2F86B

The association domain of c. elegans camkii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
NDSEKAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFDGNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Oligomerization states of the association domain and the holoenyzme of Ca2+/CaM kinase II.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
molecule keywords Hypothetical protein K11E8.1d
total genus 36
structure length 129
sequence length 129
chains with identical sequence D, F, H, J, L, N
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f86B00
3GZRA 1TP6A 1E3RA 1O7WB 2HMOB 4PEJA 4WWUC 3DZLA 3OWUA 3FZWA 3NHXA 4L8OA 4OUQA 3GZXB 3LZAA 1VZZA 3F40A 3MYTA 5AIFA 3NV0A 1ZO2A 3FGYA 3KE7A 5AIHA 2XSHB 3RGAA 3EBYA 5AIIA 5HGRA 3T8UA 2JQ5A 3F7SA 4OVMA 1OF5B 4WYKB 3JUNA 1Z1SA 2HMJB 4WYKA 1TUHA 1JKGA 3DUKA 4LMIA 1W02A 2K54A 2RCDA 3OWSA 3F14A 3DMCA 4HM1B 3KSPA 5CLKA 3WMDA 4HM2B 2GEXA 3F7XA 3RGRA 2HMLB 1JB5A 1DMNA 4WP5A 3KKGA 2GBXB 1BUQA 1JKGB 1DMQA 3ER7A 3MG2A 2F98A 2QGUA 4HM0B 1OPYA 1OHPA 1O7GB 1HKXA 1JN5B 3B4OA 3HZPA 3MSOA 3OXAA 3F8HA 3OWYA 4FCJA 1ISKA 1IDPA 3B7CA 3H51A 5CK6A 1ULIB 4Q53A 1OGZA 4U13A 1JB2A 4RZMA 3NBRA 1JB4A 2Z76A 3CNXA 2W2CA 5JPPA 3EC9A 3FF2A 3MHEA 4XBTA 5D82A 5KP3A 3T8NA 3EN8A 1ULJB 1C7HA 2BNGA 4H3UA 6STDA 2F99A 3F9SA 8CHOA 5JPUA 3GRDA 5IEPA 1K41A 5D81A 3SOAA 4ORLA 1NWWA 1OHOA 5BXQA 4J9AA 2CKFB 4HZBB 5KP4A 3A76A 3HK4A 3CPOA 3K0ZA 4L7KA 5FW5A 4XM4A 3CNMA 3EF8A 1ZX2A 3I0YA 4XDWA 2GEYA 1W01A 1GY7A 2UX0A 3B4PA 1U5OA 4HKVB 4LEHA 3G16A 4X2OA 2HMKB 3JUMA 3NV0B 5KP1A 3JUQA 4FCMA 5DRVA 4STDA 3KZTA 4R1KA 2YFJB 5BVBA 1GY5A 2HMNB 3IPTA 3GZBA 4LGQA 5TGNA 2BMQB 5AI1A 3OV4A 1O7NB 3NUVA 3FF0A 2GXFA 3S5CA 2B1XB 3OX9A 2STDA 4HM7B 3GWRA 4HZ9B 3B8LA 3JUOA 3MG1A 1OGXA 2RFRA 4X2HA 5DREA 1W6YA 3EX9A 5IG5A 1STDA 3UJMA 4HVNA 4XDVA 2R4IA 2GBWB 4GB5A 3MG3A 4HM4B 3ECFA 1W00A 3NM2A 4K1VA 4XBYA 5IF6A 1EG9B 4HJLB 3STDA 4I4KA 4R9KA 2F86B 1NU3A 1SJWA 3LYGA 5IG4A 4IIAA 2XR8B 1WQLB 5IEOA 1UUWB 1GYBA 2CHCA 3HX8A 5CXOA 4KVHA 4XBXA 2PZVA 4XB5A 5IERA 1QMAA 1S5AA 1E3VA 3NXJA 3ROBA 5AIGA 1OF5A 1ASKA 1OH0A 1Q40A 5CF2A 3DM8A 2OWPA 1CQSA 4R9LA 5CF1A 4N3VA 5AEUB 4HM8B 4MJDA 2XRXB 1AR0A 2YFLB 3EQQB 4HM3B 5AEWB 3F8XA 2BMRB 1DMMA 3FH1A 3UNLA 2A15A 1O7PB 1Q40B 3SOYA 2IMJA 3EJVA 3E99A 4HM6B 3G8ZA 3VGNA 5EVHA 5IENA 2RGQA 3G0KA 2Z77A 1OCVA 2HMMB 3D9RA 3DXOA 3K7CA 4L8PA 1JN5A 2I9WA 3BB9A 3FKAA 2B24B 2INXA 3CU3A 3FLJA 5D83A 7STDA 2XSOB 3SEDA 3FSDA 1QJGA 1OHSA 1GY6A 1A2KA 1EA2A 1GS3A 1O7MB 1UUVB 3M8CA 5STDA 2QIYA 1O7HB 1OUNA 3JUPA 3MKIA 4CDLA 2YFIB 3Q90A 2BMOB 4HM5B 1E97A 4J8TA 3VSYA 3H3HA 3EN1B 1Q42A 2Z7AA 3EBTA 5G2GA 3BLZA 5IG0A 4K1UA 5IG3A 3GZYB 3EHCA 1NDOB
chains in the Genus database with same CATH superfamily
3GZRA 1O7WB 1B27A 1DE3A 2F56A 3NHXA 4L8OA 4RNZA 3GZXB 1GMRA 3BIRA 1VQ53 1F8NA 3F40A 3MYTA 2XSHB 3EBYA 5AIIA 3FG1A 3RDEA 1Z1SA 2W56B 5G1KA 1IYYA 3TDGA 1W02A 3OWSA 7GSPA 4HM1B 2CWTA 5CLKA 1PU4A 1BSAA 2GEXA 3D5IA 3RGRA 1JB5A 3KKGA 1YJ93 1NO3A 1JJ22 4KT3B 3ER7A 1DMQA 4BL3A 2F98A 1QAFA 3OWYA 1RCKA 1RN4A 1JN5B 3B4OA 1I3IA 3FCSB 3MSOA 3NQZA 2OQEA 1NB5I 4N6TA 3B7CA 1ULIB 3KSED 1JB2A 5RNTA 3KIIA 2F5WA 2XH9A 1RNTA 5BIRA 2W2CA 5JPPA 3SYUA 2ZDJA 1IV7A 3LT8A 1RDSA 1BRGA 1C7HA 1I2EA 2L4VA 5A0OB 6STDA 3URPA 8CHOA 5JPUA 1B3SA 1B2ZA 2E2VA 1BSDA 2GSPA 2V1LA 3LXUX 3PXMA 5M1AA 5BXQA 2CKFB 5KP4A 1T3BA 3A76A 4L7KA 5FW5A 3KN4A 3CCL3 3EF8A 4XDWA 2GEYA 4HKVB 2Y73A 1U5OA 4LEHA 4QWTA 1A67A 4BIRA 4FCMA 2CK3H 2J8XB 2E2UA 1YJN3 5IW9A 2HMNB 1I8VA 1IQYA 3G6E3 2FGTA 1TTOA 4LGQA 2M7OA 1O7NB 3X42A 1TRQA 1N5HA 3CMA3 4AKYA 1IVWA 1IV9A 1G96A 2CG0A 2UGIA 3PCSA 3O8YA 4HZ9B 4X2HA 3JUOA 1CH0A 1FGOA 2RFRA 2P38A 4HVNA 4LYLB 1JV2B 2GBWB 1B2MA 3NM2A 1WTHA 4K1VA 1BIRA 3JVCA 1N5PA 2CIUA 2F86B 1SJWA 1UI8A 4EYCA 2CHCA 1FYSA 1WMPA 3PGBA 3K5TA 4I5QA 4XB5A 1QMAA 4GL6A 5AYRB 4CJNA 1UCLA 3CC43 1OH0A 1TFKA 4HYZA 3CXC2 2OWPA 5CF1A 2MF7A 2Y74A 4RNYA 2XRXB 2XF3A 4O02B 1GSPA 3DH2A 3FH1A 1B2SA 2A15A 1MWSA 1WMNA 1Q40B 2CWVA 4KFDA 2H0HA 2KF3A 2OOVC 1RGAA 3GAXA 3G0KA 4BTWA 1LOWA 1LQMB 2GU1A 1JN5A 2I9WA 7STDA 3WA3A 4ZM8A 3LMLA 2ZHXB 1RN1A 2XSOB 1I0XA 3I563 2UUGC 1OHSA 1O7MB 3AGNA 1QAKA 1N9EA 5STDA 1X1XA 1FUWA 3JUPA 2RNTA 2YFIB 2KRTA 3DY5A 3QRDA 1RCLA 2BIRA 1VQL3 1E97A 3CCJ3 1RGGA 2KCDA 3BNDA 