2F86B

The association domain of c. elegans camkii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
NDSEKAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFDGNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Oligomerization states of the association domain and the holoenyzme of Ca2+/CaM kinase II.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
molecule keywords Hypothetical protein K11E8.1d
total genus 36
structure length 129
sequence length 129
chains with identical sequence D, F, H, J, L, N
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f86B00
1O7NB 1W00A 3OWUA 3BB9A 1BUQA 3LYGA 1HKXA 1WQLB 5EVHA 3CNXA 5KP3A 4L7KA 3DMCA 3SEDA 5IERA 3EJVA 3FH1A 3MG1A 3OXAA 1Q40A 1OGZA 3FKAA 1GY5A 4J8TA 4X2OA 1UUWB 4K1UA 2F99A 4H3UA 4HZ9B 4STDA 2INXA 3CNMA 4HM4B 3T8UA 1ULJB 1JKGA 2STDA 2YFIB 3B8LA 3F8HA 3MKIA 1QMAA 3NV0B 1OCVA 3HX8A 5D83A 5D81A 5IENA 4IIAA 1GYBA 3OX9A 3NXJA 4CDLA 2RFRA 3NBRA 5BVBA 6STDA 1ISKA 2QIYA 2XRXB 4XM4A 1W01A 1C7HA 3GWRA 3DUKA 4I4KA 4X2HA 3F40A 4WYKB 4HM8B 4XBXA 1OF5B 1NU3A 2JQ5A 3A76A 1E97A 3MG3A 1K41A 4XDWA 3CPOA 1JB2A 4HM6B 4ORLA 4XBYA 5AIFA 1ZO2A 5FW5A 3OWSA 1W6YA 4R1KA 5AEUB 5IG4A 3E99A 1GY7A 8CHOA 3K7CA 4HM3B 1UUVB 3I0YA 4LMIA 3H3HA 2XSHB 3F14A 2GBWB 3HK4A 3JUMA 1Z1SA 3OV4A 4WWUC 4HM5B 3RGRA 5CK6A 5TGNA 3MHEA 3DM8A 1NWWA 5HGRA 2Z7AA 1S5AA 2GXFA 1Q42A 2GEYA 2QGUA 1JKGB 3FF2A 1OH0A 3G8ZA 4HM7B 4L8OA 4OUQA 2B24B 5DRVA 2RGQA 4R9LA 5AIIA 5G2GA 3IPTA 2K54A 1NDOB 2A15A 3CU3A 5IG5A 3B7CA 1QJGA 3F8XA 2R4IA 2HMOB 5IG3A 2I9WA 2W2CA 1OHPA 3B4PA 3DXOA 3FZWA 3LZAA 4WP5A 1A2KA 1OHSA 1OPYA 4HM2B 4LEHA 4MJDA 4WYKA 5AI1A 5CXOA 3BLZA 3NUVA 5D82A 3D9RA 5STDA 3EC9A 5JPPA 4XB5A 3EX9A 3RGAA 4N3VA 1IDPA 1E3RA 1E3VA 3EN1B 5IEOA 2HMLB 1OUNA 3KSPA 3F9SA 2BMRB 1DMNA 3GRDA 2PZVA 2CKFB 2Z76A 4FCJA 3WMDA 1SJWA 1STDA 3JUNA 4HKVB 3STDA 2CHCA 1ULIB 3EBTA 3G16A 2HMJB 3KKGA 1VZZA 2YFLB 5AIGA 2XR8B 4FCMA 3UNLA 5BXQA 1DMQA 3S5CA 3VGNA 3ER7A 1EG9B 3EHCA 1O7MB 1AR0A 4HM0B 1JB5A 2GEXA 2HMKB 3GZYB 1CQSA 4XDVA 3UJMA 1EA2A 2BNGA 5DREA 3K0ZA 1GY6A 5AEWB 1JN5B 3Q90A 4HJLB 3B4OA 1O7PB 3DZLA 3ECFA 3NHXA 3OWYA 4HVNA 1O7GB 4HZBB 2F98A 3EF8A 3G0KA 3FGYA 2HMMB 3FSDA 3MSOA 4KVHA 4L8PA 4XBTA 3KE7A 5AIHA 3KZTA 4K1VA 4Q53A 5CF2A 5IEPA 3JUQA 2B1XB 3ROBA 4R9KA 2YFJB 1O7WB 4OVMA 2BMQB 5JPUA 3GZBA 5KP4A 2Z77A 3VSYA 2GBXB 2RCDA 3NV0A 2OWPA 3EN8A 3F7XA 3FF0A 4GB5A 7STDA 5KP1A 3SOYA 5CLKA 1DMMA 1Q40B 2UX0A 1ASKA 3SOAA 1JB4A 3F7SA 1TP6A 2XSOB 1ZX2A 3JUOA 5IG0A 4PEJA 1TUHA 3HZPA 5CF1A 1O7HB 2HMNB 3FLJA 3GZRA 1OF5A 2IMJA 1W02A 1OGXA 1OHOA 1U5OA 3MG2A 3MYTA 3JUPA 4HM1B 4U13A 5IF6A 3H51A 3T8NA 4LGQA 3NM2A 2F86B 3EBYA 3EQQB 1GS3A 1JN5A 2BMOB 3M8CA 4J9AA 4RZMA 3GZXB
chains in the Genus database with same CATH superfamily
4MMYB 3GSPA 3D4AA 1D6YA 3JVCA 1BUQA 1WMNA 3CNXA 4ZM8A 3DMCA 3LT9A 3SEDA 4BIRA 3FH1A 3FKAA 1BNEA 1UUWB 1IU7A 1B21A 4H3UA 3CNMA 1A90A 3OW22 2Z6BA 1BGSA 1TRPA 1ULJB 1JKGA 1YHQ3 3DGMA 1OCVA 4K61A 2CWTA 1GYBA 1MWRA 3BNBA 6STDA 4RNYA 3HIIA 9RNTA 2KAAA 1IT8A 1RN7A 2M7OA 2HOHA 2F56A 1JZDA 3CMA3 4LZIA 4WYKB 1IVWA 3MG3A 1K41A 4XDWA 3CPOA 4HM6B 1UI8A 3KSED 4ORLA 4QWTA 1ZO2A 4XBYA 2BT3A 1NB5I 1HYFA 3KCHA 3V99A 1MNLA 3E99A 1G96A 2W56A 3I0YA 3VSYA 4WHAA 3OV4A 3DY5A 1RGFA 3AHWA 3JUMA 1GMQA 1B27A 1RGHA 1GD3A 4MEIA 4O2HA 3RGRA 4EXRA 1X1YA 3DM8A 1PYLA 5HGRA 3QK9A 2P09A 4CJNA 1RMSA 4NPBA 1DE3A 2GEYA 3X42A 3FF2A 3KFQC 3AHSA 4KFEA 4LYLB 1US1A 2RGQA 5DRVA 1NO3A 2E2UA 4FMAA 1X1UA 3SYUA 3B7CA 5IG5A 2HMOB 1UGIA 4WP5A 5AI1A 3L0RA 1VQO3 1CYUA 2OOVC 5STDA 3D3LA 1A2PA 3RGAA 4FMDA 4N3VA 3FG3A 1I0VA 4R4KA 1E3RA 1E3VA 1EKMA 2D42A 4RNTA 1UCJA 2W6JH 3F9SA 1DMNA 2H0IA 2PZVA 4FCJA 5M1AA 1W6GA 2BO9B 1VQL3 3PZWA 3G6E3 1VQN3 2LQVA 4HKVB 4EYCA 2CHCA 1ULIB 3G16A 1WTHA 4FR9A 2CX1A 2XR8B 1BSBA 3UNLA 1DVCA 1B2ZA 4LSOA 1Q824 3D5GA 2FNQA 1FGMA 3A5EA 1IQXA 1AVLA 3EHCA 3GAXA 3UJMA 1JB5A 2GEXA 1RTUA 2ML6A 5A0OB 5AEWB 5IW9A 3CCQ3 1GY6A 3FG4A 1UW1A 1TIJA 2YX9A 3B4OA 3DZLA 3NHXA 2KXGA 3Q90A 4HVNA 1O7GB 1N5PA 2F98A 1D6UA 3FGYA 2HMMB 2KF6A 3FSDA 4KVHA 5AIHA 1M9GA 1EUIC 3T0UA 4K1VA 1BNSA 3LXUX 2B1XB 1UGHI 2F4YA 2RSXA 4OVMA 5G1LA 1IQYA 1IVUA 1WMOA 1TTOA 1R4CA 2RCDA 1I2FA 1AVKA 3EN8A 4GB5A 4MMZB 2IYJA 1RGCA 5FGOA 3D79A 1IVVA 2XF3A 1LOVA 2W0QA 4JRFA 1MWUA 1RHLA 3EB8A 1GOYA 3F7SA 1RKYA 