  3K1N A;  3FJM A;  1FQA A;  5EQ9 A;  1OVB A;  1QW0 A;  2A5S A;  3QMF A;  1XS5 A;  1FTM A;  4YKJ A;  4EQ9 A;  3G7W A;  1POY 1;  3VVE A;  4H65 A;  1FQB A;  2PCR A;  4GWW A;  4IO3 A;  1FPK A;  1IEJ A;  3T9X B;  5LTC A;  1HSE A;  4RY1 A;  2NUV A;  2PBW A;  4R6Y A;  1B1H A;  1Y3P A;  1CNQ A;  1N7W A;  3IO4 A;  3PUY E;  2XD3 A;  3PPO A;  2XXU A;  3S9M C;  1YTV A;  4G68 A;  4H5G A;  4THI A;  4NF0 A;  2REJ A;  3FAT A;  4ZZA A;  1FTO A;  1WVJ A;  2AIX A;  5IZ3 B;  3PPP A;  4EUO A;  1MM6 A;  5DEX B;  2FA7 A;  4QSC A;  4RPN A;  1EU8 A;  1SQY A;  3UK4 A;  4XEQ A;  3TEL A;  3B50 A;  1K9Z A;  1NFT A;  3MQ9 A;  3B6Q A;  1M5B A;  4G8N A;  2ONK E;  4N8Y A;  5JK4 A;  3MVX A;  4GOT A;  4HCY A;  1SW4 A;  2UVI A;  2GQ1 A;  1LAF E;  2Y7K A;  4I1D A;  4JDF A;  4NF6 A;  4YB7 A;  3O97 A;  4PE5 B;  1GTK A;  4P1E A;  4QFP A;  4Z7E A;  1DOT A;  3ISP A;  4JB7 A;  4LQ5 A;  2THI A;  4NTL A;  3VFJ A;  3A29 A;  1FRP A;  4NHB A;  1LBX A;  5J16 A;  1AOV A;  2ZZW A;  3T9H B;  3JZJ A;  2PYY A;  4WEP A;  2DYX A;  3IJO B;  2I6E A;  3SKP A;  2FIX A;  3CFZ A;  5TP9 A;  4QXD A;  3OEK A;  4ZS9 A;  3G3H A;  3PUW E;  3OO9 A;  4ELP A;  1VDW A;  4H0W A;  3DEL B;  5K2X A;  1P1N A;  1NV3 A;  1UTB A;  1N84 A;  2R9J A;  4I3Y A;  5KDT A;  2VPO A;  1B51 A;  3T93 B;  2HEU A;  1ZLQ A;  5ITP A;  1PB9 A;  3EHS A;  5EYG A;  1OLA A;  1UTH B;  1EZ9 A;  1TT1 A;  3MVZ A;  3LSL A;  4LAT A;  5F1Q A;  4HTG A;  3DLN A;  2XXH A;  5M2V A;  3FZV A;  4BLA A;  4IO4 A;  4POW A;  2F34 A;  3D4C A;  4F19 A;  5CBR A;  4H45 A;  4ELR A;  2HAV A;  4Q5T A;  5DVI A;  1KZ8 A;  1JET A;  1LST A;  3DP4 A;  4FJP A;  3G3F A;  4Q8R A;  1MDP 1;  2GFE A;  5H8Q A;  3MZ9 A;  1OQH A;  3TCF A;  1N7X A;  2FYI A;  3OSQ A;  4OFO A;  1B46 A;  2XXR A;  4R75 A;  4G68 C;  3FXB A;  3K02 A;  3KC0 A;  1AL3 A;  4YAH X;  2E0S A;  2HHM A;  2Q2C A;  1MXX A;  1ELJ A;  4H1X A;  1LAG E;  1R6Z A;  1PBQ A;  1FCK A;  3PTY A;  5K2Y A;  2Q2A A;  1FPB A;  2V25 A;  4ONY A;  2Y7P A;  4F18 A;  2ABH A;  4P11 A;  5CMB A;  4PFR A;  3FXQ A;  4P8B A;  1URD A;  4DE8 A;  4GLI A;  5BUU A;  4OWD A;  4RNS A;  4YKK A;  4R9G A;  4PFU A;  3TFL A;  5ICQ A;  4GWX A;  2F36 A;  3VE1 B;  3CIJ A;  3SDF A;  4MNI A;  1FSA A;  2OZZ A;  1PDA A;  1M5D A;  1DMB A;  4FBP A;  4G8H A;  1FTL A;  3RT6 B;  2ZYO A;  4N91 A;  2B65 A;  2QVU A;  2ZZV A;  4DZ1 A;  3KEI A;  3M3F A;  1IMA A;  1ANF A;  1B40 A;  3F11 A;  3MUQ A;  4EDP A;  1IZ1 A;  4GBV A;  4C1T A;  4X04 A;  2LAO A;  4O3B A;  3KSJ A;  4PDD A;  1MQI A;  1NUZ A;  3PUZ E;  1LBB A;  4DDD A;  4N15 A;  3FUZ A;  1JVY A;  1B2H A;  4NWD A;  4OTE A;  3EPE