1Q42A 5G2GA 5ELUA 3BLZA 3AHWA 1RJOA 4AEQA 3EHCA 1PY3A 1MWTA 1TP6A 1E3RA 1AV4A 3KFQC 3A5EA 2WGQA 3CC73 1QVF2 3OWUA 1BGSA 3UL6A 2W0QA 1WMOA 1BRHA 3MWZA 1VZZA 1LOYA 1RLSA 5AIHA 3RGAA 1STFI 1IVVA 2P0MA 4O2HA 1FZUA 1BRKA 2F4YA 1JZDA 2W03A 3ZFZA 4CPKA 4WYKB 2AADA 1GOUA 4WHAA 4WYKA 1TUHA 1YI23 3DUKA 3LH4A 2K54A 1W4NA 2IUJA 1DVCA 3DMCA 1R4YA 3KSPA 1MOLA 1QALA 3J7Yd 1X1WA 2HMLB 1DMNA 4WP5A 3CCE3 1CYUA 1JKGB 3U1WA 3ROBA 5IG0A 5CF2A 5FGOA 1HKXA 1IDPA 2CFGA 1EQKA 4Q53A 1OGZA 4U13A 1Q7HA 1JB4A 2CFWA 3NX0A 1SIIA 4N6LA 3EC9A 1N8R4 4XBTA 3MHEA 5D82A 1LNIA 1K734 1CEWI 1T5YA 2KAAA 1BNFA 1LNHA 1MWRA 3EN8A 2F99A 1IU7A 1RMSA 2R41A 4FR9A 3WDGB 3SOAA 3DGLA 3IMAB 3WOEB 4BU4A 2W9QA 1AY7A 3K0ZA 1RTUA 4LSOA 4XM4A 3HIIA 1UDII 1KSIA 4RNTA 1ZX2A 3BNBA 3SVAA 2P05A 3LOYA 2L1SA 3JUQA 3NV0B 3X41A 2JDIH 2Z6BA 1FW7A 3S29A 4R80A 5G1LA 1VQQA 1Q864 1GY5A 3IPTA 4IT7A 1YVBI 2BMQB 5BU4A 4OK0A 1N9JA 2K3DA 4O8SA 3NUVA 2GXFA 3S5CA 1Q7Y4 4JF8A 3OX9A 4HM7B 2QEX3 5DREA 1YIT3 1VQ63 2E2TA 4FMBA 2LYXA 3UJMA 1M1K4 1RSNA 3CCR3 1RGFA 2KF5A 2R4IA 1MWUA 2BU4A 3MG3A 1BSEA 1W00A 3ECFA 4HM4B 5IF6A 3STDA 1FGQA 1US1A 2W56A 2MC8A 3WR2A 4DKIA 4EC6A 4IIAA 1AVKA 1VQ43 5IEOA 1FUTA 1EUIC 1GYBA 1LOVA 3DGOA 1CYVA 1I0VA 2ZL8A 1S5AA 1UGIA 4FCZA 1Q40A 1MGWA 1BAOA 4R9LA 1FGMA 3Q1CA 2BO9B 1SPUA 3EQQB 1MGRA 3F8XA 2XGNA 1DMMA 1D6YA 1IVXA 3DGNA 3AMOB 1TU5A 1YIJ3 1LOXA 3EJVA 1BNJA 4HM6B 3L0RA 1W5ZA 5EVHA 2RGQA 1OACA 1OCVA 4ORLA 1B2XA 1V58A 2Q07A 2WO0A 3BB9A 3BU4A 4GHOA 6RNTA 3SLUA 4EV5A 4MMYB 1LRAA 3SEDA 3I553 3NM7A 1GS3A 1NJI4 2FXTA 3IJEB 1M9GA 2K0MA 1UGHI 4O3VA 1I2GA 1OUNA 4N6V0 5AYSC 1GMQA 3Q90A 2BMOB 1IT7A 2CC3A 1UUGB 4J8TA 1RKYA 3HIGA 3VF1A 3VSYA 3ZG5A 2Z7AA 1RGCA 1SQWA 4K1UA 1BNIA 1NDOB 3CCU3 1SIHA 4PEJA 2H0GA 3OW22 1BSCA 1FUSA 3DZLA 5ELJA 2FNQA 3FZWA 1A2PA 1V57A 3U97A 3LZAA 1VQ83 5M19A 2KF4A 5AIFA 2CH9A 3NV0A 1SARA 2SARA 1T2HA 3FGYA 4FMAA 3T8UA 1IQXA 2JQ5A 3F7SA 3WHOA 1OF5B 1YVSA 2GU3A 4HOHA 3V99A 1RNBA 2HMJB 1ZGXA 2SBLA 1JKGA 2RCDA 4EBGA 5LC7A 1B20A 1ZS7A 3F14A 6GSPA 2XFSA 4HM2B 3F7XA 1GOVA 3N54B 4N6NB 2C11A 3PYJA 4AKZA 2W9PA 2XGLA 2GBXB 4IPBA 3CCM3 1DYUA 3MG2A 4LZIA 4XBYA 1BUJA 3F8HA 3BNEA 4N6OB 3CCS3 1ISKA 3H51A 1FGTA 5CK6A 1VQ73 1IK3A 4RZMA 2PNCA 3NBRA 1JZOA 2Z76A 2CFLA 3UB1A 3CNXA 1UW1A 1GD4A 1GMPA 3FG3A 1WNHA 1YGWA 5KP3A 3T8NA 3SX1A 3PZWA 2BNGA 2H0IA 4H3UA 3S27A 1G02A 5IEPA 1K41A 1Q9EA 3MPHA 5D81A 1NNVA 1NWWA 1OHOA 1YGEA 3CME3 4J9AA 2CG1A 3PS8A 3WA2X 2WOHA 1TRPA 2CX1A 3I0YA 4NHFA 2O3OA 1W01A 2UX0A 3WOFB 3G16A 1I3FA 2HMKB 1YHQ3 3JUMA 4BTYA 2O9UX 3EE1A 1JNQA 5DRVA 1N8QA 4STDA 3KZTA 8RNTA 5HOHA 2YFJB 1YJW3 2KXGA 1I70A 5M18A 3AHSA 5TGNA 1DETA 1I2FA 1BANA 3FF0A 4HAAA 3ALAA 1JBRA 2B1XB 1BRJA 7RNTA 2HOHA 3GWRA 1IVUA 3B8LA 2CFDA 2F5MA 1OGXA 3MG1A 3N8BA 5IG5A 3EX9A 1LVNA 1STDA 4FMCA 4N6UA 5GSPA 1BNRA 2OTJ3 3DGMA 2RSXA 1QVG2 4XDVA 1VQM3 4GB5A 1A90A 1TIJA 3CD63 1JBSA 4CCVA 1EG9B 4ILFA 1NU3A 1YNVX 3LYGA 5IG4A 1K8A4 1AVLA 1JBTA 2XR8B 1UUWB 1X1YA 2XFTA 4KVHA 4TX4A 2PZVA 3DGYA 5CXOA 3NXJA 2YX9A 3K63A 3AMOA 3K9MC 4EW5A 1OF5A 1ASKA 1M1XB 1VQO3 1BVIA 1GD3A 1UI7A 2WOFA 5AEUB 4HM8B 1HU9A 1AR0A 1LQGC 1RGKA 2YFLB 4KFFA 4WFOA 3X3ZA 1RGEA 2BT3A 2IY2A 2P09A 4BL2A 2OTL3 1K28A 1B2UA 1O7PB 2IMJA 3E99A 1W6CA 2CW9A 3VGNA 5IENA 1D6UA 3GSPA 1EEJA 1AQZA 1KWIA 2HMMB 2Z77A 3DXOA 3D79A 4L8PA 3LTAA 4MJDA 2OOVA 2B24B 3CU3A 5D83A 1BNSA 1C54A 2CFKA 3AGOA 4G1MB 3FSDA 1A2KA 1EA2A 3M8CA 1BRNL 2WGOA 3EB8A 2QIYA 1BNEA 4R4KA 4GSPA 2ZA4A 2BHMA 3UL5A 2P0XA 5IG3A 1GOYA 3GZYB 1A2VA 4MMZB 3LTBA 1J2BA 1BRIA 1BU4A 4HBRA 4KZ1A 4WWUC 2HMOB 1UCIA 1W7CA 1Q824 1RGHA 4H61A 2IUKA 4OUQA 1FA3A 1RRHA 2OCTA 3G4S3 1ZO2A 3KE7A 1KQS2 5HGRA 4OVMA 3JUNA 4BTXA 1W2ZA 5EQLA 4LMIA 4NPBA 1LXEA 1G0TA 3V92A 1TFOA 2IYJA 3WMDA 3X40A 1B21A 4N6MA 1Y4KA 1BUQA 1BRSA 1T2IA 2QGUA 4HM0B 1OPYA 1OHPA 1O7GB 3HZPA 3OXAA 4NREA 4FCJA 2C10A 3LTCA 1EKMA 2QA43 9RNTA 3T0UA 3X3YA 1U8CB 4MEIA 1IT8A 1IQ8A 3FF2A 3V98A 3G713 1Q814 1ROAA 1ULJB 1L5GB 3RNTA 3BNCA 3F9SA 3S28A 3GRDA 2D1WA 1D6ZA 4HZBB 3HK4A 3CPOA 2LQVA 1NB3I 3CNMA 3WODG 3KCHA 3CC23 1VQP3 1GY7A 3B4PA 2ML6A 4X2OA 1RHLA 5KP1A 2CWUA 2OQEC 1KD14 2AAEA 3Q3FA 1K9M4 4R1KA 3D3LA 5BVBA 2ML5A 3GZBA 1R4CA 3HI7A 5AI1A 3OV4A 3LT9A 3SXXA 1V74A 1PFPA 1M904 4EV2A 2STDA 4K90B 1W6YA 5LC6A 1W2B2 2C4BA 1HYFA 4J5KA 1BOXA 1ROVA 1X1UA 3D4AA 1HZ1A 4HJLB 1W6GA 4I4KA 4R9KA 3D5GA 1UCKA 1DVDA 1WQLB 2KF6A 2XEPA 3HX8A 4XBXA 5IERA 4JRFA 3PCRA 2D42A 1E3VA 4EXRA 1TJDA 3X3XA 5AIGA 3DM8A 1CQSA 1UCJA 4FMDA 4N3VA 2IA7A 4HM3B 2RBIA 3QK9A 5AEWB 3CPW2 3CCV3 2BMRB 4J5GA 4RBNA 3UNLA 1RGLA 1RRLA 3S67A 3SOYA 3NBJA 3FG4A 2CX0A 3HOHA 5JBSA 3CCQ3 3G8ZA 3NBBA 1VQ93 5EEOA 3D9RA 3K7CA 1VQK3 1KC84 3FKAA 2INXA 3FLJA 1QJGA 1GY6A 1JRQA 1UUVB 1BNGA 1S723 1BSBA 4KFEA 1O7HB 2W04A 4MMXB 1FGRA 1RN7A 1VQN3 3MKIA 3ZG0A 4CDLA 4HM5B 4K61A 3Q2PA 1MNLA 1PYLA 3H3HA 3N9HA 3EN1B 3EBTA 3NQYA 5I97A 3LTDA 2W6JH