4NREA 1BRKA 3ZG5A 3ALAA 1O7HB 2MF7A 3GZRA 3SXXA 1L5GB 4KFDA 3SLUA 1IQ8A 4EV2A 1W02A 4HM1B 1FGQA 2AAEA 2QA43 1FGTA 3UL5A 3H51A 4LGQA 1BSCA 2E2VA 3EBYA 4J9AA 2GBXB 2W9QA 4IPBA 1YIJ3 1BANA 3BB9A 5KP3A 5EVHA 2R41A 3SX1A 4O3VA 4J5KA 3VF1A 2BIRA 3OXAA 1GY5A 2F99A 2O9UX 3V92A 2INXA 2C10A 4HM4B 1DYUA 3T8UA 2STDA 3F8HA 3MKIA 1QMAA 4G1MB 1RLSA 5IENA 1YNVX 3NXJA 5HOHA 1MWTA 2QIYA 2XEPA 1A2VA 1IYYA 1FW7A 1JNQA 3DUKA 4X2HA 7GSPA 1SIHA 2V1LA 3IJEB 1Q7Y4 3N54B 1NU3A 1ROAA 1SIIA 1Q864 1RGKA 5AIFA 2CH9A 5AEUB 5IG4A 3HIGA 1PY3A 1RJOA 3OWSA 3NQYA 4R1KA 8CHOA 4HM3B 1YGWA 1UUVB 3HK4A 1BNGA 2GBWB 1VQ73 2BHMA 4HM5B 3HI7A 3S28A 1VQ93 5TGNA 1MGWA 2KF5A 1BUJA 1NJI4 1TJDA 2XGLA 3U1WA 1VQ83 3WODG 5M19A 1STFI 2GXFA 1Q42A 1JKGB 1OH0A 1TFOA 3K63A 2K54A 1NDOB 1FZUA 3CU3A 1R4YA 1SPUA 2UUGC 3URPA 3CCE3 1CYVA 1QJGA 1YVSA 1W5ZA 1T2IA 3LH4A 2CFGA 4GL6A 3LZAA 7RNTA 5IG3A 4WYKA 1RRHA 3NUVA 2W04A 2UGIA 3EC9A 1NB3I 1IDPA 1W7CA 5LC6A 6GSPA 1A67A 1ZS7A 1OUNA 4HBRA 2BMRB 3BNEA 3MWZA 3WHOA 3WMDA 1BNIA 2KRTA 3QRDA 4KT3B 3DH2A 3JUNA 1HU9A 1LNIA 3KKGA 1RCLA 4CCVA 5EQLA 3PCRA 5BU4A 4HYZA 5AIGA 5M18A 6RNTA 1DMQA 3UB1A 1BOXA 1V58A 3PGBA 3ER7A 5EEOA 3VGNA 1TFKA 3CD63 3AMOA 3FCSB 5LC7A 5BIRA 1RDSA 1K8A4 1N9JA 3GZYB 1BVIA 1IVXA 1AQZA 1EA2A 4O8SA 1Q814 1JN5B 3PYJA 4HJLB 1WMPA 1O7PB 1LXEA 2XFTA 3ECFA 4HZBB 5G2GA 2IUKA 3X41A 1VQ63 1Q7HA 1X1XA 3EF8A 3G0KA 4XBTA 4CDLA 2WGQA 1BRNL 3X3YA 8RNTA 1W2B2 1YGEA 3JUQA 2GSPA 2YFJB 1FGRA 2OCTA 2BMQB 5JPUA 1JBTA 5KP4A 2XGNA 2Z77A 3X3ZA 2CWVA 5ELUA 3NV0A 1B2UA 2Y74A 1ZGXA 2OWPA 3DGOA 4HOHA 2F5WA 5KP1A 3SOYA 3U97A 1FGOA 1YVBI 1DMMA 1Q40B 3X40A 2UX0A 1ASKA 3LOYA 4BU4A 3CCS3 3SVAA 1QVF2 3N9HA 3TDGA 2ZL8A 3N8BA 2HMNB 1TRQA 1OF5A 2CC3A 3CPW2 1U5OA 1OHOA 3MYTA 4H61A 1BRHA 4AKZA 5IF6A 1BSEA 3T8NA 4N6UA 1JN5A 4ILFA 4MMXB 3DGLA 1C54A 1M1XB 1CEWI 1O7NB 1I2GA 2OOVA 3OWUA 3LYGA 1I3IA 1HKXA 2ZA4A 1JJ22 1I70A 3BNDA 4BTWA 3MG1A 4J8TA 4X2OA 4BL2A 4HZ9B 1GMPA 3S29A 2W56B 4I5QA 2WOFA 2PNCA 2YFIB 1B2MA 4N6LA 1ISKA 1CH0A 2Q07A 1N8QA 3CCL3 1B20A 2XRXB 1W01A 4N6MA 1BRIA 2GU1A 3GWRA 4I4KA 1PU4A 1VQM3 2CFDA 3Q2PA 4XBXA 4FMBA 2JQ5A 3A76A 4TX4A 3CXC2 1LOWA 2CG1A 1T5YA 3PCSA 3K7CA 1KC84 3LTDA 3NBJA 2P05A 4OK0A 3WOFB 1YI23 3H3HA 1RN4A 1BSAA 2ZDJA 2OTJ3 1KSIA 5CK6A 2ML5A 3MHEA 1PFPA 2L1SA 2H0HA 2E2TA 3LTCA 3CC23 1NWWA 1JZOA 1YJW3 1MOLA 3CCJ3 2Z7AA 1EEJA 1S5AA 2QGUA 1UCLA 3BNCA 4L8OA 4HM7B 1UCKA 2J8XB 2B24B 1IT7A 4N6TA 4R9LA 5AYSC 1AV4A 4NHFA 3D5IA 3NM7A 3F8XA 1V74A 2R4IA 1DETA 4EW5A 1K9M4 2W2CA 1OHPA 3FZWA 1M1K4 1W4NA 3ZFZA 1A2KA 1OHSA 1OPYA 4HM2B 5D82A 4K90B 2WGOA 2SBLA 3BU4A 1SARA 2HMLB 1GSPA 3GRDA 2Z76A 2XFSA 1YIT3 1Q9EA 3STDA 3EBTA 2P38A 2IA7A 1NNVA 3WDGB 1VZZA 2YFLB 4KZ1A 1IK3A 3ZG0A 1LOYA 3EE1A 3AGNA 1EG9B 1BSDA 1O7MB 4XDVA 3WOEB 2P0XA 3OWYA 3DGYA 1QALA 2CW9A 4L8PA 2OTL3 1LRAA 1WNHA 5IEPA 2KF3A 1YJN3 3KZTA 1RCKA 2L4VA 3I563 1RGLA 4R80A 4FMCA 4R9KA 2O3OA 3I553 3GZBA 1G02A 4CPKA 5RNTA 2FGTA 1VQ53 1RNBA 1EQKA 1FUSA 1UUGB 7STDA 3NX0A 2K0MA 2LYXA 3FF0A 2FXTA 2KCDA 3G713 3X3XA 5CLKA 3K5TA 4WFOA 2JDIH 2OQEA 5ELJA 3RNTA 3SOAA 1JBRA 1AY7A 1TP6A 1M904 2OQEC 3JUOA 1KWIA 1RNTA 3HZPA 1JRQA 5CF1A 3CC73 2CWUA 1B2SA 1OGXA 1T2HA 3NBBA 3MG2A 1D6ZA 3NQZA 4U13A 4AEQA 1J2BA 1QAKA 1QAFA 3NM2A 2F86B 4KFFA 1FUWA 1GS3A 1IV9A 2BMOB 4RZMA 2QEX3 3GZXB 4RNZA 4BTXA 1GD4A 1BIRA 1W00A 1OACA 3DGNA 5G1KA 1WQLB 2F5MA 5IERA 1G0TA 1V57A 3RDEA 2CK3H 2D1WA 1BRSA 3EJVA 1LVNA 4DKIA 1GOUA 1OGZA 1Q40A 4K1UA 4STDA 1U8CB 2IY2A 1N9EA 2KF4A 3NV0B 3B8LA 5D83A 4BTYA 3HX8A 5D81A 1ROVA 4IIAA 3OX9A 4BL3A 2RFRA 3NBRA 5BVBA 2ZHXB 4XM4A 1I8VA 1C7HA 3F40A 1YJ93 2H0GA 1F8NA 2K3DA 2WOHA 2XH9A 4HM8B 1OF5B 1E97A 1T3BA 1W2ZA 1I0XA 1JB2A 1RGGA 5FW5A 1FYSA 4HAAA 1MWSA 1W6YA 1RRLA 1LNHA 1GY7A 4O02B 3CC43 1Y4KA 4GSPA 4LMIA 2XSHB 3F14A 4WWUC 1Z1SA 1TU5A 3HOHA 1GOVA 1BNRA 3IMAB 1VQK3 1RN1A 1I3FA 4OUQA 5DREA 1HZ1A 3G8ZA 1RGEA 4EBGA 1LQGC 1IV7A 5AIIA 3IPTA 4EC6A 3LT8A 3J7Yd 2C4BA 2A15A 2CFWA 3LTAA 5GSPA 1W6CA 1BRJA 3LMLA 2I9WA 2P0MA 3DXOA 3B4PA 1JBSA 1BU4A 4LEHA 5CXOA 4MJDA 3BLZA 1K28A 3AMOB 3D9RA 5JPPA 1B2XA 3CCU3 2C11A 4JF8A 3BIRA 3EX9A 4XB5A 3S27A 3CCR3 1VQ43 1DVDA 4J5GA 1VQP3 1SQWA 3EN1B 5IEOA 3KSPA 1I2EA 4IT7A 2CX0A 2CKFB 4N6V0 1SJWA 3O8YA 3MPHA 4N6NB 3V98A 3KN4A 1STDA 2BU4A 2RBIA 3FG1A 1QVG2 2WO0A 2HMJB 1GMRA 2CFKA 4N6OB 2IUJA 3WA2X 4FCMA 3K9MC 5BXQA 1B3SA 3S5CA 5JBSA 4GHOA 1LQMB 3LTBA 4EV5A 1AR0A 2CIUA 4HM0B 2HMKB 2RNTA 5AYRB 1CQSA 3CME3 1KQS2 3WA3A 2BNGA 3K0ZA 3PS8A 4L7KA 1JV2B 1BRGA 3Q1CA 3MSOA 1RSNA 1N8R4 5CF2A 3KE7A 4RBNA 4Q53A 3CCM3 1FUTA 1FA3A 3ROBA 5I97A 1UI7A 1O7WB 2CG0A 4AKYA 3AGOA 3Q3FA 2SARA 1BNFA 3F7XA 3WR2A 1X1WA 3S67A 2GU3A 2AADA 3PXMA 3KIIA 1K734 1UDII 3CCV3 1JB4A 1N5HA 1UCIA 2XSOB 2CFLA 1ZX2A 1VQQA 1RGAA 2W03A 4PEJA 1TUHA 5IG0A 1LOXA 1KD14 3FLJA 2IMJA 1BAOA 4FCZA 1MGRA 2Y73A 3UL6A 3JUPA 1S723 2MC8A 1BNJA 3EQQB 3G4S3 3M8CA 2W9PA