A;  2X7Q A;  4H8I A;  5CMK A;  4XKR A;  3QSL A;  1MXZ A;  5TPA A;  2F5X A;  1DTZ A;  1IMF A;  1NUY A;  5TPA B;  3CG3 A;  2Z8E A;  2HFB A;  3IOV A;  2UYF A;  1VR5 A;  1B32 A;  2RIN A;  3TAJ A;  4GXA A;  1Z7N E;  4OZ9 A;  3TZA A;  3TYH A;  3QK6 A;  5AA2 B;  3S9E A;  4HW8 A;  3TQW A;  4I3E A;  1ZU0 A;  3CR9 A;  4PFI A;  1MXW A;  1NKX A;  3KN8 A;  4GF8 A;  1XI6 A;  4NF4 A;  4PBQ A;  4NF4 B;  3VXB A;  2B3F A;  3EHT A;  1L5T A;  4F3S A;  3SER A;  4KYS A;  3U8Q A;  5ICT A;  2I0B A;  4XKP A;  1RYX A;  3MJN A;  4OEU A;  4GWY A;  3Q25 A;  1NNP A;  2ONR A;  4P0I A;  1JP4 A;  1EYI A;  2BJI A;  2ALU A;  3HV1 A;  1FBD A;  4X9T A;  4DLD A;  2YLN A;  2QJE A;  3RN8 A;  1FPD A;  2ZZX A;  4P56 A;  2XXX A;  5ET7 A;  1Y20 A;  3CSB A;  5DVF A;  2XXY A;  3CSG A;  1B7Z A;  1RYO A;  3V89 B;  4ELQ A;  2X7P A;  3CHG A;  1SYI A;  4R74 A;  1KWH A;  1S7Y A;  2JJK A;  4AB6 A;  4GBW A;  2DDK A;  2YPN A;  2GHA A;  1NL5 A;  4RA1 A;  1LFH A;  2VP1 A;  1Q1K A;  4ESX A;  2HPG A;  2X26 A;  5ISU A;  2OX3 A;  4OET A;  3UP9 A;  2B4M A;  1DBZ A;  1IXG A;  1TXF A;  1OIB A;  2QVV A;  2DOJ A;  1B3L A;  4OMB A;  3KFM A;  3EF7 A;  2WBB A;  3D4G A;  5ET8 A;  2ZNU A;  3RQT A;  3R26 A;  1SD3 A;  2RCA A;  5EQ8 A;  1Q9D A;  3LBS A;  3UN6 A;  5CM6 A;  2ONS A;  4AB5 A;  1G0I A;  4HS7 A;  3U92 A;  2OWS A;  4ZEF A;  1G0H A;  4NE4 A;  5I58 A;  3K00 A;  3E79 A;  3H06 B;  3B7D A;  3W9V A;  1MH4 A;  4RJZ A;  4UA8 A;  3MPL A;  4PFB A;  2WYK A;  3ECR A;  4BDM A;  5AA1 A;  1AH5 A;  4FEB A;  4MLQ A;  4ZDM A;  2V3U A;  4Q30 B;  3B6W A;  4ZEK A;  3VV5 A;  3DP8 A;  2O1M A;  1NNF A;  2CZH A;  1Y3Q A;  4O8M A;  2RCB A;  2VD2 A;  2D3I A;  1SW5 A;  3IFA A;  3RYD A;  1FPI A;  5ET6 A;  4PFY A;  3FJ7 A;  1USY H;  4P3L A;  3K6U A;  1MXY A;  1LB8 A;  3GXA A;  4R6K A;  4IR8 A;  4KQP A;  1LFI A;  3S9N C;  4IO5 A;  4ZED A;  3OEM A;  4MCO A;  4DCX A;  4F39 A;  1LBZ A;  1SW1 A;  3EN3 A;  4M1V A;  1FTK A;  3OEN A;  1LBY A;  4O94 A;  3E4R A;  1A54 A;  4PCD A;  3OXN A;  4OXV A;  1PBP A;  4OEN A;  4QRZ A;  4BDN A;  1WDN A;  3FVO A;  2XXQ A;  4O3C A;  3TTN A;  2FIE A;  2R8T A;  5EYH A;  2DWA A;  1DK4 A;  2O84 X;  5LOM A;  1ZJL A;  4DIG A;  4MH5 A;  4QFK A;  4GQO A;  1P1Q A;  4UAC A;  2FBP A;  2Y5L A;  1RKM A;  1MDQ A;  2O6A A;  2DE3 A;  3KC1 A;  1NUX A;  5AA3 A;  3GBB A;  5A5X A;  3EKI A;  2DWH A;  1MS7 A;  1RDZ A;  1H43 A;  4PFW A;  5I59 A;  1FTJ A;  4HCW A;  5FTH A;  1M5E A;  2QMW A;  3TPA A;  1H45 A;  2ZMB A;  4ESW A;  1SW2 A;  4N81 A;  1FW0 A;  2Q89 A;  5H8N A;  2I0C A;  4I9D A;  1Z7M E;  1M5C A;  1Y1Z A;  4O7M A;  4LUB A;  1IXI A;  4G68 