chains in the Genus database with same CATH topology
3GZRA 1O7WB 1VQ53 3NHXA 4L8OA 4RNZA 3GZXB 1F8NA 3F40A 3MYTA 2XSHB 3EBYA 5AIIA 3FG1A 3RDEA 1Z1SA 2W56B 3TDGA 1W02A 3OWSA 4HM1B 2CWTA 5CLKA 1PU4A 2GEXA 3RGRA 1JB5A 3KKGA 1YJ93 1NO3A 1JJ22 3ER7A 1DMQA 2F98A 1QAFA 3OWYA 3MSOA 3NQZA 1JN5B 3B4OA 3FCSB 2OQEA 1NB5I 4N6TA 3B7CA 1ULIB 3KSED 1JB2A 3KIIA 2XH9A 2W2CA 5JPPA 2ZDJA 1IV7A 3LT8A 2L4VA 1C7HA 5A0OB 6STDA 8CHOA 5JPUA 2E2VA 2V1LA 3LXUX 3PXMA 5BXQA 2CKFB 5KP4A 3A76A 4L7KA 5FW5A 3KN4A 3CCL3 3EF8A 4XDWA 2GEYA 4HKVB 2Y73A 1U5OA 4LEHA 4QWTA 1A67A 4FCMA 2CK3H 2E2UA 1YJN3 5IW9A 2HMNB 1IQYA 3G6E3 2FGTA 4LGQA 2M7OA 1O7NB 3X42A 1N5HA 3CMA3 4AKYA 1IVWA 1IV9A 1G96A 2CG0A 3PCSA 3O8YA 4HZ9B 4X2HA 3JUOA 1FGOA 2RFRA 2P38A 4HVNA 1JV2B 2GBWB 3NM2A 1WTHA 4K1VA 3JVCA 1N5PA 2CIUA 2F86B 1SJWA 1UI8A 4EYCA 2CHCA 1WMPA 3PGBA 3K5TA 4XB5A 1QMAA 4GL6A 5AYRB 3CC43 1OH0A 1TFKA 4HYZA 3CXC2 2OWPA 5CF1A 2MF7A 2Y74A 4RNYA 2XRXB 2XF3A 4O02B 3FH1A 2A15A 1WMNA 1Q40B 2CWVA 4KFDA 2OOVC 3GAXA 4BTWA 3G0KA 2GU1A 1JN5A 2I9WA 7STDA 3WA3A 4ZM8A 3LMLA 2XSOB 3I563 1OHSA 1O7MB 1QAKA 1N9EA 5STDA 3JUPA 2YFIB 2KRTA 3DY5A 3QRDA 1VQL3 1E97A 3CCJ3 2KCDA 3BNDA 1Q42A 5G2GA 5ELUA 3BLZA 1RJOA 4AEQA 3EHCA 1TP6A 1E3RA 1AV4A 3KFQC 3CC73 2WGQA 1QVF2 3OWUA 3UL6A 2W0QA 1WMOA 3MWZA 1VZZA 5AIHA 3RGAA 1STFI 1IVVA 2P0MA 4O2HA 2W03A 4WYKB 4WHAA 4WYKA 1TUHA 1YI23 3DUKA 3LH4A 2K54A 1W4NA 2IUJA 1DVCA 3DMCA 3KSPA 1MOLA 1QALA 3J7Yd 2HMLB 1DMNA 4WP5A 3CCE3 1JKGB 3U1WA 3ROBA 5IG0A 5CF2A 5FGOA 1HKXA 1IDPA 2CFGA 1EQKA 4Q53A 1OGZA 4U13A 2CFWA 1JB4A 3NX0A 1SIIA 4N6LA 3EC9A 1N8R4 4XBTA 3MHEA 5D82A 1K734 1CEWI 1T5YA 3EN8A 4FR9A 1LNHA 3WDGB 2F99A 1IU7A 3SOAA 3DGLA 3IMAB 3WOEB 2W9QA 3K0ZA 4LSOA 4XM4A 3HIIA 1KSIA 1ZX2A 3BNBA 3SVAA 2P05A 3LOYA 3NV0B 3JUQA 3X41A 2JDIH 2Z6BA 3S29A 4R80A 1Q864 1GY5A 3IPTA 4IT7A 1YVBI 2BMQB 4OK0A 1N9JA 4O8SA 3NUVA 2GXFA 3S5CA 1Q7Y4 4JF8A 3OX9A 4HM7B 2QEX3 5DREA 1YIT3 1VQ63 2E2TA 4FMBA 2LYXA 3UJMA 1M1K4 3CCR3 2R4IA 3MG3A 4HM4B 3ECFA 1W00A 5IF6A 3STDA 2W56A 1FGQA 1US1A 2MC8A 4EC6A 1VQ43 4IIAA 1AVKA 5IEOA 1GYBA 3DGOA 1CYVA 2ZL8A 1S5AA 4FCZA 1Q40A 4R9LA 1FGMA 3Q1CA 2BO9B 1SPUA 3EQQB 3F8XA 2XGNA 3DGNA 1DMMA 1D6YA 1IVXA 3AMOB 1TU5A 1YIJ3 1LOXA 3EJVA 4HM6B 3L0RA 1W5ZA 5EVHA 2RGQA 1OACA 1OCVA 4ORLA 2Q07A 2WO0A 3BB9A 3SLUA 4EV5A 4MMYB 3SEDA 3I553 3NM7A 1GS3A 1NJI4 2FXTA 3IJEB 1M9GA 2K0MA 4O3VA 1OUNA 4N6V0 5AYSC 3Q90A 2BMOB 1IT7A 2CC3A 4J8TA 1RKYA 3HIGA 3VF1A 3VSYA 2Z7AA 1SQWA 4K1UA 1NDOB 3CCU3 1SIHA 4PEJA 3OW22 3DZLA 5ELJA 2FNQA 3FZWA 3U97A 3LZAA 1VQ83 5AIFA 2CH9A 3NV0A 3FGYA 4FMAA 3T8UA 1IQXA 2JQ5A 3F7SA 1OF5B 2GU3A 3V99A 2HMJB 2SBLA 1JKGA 2RCDA 4EBGA 5LC7A 3F14A 2XFSA 4HM2B 3F7XA 3N54B 4N6NB 2C11A 3PYJA 4AKZA 2W9PA 2XGLA 2GBXB 4IPBA 3CCM3 1DYUA 3MG2A 4LZIA 4XBYA 3F8HA 3BNEA 4N6OB 3CCS3 1ISKA 3H51A 1FGTA 5CK6A 1VQ73 1IK3A 4RZMA 2PNCA 3NBRA 2Z76A 2CFLA 3UB1A 3CNXA 1UW1A 1GD4A 3FG3A 1WNHA 5KP3A 3T8NA 3SX1A 3PZWA 2BNGA 4H3UA 3S27A 5IEPA 1K41A 5D81A 3MPHA 1CYUA 1NWWA 1YGEA 1OHOA 3CME3 4J9AA 2CG1A 3PS8A 3WA2X 2WOHA 3I0YA 4NHFA 2O3OA 1W01A 2UX0A 3WOFB 3G16A 1YHQ3 2HMKB 3JUMA 4BTYA 2O9UX 3EE1A 1JNQA 5DRVA 1N8QA 4STDA 3KZTA 2YFJB 1YJW3 2KXGA 5TGNA 3FF0A 3ALAA 2B1XB 3GWRA 1IVUA 3B8LA 2CFDA 3MG1A 1OGXA 5IG5A 3N8BA 3EX9A 1LVNA 1STDA 4FMCA 4N6UA 2OTJ3 3DGMA 2RSXA 1QVG2 4XDVA 1VQM3 4GB5A 1A90A 1TIJA 3CD63 4CCVA 1EG9B 1NU3A 3LYGA 5IG4A 1K8A4 1AVLA 2XR8B 1UUWB 2XFTA 4KVHA 4TX4A 2PZVA 5CXOA 3NXJA 2YX9A 3K63A 3AMOA 3K9MC 1OF5A 1ASKA 1M1XB 1VQO3 1GD3A 1UI7A 2WOFA 5AEUB 4HM8B 1HU9A 1AR0A 2YFLB 4KFFA 4WFOA 3X3ZA 2BT3A 2P09A 2OTL3 1K28A 1O7PB 2IMJA 3E99A 1W6CA 2CW9A 3VGNA 5IENA 1D6UA 3DXOA 1KWIA 2HMMB 2Z77A 4MJDA 4L8PA 1FUWA 3LTAA 2OOVA 2B24B 3CU3A 5D83A 2CFKA 4G1MB 3FSDA 1A2KA 