chains in the Genus database with same CATH topology
4MMYB 3JVCA 1D6YA 1BUQA 1WMNA 3CNXA 4ZM8A 3DMCA 3LT9A 3SEDA 3FH1A 3FKAA 1UUWB 1IU7A 4H3UA 3CNMA 1A90A 3OW22 2Z6BA 1ULJB 1JKGA 1YHQ3 3DGMA 1OCVA 4K61A 2CWTA 1GYBA 3BNBA 6STDA 4RNYA 3HIIA 2M7OA 1IT8A 1RN7A 3CMA3 4LZIA 4WYKB 1IVWA 3MG3A 1K41A 4XDWA 3CPOA 4HM6B 1UI8A 3KSED 4ORLA 4QWTA 1ZO2A 4XBYA 2BT3A 1NB5I 3V99A 1MNLA 3E99A 1G96A 2W56A 3I0YA 3VSYA 4WHAA 3OV4A 3DY5A 3JUMA 3RGRA 1GD3A 4MEIA 4O2HA 4EXRA 3DM8A 5HGRA 3QK9A 2P09A 2GEYA 3X42A 3FF2A 3KFQC 4KFEA 5DRVA 1US1A 2RGQA 1NO3A 2E2UA 4FMAA 5IG5A 3B7CA 2HMOB 4WP5A 5AI1A 3L0RA 1VQO3 1CYUA 2OOVC 5STDA 3D3LA 3RGAA 4FMDA 4N3VA 3FG3A 4R4KA 1E3RA 1E3VA 1EKMA 2D42A 2W6JH 3F9SA 1DMNA 2PZVA 4FCJA 1W6GA 2BO9B 1VQL3 3PZWA 3G6E3 1VQN3 2LQVA 4HKVB 4EYCA 2CHCA 1ULIB 3G16A 1WTHA 4FR9A 2XR8B 3UNLA 1DVCA 4LSOA 1Q824 2FNQA 1FGMA 3GAXA 1IQXA 3EHCA 1AVLA 3UJMA 1JB5A 2GEXA 2ML6A 5A0OB 5AEWB 5IW9A 3CCQ3 1GY6A 3FG4A 1UW1A 1TIJA 2YX9A 3B4OA 3DZLA 3NHXA 2KXGA 3Q90A 4HVNA 1O7GB 1N5PA 2F98A 1D6UA 3FGYA 2HMMB 3FSDA 4KVHA 5AIHA 1M9GA 3T0UA 4K1VA 3LXUX 2B1XB 2RSXA 4OVMA 1IQYA 1IVUA 1WMOA 2RCDA 1R4CA 4GB5A 3EN8A 1AVKA 4MMZB 5FGOA 1IVVA 2XF3A 2W0QA 4JRFA 3EB8A 3F7SA 1RKYA 4NREA 3ALAA 1O7HB 2MF7A 3GZRA 3SXXA 1L5GB 4KFDA 3SLUA 1IQ8A 4EV2A 1W02A 4HM1B 1FGQA 2QA43 1FGTA 3UL5A 3H51A 4LGQA 2E2VA 3EBYA 4J9AA 2GBXB 2W9QA 4IPBA 1YIJ3 3BB9A 5KP3A 5EVHA 3SX1A 4O3VA 3VF1A 3OXAA 1GY5A 2F99A 2O9UX 3V92A 2INXA 2C10A 4HM4B 1DYUA 3T8UA 2STDA 3F8HA 3MKIA 1QMAA 4G1MB 5IENA 3NXJA 2QIYA 2XEPA 1A2VA 1JNQA 3DUKA 4X2HA 1SIHA 2V1LA 3IJEB 1Q7Y4 3N54B 1NU3A 1ROAA 1SIIA 1Q864 5IG4A 5AIFA 2CH9A 5AEUB 1KD14 3HIGA 3OWSA 1RJOA 4R1KA 3NQYA 8CHOA 4HM3B 1UUVB 3HK4A 2GBWB 1VQ73 2BHMA 4HM5B 3HI7A 3S28A 1VQ93 5TGNA 1NJI4 2XGLA 3U1WA 1VQ83 3WODG 1STFI 2GXFA 1Q42A 1JKGB 1OH0A 1TFOA 3K63A 2K54A 1NDOB 3CU3A 1SPUA 3CCE3 1CYVA 1QJGA 3LH4A 1W5ZA 2CFGA 4GL6A 3LZAA 5IG3A 4WYKA 1RRHA 3NUVA 2W04A 3EC9A 1NB3I 1IDPA 1W7CA 5LC6A 1A67A 1OUNA 4HBRA 2BMRB 3BNEA 3MWZA 3WMDA 2KRTA 3QRDA 3JUNA 1HU9A 3KKGA 4CCVA 5EQLA 3PCRA 4HYZA 5AIGA 1DMQA 3UB1A 3PGBA 5EEOA 3ER7A 3VGNA 3CD63 1TFKA 3AMOA 3FCSB 5LC7A 1K8A4 1N9JA 3GZYB 1IVXA 1EA2A 4O8SA 1Q814 1JN5B 3PYJA 4HJLB 1WMPA 1O7PB 1LXEA 2XFTA 3ECFA 4HZBB 5G2GA 2IUKA 3X41A 1VQ63 3EF8A 3G0KA 4XBTA 4CDLA 2WGQA 3X3YA 1W2B2 1YGEA 3JUQA 2YFJB 1FGRA 2OCTA 2BMQB 5JPUA 5KP4A 2XGNA 2Z77A 3X3ZA 2CWVA 5ELUA 3NV0A 2Y74A 2OWPA 3DGOA 5KP1A 3SOYA 3U97A 1FGOA 1YVBI 1DMMA 1Q40B 3X40A 2UX0A 1ASKA 3LOYA 3CCS3 1QVF2 3SVAA 3N9HA 3TDGA 2ZL8A 3N8BA 2HMNB 1OF5A 2CC3A 3CPW2 1U5OA 1OHOA 3MYTA 4H61A 4AKZA 5IF6A 3T8NA 4N6UA 1JN5A 4MMXB 3DGLA 1CEWI 1M1XB 1O7NB 2OOVA 3OWUA 3LYGA 1HKXA 1JJ22 3BNDA 4BTWA 3MG1A 4J8TA 4X2OA 4HZ9B 3S29A 2W56B 2WOFA 2PNCA 2YFIB 4N6LA 1ISKA 2Q07A 3CCL3 1N8QA 2XRXB 1W01A 4N6MA 2GU1A 3GWRA 4I4KA 1PU4A 1VQM3 2CFDA 3Q2PA 4XBXA 4FMBA 2JQ5A 3A76A 4TX4A 3CXC2 2CG1A 1T5YA 3PCSA 3K7CA 1KC84 3LTDA 3NBJA 2P05A 4OK0A 3WOFB 1YI23 3H3HA 2ZDJA 2OTJ3 1KSIA 5CK6A 2ML5A 3MHEA 1PFPA 3LTCA 2E2TA 1YJW3 3CC23 1NWWA 1MOLA 3CCJ3 2Z7AA 1S5AA 2QGUA 3BNCA 4L8OA 4HM7B 2B24B 1IT7A 4N6TA 4R9LA 5AYSC 1AV4A 4NHFA 3NM7A 3F8XA 1V74A 2R4IA 1K9M4 2W2CA 1OHPA 3FZWA 1M1K4 1W4NA 1A2KA 1OHSA 1OPYA 4HM2B 5D82A 4K90B 2WGOA 2SBLA 2HMLB 3GRDA 2Z76A 2XFSA 1YIT3 3STDA 3EBTA 2P38A 2IA7A 3WDGB 1VZZA 2YFLB 4KZ1A 1IK3A 3EE1A 1EG9B 1O7MB 4XDVA 3WOEB 2P0XA 3OWYA 1QALA 2CW9A 4L8PA 2OTL3 1WNHA 5IEPA 1YJN3 3KZTA 2L4VA 3I563 4R80A 4FMCA 4R9KA 2O3OA 3I553 3GZBA 2FGTA 1VQ53 1EQKA 7STDA 3NX0A 2K0MA 2LYXA 3FF0A 2FXTA 2KCDA 3G713 3X3XA 5CLKA 3K5TA 4WFOA 2JDIH 2OQEA 5ELJA 3SOAA 1TP6A 1M904 2OQEC 3JUOA 1KWIA 3HZPA 1JRQA 5CF1A 3CC73 2CWUA 3NBBA 1OGXA 4AEQA 3NQZA 3MG2A 1D6ZA 4U13A 1J2BA 1QAKA 1QAFA 3NM2A 2F86B 