B;  1IMB A;  2XX9 A;  3Q29 A;  2KQZ A;  2DS9 A;  1QJM A;  5CMC A;  2F6G A;  5IM2 A;  2RC7 A;  2Q88 A;  1NNT A;  4QFO A;  2Q8J A;  1SBP A;  4NQ8 A;  1FBE A;  1VFE A;  1D9Y A;  3C32 A;  3GYY A;  3WAF A;  1IXH A;  2XWO A;  3DP6 A;  2O51 A;  4IO2 A;  5JTY A;  3G3J A;  4GRK A;  1P1O A;  1B5J A;  4QBA A;  4P0G A;  4N6D A;  1Y3N A;  4GX4 A;  4AQ4 A;  4N8G A;  3MST A;  4E0X A;  5IAI A;  4R2F A;  1S9T A;  2F35 A;  4NF6 B;  3SES A;  3KJ7 A;  1FQC A;  2L5V A;  4DXC A;  2F8D A;  1OQG A;  2Y7I A;  4H6D A;  1B7U A;  3C9H A;  1B1X A;  4LA9 A;  4H67 A;  1JVX A;  3W15 C;  4PGP A;  3H6T A;  3IFC A;  2ZNS A;  1ZTY A;  4MAG A;  1MY0 A;  1UIU A;  3FIR A;  3OOA A;  3O28 A;  5EHM A;  4ND9 A;  4RYA A;  3PD8 A;  4P9K A;  1B4Z A;  3RPL A;  4F2O A;  4LQ2 A;  2FVZ A;  5TP9 B;  2VT5 A;  1P1W A;  4PFT A;  1OVT A;  4TOZ A;  4PQJ A;  1NV0 A;  4O3A A;  5B70 A;  4ISU A;  3KBZ A;  3Q26 A;  1TFA A;  3Q27 A;  4KCD A;  3LSW A;  1N04 A;  1UTB B;  1EYJ A;  3AXF A;  3O9P A;  4FIM A;  2HXW A;  1B4H A;  5FHO A;  5KDT B;  3LSF B;  1OLC A;  4GFR A;  3H7M A;  3HN0 A;  5CRY A;  2V93 A;  4Q0C A;  2Z22 A;  3S9L C;  1XVY A;  1XVX A;  3K1M A;  5H8S A;  2R6G E;  2G93 A;  5FHN A;  1N3X A;  3RTF B;  3MAM A;  3KZG A;  1YXI A;  4OVS A;  3K6X A;  3MVW A;  4KR5 A;  3WAE A;  5H8Q B;  4LZ5 A;  1MXU A;  4TLM B;  2DWJ A;  3CI8 A;  4MHF A;  2P2A A;  5IZZ A;  1B5I A;  2ANJ A;  2V3T A;  4N4U A;  4ZEI A;  1IMD A;  4F1U A;  1MY4 A;  2FNC A;  1LGB C;  3O6H A;  3LR1 A;  5IGA A;  1B58 A;  4G8M A;  5I7I A;  3TTM A;  1JW4 A;  3PMV A;  2VD3 A;  4OEV A;  1FBC A;  3G3K A;  3K0V A;  2QMX A;  1B7H A;  4H46 A;  1MH3 A;  2CZK A;  4PC9 A;  1QUI A;  3U72 A;  3IOU A;  3KBR A;  2AYS A;  4X48 A;  1LBV A;  2AL4 A;  3UOR A;  1FBP A;  4GWO A;  1IUD A;  4F31 B;  2I49 A;  3BFU A;  3OD7 A;  2QVR A;  1SYH A;  1SPI A;  1MG1 A;  4U21 A;  2F7C A;  4MFI A;  2B3B A;  3LV0 A;  5EYF A;  1O64 A;  2WBD A;  4L17 A;  5DVJ A;  1US5 A;  1B3H A;  3H6U A;  3ZKK A;  5ITO A;  4DCY A;  2ZYK A;  4YKI A;  2UXA A;  2PVU A;  4XFE A;  1B52 A;  1ZBM A;  2F6P A;  4RK9 A;  5L9S A;  4PAI A;  4JVD A;  1IME A;  2R71 A;  3GLB A;  4OVT A;  3IL1 B;  2CEX A;  3MWB A;  1D9Q A;  3K2D A;  4I40 A;  2DVC A;  3VLW A;  3SEW A;  1I6B A;  1MRP A;  1SVX B;  2DWI A;  1TWY A;  3BKI B;  2OWZ A;  2HQ0 A;  4R9F A;  4R2B A;  4NAP A;  4DXU A;  4GL0 A;  1FPJ A;  3M3L A;  3FAS A;  4OER A;  4EQ7 A;  2QS4 A;  1I6Q A;  1PB8 A;  3MW0 A;  5ET5 A;  2F3B A;  1HSJ A;  2E1S A;  4OHN A;  2O7I A;  1A55 A;  2F7A A;  3IOR A;  3N5L A;  5I57 A;  3FXU A;  1JNF A;  1KA1 A;  3T0J A;  4JVC A;  1FBF A;  5KCJ A;  4U1O