1EA2A 3M8CA 2WGOA 3EB8A 2QIYA 4R4KA 2BHMA 3UL5A 2P0XA 5IG3A 3GZYB 1A2VA 4MMZB 3LTBA 1J2BA 4HBRA 4KZ1A 4WWUC 2HMOB 1W7CA 1Q824 4H61A 2IUKA 4OUQA 1FA3A 1RRHA 2OCTA 3G4S3 1ZO2A 3KE7A 1KQS2 5HGRA 4OVMA 3JUNA 4BTXA 1W2ZA 5EQLA 4LMIA 1LXEA 3WMDA 3V92A 1TFOA 3X40A 4N6MA 1Y4KA 1BUQA 2QGUA 4HM0B 1OPYA 1OHPA 1O7GB 3HZPA 3OXAA 4NREA 4FCJA 2C10A 3LTCA 1EKMA 2QA43 3T0UA 3X3YA 1U8CB 4MEIA 1IT8A 1IQ8A 3FF2A 3V98A 3G713 1Q814 1ROAA 1ULJB 1L5GB 3BNCA 3F9SA 3S28A 3GRDA 2D1WA 1D6ZA 4HZBB 3HK4A 3CPOA 2LQVA 1NB3I 3CNMA 3WODG 3CC23 1VQP3 1GY7A 3B4PA 2ML6A 4X2OA 5KP1A 2CWUA 2OQEC 1KD14 1K9M4 4R1KA 3D3LA 5BVBA 2ML5A 3GZBA 1R4CA 3HI7A 5AI1A 3OV4A 3LT9A 3SXXA 1V74A 1PFPA 1M904 4EV2A 2STDA 4K90B 1W6YA 5LC6A 1W2B2 1ROVA 4HJLB 1W6GA 4I4KA 4R9KA 1DVDA 1WQLB 2XEPA 3HX8A 4XBXA 5IERA 4JRFA 3PCRA 2D42A 1E3VA 4EXRA 3X3XA 5AIGA 3DM8A 1CQSA 4FMDA 4N3VA 2IA7A 4HM3B 3QK9A 5AEWB 3CCV3 3CPW2 2BMRB 4RBNA 3UNLA 1RRLA 3S67A 3SOYA 3NBJA 3FG4A 5JBSA 3CCQ3 3G8ZA 3NBBA 1VQ93 5EEOA 3D9RA 3K7CA 1VQK3 1KC84 3FKAA 2INXA 3FLJA 1QJGA 1GY6A 1JRQA 1UUVB 1S723 4KFEA 1O7HB 2W04A 4MMXB 1FGRA 1RN7A 1VQN3 3MKIA 4CDLA 4HM5B 4K61A 3Q2PA 1MNLA 3H3HA 3N9HA 3EN1B 3EBTA 3NQYA 5I97A 3LTDA 2W6JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZR A;  1TP6 A;  1E3R A;  1O7W B;  2HMO B;  4PEJ A;  4WWU C;  3DZL A;  3OWU A;  3FZW A;  3NHX A;  4L8O A;  4OUQ A;  3GZX B;  3LZA A;  1VZZ A;  3F40 A;  3MYT A;  5AIF A;  3NV0 A;  1ZO2 A;  3FGY A;  3KE7 A;  5AIH A;  2XSH B;  3RGA A;  3EBY A;  5AII A;  5HGR A;  3T8U A;  2JQ5 A;  3F7S A;  4OVM A;  1OF5 B;  4WYK B;  3JUN A;  1Z1S A;  2HMJ B;  4WYK A;  1TUH A;  1JKG A;  3DUK A;  4LMI A;  1W02 A;  2K54 A;  2RCD A;  3OWS A;  3F14 A;  3DMC A;  4HM1 B;  3KSP A;  5CLK A;  3WMD A;  4HM2 B;  2GEX A;  3F7X A;  3RGR A;  2HML B;  1JB5 A;  1DMN A;  4WP5 A;  3KKG A;  2GBX B;  1BUQ A;  1JKG B;  1DMQ A;  3ER7 A;  3MG2 A;  2F98 A;  2QGU A;  4HM0 B;  1OPY A;  1OHP A;  1O7G B;  1HKX A;  1JN5 B;  3B4O A;  3HZP A;  3MSO A;  3OXA A;  3F8H A;  3OWY A;  4FCJ A;  1ISK A;  1IDP A;  3B7C A;  3H51 A;  5CK6 A;  1ULI B;  4Q53 A;  1OGZ A;  4U13 A;  1JB2 A;  4RZM A;  3NBR A;  1JB4 A;  2Z76 A;  3CNX A;  2W2C A;  5JPP A;  3EC9 A;  3FF2 A;  3MHE A;  4XBT A;  5D82 A;  5KP3 A;  3T8N A;  3EN8 A;  1ULJ B;  1C7H A;  2BNG A;  4H3U A;  6STD A;  2F99 A;  3F9S A;  8CHO A;  5JPU A;  3GRD A;  5IEP A;  1K41 A;  5D81 A;  3SOA A;  4ORL A;  1NWW A;  1OHO A;  5BXQ A;  4J9A A;  2CKF B;  4HZB B;  5KP4 A;  3A76 A;  3HK4 A;  3CPO A;  3K0Z A;  4L7K A;  5FW5 A;  4XM4 A;  3CNM A;  3EF8 A;  1ZX2 A;  3I0Y A;  4XDW A;  2GEY A;  1W01 A;  1GY7 A;  2UX0 A;  3B4P A;  1U5O A;  4HKV B;  4LEH A;  3G16 A;  4X2O A;  2HMK B;  3JUM A;  3NV0 B;  5KP1 A;  3JUQ A;  4FCM A;  5DRV A;  4STD A;  3KZT A;  4R1K A;  2YFJ B;  5BVB A;  1GY5 A;  2HMN B;  3IPT A;  3GZB A;  4LGQ A;  5TGN A;  2BMQ B;  5AI1 A;  3OV4 A;  1O7N B;  3NUV A;  3FF0 A;  2GXF A;  3S5C A;  2B1X B;  3OX9 A;  2STD A;  4HM7 B;  3GWR A;  4HZ9 B;  3B8L A;  3JUO A;  3MG1 A;  1OGX A;  2RFR A;  4X2H A;  5DRE A;  1W6Y A;  3EX9 A;  5IG5 A;  1STD A;  3UJM A;  4HVN A;  4XDV A;  2R4I A;  2GBW B;  4GB5 A;  3MG3 A;  4HM4 B;  3ECF A;  1W00 A;  3NM2 A;  4K1V A;  4XBY A;  5IF6 A;  1EG9 B;  4HJL B;  3STD A;  4I4K A;  4R9K A;  2F86 B;  1NU3 A;  1SJW A;  3LYG A;  5IG4 A;  4IIA A;  2XR8 B;  1WQL B;  5IEO A;  1UUW B;  1GYB A;  2CHC A;  3HX8 A;  5CXO A;  4KVH A;  4XBX A;  2PZV A;  4XB5 A;  5IER A;  1QMA A;  1S5A A;  1E3V A;  3NXJ A;  3ROB A;  5AIG A;  1OF5 A;  1ASK A;  1OH0 A;  1Q40 A;  5CF2 A;  3DM8 A;  2OWP A;  1CQS A;  4R9L A;  5CF1 A;  4N3V A;  5AEU B;  4HM8 B;  4MJD A;  2XRX B;  1AR0 A;  2YFL B;  3EQQ B;  4HM3 B;  5AEW B;  3F8X A;  2BMR B;  1DMM A;  3FH1 A;  3UNL A;  2A15 A;  1O7P B;  1Q40 B;  3SOY A;  2IMJ A;  3EJV A;  3E99 A;  4HM6 B;  3G8Z A;  3VGN A;  5EVH A;  5IEN A;  2RGQ A;  3G0K A;  2Z77 A;  1OCV A;  2HMM B;  3D9R A;  3DXO A;  3K7C A;  4L8P A;  1JN5 A;  2I9W A;  3BB9 A;  3FKA A;  2B24 B;  2INX A;  3CU3 A;  3FLJ A;  5D83 A;  7STD A;  2XSO B;  3SED A;  3FSD A;  1QJG A;  1OHS A;  1GY6 A;  1A2K A;  1EA2 A;  1GS3 A;  1O7M B;  1UUV B;  3M8C A;  5STD A;  2QIY A;  1O7H B;  1OUN A;  3JUP A;  3MKI A;  4CDL A;  2YFI B;  3Q90 A;  2BMO B;  4HM5 B;  1E97 A;  4J8T A;  3VSY A;  3H3H A;  3EN1 B;  1Q42 A;  2Z7A A;  3EBT A;  5G2G A;  3BLZ A;  5IG0 A;  4K1U A;  5IG3 A;  3GZY B;  3EHC A;  1NDO B; 