4KFFA 1FUWA 1GS3A 1IV9A 2BMOB 4RZMA 2QEX3 3GZXB 4RNZA 4BTXA 1GD4A 1W00A 1OACA 3DGNA 1WQLB 5IERA 3RDEA 2CK3H 2D1WA 3EJVA 1LVNA 1Q40A 1OGZA 4K1UA 4STDA 1U8CB 1N9EA 3NV0B 3B8LA 5D83A 4BTYA 3HX8A 5D81A 1ROVA 4IIAA 3OX9A 2RFRA 3NBRA 5BVBA 4XM4A 1C7HA 3F40A 1YJ93 1F8NA 2XH9A 2WOHA 4HM8B 1OF5B 1E97A 1W2ZA 1JB2A 5FW5A 1W6YA 1RRLA 1LNHA 1GY7A 4O02B 3CC43 1Y4KA 4LMIA 2XSHB 3F14A 4WWUC 1Z1SA 1TU5A 3IMAB 1VQK3 4OUQA 5DREA 3G8ZA 4EBGA 1IV7A 5AIIA 3IPTA 4EC6A 3LT8A 3J7Yd 2A15A 2CFWA 3LTAA 1W6CA 3LMLA 2I9WA 2P0MA 3DXOA 3B4PA 4LEHA 5CXOA 4MJDA 3BLZA 1K28A 3AMOB 3D9RA 5JPPA 3CCU3 1VQ43 2C11A 4JF8A 4XB5A 3EX9A 3S27A 3CCR3 1DVDA 1VQP3 1SQWA 3EN1B 5IEOA 3KSPA 4IT7A 2CKFB 4N6V0 1SJWA 3O8YA 3MPHA 4N6NB 3V98A 3KN4A 1STDA 3FG1A 1QVG2 2WO0A 2HMJB 2CFKA 4N6OB 2IUJA 3WA2X 4FCMA 3K9MC 5BXQA 3S5CA 5JBSA 3LTBA 4EV5A 1AR0A 2CIUA 4HM0B 2HMKB 3CME3 5AYRB 1CQSA 1KQS2 3WA3A 2BNGA 3K0ZA 3PS8A 4L7KA 1JV2B 3Q1CA 3MSOA 1N8R4 5CF2A 3KE7A 4RBNA 4Q53A 3CCM3 1FA3A 3ROBA 5I97A 1UI7A 1O7WB 2CG0A 4AKYA 3F7XA 3S67A 2GU3A 1K734 3PXMA 3KIIA 3CCV3 1JB4A 1N5HA 2XSOB 2CFLA 1ZX2A 2W03A 5IG0A 4PEJA 1TUHA 1LOXA 3FLJA 2IMJA 4FCZA 2Y73A 3UL6A 3JUPA 1S723 2MC8A 3EQQB 3G4S3 3M8CA 2W9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7N B;  1W00 A;  3OWU A;  3BB9 A;  1BUQ A;  3LYG A;  1HKX A;  1WQL B;  5EVH A;  3CNX A;  5KP3 A;  4L7K A;  3DMC A;  3SED A;  5IER A;  3EJV A;  3FH1 A;  3MG1 A;  3OXA A;  1Q40 A;  1OGZ A;  3FKA A;  1GY5 A;  4J8T A;  4X2O A;  1UUW B;  4K1U A;  2F99 A;  4H3U A;  4HZ9 B;  4STD A;  2INX A;  3CNM A;  4HM4 B;  3T8U A;  1ULJ B;  1JKG A;  2STD A;  2YFI B;  3B8L A;  3F8H A;  3MKI A;  1QMA A;  3NV0 B;  1OCV A;  3HX8 A;  5D83 A;  5D81 A;  5IEN A;  4IIA A;  1GYB A;  3OX9 A;  3NXJ A;  4CDL A;  2RFR A;  3NBR A;  5BVB A;  6STD A;  1ISK A;  2QIY A;  2XRX B;  4XM4 A;  1W01 A;  1C7H A;  3GWR A;  3DUK A;  4I4K A;  4X2H A;  3F40 A;  4WYK B;  4HM8 B;  4XBX A;  1OF5 B;  1NU3 A;  2JQ5 A;  3A76 A;  1E97 A;  3MG3 A;  1K41 A;  4XDW A;  3CPO A;  1JB2 A;  4HM6 B;  4ORL A;  4XBY A;  5AIF A;  1ZO2 A;  5FW5 A;  3OWS A;  1W6Y A;  4R1K A;  5AEU B;  5IG4 A;  3E99 A;  1GY7 A;  8CHO A;  3K7C A;  4HM3 B;  1UUV B;  3I0Y A;  4LMI A;  3H3H A;  2XSH B;  3F14 A;  2GBW B;  3HK4 A;  3JUM A;  1Z1S A;  3OV4 A;  4WWU C;  4HM5 B;  3RGR A;  5CK6 A;  5TGN A;  3MHE A;  3DM8 A;  1NWW A;  5HGR A;  2Z7A A;  1S5A A;  2GXF A;  1Q42 A;  2GEY A;  2QGU A;  1JKG B;  3FF2 A;  1OH0 A;  3G8Z A;  4HM7 B;  4L8O A;  4OUQ A;  2B24 B;  5DRV A;  2RGQ A;  4R9L A;  5AII A;  5G2G A;  3IPT A;  2K54 A;  1NDO B;  2A15 A;  3CU3 A;  5IG5 A;  3B7C A;  1QJG A;  3F8X A;  2R4I A;  2HMO B;  5IG3 A;  2I9W A;  2W2C A;  1OHP A;  3B4P A;  3DXO A;  3FZW A;  3LZA A;  4WP5 A;  1A2K A;  1OHS A;  1OPY A;  4HM2 B;  4LEH A;  4MJD A;  4WYK A;  5AI1 A;  5CXO A;  3BLZ A;  3NUV A;  5D82 A;  3D9R A;  5STD A;  3EC9 A;  5JPP A;  4XB5 A;  3EX9 A;  3RGA A;  4N3V A;  1IDP A;  1E3R A;  1E3V A;  3EN1 B;  5IEO A;  2HML B;  1OUN A;  3KSP A;  3F9S A;  2BMR B;  1DMN A;  3GRD A;  2PZV A;  2CKF B;  2Z76 A;  4FCJ A;  3WMD A;  1SJW A;  1STD A;  3JUN A;  4HKV B;  3STD A;  2CHC A;  1ULI B;  3EBT A;  3G16 A;  2HMJ B;  3KKG A;  1VZZ A;  2YFL B;  5AIG A;  2XR8 B;  4FCM A;  3UNL A;  5BXQ A;  1DMQ A;  3S5C A;  3VGN A;  3ER7 A;  1EG9 B;  3EHC A;  1O7M B;  1AR0 A;  4HM0 B;  1JB5 A;  2GEX A;  2HMK B;  3GZY B;  1CQS A;  4XDV A;  3UJM A;  1EA2 A;  2BNG A;  5DRE A;  3K0Z A;  1GY6 A;  5AEW B;  1JN5 B;  3Q90 A;  4HJL B;  3B4O A;  1O7P B;  3DZL A;  3ECF A;  3NHX A;  3OWY A;  4HVN A;  1O7G B;  4HZB B;  2F98 A;  3EF8 A;  3G0K A;  3FGY A;  2HMM B;  3FSD A;  3MSO A;  4KVH A;  4L8P A;  4XBT A;  3KE7 A;  5AIH A;  3KZT A;  4K1V A;  4Q53 A;  5CF2 A;  5IEP A;  3JUQ A;  2B1X B;  3ROB A;  4R9K A;  2YFJ B;  1O7W B;  4OVM A;  2BMQ B;  5JPU A;  3GZB A;  5KP4 A;  2Z77 A;  3VSY A;  2GBX B;  2RCD A;  3NV0 A;  2OWP A;  3EN8 A;  3F7X A;  3FF0 A;  4GB5 A;  7STD A;  5KP1 A;  3SOY A;  5CLK A;  1DMM A;  1Q40 B;  2UX0 A;  1ASK A;  3SOA A;  1JB4 A;  3F7S A;  1TP6 A;  2XSO B;  1ZX2 A;  3JUO A;  5IG0 A;  4PEJ A;  1TUH A;  3HZP A;  5CF1 A;  1O7H B;  2HMN B;  3FLJ A;  3GZR A;  1OF5 A;  2IMJ A;  1W02 A;  1OGX A;  1OHO A;  1U5O A;  3MG2 A;  3MYT A;  3JUP A;  4HM1 B;  4U13 A;  5IF6 A;  3H51 A;  3T8N A;  4LGQ A;  3NM2 A;  2F86 B;  3EBY A;  3EQQ B;  1GS3 A;  1JN5 A;  2BMO B;  3M8C A;  4J9A A;  4RZM A;  3GZX B; 