A;  4WXJ A;  3RT8 A;  5KCJ B;  4N17 A;  1B9J A;  5L8D A;  2NWJ A;  1B05 A;  3PPR A;  3FV2 A;  1P99 A;  3QYT A;  1DPE A;  2RC8 A;  4G61 A;  4KXP A;  2I4C A;  3LC8 A;  3ZKL A;  2DE2 A;  4GL8 A;  4JVI A;  2DP8 A;  1LBC A;  1US4 A;  3T22 A;  3DM0 A;  4EQB A;  1MPD A;  3QXM A;  1VFD A;  4M4G A;  1POT A;  1FPL A;  3O29 A;  1DPP A;  4QHQ A;  2UVJ A;  3ILU B;  2VHA A;  2IA4 A;  1O63 A;  3USD A;  3T9V A;  3KOT A;  1IMC A;  3LSX A;  4H8J A;  1JW1 A;  1PB7 A;  2Y7R A;  3OO8 A;  3KOS A;  3THI A;  5HPQ A;  3FD3 A;  2H98 A;  4NF5 A;  4MIJ A;  2PFY A;  3TTK A;  1XHY A;  1NV1 A;  3PGF A;  2CMO A;  4LON B;  2H5Y A;  2PT1 A;  3BBR A;  1EYK A;  4IGT A;  3HHF A;  1J1N A;  4POX A;  1D3K A;  4MF3 A;  4I8C A;  4G2Z A;  5I5P A;  2F3D A;  4P1L A;  1A99 A;  1MY1 A;  3Q28 A;  1SDX A;  3C34 A;  4TQU Q;  4N6K A;  3VVD A;  1CB6 A;  4MJO A;  2QSX A;  3IJX B;  4F1Y A;  2VPN A;  3KSX A; 
#chains in the Genus database with same CATH homology
 2G29 A;  3A3C A;  3MP8 A;  1Y4C A;  4G4P A;  1B0H A;  1BKA A;  2ZYM A;  5DTB A;  1SI0 A;  4F29 A;  1LCF A;  1DTG A;  2GH9 A;  4JXI A;  2ESN A;  3EQ1 A;  5L9M A;  5I58 B;  1N76 A;  5H8F A;  5CBS A;  4FEC A;  1H3D A;  1UIV A;  3VVF A;  3E3K A;  1B3G A;  3TTL A;  2RKM A;  3FJG A;  3TUS A;  3FVN A;  3PPN A;  4BDQ A;  4WED A;  3TQL A;  1H44 A;  3QUF A;  3E13 X;  4BDL A;  5J1D A;  3O2A A;  4N13 A;  1USY E;  3QUJ A;  4FAJ A;  3L6H A;  4RXL A;  3C31 A;  2DXY A;  5I56 A;  4ELO A;  3U93 A;  1D4N A;  3TKD A;  1S50 A;  1N0T A;  3TOD A;  3PD9 A;  1DSN A;  2ZNT A;  4XTC Q;  1MQJ A;  4MLV A;  4YB5 A;  1MXV A;  4BDR A;  1BP5 A;  4JBZ A;  3T96 B;  1EZO A;  2XX8 A;  1XT8 A;  1A8F A;  3H6V A;  5AE4 A;  3B6T A;  2UYE A;  3P7I A;  1SI1 A;  3JYR A;  1IXC A;  2Z8F A;  3MZ1 A;  4U4S A;  3PUV E;  3VLV A;  3OO7 A;  1NH7 A;  1AMF A;  2H99 A;  4ZEB A;  4KHZ E;  3RPW A;  2D21 A;  1N3W A;  2OCU A;  1QUK A;  4IO7 A;  5I2K A;  4IY5 A;  4FOR A;  4PP0 A;  3ILT B;  5BWJ A;  5A5X B;  4NED A;  2VGQ A;  1XOC A;  4U1Z A;  4KPT A;  4XKQ A;  1MM7 A;  1ZIU A;  3PMW A;  5I59 B;  1LLS A;  3VDF A;  1MQD A;  5ELV A;  1JEV A;  3T66 A;  5FTI A;  5HBC A;  4KYE A;  3ZS6 A;  5H8N B;  2REG A;  4YMA A;  4NF8 A;  5FHM A;  2DVZ A;  4NF8 B;  1A8E A;  1IIT A;  3K4U A;  3S4U A;  4YZZ A;  3W9W A;  4GIZ A;  1AIV A;  3SEU A;  4JWO A;  1QUJ A;  1Y1M A;  3CVG A;  3CFX A;  3IX1 A;  5JTY B;  1MY3 A;  2P1S A;  5DEX A;  4OQO A;  4IB2 A;  1CE2 A;  1B3F A;  3C4M A;  1Q35 A;  1GR2 A;  2QRY A;  3TTR A;  2W7Y A;  3CG1 A;  1MY2 A;  3N94 A;  3RY3 A;  2UVG A;  1B0L A;  4IO6 A;  1A7L A;  2I48 A;  3U1O A;  3HST A;  3R6U A;  3IO6 