#chains in the Genus database with same CATH topology
 3GZR A;  1O7W B;  1B27 A;  1DE3 A;  2F56 A;  3NHX A;  4L8O A;  4RNZ A;  3GZX B;  1GMR A;  3BIR A;  1VQ5 3;  1F8N A;  3F40 A;  3MYT A;  2XSH B;  3EBY A;  5AII A;  3FG1 A;  3RDE A;  1Z1S A;  2W56 B;  5G1K A;  1IYY A;  3TDG A;  1W02 A;  3OWS A;  7GSP A;  4HM1 B;  2CWT A;  5CLK A;  1PU4 A;  1BSA A;  2GEX A;  3D5I A;  3RGR A;  1JB5 A;  3KKG A;  1YJ9 3;  1NO3 A;  1JJ2 2;  4KT3 B;  3ER7 A;  1DMQ A;  4BL3 A;  2F98 A;  1QAF A;  3OWY A;  1RCK A;  1RN4 A;  1JN5 B;  3B4O A;  1I3I A;  3FCS B;  3MSO A;  3NQZ A;  2OQE A;  1NB5 I;  4N6T A;  3B7C A;  1ULI B;  3KSE D;  1JB2 A;  5RNT A;  3KII A;  2F5W A;  2XH9 A;  1RNT A;  5BIR A;  2W2C A;  5JPP A;  3SYU A;  2ZDJ A;  1IV7 A;  3LT8 A;  1RDS A;  1BRG A;  1C7H A;  1I2E A;  2L4V A;  5A0O B;  6STD A;  3URP A;  8CHO A;  5JPU A;  1B3S A;  1B2Z A;  2E2V A;  1BSD A;  2GSP A;  2V1L A;  3LXU X;  3PXM A;  5M1A A;  5BXQ A;  2CKF B;  5KP4 A;  1T3B A;  3A76 A;  4L7K A;  5FW5 A;  3KN4 A;  3CCL 3;  3EF8 A;  4XDW A;  2GEY A;  4HKV B;  2Y73 A;  1U5O A;  4LEH A;  4QWT A;  1A67 A;  4BIR A;  4FCM A;  2CK3 H;  2J8X B;  2E2U A;  1YJN 3;  5IW9 A;  2HMN B;  1I8V A;  1IQY A;  3G6E 3;  2FGT A;  1TTO A;  4LGQ A;  2M7O A;  1O7N B;  3X42 A;  1TRQ A;  1N5H A;  3CMA 3;  4AKY A;  1IVW A;  1IV9 A;  1G96 A;  2CG0 A;  2UGI A;  3PCS A;  3O8Y A;  4HZ9 B;  4X2H A;  3JUO A;  1CH0 A;  1FGO A;  2RFR A;  2P38 A;  4HVN A;  4LYL B;  1JV2 B;  2GBW B;  1B2M A;  3NM2 A;  1WTH A;  4K1V A;  1BIR A;  3JVC A;  1N5P A;  2CIU A;  2F86 B;  1SJW A;  1UI8 A;  4EYC A;  2CHC A;  1FYS A;  1WMP A;  3PGB A;  3K5T A;  4I5Q A;  4XB5 A;  1QMA A;  4GL6 A;  5AYR B;  4CJN A;  1UCL A;  3CC4 3;  1OH0 A;  1TFK A;  4HYZ A;  3CXC 2;  2OWP A;  5CF1 A;  2MF7 A;  2Y74 A;  4RNY A;  2XRX B;  2XF3 A;  4O02 B;  1GSP A;  3DH2 A;  3FH1 A;  1B2S A;  2A15 A;  1MWS A;  1WMN A;  1Q40 B;  2CWV A;  4KFD A;  2H0H A;  2KF3 A;  2OOV C;  1RGA A;  3GAX A;  3G0K A;  4BTW A;  1LOW A;  1LQM B;  2GU1 A;  1JN5 A;  2I9W A;  7STD A;  3WA3 A;  4ZM8 A;  3LML A;  2ZHX B;  1RN1 A;  2XSO B;  1I0X A;  3I56 3;  2UUG C;  1OHS A;  1O7M B;  3AGN A;  1QAK A;  1N9E A;  5STD A;  1X1X A;  1FUW A;  3JUP A;  2RNT A;  2YFI B;  2KRT A;  3DY5 A;  3QRD A;  1RCL A;  2BIR A;  1VQL 3;  1E97 A;  3CCJ 3;  1RGG A;  2KCD A;  3BND A;  1Q42 A;  5G2G A;  5ELU A;  3BLZ A;  3AHW A;  1RJO A;  4AEQ A;  3EHC A;  1PY3 A;  1MWT A;  1TP6 A;  1E3R A;  1AV4 A;  3KFQ C;  3A5E A;  2WGQ A;  3CC7 3;  1QVF 2;  3OWU A;  1BGS A;  3UL6 A;  2W0Q A;  1WMO A;  1BRH A;  3MWZ A;  1VZZ A;  1LOY A;  1RLS A;  5AIH A;  3RGA A;  1STF I;  1IVV A;  2P0M A;  4O2H A;  1FZU A;  1BRK A;  2F4Y A;  1JZD A;  2W03 A;  3ZFZ A;  4CPK A;  4WYK B;  2AAD A;  1GOU A;  4WHA A;  4WYK A;  1TUH A;  1YI2 3;  3DUK A;  3LH4 A;  2K54 A;  1W4N A;  2IUJ A;  1DVC A;  3DMC A;  1R4Y A;  3KSP A;  1MOL A;  1QAL A;  3J7Y d;  1X1W A;  2HML B;  1DMN A;  4WP5 A;  3CCE 3;  1CYU A;  1JKG B;  3U1W A;  3ROB A;  5IG0 A;  5CF2 A;  5FGO A;  1HKX A;  1IDP A;  2CFG A;  1EQK A;  4Q53 A;  1OGZ A;  4U13 A;  1Q7H A;  1JB4 A;  2CFW A;  3NX0 A;  1SII A;  4N6L A;  3EC9 A;  1N8R 4;  4XBT A;  3MHE A;  5D82 A;  1LNI A;  1K73 4;  1CEW I;  1T5Y A;  2KAA A;  1BNF A;  1LNH A;  1MWR A;  3EN8 A;  2F99 A;  1IU7 A;  1RMS A;  2R41 A;  4FR9 A;  3WDG B;  3SOA A;  3DGL A;  3IMA B;  3WOE B;  4BU4 A;  2W9Q A;  1AY7 A;  3K0Z A;  1RTU A;  4LSO A;  4XM4 A;  3HII A;  1UDI I;  1KSI A;  4RNT A;  1ZX2 A;  3BNB A;  3SVA A;  2P05 A;  3LOY A;  2L1S A;  3JUQ A;  3NV0 B;  3X41 A;  2JDI H;  2Z6B A;  1FW7 A;  3S29 A;  4R80 A;  5G1L A;  1VQQ A;  1Q86 4;  1GY5 A;  3IPT A;  4IT7 A;  1YVB I;  2BMQ B;  5BU4 A;  4OK0 A;  1N9J A;  2K3D A;  4O8S A;  3NUV A;  2GXF A;  3S5C A;  1Q7Y 4;  4JF8 A;  3OX9 A;  4HM7 B;  2QEX 3;  5DRE A;  1YIT 3;  1VQ6 3;  2E2T A;  4FMB A;  2LYX A;  3UJM A;  1M1K 4;  1RSN A;  3CCR 3;  1RGF A;  2KF5 A;  2R4I A;  1MWU A;  2BU4 A;  3MG3 A;  1BSE A;  1W00 A;  3ECF A;  4HM4 B;  5IF6 A;  3STD A;  1FGQ A;  1US1 A;  2W56 A;  2MC8 A;  3WR2 A;  4DKI A;  4EC6 A;  4IIA A;  1AVK A;  1VQ4 3;  5IEO A;  1FUT A;  1EUI C;  1GYB A;  1LOV A;  3DGO A;  1CYV A;  