#chains in the Genus database with same CATH topology
 4MMY B;  3GSP A;  3D4A A;  1D6Y A;  3JVC A;  1BUQ A;  1WMN A;  3CNX A;  4ZM8 A;  3DMC A;  3LT9 A;  3SED A;  4BIR A;  3FH1 A;  3FKA A;  1BNE A;  1UUW B;  1IU7 A;  1B21 A;  4H3U A;  3CNM A;  1A90 A;  3OW2 2;  2Z6B A;  1BGS A;  1TRP A;  1ULJ B;  1JKG A;  1YHQ 3;  3DGM A;  1OCV A;  4K61 A;  2CWT A;  1GYB A;  1MWR A;  3BNB A;  6STD A;  4RNY A;  3HII A;  9RNT A;  2KAA A;  1IT8 A;  1RN7 A;  2M7O A;  2HOH A;  2F56 A;  1JZD A;  3CMA 3;  4LZI A;  4WYK B;  1IVW A;  3MG3 A;  1K41 A;  4XDW A;  3CPO A;  4HM6 B;  1UI8 A;  3KSE D;  4ORL A;  4QWT A;  1ZO2 A;  4XBY A;  2BT3 A;  1NB5 I;  1HYF A;  3KCH A;  3V99 A;  1MNL A;  3E99 A;  1G96 A;  2W56 A;  3I0Y A;  3VSY A;  4WHA A;  3OV4 A;  3DY5 A;  1RGF A;  3AHW A;  3JUM A;  1GMQ A;  1B27 A;  1RGH A;  1GD3 A;  4MEI A;  4O2H A;  3RGR A;  4EXR A;  1X1Y A;  3DM8 A;  1PYL A;  5HGR A;  3QK9 A;  2P09 A;  4CJN A;  1RMS A;  4NPB A;  1DE3 A;  2GEY A;  3X42 A;  3FF2 A;  3KFQ C;  3AHS A;  4KFE A;  4LYL B;  1US1 A;  2RGQ A;  5DRV A;  1NO3 A;  2E2U A;  4FMA A;  1X1U A;  3SYU A;  3B7C A;  5IG5 A;  2HMO B;  1UGI A;  4WP5 A;  5AI1 A;  3L0R A;  1VQO 3;  1CYU A;  2OOV C;  5STD A;  3D3L A;  1A2P A;  3RGA A;  4FMD A;  4N3V A;  3FG3 A;  1I0V A;  4R4K A;  1E3R A;  1E3V A;  1EKM A;  2D42 A;  4RNT A;  1UCJ A;  2W6J H;  3F9S A;  1DMN A;  2H0I A;  2PZV A;  4FCJ A;  5M1A A;  1W6G A;  2BO9 B;  1VQL 3;  3PZW A;  3G6E 3;  1VQN 3;  2LQV A;  4HKV B;  4EYC A;  2CHC A;  1ULI B;  3G16 A;  1WTH A;  4FR9 A;  2CX1 A;  2XR8 B;  1BSB A;  3UNL A;  1DVC A;  1B2Z A;  4LSO A;  1Q82 4;  3D5G A;  2FNQ A;  1FGM A;  3A5E A;  1IQX A;  1AVL A;  3EHC A;  3GAX A;  3UJM A;  1JB5 A;  2GEX A;  1RTU A;  2ML6 A;  5A0O B;  5AEW B;  5IW9 A;  3CCQ 3;  1GY6 A;  3FG4 A;  1UW1 A;  1TIJ A;  2YX9 A;  3B4O A;  3DZL A;  3NHX A;  2KXG A;  3Q90 A;  4HVN A;  1O7G B;  1N5P A;  2F98 A;  1D6U A;  3FGY A;  2HMM B;  2KF6 A;  3FSD A;  4KVH A;  5AIH A;  1M9G A;  1EUI C;  3T0U A;  4K1V A;  1BNS A;  3LXU X;  2B1X B;  1UGH I;  2F4Y A;  2RSX A;  4OVM A;  5G1L A;  1IQY A;  1IVU A;  1WMO A;  1TTO A;  1R4C A;  2RCD A;  1I2F A;  1AVK A;  3EN8 A;  4GB5 A;  4MMZ B;  2IYJ A;  1RGC A;  5FGO A;  3D79 A;  1IVV A;  2XF3 A;  1LOV A;  2W0Q A;  4JRF A;  1MWU A;  1RHL A;  3EB8 A;  1GOY A;  3F7S A;  1RKY A;  4NRE A;  1BRK A;  3ZG5 A;  3ALA A;  1O7H B;  2MF7 A;  3GZR A;  3SXX A;  1L5G B;  4KFD A;  3SLU A;  1IQ8 A;  4EV2 A;  1W02 A;  4HM1 B;  1FGQ A;  2AAE A;  2QA4 3;  1FGT A;  3UL5 A;  3H51 A;  4LGQ A;  1BSC A;  2E2V A;  3EBY A;  4J9A A;  2GBX B;  2W9Q A;  4IPB A;  1YIJ 3;  1BAN A;  3BB9 A;  5KP3 A;  5EVH A;  2R41 A;  3SX1 A;  4O3V A;  4J5K A;  3VF1 A;  2BIR A;  3OXA A;  1GY5 A;  2F99 A;  2O9U X;  3V92 A;  2INX A;  2C10 A;  4HM4 B;  1DYU A;  3T8U A;  2STD A;  3F8H A;  3MKI A;  1QMA A;  4G1M B;  1RLS A;  5IEN A;  1YNV X;  3NXJ A;  5HOH A;  1MWT A;  2QIY A;  2XEP A;  1A2V A;  1IYY A;  1FW7 A;  1JNQ A;  3DUK A;  4X2H A;  7GSP A;  1SIH A;  2V1L A;  3IJE B;  1Q7Y 4;  3N54 B;  1NU3 A;  1ROA A;  1SII A;  1Q86 4;  1RGK A;  5AIF A;  2CH9 A;  5AEU B;  5IG4 A;  3HIG A;  1PY3 A;  1RJO A;  3OWS A;  3NQY A;  4R1K A;  8CHO A;  4HM3 B;  1YGW A;  1UUV B;  3HK4 A;  1BNG A;  2GBW B;  1VQ7 3;  2BHM A;  4HM5 B;  3HI7 A;  3S28 A;  1VQ9 3;  5TGN A;  1MGW A;  2KF5 A;  1BUJ A;  1NJI 4;  1TJD A;  2XGL A;  3U1W A;  1VQ8 3;  3WOD G;  5M19 A;  1STF I;  2GXF A;  1Q42 A;  1JKG B;  1OH0 A;  1TFO A;  3K63 A;  2K54 A;  1NDO B;  1FZU A;  3CU3 A;  1R4Y A;  1SPU A;  2UUG C;  3URP A;  3CCE 3;  1CYV A;  1QJG A;  1YVS A;  1W5Z A;  1T2I A;  3LH4 A;  2CFG A;  4GL6 A;  3LZA A;  7RNT A;  5IG3 A;  4WYK A;  1RRH A;  3NUV A;  2W04 A;  2UGI A;  3EC9 A;  1NB3 I;  1IDP A;  1W7C A;  5LC6 A;  6GSP A;  1A67 A;  1ZS7 A;  1OUN A;  4HBR A;  2BMR B;  3BNE A;  3MWZ A;  3WHO A;  3WMD A;  1BNI A;  2KRT A;  3QRD A;  4KT3 B;  3DH2 A;  3JUN A;  1HU9 A;  1LNI A;  3KKG A;  1RCL A;  4CCV A;  5EQL A;  3PCR A;  5BU4 A;  4HYZ A;  5AIG A;  5M18 A;  6RNT A;  1DMQ A;  3UB1 A;  1BOX A;  1V58 A;  3PGB A;  3ER7 A;  5EEO A;  3VGN A;  1TFK A;  3CD6 3;  3AMO A;  3FCS B;  5LC7 A;  5BIR A;  1RDS A;  