A;  4EXK A;  4RPO A;  4KCC A;  5CC2 A;  2NXO A;  1BTJ A;  1LAH E;  3RLF E;  1O7T A;  4F3P A;  1R9L A;  2Z23 A;  2YJP A;  3L6G A;  5L9O A;  4NWC A;  3KGC A;  2GHB A;  3V5A A;  3SEX A;  2O69 A;  3ONM A;  3IK6 B;  4XKN A;  3MP6 A;  3K1P A;  4F2Q A;  2OK2 A;  1R1N A;  4I62 A;  1GVC A;  5EHS A;  3TCG A;  2AL5 A;  3FV1 A;  4IY6 A;  2H4I A;  4X1D A;  4XXU A;  2PX1 A;  4FED A;  2VOZ A;  4IGR A;  4OFJ A;  2NVU B;  5IKB A;  2GRV A;  2A5T A;  3MP1 A;  1UTH A;  2A5T B;  3I3V A;  4R6H A;  4Z0I A;  2H9B A;  4QFL A;  3IR1 A;  2XX7 A;  5I2N A;  2CZL A;  3UGW A;  1H76 A;  2HZK A;  5I2N B;  1JEU A;  4GXS B;  3RUM A;  3TCH A;  1NMU A;  3RTW B;  1TFD A;  4ZE8 A;  3IB0 A;  1VE4 A;  3FGS A;  4YB6 A;  2DXR A;  2M8C A;  3C33 A;  1I6A A;  5DYH A;  4U23 A;  2QS3 A;  1ZMG A;  3IB1 A;  3PMX A;  4K3F A;  4WKM A;  3KN3 A;  1I69 A;  4OFL A;  1FQF A;  1JW5 A;  3RNN A;  1LB9 A;  5DT6 A;  1B6H A;  2F7B A;  3MZB A;  2DQV A;  1VSO A;  3IB2 A;  3K01 A;  5F7V A;  4QSE A;  2RF1 A;  1XC1 A;  3BFT A;  4C0R A;  3I5O A;  1BLF A;  2HZL A;  4DXB A;  5B7D A;  3S2V A;  2QPQ A;  1UQW A;  3I6V A;  3N6U A;  4JSD A;  5HM4 B;  4X1B A;  1IIW A;  2OLB A;  1B5H A;  2Z8D A;  2HCA A;  2Q9T A;  3K6V A;  3KG2 A;  4BDO A;  4U2R A;  1QKB A;  1YAE A;  4OES A;  2P0S A;  2DE4 A;  3LUY A;  4KD5 A;  2NOO A;  1FQD A;  2D5W A;  2RC9 A;  2I3V A;  2Y7W A;  5H8H A;  3HO7 A;  1URS A;  5H8H B;  2XD2 A;  5AA4 A;  3O6I A;  3OO6 A;  2XXV A;  5AA4 B;  3N6T A;  4C1U A;  2DSF A;  4YKP A;  3M3K A;  1R9Q A;  1OMP A;  4EF2 A;  4OVJ A;  2ZYN A;  5AA2 D;  4R72 A;  3FVG A;  1B3E A;  3SET A;  4LZ7 A;  1MPB A;  1WOD A;  2WKY A;  4JWY A;  4YMB A;  4LVQ A;  5CMM A;  3GZG A;  4TLL B;  1EH3 A;  1LCT A;  4ZEC A;  3MVY A;  2PT2 A;  5I84 A;  4ECF A;  5I57 B;  4KFQ A;  1T0K A;  5AA2 A;  2I4B A;  1MPC A;  3C35 A;  5JEI A;  1QKA A;  3TEP A;  3OEL A;  2PMS A;  3SEY A;  4N6P A;  3R7X A;  3E9X A;  3TDJ A;  2QS2 A;  4H5F A;  4F22 A;  1URG A;  3H4Z A;  3PPQ A;  3QAX A;  3O66 A;  3G3I A;  2IEE A;  2V3Q A;  3KJT A;  4E0W A;  1QVS A;  1YPN A;  3FVK A;  1Y4T A;  3UIF A;  4U4X A;  4ZZE A;  1A40 A;  4NF5 B;  2O1L A;  3H6W A;  1QUL A;  1II5 A;  2O7U A;  4FE8 A;  3V8X B;  4LZ8 A;  4OYV A;  1M5F A;  4YIC A;  2XXP A;  3CRB A;  1ATG A;  3T9U A;  2O68 A;  3A09 A;  3GBA A;  1LAX A;  1PC3 A;  2OJT A;  3QIM A;  2BJJ X;  2UVH A;  3O6G A;  4JWX A;  1HSL A;  4KI0 E;  4MBP A;  3G3G A;  3IOW A;  2HAU A;  3PU5 A;  3MC2 A;  3MPK A;  3V83 A;  5TU0 A;  3U94 A;  1FQE A;  3N26 A;  4QFN A;  3KN7 A;  5CI5 A;  4XIG Q;  4RK2 A;  2OWT A;  2Y84 A;  4YU0 A;  3ODB A;  4GVO A;  4G77 A;  2XXW