1I0V A;  2ZL8 A;  1S5A A;  1UGI A;  4FCZ A;  1Q40 A;  1MGW A;  1BAO A;  4R9L A;  1FGM A;  3Q1C A;  2BO9 B;  1SPU A;  3EQQ B;  1MGR A;  3F8X A;  2XGN A;  1DMM A;  1D6Y A;  1IVX A;  3DGN A;  3AMO B;  1TU5 A;  1YIJ 3;  1LOX A;  3EJV A;  1BNJ A;  4HM6 B;  3L0R A;  1W5Z A;  5EVH A;  2RGQ A;  1OAC A;  1OCV A;  4ORL A;  1B2X A;  1V58 A;  2Q07 A;  2WO0 A;  3BB9 A;  3BU4 A;  4GHO A;  6RNT A;  3SLU A;  4EV5 A;  4MMY B;  1LRA A;  3SED A;  3I55 3;  3NM7 A;  1GS3 A;  1NJI 4;  2FXT A;  3IJE B;  1M9G A;  2K0M A;  1UGH I;  4O3V A;  1I2G A;  1OUN A;  4N6V 0;  5AYS C;  1GMQ A;  3Q90 A;  2BMO B;  1IT7 A;  2CC3 A;  1UUG B;  4J8T A;  1RKY A;  3HIG A;  3VF1 A;  3VSY A;  3ZG5 A;  2Z7A A;  1RGC A;  1SQW A;  4K1U A;  1BNI A;  1NDO B;  3CCU 3;  1SIH A;  4PEJ A;  2H0G A;  3OW2 2;  1BSC A;  1FUS A;  3DZL A;  5ELJ A;  2FNQ A;  3FZW A;  1A2P A;  1V57 A;  3U97 A;  3LZA A;  1VQ8 3;  5M19 A;  2KF4 A;  5AIF A;  2CH9 A;  3NV0 A;  1SAR A;  2SAR A;  1T2H A;  3FGY A;  4FMA A;  3T8U A;  1IQX A;  2JQ5 A;  3F7S A;  3WHO A;  1OF5 B;  1YVS A;  2GU3 A;  4HOH A;  3V99 A;  1RNB A;  2HMJ B;  1ZGX A;  2SBL A;  1JKG A;  2RCD A;  4EBG A;  5LC7 A;  1B20 A;  1ZS7 A;  3F14 A;  6GSP A;  2XFS A;  4HM2 B;  3F7X A;  1GOV A;  3N54 B;  4N6N B;  2C11 A;  3PYJ A;  4AKZ A;  2W9P A;  2XGL A;  2GBX B;  4IPB A;  3CCM 3;  1DYU A;  3MG2 A;  4LZI A;  4XBY A;  1BUJ A;  3F8H A;  3BNE A;  4N6O B;  3CCS 3;  1ISK A;  3H51 A;  1FGT A;  5CK6 A;  1VQ7 3;  1IK3 A;  4RZM A;  2PNC A;  3NBR A;  1JZO A;  2Z76 A;  2CFL A;  3UB1 A;  3CNX A;  1UW1 A;  1GD4 A;  1GMP A;  3FG3 A;  1WNH A;  1YGW A;  5KP3 A;  3T8N A;  3SX1 A;  3PZW A;  2BNG A;  2H0I A;  4H3U A;  3S27 A;  1G02 A;  5IEP A;  1K41 A;  1Q9E A;  3MPH A;  5D81 A;  1NNV A;  1NWW A;  1OHO A;  1YGE A;  3CME 3;  4J9A A;  2CG1 A;  3PS8 A;  3WA2 X;  2WOH A;  1TRP A;  2CX1 A;  3I0Y A;  4NHF A;  2O3O A;  1W01 A;  2UX0 A;  3WOF B;  3G16 A;  1I3F A;  2HMK B;  1YHQ 3;  3JUM A;  4BTY A;  2O9U X;  3EE1 A;  1JNQ A;  5DRV A;  1N8Q A;  4STD A;  3KZT A;  8RNT A;  5HOH A;  2YFJ B;  1YJW 3;  2KXG A;  1I70 A;  5M18 A;  3AHS A;  5TGN A;  1DET A;  1I2F A;  1BAN A;  3FF0 A;  4HAA A;  3ALA A;  1JBR A;  2B1X B;  1BRJ A;  7RNT A;  2HOH A;  3GWR A;  1IVU A;  3B8L A;  2CFD A;  2F5M A;  1OGX A;  3MG1 A;  3N8B A;  5IG5 A;  3EX9 A;  1LVN A;  1STD A;  4FMC A;  4N6U A;  5GSP A;  1BNR A;  2OTJ 3;  3DGM A;  2RSX A;  1QVG 2;  4XDV A;  1VQM 3;  4GB5 A;  1A90 A;  1TIJ A;  3CD6 3;  1JBS A;  4CCV A;  1EG9 B;  4ILF A;  1NU3 A;  1YNV X;  3LYG A;  5IG4 A;  1K8A 4;  1AVL A;  1JBT A;  2XR8 B;  1UUW B;  1X1Y A;  2XFT A;  4KVH A;  4TX4 A;  2PZV A;  3DGY A;  5CXO A;  3NXJ A;  2YX9 A;  3K63 A;  3AMO A;  3K9M C;  4EW5 A;  1OF5 A;  1ASK A;  1M1X B;  1VQO 3;  1BVI A;  1GD3 A;  1UI7 A;  2WOF A;  5AEU B;  4HM8 B;  1HU9 A;  1AR0 A;  1LQG C;  1RGK A;  2YFL B;  4KFF A;  4WFO A;  3X3Z A;  1RGE A;  2BT3 A;  2IY2 A;  2P09 A;  4BL2 A;  2OTL 3;  1K28 A;  1B2U A;  1O7P B;  2IMJ A;  3E99 A;  1W6C A;  2CW9 A;  3VGN A;  5IEN A;  1D6U A;  3GSP A;  1EEJ A;  1AQZ A;  1KWI A;  2HMM B;  2Z77 A;  3DXO A;  3D79 A;  4L8P A;  3LTA A;  4MJD A;  2OOV A;  2B24 B;  3CU3 A;  5D83 A;  1BNS A;  1C54 A;  2CFK A;  3AGO A;  4G1M B;  3FSD A;  1A2K A;  1EA2 A;  3M8C A;  1BRN L;  2WGO A;  3EB8 A;  2QIY A;  1BNE A;  4R4K A;  4GSP A;  2ZA4 A;  2BHM A;  3UL5 A;  2P0X A;  5IG3 A;  1GOY A;  3GZY B;  1A2V A;  4MMZ B;  3LTB A;  1J2B A;  1BRI A;  1BU4 A;  4HBR A;  4KZ1 A;  4WWU C;  2HMO B;  1UCI A;  1W7C A;  1Q82 4;  1RGH A;  4H61 A;  2IUK A;  4OUQ A;  1FA3 A;  1RRH A;  2OCT A;  3G4S 3;  1ZO2 A;  3KE7 A;  1KQS 2;  5HGR A;  4OVM A;  3JUN A;  4BTX A;  1W2Z A;  5EQL A;  4LMI A;  4NPB A;  1LXE A;  1G0T A;  3V92 A;  1TFO A;  2IYJ A;  3WMD A;  3X40 A;  1B21 A;  4N6M A;  1Y4K A;  1BUQ A;  1BRS A;  1T2I A;  2QGU A;  4HM0 B;  1OPY A;  1OHP A;  1O7G B;  3HZP A;  3OXA A;  4NRE A;  4FCJ A;  2C10 A;  3LTC A;  1EKM A;  2QA4 3;  9RNT A;  3T0U A;  3X3Y A;  1U8C B;  4MEI A;  1IT8 A;  1IQ8 A;  3FF2 A;  3V98 A;  3G71 3;  1Q81 4;  1ROA A;  1ULJ B;  1L5G B;  3RNT A;  3BNC A;  3F9S A;  3S28 A;  3GRD A;  2D1W A;  1D6Z A;  4HZB B;  3HK4 A;  3CPO A;  2LQV A;  1NB3 I;  3CNM A;  3WOD G;  3KCH A;  3CC2 3;  1VQP 3;  1GY7 A;  3B4P A;  2ML6 A;  4X2O A;  1RHL A;  5KP1 