1K8A 4;  1N9J A;  3GZY B;  1BVI A;  1IVX A;  1AQZ A;  1EA2 A;  4O8S A;  1Q81 4;  1JN5 B;  3PYJ A;  4HJL B;  1WMP A;  1O7P B;  1LXE A;  2XFT A;  3ECF A;  4HZB B;  5G2G A;  2IUK A;  3X41 A;  1VQ6 3;  1Q7H A;  1X1X A;  3EF8 A;  3G0K A;  4XBT A;  4CDL A;  2WGQ A;  1BRN L;  3X3Y A;  8RNT A;  1W2B 2;  1YGE A;  3JUQ A;  2GSP A;  2YFJ B;  1FGR A;  2OCT A;  2BMQ B;  5JPU A;  1JBT A;  5KP4 A;  2XGN A;  2Z77 A;  3X3Z A;  2CWV A;  5ELU A;  3NV0 A;  1B2U A;  2Y74 A;  1ZGX A;  2OWP A;  3DGO A;  4HOH A;  2F5W A;  5KP1 A;  3SOY A;  3U97 A;  1FGO A;  1YVB I;  1DMM A;  1Q40 B;  3X40 A;  2UX0 A;  1ASK A;  3LOY A;  4BU4 A;  3CCS 3;  3SVA A;  1QVF 2;  3N9H A;  3TDG A;  2ZL8 A;  3N8B A;  2HMN B;  1TRQ A;  1OF5 A;  2CC3 A;  3CPW 2;  1U5O A;  1OHO A;  3MYT A;  4H61 A;  1BRH A;  4AKZ A;  5IF6 A;  1BSE A;  3T8N A;  4N6U A;  1JN5 A;  4ILF A;  4MMX B;  3DGL A;  1C54 A;  1M1X B;  1CEW I;  1O7N B;  1I2G A;  2OOV A;  3OWU A;  3LYG A;  1I3I A;  1HKX A;  2ZA4 A;  1JJ2 2;  1I70 A;  3BND A;  4BTW A;  3MG1 A;  4J8T A;  4X2O A;  4BL2 A;  4HZ9 B;  1GMP A;  3S29 A;  2W56 B;  4I5Q A;  2WOF A;  2PNC A;  2YFI B;  1B2M A;  4N6L A;  1ISK A;  1CH0 A;  2Q07 A;  1N8Q A;  3CCL 3;  1B20 A;  2XRX B;  1W01 A;  4N6M A;  1BRI A;  2GU1 A;  3GWR A;  4I4K A;  1PU4 A;  1VQM 3;  2CFD A;  3Q2P A;  4XBX A;  4FMB A;  2JQ5 A;  3A76 A;  4TX4 A;  3CXC 2;  1LOW A;  2CG1 A;  1T5Y A;  3PCS A;  3K7C A;  1KC8 4;  3LTD A;  3NBJ A;  2P05 A;  4OK0 A;  3WOF B;  1YI2 3;  3H3H A;  1RN4 A;  1BSA A;  2ZDJ A;  2OTJ 3;  1KSI A;  5CK6 A;  2ML5 A;  3MHE A;  1PFP A;  2L1S A;  2H0H A;  2E2T A;  3LTC A;  3CC2 3;  1NWW A;  1JZO A;  1YJW 3;  1MOL A;  3CCJ 3;  2Z7A A;  1EEJ A;  1S5A A;  2QGU A;  1UCL A;  3BNC A;  4L8O A;  4HM7 B;  1UCK A;  2J8X B;  2B24 B;  1IT7 A;  4N6T A;  4R9L A;  5AYS C;  1AV4 A;  4NHF A;  3D5I A;  3NM7 A;  3F8X A;  1V74 A;  2R4I A;  1DET A;  4EW5 A;  1K9M 4;  2W2C A;  1OHP A;  3FZW A;  1M1K 4;  1W4N A;  3ZFZ A;  1A2K A;  1OHS A;  1OPY A;  4HM2 B;  5D82 A;  4K90 B;  2WGO A;  2SBL A;  3BU4 A;  1SAR A;  2HML B;  1GSP A;  3GRD A;  2Z76 A;  2XFS A;  1YIT 3;  1Q9E A;  3STD A;  3EBT A;  2P38 A;  2IA7 A;  1NNV A;  3WDG B;  1VZZ A;  2YFL B;  4KZ1 A;  1IK3 A;  3ZG0 A;  1LOY A;  3EE1 A;  3AGN A;  1EG9 B;  1BSD A;  1O7M B;  4XDV A;  3WOE B;  2P0X A;  3OWY A;  3DGY A;  1QAL A;  2CW9 A;  4L8P A;  2OTL 3;  1LRA A;  1WNH A;  5IEP A;  2KF3 A;  1YJN 3;  3KZT A;  1RCK A;  2L4V A;  3I56 3;  1RGL A;  4R80 A;  4FMC A;  4R9K A;  2O3O A;  3I55 3;  3GZB A;  1G02 A;  4CPK A;  5RNT A;  2FGT A;  1VQ5 3;  1RNB A;  1EQK A;  1FUS A;  1UUG B;  7STD A;  3NX0 A;  2K0M A;  2LYX A;  3FF0 A;  2FXT A;  2KCD A;  3G71 3;  3X3X A;  5CLK A;  3K5T A;  4WFO A;  2JDI H;  2OQE A;  5ELJ A;  3RNT A;  3SOA A;  1JBR A;  1AY7 A;  1TP6 A;  1M90 4;  2OQE C;  3JUO A;  1KWI A;  1RNT A;  3HZP A;  1JRQ A;  5CF1 A;  3CC7 3;  2CWU A;  1B2S A;  1OGX A;  1T2H A;  3NBB A;  3MG2 A;  1D6Z A;  3NQZ A;  4U13 A;  4AEQ A;  1J2B A;  1QAK A;  1QAF A;  3NM2 A;  2F86 B;  4KFF A;  1FUW A;  1GS3 A;  1IV9 A;  2BMO B;  4RZM A;  2QEX 3;  3GZX B;  4RNZ A;  4BTX A;  1GD4 A;  1BIR A;  1W00 A;  1OAC A;  3DGN A;  5G1K A;  1WQL B;  2F5M A;  5IER A;  1G0T A;  1V57 A;  3RDE A;  2CK3 H;  2D1W A;  1BRS A;  3EJV A;  1LVN A;  4DKI A;  1GOU A;  1OGZ A;  1Q40 A;  4K1U A;  4STD A;  1U8C B;  2IY2 A;  1N9E A;  2KF4 A;  3NV0 B;  3B8L A;  5D83 A;  4BTY A;  3HX8 A;  5D81 A;  1ROV A;  4IIA A;  3OX9 A;  4BL3 A;  2RFR A;  3NBR A;  5BVB A;  2ZHX B;  4XM4 A;  1I8V A;  1C7H A;  3F40 A;  1YJ9 3;  2H0G A;  1F8N A;  2K3D A;  2WOH A;  2XH9 A;  4HM8 B;  1OF5 B;  1E97 A;  1T3B A;  1W2Z A;  1I0X A;  1JB2 A;  1RGG A;  5FW5 A;  1FYS A;  4HAA A;  1MWS A;  1W6Y A;  1RRL A;  1LNH A;  1GY7 A;  4O02 B;  3CC4 3;  1Y4K A;  4GSP A;  4LMI A;  2XSH B;  3F14 A;  4WWU C;  1Z1S A;  1TU5 A;  3HOH A;  1GOV A;  1BNR A;  3IMA B;  1VQK 3;  1RN1 A;  1I3F A;  4OUQ A;  5DRE A;  1HZ1 A;  3G8Z A;  1RGE A;  4EBG A;  1LQG C;  1IV7 A;  5AII A;  3IPT A;  4EC6 A;  3LT8 A;  3J7Y d;  2C4B A;  2A15 A;  2CFW A;  3LTA A;  5GSP A;  1W6C A;  1BRJ A;  3LML A;  2I9W A;  2P0M A;  3DXO A;  3B4P A;  1JBS A;  1BU4 A;  4LEH A;  5CXO A;  4MJD A;  3BLZ A;  1K28 A;  3AMO B;  3D9R A;  5JPP A;  1B2X A;  3CCU 3;  2C11 A;  4JF8 A;  3BIR