A;  5H8F B;  4FAT A;  1GV8 A;  2QS1 A;  3FXR A;  1MQG A;  1F9B A;  1MQH A;  2KLF A;  3IAZ A;  1BIY A;  3EHU A;  4KYD A;  3VXC A;  2V84 A;  4PET A;  3A3U A;  4JSO A;  3RGY A;  3UA8 A;  4QF9 A;  5I56 B;  1EZP A;  3OSR A;  4QSD A;  2F97 A;  5KZT A;  4F1V A;  2ZXT A;  1D9V A;  2XXT A;  4EF1 A;  4F3B A;  3H3G A;  4U22 A;  4ZE9 A;  2OBG A;  1P1U A;  1Y9U A;  3VLU A;  4F3G A;  1LFG A;  1PEB A;  4N07 A;  3K6W A;  3HHG A;  4NMY A;  3ZSF A;  3JV9 A;  1GGG A;  1JQF A;  4EXL A;  2I58 A;  2XXI A;  2XHD A;  4GD5 A;  3H03 A;  1YCJ A;  3PV0 E;  2I3W A;  1ZKB A;  3TMG A;  1NNK A;  3HPI A;  3SEV A;  5I2K B;  3MBP A;  3OMB A;  1NH8 A;  3C36 A;  3IOT A;  1IQ7 A;  3CFL A;  4LP2 B;  3HCQ A;  4R73 A;  2F78 A;  2QL3 A;  2H25 A;  3PUX E;  3M8U A;  3K1N A;  3FJM A;  1FQA A;  1OVB A;  1QW0 A;  2A5S A;  1XS5 A;  1FTM A;  4YKJ A;  4EQ9 A;  3G7W A;  1POY 1;  3VVE A;  4H65 A;  1FQB A;  4IO3 A;  1IEJ A;  3T9X B;  1HSE A;  4RY1 A;  2NUV A;  2PBW A;  4R6Y A;  1B1H A;  1Y3P A;  1N7W A;  3IO4 A;  3PUY E;  2XD3 A;  3PPO A;  2XXU A;  3S9M C;  1YTV A;  4G68 A;  4H5G A;  4THI A;  2REJ A;  3FAT A;  4ZZA A;  1FTO A;  1WVJ A;  2AIX A;  4EUO A;  3PPP A;  1MM6 A;  5DEX B;  2FA7 A;  4QSC A;  4RPN A;  1EU8 A;  1SQY A;  3UK4 A;  3TEL A;  1NFT A;  3MQ9 A;  3B6Q A;  1M5B A;  4G8N A;  2ONK E;  5JK4 A;  3MVX A;  4GOT A;  4HCY A;  1SW4 A;  2UVI A;  4I1D A;  1LAF E;  2Y7K A;  4NF6 A;  4JDF A;  4YB7 A;  3O97 A;  4PE5 B;  1GTK A;  4QFP A;  4Z7E A;  1DOT A;  4JB7 A;  4LQ5 A;  2THI A;  4NTL A;  3VFJ A;  1AOV A;  3T9H B;  3JZJ A;  2PYY A;  4WEP A;  2DYX A;  3IJO B;  2I6E A;  3SKP A;  3CFZ A;  5TP9 A;  3OEK A;  4ZS9 A;  3G3H A;  3PUW E;  3OO9 A;  4ELP A;  4H0W A;  3DEL B;  5K2X A;  1P1N A;  1UTB A;  1N84 A;  2R9J A;  5KDT A;  1B51 A;  3T93 B;  2HEU A;  1ZLQ A;  5ITP A;  1PB9 A;  3EHS A;  1OLA A;  1UTH B;  1EZ9 A;  1TT1 A;  3MVZ A;  3LSL A;  4LAT A;  5F1Q A;  4HTG A;  3DLN A;  2XXH A;  5M2V A;  3FZV A;  4BLA A;  4IO4 A;  4POW A;  2F34 A;  3D4C A;  4F19 A;  5CBR A;  4ELR A;  2HAV A;  4Q5T A;  5DVI A;  1JET A;  1LST A;  3DP4 A;  4FJP A;  3G3F A;  4Q8R A;  1MDP 1;  2GFE A;  5H8Q A;  3MZ9 A;  1OQH A;  3TCF A;  1N7X A;  2FYI A;  3OSQ A;  4OFO A;  1B46 A;  2XXR A;  4R75 A;  4G68 C;  3K02 A;  1AL3 A;  4YAH X;  2E0S A;  2Q2C A;  1MXX A;  1ELJ A;  4H1X A;  1LAG E;  1R6Z A;  1PBQ A;  1FCK A;  5K2Y A;  2Q2A A;  2V25 A;  4ONY A;  2Y7P A;  4F18 A;  2ABH A;  4P11 A;  5CMB A;  3FXQ A;  1URD A;  4DE8 A;  4GLI A;  5BUU A;  4OWD A;  4RNS A;  4YKK A;  4R9G A;  4PFU A;  3TFL A;  5ICQ A;  2F36 A;  3VE1 B;  3CIJ A;  3SDF A;  2OZZ A;  1PDA