A;  2CWU A;  2OQE C;  1KD1 4;  2AAE A;  3Q3F A;  1K9M 4;  4R1K A;  3D3L A;  5BVB A;  2ML5 A;  3GZB A;  1R4C A;  3HI7 A;  5AI1 A;  3OV4 A;  3LT9 A;  3SXX A;  1V74 A;  1PFP A;  1M90 4;  4EV2 A;  2STD A;  4K90 B;  1W6Y A;  5LC6 A;  1W2B 2;  2C4B A;  1HYF A;  4J5K A;  1BOX A;  1ROV A;  1X1U A;  3D4A A;  1HZ1 A;  4HJL B;  1W6G A;  4I4K A;  4R9K A;  3D5G A;  1UCK A;  1DVD A;  1WQL B;  2KF6 A;  2XEP A;  3HX8 A;  4XBX A;  5IER A;  4JRF A;  3PCR A;  2D42 A;  1E3V A;  4EXR A;  1TJD A;  3X3X A;  5AIG A;  3DM8 A;  1CQS A;  1UCJ A;  4FMD A;  4N3V A;  2IA7 A;  4HM3 B;  2RBI A;  3QK9 A;  5AEW B;  3CPW 2;  3CCV 3;  2BMR B;  4J5G A;  4RBN A;  3UNL A;  1RGL A;  1RRL A;  3S67 A;  3SOY A;  3NBJ A;  3FG4 A;  2CX0 A;  3HOH A;  5JBS A;  3CCQ 3;  3G8Z A;  3NBB A;  1VQ9 3;  5EEO A;  3D9R A;  3K7C A;  1VQK 3;  1KC8 4;  3FKA A;  2INX A;  3FLJ A;  1QJG A;  1GY6 A;  1JRQ A;  1UUV B;  1BNG A;  1S72 3;  1BSB A;  4KFE A;  1O7H B;  2W04 A;  4MMX B;  1FGR A;  1RN7 A;  1VQN 3;  3MKI A;  3ZG0 A;  4CDL A;  4HM5 B;  4K61 A;  3Q2P A;  1MNL A;  1PYL A;  3H3H A;  3N9H A;  3EN1 B;  3EBT A;  3NQY A;  5I97 A;  3LTD A;  2W6J H; 
#chains in the Genus database with same CATH homology
 3GZR A;  1O7W B;  1VQ5 3;  3NHX A;  4L8O A;  4RNZ A;  3GZX B;  1F8N A;  3F40 A;  3MYT A;  2XSH B;  3EBY A;  5AII A;  3FG1 A;  3RDE A;  1Z1S A;  2W56 B;  3TDG A;  1W02 A;  3OWS A;  4HM1 B;  2CWT A;  5CLK A;  1PU4 A;  2GEX A;  3RGR A;  1JB5 A;  3KKG A;  1YJ9 3;  1NO3 A;  1JJ2 2;  3ER7 A;  1DMQ A;  2F98 A;  1QAF A;  3OWY A;  3MSO A;  3NQZ A;  1JN5 B;  3B4O A;  3FCS B;  2OQE A;  1NB5 I;  4N6T A;  3B7C A;  1ULI B;  3KSE D;  1JB2 A;  3KII A;  2XH9 A;  2W2C A;  5JPP A;  2ZDJ A;  1IV7 A;  3LT8 A;  2L4V A;  1C7H A;  5A0O B;  6STD A;  8CHO A;  5JPU A;  2E2V A;  2V1L A;  3LXU X;  3PXM A;  5BXQ A;  2CKF B;  5KP4 A;  3A76 A;  4L7K A;  5FW5 A;  3KN4 A;  3CCL 3;  3EF8 A;  4XDW A;  2GEY A;  4HKV B;  2Y73 A;  1U5O A;  4LEH A;  4QWT A;  1A67 A;  4FCM A;  2CK3 H;  2E2U A;  1YJN 3;  5IW9 A;  2HMN B;  1IQY A;  3G6E 3;  2FGT A;  4LGQ A;  2M7O A;  1O7N B;  3X42 A;  1N5H A;  3CMA 3;  4AKY A;  1IVW A;  1IV9 A;  1G96 A;  2CG0 A;  3PCS A;  3O8Y A;  4HZ9 B;  4X2H A;  3JUO A;  1FGO A;  2RFR A;  2P38 A;  4HVN A;  1JV2 B;  2GBW B;  3NM2 A;  1WTH A;  4K1V A;  3JVC A;  1N5P A;  2CIU A;  2F86 B;  1SJW A;  1UI8 A;  4EYC A;  2CHC A;  1WMP A;  3PGB A;  3K5T A;  4XB5 A;  1QMA A;  4GL6 A;  5AYR B;  3CC4 3;  1OH0 A;  1TFK A;  4HYZ A;  3CXC 2;  2OWP A;  5CF1 A;  2MF7 A;  2Y74 A;  4RNY A;  2XRX B;  2XF3 A;  4O02 B;  3FH1 A;  2A15 A;  1WMN A;  1Q40 B;  2CWV A;  4KFD A;  2OOV C;  3GAX A;  4BTW A;  3G0K A;  2GU1 A;  1JN5 A;  2I9W A;  7STD A;  3WA3 A;  4ZM8 A;  3LML A;  2XSO B;  3I56 3;  1OHS A;  1O7M B;  1QAK A;  1N9E A;  5STD A;  3JUP A;  2YFI B;  2KRT A;  3DY5 A;  3QRD A;  1VQL 3;  1E97 A;  3CCJ 3;  2KCD A;  3BND A;  1Q42 A;  5G2G A;  5ELU A;  3BLZ A;  1RJO A;  4AEQ A;  3EHC A;  1TP6 A;  1E3R A;  1AV4 A;  3KFQ C;  3CC7 3;  2WGQ A;  1QVF 2;  3OWU A;  3UL6 A;  2W0Q A;  1WMO A;  3MWZ A;  1VZZ A;  5AIH A;  3RGA A;  1STF I;  1IVV A;  2P0M A;  4O2H A;  2W03 A;  4WYK B;  4WHA A;  4WYK A;  1TUH A;  1YI2 3;  3DUK A;  3LH4 A;  2K54 A;  1W4N A;  2IUJ A;  1DVC A;  3DMC A;  3KSP A;  1MOL A;  1QAL A;  3J7Y d;  2HML B;  1DMN A;  4WP5 A;  3CCE 3;  1JKG B;  3U1W A;  3ROB A;  5IG0 A;  5CF2 A;  5FGO A;  1HKX A;  1IDP A;  2CFG A;  1EQK A;  4Q53 A;  1OGZ A;  4U13 A;  2CFW A;  1JB4 A;  3NX0 A;  1SII A;  4N6L A;  3EC9 A;  1N8R 4;  4XBT A;  3MHE A;  5D82 A;  1K73 4;  1CEW I;  1T5Y A;  3EN8 A;  4FR9 A;  1LNH A;  3WDG B;  2F99 A;  1IU7 A;  3SOA A;  3DGL A;  3IMA B;  3WOE B;  2W9Q A;  3K0Z A;  4LSO A;  4XM4 A;  3HII A;  1KSI A;  1ZX2 A;  3BNB A;  3SVA A;  2P05 A;  3LOY A;  3NV0 B;  3JUQ A;  3X41 A;  2JDI H;  2Z6B A;  3S29 A;  4R80 A;  1Q86 4;  1GY5 A;  3IPT A;  4IT7 A;  1YVB I;  2BMQ B;  4OK0 A;  1N9J A;  4O8S A;  3NUV A;  2GXF A;  3S5C A;  1Q7Y 4;  4JF8 A;  3OX9 A;  4HM7 B;  2QEX 3;  5DRE A;  1YIT 3;  1VQ6 3;  2E2T A;  4FMB A;  2LYX A;  3UJM A;  1M1K 4;  3CCR 3;  2R4I A;  3MG3 A;  4HM4 B;  3ECF A;  1W00 A;  5IF6 A;  3STD A;  2W56 A;  1FGQ A;  1US1 A;  2MC8 A;  4EC6 A;  1VQ4 3;  4IIA A;  1AVK A;  5IEO A;  1GYB A;  3DGO A;  1CYV A;  2ZL8 A;  1S5A A;  