A;  3EX9 A;  4XB5 A;  3S27 A;  3CCR 3;  1VQ4 3;  1DVD A;  4J5G A;  1VQP 3;  1SQW A;  3EN1 B;  5IEO A;  3KSP A;  1I2E A;  4IT7 A;  2CX0 A;  2CKF B;  4N6V 0;  1SJW A;  3O8Y A;  3MPH A;  4N6N B;  3V98 A;  3KN4 A;  1STD A;  2BU4 A;  2RBI A;  3FG1 A;  1QVG 2;  2WO0 A;  2HMJ B;  1GMR A;  2CFK A;  4N6O B;  2IUJ A;  3WA2 X;  4FCM A;  3K9M C;  5BXQ A;  1B3S A;  3S5C A;  5JBS A;  4GHO A;  1LQM B;  3LTB A;  4EV5 A;  1AR0 A;  2CIU A;  4HM0 B;  2HMK B;  2RNT A;  5AYR B;  1CQS A;  3CME 3;  1KQS 2;  3WA3 A;  2BNG A;  3K0Z A;  3PS8 A;  4L7K A;  1JV2 B;  1BRG A;  3Q1C A;  3MSO A;  1RSN A;  1N8R 4;  5CF2 A;  3KE7 A;  4RBN A;  4Q53 A;  3CCM 3;  1FUT A;  1FA3 A;  3ROB A;  5I97 A;  1UI7 A;  1O7W B;  2CG0 A;  4AKY A;  3AGO A;  3Q3F A;  2SAR A;  1BNF A;  3F7X A;  3WR2 A;  1X1W A;  3S67 A;  2GU3 A;  2AAD A;  3PXM A;  3KII A;  1K73 4;  1UDI I;  3CCV 3;  1JB4 A;  1N5H A;  1UCI A;  2XSO B;  2CFL A;  1ZX2 A;  1VQQ A;  1RGA A;  2W03 A;  4PEJ A;  1TUH A;  5IG0 A;  1LOX A;  1KD1 4;  3FLJ A;  2IMJ A;  1BAO A;  4FCZ A;  1MGR A;  2Y73 A;  3UL6 A;  3JUP A;  1S72 3;  2MC8 A;  1BNJ A;  3EQQ B;  3G4S 3;  3M8C A;  2W9P A; 
#chains in the Genus database with same CATH homology
 4MMY B;  3JVC A;  1D6Y A;  1BUQ A;  1WMN A;  3CNX A;  4ZM8 A;  3DMC A;  3LT9 A;  3SED A;  3FH1 A;  3FKA A;  1UUW B;  1IU7 A;  4H3U A;  3CNM A;  1A90 A;  3OW2 2;  2Z6B A;  1ULJ B;  1JKG A;  1YHQ 3;  3DGM A;  1OCV A;  4K61 A;  2CWT A;  1GYB A;  3BNB A;  6STD A;  4RNY A;  3HII A;  2M7O A;  1IT8 A;  1RN7 A;  3CMA 3;  4LZI A;  4WYK B;  1IVW A;  3MG3 A;  1K41 A;  4XDW A;  3CPO A;  4HM6 B;  1UI8 A;  3KSE D;  4ORL A;  4QWT A;  1ZO2 A;  4XBY A;  2BT3 A;  1NB5 I;  3V99 A;  1MNL A;  3E99 A;  1G96 A;  2W56 A;  3I0Y A;  3VSY A;  4WHA A;  3OV4 A;  3DY5 A;  3JUM A;  3RGR A;  1GD3 A;  4MEI A;  4O2H A;  4EXR A;  3DM8 A;  5HGR A;  3QK9 A;  2P09 A;  2GEY A;  3X42 A;  3FF2 A;  3KFQ C;  4KFE A;  5DRV A;  1US1 A;  2RGQ A;  1NO3 A;  2E2U A;  4FMA A;  5IG5 A;  3B7C A;  2HMO B;  4WP5 A;  5AI1 A;  3L0R A;  1VQO 3;  1CYU A;  2OOV C;  5STD A;  3D3L A;  3RGA A;  4FMD A;  4N3V A;  3FG3 A;  4R4K A;  1E3R A;  1E3V A;  1EKM A;  2D42 A;  2W6J H;  3F9S A;  1DMN A;  2PZV A;  4FCJ A;  1W6G A;  2BO9 B;  1VQL 3;  3PZW A;  3G6E 3;  1VQN 3;  2LQV A;  4HKV B;  4EYC A;  2CHC A;  1ULI B;  3G16 A;  1WTH A;  4FR9 A;  2XR8 B;  3UNL A;  1DVC A;  4LSO A;  1Q82 4;  2FNQ A;  1FGM A;  3GAX A;  1IQX A;  3EHC A;  1AVL A;  3UJM A;  1JB5 A;  2GEX A;  2ML6 A;  5A0O B;  5AEW B;  5IW9 A;  3CCQ 3;  1GY6 A;  3FG4 A;  1UW1 A;  1TIJ A;  2YX9 A;  3B4O A;  3DZL A;  3NHX A;  2KXG A;  3Q90 A;  4HVN A;  1O7G B;  1N5P A;  2F98 A;  1D6U A;  3FGY A;  2HMM B;  3FSD A;  4KVH A;  5AIH A;  1M9G A;  3T0U A;  4K1V A;  3LXU X;  2B1X B;  2RSX A;  4OVM A;  1IQY A;  1IVU A;  1WMO A;  2RCD A;  1R4C A;  4GB5 A;  3EN8 A;  1AVK A;  4MMZ B;  5FGO A;  1IVV A;  2XF3 A;  2W0Q A;  4JRF A;  3EB8 A;  3F7S A;  1RKY A;  4NRE A;  3ALA A;  1O7H B;  2MF7 A;  3GZR A;  3SXX A;  1L5G B;  4KFD A;  3SLU A;  1IQ8 A;  4EV2 A;  1W02 A;  4HM1 B;  1FGQ A;  2QA4 3;  1FGT A;  3UL5 A;  3H51 A;  4LGQ A;  2E2V A;  3EBY A;  4J9A A;  2GBX B;  2W9Q A;  4IPB A;  1YIJ 3;  3BB9 A;  5KP3 A;  5EVH A;  3SX1 A;  4O3V A;  3VF1 A;  3OXA A;  1GY5 A;  2F99 A;  2O9U X;  3V92 A;  2INX A;  2C10 A;  4HM4 B;  1DYU A;  3T8U A;  2STD A;  3F8H A;  3MKI A;  1QMA A;  4G1M B;  5IEN A;  3NXJ A;  2QIY A;  2XEP A;  1A2V A;  1JNQ A;  3DUK A;  4X2H A;  1SIH A;  2V1L A;  3IJE B;  1Q7Y 4;  3N54 B;  1NU3 A;  1ROA A;  1SII A;  1Q86 4;  5IG4 A;  5AIF A;  2CH9 A;  5AEU B;  1KD1 4;  3HIG A;  3OWS A;  1RJO A;  4R1K A;  3NQY A;  8CHO A;  4HM3 B;  1UUV B;  3HK4 A;  2GBW B;  1VQ7 3;  2BHM A;  4HM5 B;  3HI7 A;  3S28 A;  1VQ9 3;  5TGN A;  1NJI 4;  2XGL A;  3U1W A;  1VQ8 3;  3WOD G;  1STF I;  2GXF A;  1Q42 A;  1JKG B;  1OH0 A;  1TFO A;  3K63 A;  2K54 A;  1NDO B;  3CU3 A;  1SPU A;  3CCE 3;  1CYV A;  1QJG A;  3LH4 A;  1W5Z A;  2CFG A;  4GL6 A;  3LZA A;  5IG3 A;  4WYK A;  1RRH A;  3NUV A;  2W04 A;  3EC9 A;  1NB3 I;  1IDP A;  1W7C A;  5LC6 A;  1A67 A;  1OUN A;  4HBR A;  2BMR B;  3BNE A;  3MWZ A;  3WMD A;  2KRT A;  3QRD A;  3JUN A;  1HU9 A;  3KKG A;  4CCV A;  5EQL A;  3PCR A;  4HYZ A;  5AIG A;  1DMQ A;  3UB1 A;  3PGB A;  5EEO A;  3ER7 A;  