A;  1M5D A;  1DMB A;  4G8H A;  1FTL A;  3RT6 B;  2ZYO A;  2B65 A;  4DZ1 A;  3KEI A;  3M3F A;  1ANF A;  1B40 A;  3F11 A;  3MUQ A;  4EDP A;  1IZ1 A;  4C1T A;  2LAO A;  4O3B A;  3KSJ A;  1MQI A;  3PUZ E;  1LBB A;  4DDD A;  3FUZ A;  1JVY A;  1B2H A;  4NWD A;  4OTE A;  3EPE A;  2X7Q A;  4H8I A;  5CMK A;  4XKR A;  3QSL A;  1MXZ A;  5TPA A;  2F5X A;  1DTZ A;  5TPA B;  3CG3 A;  2Z8E A;  2HFB A;  3IOV A;  2UYF A;  1VR5 A;  1B32 A;  2RIN A;  3TAJ A;  4GXA A;  1Z7N E;  4OZ9 A;  3TZA A;  3TYH A;  3QK6 A;  5AA2 B;  3S9E A;  4HW8 A;  3TQW A;  1ZU0 A;  3CR9 A;  1MXW A;  1NKX A;  3KN8 A;  4GF8 A;  4NF4 A;  4NF4 B;  3VXB A;  2B3F A;  3EHT A;  1L5T A;  4F3S A;  3SER A;  4KYS A;  3U8Q A;  5ICT A;  2I0B A;  4XKP A;  1RYX A;  3MJN A;  4OEU A;  3Q25 A;  1NNP A;  2ONR A;  4P0I A;  2ALU A;  3HV1 A;  4X9T A;  4DLD A;  2YLN A;  2QJE A;  3RN8 A;  2XXX A;  1Y20 A;  3CSB A;  5DVF A;  2XXY A;  3CSG A;  1B7Z A;  1RYO A;  4ELQ A;  3V89 B;  2X7P A;  1SYI A;  4R74 A;  1KWH A;  1S7Y A;  4AB6 A;  2YPN A;  2GHA A;  1NL5 A;  4RA1 A;  1LFH A;  2VP1 A;  1Q1K A;  4ESX A;  2X26 A;  5ISU A;  4OET A;  3UP9 A;  1IXG A;  1TXF A;  1OIB A;  2DOJ A;  1B3L A;  4OMB A;  3KFM A;  3EF7 A;  3D4G A;  2ZNU A;  3RQT A;  3R26 A;  1SD3 A;  2RCA A;  3LBS A;  3UN6 A;  5CM6 A;  2ONS A;  4AB5 A;  4HS7 A;  3U92 A;  2OWS A;  4ZEF A;  4NE4 A;  5I58 A;  3K00 A;  3H06 B;  3B7D A;  3W9V A;  1MH4 A;  4RJZ A;  4UA8 A;  3MPL A;  3ECR A;  4BDM A;  5AA1 A;  1AH5 A;  4FEB A;  4MLQ A;  4ZDM A;  2V3U A;  4Q30 B;  3B6W A;  4ZEK A;  3VV5 A;  3DP8 A;  2O1M A;  1NNF A;  1Y3Q A;  2RCB A;  2VD2 A;  2D3I A;  1SW5 A;  4PFY A;  3FJ7 A;  1USY H;  3K6U A;  1MXY A;  1LB8 A;  3GXA A;  4R6K A;  4KQP A;  1LFI A;  3S9N C;  4IO5 A;  4ZED A;  3OEM A;  4DCX A;  4F39 A;  1SW1 A;  3EN3 A;  4M1V A;  1FTK A;  3OEN A;  3E4R A;  1A54 A;  3OXN A;  4OXV A;  1PBP A;  4OEN A;  4QRZ A;  4BDN A;  1WDN A;  3FVO A;  2XXQ A;  4O3C A;  3TTN A;  2DWA A;  2O84 X;  5LOM A;  1ZJL A;  4DIG A;  4MH5 A;  4QFK A;  4GQO A;  1P1Q A;  4UAC A;  1RKM A;  1MDQ A;  2O6A A;  2DE3 A;  5AA3 A;  3GBB A;  5A5X A;  2DWH A;  1MS7 A;  1H43 A;  4PFW A;  5I59 A;  1FTJ A;  4HCW A;  5FTH A;  1M5E A;  2QMW A;  3TPA A;  1H45 A;  2ZMB A;  4ESW A;  1SW2 A;  1FW0 A;  2Q89 A;  5H8N A;  2I0C A;  4I9D A;  1Z7M E;  1M5C A;  1Y1Z A;  4LUB A;  1IXI A;  4G68 B;  2XX9 A;  3Q29 A;  2DS9 A;  1QJM A;  5CMC A;  2F6G A;  2RC7 A;  2Q88 A;  1NNT A;  4QFO A;  2Q8J A;  1SBP A;  1VFE A;  1D9Y A;  3C32 A;  3WAF A;  1IXH A;  3DP6 A;  2O51 A;  4IO2 A;  5JTY A;  3G3J A;  4GRK A;  1P1O A;  1B5J A;  4P0G A;  1Y3N A;  4AQ4 