4FCZ A;  1Q40 A;  4R9L A;  1FGM A;  3Q1C A;  2BO9 B;  1SPU A;  3EQQ B;  3F8X A;  2XGN A;  3DGN A;  1DMM A;  1D6Y A;  1IVX A;  3AMO B;  1TU5 A;  1YIJ 3;  1LOX A;  3EJV A;  4HM6 B;  3L0R A;  1W5Z A;  5EVH A;  2RGQ A;  1OAC A;  1OCV A;  4ORL A;  2Q07 A;  2WO0 A;  3BB9 A;  3SLU A;  4EV5 A;  4MMY B;  3SED A;  3I55 3;  3NM7 A;  1GS3 A;  1NJI 4;  2FXT A;  3IJE B;  1M9G A;  2K0M A;  4O3V A;  1OUN A;  4N6V 0;  5AYS C;  3Q90 A;  2BMO B;  1IT7 A;  2CC3 A;  4J8T A;  1RKY A;  3HIG A;  3VF1 A;  3VSY A;  2Z7A A;  1SQW A;  4K1U A;  1NDO B;  3CCU 3;  1SIH A;  4PEJ A;  3OW2 2;  3DZL A;  5ELJ A;  2FNQ A;  3FZW A;  3U97 A;  3LZA A;  1VQ8 3;  5AIF A;  2CH9 A;  3NV0 A;  3FGY A;  4FMA A;  3T8U A;  1IQX A;  2JQ5 A;  3F7S A;  1OF5 B;  2GU3 A;  3V99 A;  2HMJ B;  2SBL A;  1JKG A;  2RCD A;  4EBG A;  5LC7 A;  3F14 A;  2XFS A;  4HM2 B;  3F7X A;  3N54 B;  4N6N B;  2C11 A;  3PYJ A;  4AKZ A;  2W9P A;  2XGL A;  2GBX B;  4IPB A;  3CCM 3;  1DYU A;  3MG2 A;  4LZI A;  4XBY A;  3F8H A;  3BNE A;  4N6O B;  3CCS 3;  1ISK A;  3H51 A;  1FGT A;  5CK6 A;  1VQ7 3;  1IK3 A;  4RZM A;  2PNC A;  3NBR A;  2Z76 A;  2CFL A;  3UB1 A;  3CNX A;  1UW1 A;  1GD4 A;  3FG3 A;  1WNH A;  5KP3 A;  3T8N A;  3SX1 A;  3PZW A;  2BNG A;  4H3U A;  3S27 A;  5IEP A;  1K41 A;  5D81 A;  3MPH A;  1CYU A;  1NWW A;  1YGE A;  1OHO A;  3CME 3;  4J9A A;  2CG1 A;  3PS8 A;  3WA2 X;  2WOH A;  3I0Y A;  4NHF A;  2O3O A;  1W01 A;  2UX0 A;  3WOF B;  3G16 A;  1YHQ 3;  2HMK B;  3JUM A;  4BTY A;  2O9U X;  3EE1 A;  1JNQ A;  5DRV A;  1N8Q A;  4STD A;  3KZT A;  2YFJ B;  1YJW 3;  2KXG A;  5TGN A;  3FF0 A;  3ALA A;  2B1X B;  3GWR A;  1IVU A;  3B8L A;  2CFD A;  3MG1 A;  1OGX A;  5IG5 A;  3N8B A;  3EX9 A;  1LVN A;  1STD A;  4FMC A;  4N6U A;  2OTJ 3;  3DGM A;  2RSX A;  1QVG 2;  4XDV A;  1VQM 3;  4GB5 A;  1A90 A;  1TIJ A;  3CD6 3;  4CCV A;  1EG9 B;  1NU3 A;  3LYG A;  5IG4 A;  1K8A 4;  1AVL A;  2XR8 B;  1UUW B;  2XFT A;  4KVH A;  4TX4 A;  2PZV A;  5CXO A;  3NXJ A;  2YX9 A;  3K63 A;  3AMO A;  3K9M C;  1OF5 A;  1ASK A;  1M1X B;  1VQO 3;  1GD3 A;  1UI7 A;  2WOF A;  5AEU B;  4HM8 B;  1HU9 A;  1AR0 A;  2YFL B;  4KFF A;  4WFO A;  3X3Z A;  2BT3 A;  2P09 A;  2OTL 3;  1K28 A;  1O7P B;  2IMJ A;  3E99 A;  1W6C A;  2CW9 A;  3VGN A;  5IEN A;  1D6U A;  3DXO A;  1KWI A;  2HMM B;  2Z77 A;  4MJD A;  4L8P A;  1FUW A;  3LTA A;  2OOV A;  2B24 B;  3CU3 A;  5D83 A;  2CFK A;  4G1M B;  3FSD A;  1A2K A;  1EA2 A;  3M8C A;  2WGO A;  3EB8 A;  2QIY A;  4R4K A;  2BHM A;  3UL5 A;  2P0X A;  5IG3 A;  3GZY B;  1A2V A;  4MMZ B;  3LTB A;  1J2B A;  4HBR A;  4KZ1 A;  4WWU C;  2HMO B;  1W7C A;  1Q82 4;  4H61 A;  2IUK A;  4OUQ A;  1FA3 A;  1RRH A;  2OCT A;  3G4S 3;  1ZO2 A;  3KE7 A;  1KQS 2;  5HGR A;  4OVM A;  3JUN A;  4BTX A;  1W2Z A;  5EQL A;  4LMI A;  1LXE A;  3WMD A;  3V92 A;  1TFO A;  3X40 A;  4N6M A;  1Y4K A;  1BUQ A;  2QGU A;  4HM0 B;  1OPY A;  1OHP A;  1O7G B;  3HZP A;  3OXA A;  4NRE A;  4FCJ A;  2C10 A;  3LTC A;  1EKM A;  2QA4 3;  3T0U A;  3X3Y A;  1U8C B;  4MEI A;  1IT8 A;  1IQ8 A;  3FF2 A;  3V98 A;  3G71 3;  1Q81 4;  1ROA A;  1ULJ B;  1L5G B;  3BNC A;  3F9S A;  3S28 A;  3GRD A;  2D1W A;  1D6Z A;  4HZB B;  3HK4 A;  3CPO A;  2LQV A;  1NB3 I;  3CNM A;  3WOD G;  3CC2 3;  1VQP 3;  1GY7 A;  3B4P A;  2ML6 A;  4X2O A;  5KP1 A;  2CWU A;  2OQE C;  1KD1 4;  1K9M 4;  4R1K A;  3D3L A;  5BVB A;  2ML5 A;  3GZB A;  1R4C A;  3HI7 A;  5AI1 A;  3OV4 A;  3LT9 A;  3SXX A;  1V74 A;  1PFP A;  1M90 4;  4EV2 A;  2STD A;  4K90 B;  1W6Y A;  5LC6 A;  1W2B 2;  1ROV A;  4HJL B;  1W6G A;  4I4K A;  4R9K A;  1DVD A;  1WQL B;  2XEP A;  3HX8 A;  4XBX A;  5IER A;  4JRF A;  3PCR A;  2D42 A;  1E3V A;  4EXR A;  3X3X A;  5AIG A;  3DM8 A;  1CQS A;  4FMD A;  4N3V A;  2IA7 A;  4HM3 B;  3QK9 A;  5AEW B;  3CCV 3;  3CPW 2;  2BMR B;  4RBN A;  3UNL A;  1RRL A;  3S67 A;  3SOY A;  3NBJ A;  3FG4 A;  5JBS A;  3CCQ 3;  3G8Z A;  3NBB A;  1VQ9 3;  5EEO A;  3D9R A;  3K7C A;  1VQK 3;  1KC8 4;  3FKA A;  2INX A;  3FLJ A;  1QJG A;  1GY6 A;  1JRQ A;  1UUV B;  1S72 3;  4KFE A;  1O7H B;  2W04 A;  4MMX B;  1FGR A;  1RN7 A;  1VQN 3;  3MKI A;  4CDL A;  4HM5 B;  4K61 A;  3Q2P A;  1MNL A;  3H3H A;  3N9H A;  3EN1 B;  3EBT A;  3NQY A;  5I97 A;  3LTD A;  2W6J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...