3VGN A;  3CD6 3;  1TFK A;  3AMO A;  3FCS B;  5LC7 A;  1K8A 4;  1N9J A;  3GZY B;  1IVX A;  1EA2 A;  4O8S A;  1Q81 4;  1JN5 B;  3PYJ A;  4HJL B;  1WMP A;  1O7P B;  1LXE A;  2XFT A;  3ECF A;  4HZB B;  5G2G A;  2IUK A;  3X41 A;  1VQ6 3;  3EF8 A;  3G0K A;  4XBT A;  4CDL A;  2WGQ A;  3X3Y A;  1W2B 2;  1YGE A;  3JUQ A;  2YFJ B;  1FGR A;  2OCT A;  2BMQ B;  5JPU A;  5KP4 A;  2XGN A;  2Z77 A;  3X3Z A;  2CWV A;  5ELU A;  3NV0 A;  2Y74 A;  2OWP A;  3DGO A;  5KP1 A;  3SOY A;  3U97 A;  1FGO A;  1YVB I;  1DMM A;  1Q40 B;  3X40 A;  2UX0 A;  1ASK A;  3LOY A;  3CCS 3;  1QVF 2;  3SVA A;  3N9H A;  3TDG A;  2ZL8 A;  3N8B A;  2HMN B;  1OF5 A;  2CC3 A;  3CPW 2;  1U5O A;  1OHO A;  3MYT A;  4H61 A;  4AKZ A;  5IF6 A;  3T8N A;  4N6U A;  1JN5 A;  4MMX B;  3DGL A;  1CEW I;  1M1X B;  1O7N B;  2OOV A;  3OWU A;  3LYG A;  1HKX A;  1JJ2 2;  3BND A;  4BTW A;  3MG1 A;  4J8T A;  4X2O A;  4HZ9 B;  3S29 A;  2W56 B;  2WOF A;  2PNC A;  2YFI B;  4N6L A;  1ISK A;  2Q07 A;  3CCL 3;  1N8Q A;  2XRX B;  1W01 A;  4N6M A;  2GU1 A;  3GWR A;  4I4K A;  1PU4 A;  1VQM 3;  2CFD A;  3Q2P A;  4XBX A;  4FMB A;  2JQ5 A;  3A76 A;  4TX4 A;  3CXC 2;  2CG1 A;  1T5Y A;  3PCS A;  3K7C A;  1KC8 4;  3LTD A;  3NBJ A;  2P05 A;  4OK0 A;  3WOF B;  1YI2 3;  3H3H A;  2ZDJ A;  2OTJ 3;  1KSI A;  5CK6 A;  2ML5 A;  3MHE A;  1PFP A;  3LTC A;  2E2T A;  1YJW 3;  3CC2 3;  1NWW A;  1MOL A;  3CCJ 3;  2Z7A A;  1S5A A;  2QGU A;  3BNC A;  4L8O A;  4HM7 B;  2B24 B;  1IT7 A;  4N6T A;  4R9L A;  5AYS C;  1AV4 A;  4NHF A;  3NM7 A;  3F8X A;  1V74 A;  2R4I A;  1K9M 4;  2W2C A;  1OHP A;  3FZW A;  1M1K 4;  1W4N A;  1A2K A;  1OHS A;  1OPY A;  4HM2 B;  5D82 A;  4K90 B;  2WGO A;  2SBL A;  2HML B;  3GRD A;  2Z76 A;  2XFS A;  1YIT 3;  3STD A;  3EBT A;  2P38 A;  2IA7 A;  3WDG B;  1VZZ A;  2YFL B;  4KZ1 A;  1IK3 A;  3EE1 A;  1EG9 B;  1O7M B;  4XDV A;  3WOE B;  2P0X A;  3OWY A;  1QAL A;  2CW9 A;  4L8P A;  2OTL 3;  1WNH A;  5IEP A;  1YJN 3;  3KZT A;  2L4V A;  3I56 3;  4R80 A;  4FMC A;  4R9K A;  2O3O A;  3I55 3;  3GZB A;  2FGT A;  1VQ5 3;  1EQK A;  7STD A;  3NX0 A;  2K0M A;  2LYX A;  3FF0 A;  2FXT A;  2KCD A;  3G71 3;  3X3X A;  5CLK A;  3K5T A;  4WFO A;  2JDI H;  2OQE A;  5ELJ A;  3SOA A;  1TP6 A;  1M90 4;  2OQE C;  3JUO A;  1KWI A;  3HZP A;  1JRQ A;  5CF1 A;  3CC7 3;  2CWU A;  3NBB A;  1OGX A;  4AEQ A;  3NQZ A;  3MG2 A;  1D6Z A;  4U13 A;  1J2B A;  1QAK A;  1QAF A;  3NM2 A;  2F86 B;  4KFF A;  1FUW A;  1GS3 A;  1IV9 A;  2BMO B;  4RZM A;  2QEX 3;  3GZX B;  4RNZ A;  4BTX A;  1GD4 A;  1W00 A;  1OAC A;  3DGN A;  1WQL B;  5IER A;  3RDE A;  2CK3 H;  2D1W A;  3EJV A;  1LVN A;  1Q40 A;  1OGZ A;  4K1U A;  4STD A;  1U8C B;  1N9E A;  3NV0 B;  3B8L A;  5D83 A;  4BTY A;  3HX8 A;  5D81 A;  1ROV A;  4IIA A;  3OX9 A;  2RFR A;  3NBR A;  5BVB A;  4XM4 A;  1C7H A;  3F40 A;  1YJ9 3;  1F8N A;  2XH9 A;  2WOH A;  4HM8 B;  1OF5 B;  1E97 A;  1W2Z A;  1JB2 A;  5FW5 A;  1W6Y A;  1RRL A;  1LNH A;  1GY7 A;  4O02 B;  3CC4 3;  1Y4K A;  4LMI A;  2XSH B;  3F14 A;  4WWU C;  1Z1S A;  1TU5 A;  3IMA B;  1VQK 3;  4OUQ A;  5DRE A;  3G8Z A;  4EBG A;  1IV7 A;  5AII A;  3IPT A;  4EC6 A;  3LT8 A;  3J7Y d;  2A15 A;  2CFW A;  3LTA A;  1W6C A;  3LML A;  2I9W A;  2P0M A;  3DXO A;  3B4P A;  4LEH A;  5CXO A;  4MJD A;  3BLZ A;  1K28 A;  3AMO B;  3D9R A;  5JPP A;  3CCU 3;  1VQ4 3;  2C11 A;  4JF8 A;  4XB5 A;  3EX9 A;  3S27 A;  3CCR 3;  1DVD A;  1VQP 3;  1SQW A;  3EN1 B;  5IEO A;  3KSP A;  4IT7 A;  2CKF B;  4N6V 0;  1SJW A;  3O8Y A;  3MPH A;  4N6N B;  3V98 A;  3KN4 A;  1STD A;  3FG1 A;  1QVG 2;  2WO0 A;  2HMJ B;  2CFK A;  4N6O B;  2IUJ A;  3WA2 X;  4FCM A;  3K9M C;  5BXQ A;  3S5C A;  5JBS A;  3LTB A;  4EV5 A;  1AR0 A;  2CIU A;  4HM0 B;  2HMK B;  3CME 3;  5AYR B;  1CQS A;  1KQS 2;  3WA3 A;  2BNG A;  3K0Z A;  3PS8 A;  4L7K A;  1JV2 B;  3Q1C A;  3MSO A;  1N8R 4;  5CF2 A;  3KE7 A;  4RBN A;  4Q53 A;  3CCM 3;  1FA3 A;  3ROB A;  5I97 A;  1UI7 A;  1O7W B;  2CG0 A;  4AKY A;  3F7X A;  3S67 A;  2GU3 A;  1K73 4;  3PXM A;  3KII A;  3CCV 3;  1JB4 A;  1N5H A;  2XSO B;  2CFL A;  1ZX2 A;  2W03 A;  5IG0 A;  4PEJ A;  1TUH A;  1LOX A;  3FLJ A;  2IMJ A;  4FCZ A;  2Y73 A;  3UL6 A;  3JUP A;  1S72 3;  2MC8 A;  3EQQ B;  3G4S 3;  3M8C A;  2W9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...