A;  4E0X A;  5IAI A;  4R2F A;  1S9T A;  2F35 A;  4NF6 B;  3SES A;  3KJ7 A;  1FQC A;  4DXC A;  2F8D A;  1OQG A;  2Y7I A;  4H6D A;  1B7U A;  3C9H A;  1B1X A;  4LA9 A;  4H67 A;  1JVX A;  3W15 C;  3H6T A;  2ZNS A;  1ZTY A;  1MY0 A;  1UIU A;  3FIR A;  3OOA A;  3O28 A;  5EHM A;  4ND9 A;  4RYA A;  3PD8 A;  1B4Z A;  4F2O A;  4LQ2 A;  5TP9 B;  1P1W A;  4PFT A;  1OVT A;  4TOZ A;  4PQJ A;  4O3A A;  5B70 A;  4ISU A;  3Q26 A;  1TFA A;  3Q27 A;  4KCD A;  3LSW A;  1N04 A;  1UTB B;  3AXF A;  4FIM A;  3O9P A;  2HXW A;  1B4H A;  5FHO A;  5KDT B;  3LSF B;  1OLC A;  4GFR A;  3H7M A;  3HN0 A;  5CRY A;  2V93 A;  4Q0C A;  2Z22 A;  3S9L C;  1XVY A;  1XVX A;  3K1M A;  5H8S A;  2R6G E;  2G93 A;  5FHN A;  1N3X A;  3RTF B;  3MAM A;  3KZG A;  3K6X A;  3MVW A;  4KR5 A;  3WAE A;  5H8Q B;  4LZ5 A;  1MXU A;  4TLM B;  2DWJ A;  3CI8 A;  2P2A A;  1B5I A;  2ANJ A;  2V3T A;  4ZEI A;  4F1U A;  1MY4 A;  2FNC A;  1LGB C;  3O6H A;  3LR1 A;  1B58 A;  4G8M A;  3TTM A;  1JW4 A;  3PMV A;  2VD3 A;  4OEV A;  3G3K A;  3K0V A;  2QMX A;  1B7H A;  1MH3 A;  1QUI A;  3U72 A;  3IOU A;  3KBR A;  2AYS A;  4X48 A;  2AL4 A;  3UOR A;  4GWO A;  1IUD A;  4F31 B;  2I49 A;  3BFU A;  3OD7 A;  1SYH A;  1MG1 A;  4U21 A;  2F7C A;  4MFI A;  2B3B A;  5EYF A;  1O64 A;  4L17 A;  5DVJ A;  1US5 A;  1B3H A;  3H6U A;  3ZKK A;  5ITO A;  4DCY A;  2ZYK A;  4YKI A;  2UXA A;  2PVU A;  1B52 A;  1ZBM A;  2F6P A;  4RK9 A;  5L9S A;  2R71 A;  3GLB A;  3IL1 B;  3MWB A;  3K2D A;  2DVC A;  3VLW A;  3SEW A;  1I6B A;  1MRP A;  1SVX B;  2DWI A;  1TWY A;  3BKI B;  2HQ0 A;  4R9F A;  4R2B A;  4DXU A;  4GL0 A;  3M3L A;  3FAS A;  4OER A;  4EQ7 A;  2QS4 A;  1I6Q A;  1PB8 A;  3MW0 A;  1HSJ A;  2E1S A;  4OHN A;  2O7I A;  1A55 A;  2F7A A;  3IOR A;  3N5L A;  5I57 A;  3FXU A;  1JNF A;  5KCJ A;  4U1O A;  4WXJ A;  3RT8 A;  5KCJ B;  1B9J A;  5L8D A;  2NWJ A;  1B05 A;  3PPR A;  3FV2 A;  1P99 A;  3QYT A;  1DPE A;  2RC8 A;  2I4C A;  3LC8 A;  3ZKL A;  2DE2 A;  4GL8 A;  2DP8 A;  1LBC A;  1US4 A;  3T22 A;  3DM0 A;  4EQB A;  1MPD A;  3QXM A;  1VFD A;  4M4G A;  1POT A;  3O29 A;  1DPP A;  4QHQ A;  2UVJ A;  3ILU B;  2VHA A;  2IA4 A;  1O63 A;  3USD A;  3T9V A;  3KOT A;  3LSX A;  4H8J A;  1JW1 A;  1PB7 A;  2Y7R A;  3OO8 A;  3KOS A;  3THI A;  5HPQ A;  3FD3 A;  2H98 A;  4NF5 A;  3TTK A;  1XHY A;  3PGF A;  2CMO A;  4LON B;  2H5Y A;  2PT1 A;  3BBR A;  4IGT A;  3HHF A;  1J1N A;  4POX A;  1D3K A;  4MF3 A;  4I8C A;  4G2Z A;  1A99 A;  1MY1 A;  3Q28 A;  1SDX A;  3C34 A;  4TQU Q;  3VVD A;  1CB6 A;  2QSX A;  3IJX B;  4F1Y A;  3KSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...