2F86B

The association domain of c. elegans camkii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
NDSEKAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFDGNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein K11E8.1d
publication title Oligomerization states of the association domain and the holoenyzme of Ca2+/CaM kinase II.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 36
structure length 129
sequence length 129
chains with identical sequence D, F, H, J, L, N
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f86B00
3EJVA 1GY7A 5IF6A 4HM7B 2BMOB 3S5CA 5FW5A 2JQ5A 1JKGB 4WP5A 3LYGA 1QJGA 5AEWB 3OX9A 3F40A 1OF5B 2BNGA 1GYBA 5AIIA 2HMOB 2QGUA 3B7CA 2F86B 2YFJB 3NM2A 4LGQA 1EG9B 4XBYA 3GRDA 3KE7A 3EHCA 2BMRB 1NU3A 5KP3A 2K54A 3CU3A 2HMNB 6STDA 4L8PA 3E99A 4HM4B 2BMQB 1VZZA 2RCDA 2RFRA 2GBXB 4HZBB 5CF1A 4ORLA 5AIFA 1A2KA 3KZTA 3G16A 1Q42A 2OWPA 3T8UA 3UJMA 4FCJA 4XB5A 4HM1B 4R9LA 1E97A 4LMIA 4N3VA 4XBTA 1S5AA 3F7XA 2XR8B 2XSHB 4STDA 2GXFA 3T8NA 1JN5A 3ECFA 1C7HA 3JUMA 1O7WB 2HMLB 3Q90A 1JB2A 1OUNA 3MG2A 3OWUA 5IENA 5IEOA 2IMJA 1Z1SA 3CNXA 4GB5A 3FKAA 1GY5A 4HM0B 1ZO2A 1O7NB 1OHOA 3NBRA 2Z77A 4HZ9B 3JUPA 3MG3A 4R1KA 7STDA 4OVMA 3NHXA 3FF0A 3GWRA 5AI1A 4RZMA 3BB9A 2HMKB 3I0YA 1ZX2A 3F7SA 1DMNA 2QIYA 1QMAA 3NV0B 1O7MB 2STDA 3FF2A 3RGRA 1UUWB 3GZRA 5IEPA 4HM2B 4WYKB 3DMCA 3FGYA 4XDVA 3LZAA 4HM5B 4FCMA 4HVNA 3EC9A 3G8ZA 3H3HA 5HGRA 1OHSA 3OXAA 3EX9A 1W02A 4L7KA 4I4KA 1ULJB 4R9KA 4CDLA 3OWYA 1Q40A 3SOAA 2YFIB 3MSOA 5JPPA 1JKGA 3G0KA 4MJDA 2W2CA 1WQLB 1DMQA 1SJWA 1OF5A 1OGXA 5BVBA 1GS3A 3CPOA 4X2HA 5D81A 3OV4A 4HKVB 2GBWB 3EN8A 4HJLB 4U13A 3HZPA 4XM4A 5EVHA 3MG1A 2CKFB 4J8TA 5IG4A 2R4IA 3HX8A 5BXQA 1OGZA 1JB5A 1ULIB 5STDA 3A76A 1O7GB 4HM6B 5JPUA 1OCVA 5DRVA 3DM8A 1E3VA 1W00A 5CK6A 3GZXB 5AIGA 4J9AA 1IDPA 1CQSA 5CF2A 5IG3A 3MKIA 2PZVA 3ER7A 2GEYA 3NXJA 1UUVB 4WWUC 3B8LA 3EN1B 1O7HB 2A15A 2XRXB 3HK4A 5D83A 1TP6A 3FZWA 5KP1A 2Z7AA 3F14A 5D82A 3IPTA 1DMMA 4OUQA 1OH0A 1GY6A 1NDOB 3VGNA 3DUKA 4XBXA 1STDA 1JN5B 5G2GA 2F99A 1K41A 3DZLA 4X2OA 3EF8A 4XDWA 3FLJA 5IERA 5IG5A 3ROBA 1ISKA 8CHOA 1NWWA 2HMMB 3FSDA 3B4OA 3B4PA 3MYTA 5DREA 1O7PB 5AEUB 3EBYA 3GZBA 4IIAA 1JB4A 4L8OA 3NUVA 1AR0A 4HM3B 1U5OA 2I9WA 4Q53A 4KVHA 3KSPA 3OWSA 3EQQB 4PEJA 3F8XA 1BUQA 3K7CA 5CXOA 1ASKA 3NV0A 3SEDA 3WMDA 3RGAA 3UNLA 4K1UA 4WYKA 3F9SA 5TGNA 3M8CA 3STDA 5KP4A 2B1XB 2HMJB 3JUOA 5CLKA 2YFLB 3BLZA 3D9RA 3F8HA 1EA2A 4HM8B 2RGQA 2CHCA 2B24B 3SOYA 5IG0A 1E3RA 2UX0A 3DXOA 2Z76A 2F98A 1OHPA 3JUQA 2GEXA 5AIHA 4LEHA 3K0ZA 3CNMA 1OPYA 3MHEA 3VSYA 3H51A 3GZYB 1W01A 1W6YA 3EBTA 3FH1A 3JUNA 2XSOB 4K1VA 4H3UA 1HKXA 2INXA 1Q40B 1TUHA 3KKGA
chains in the Genus database with same CATH superfamily
3EJVA 1BSBA 1GY7A 5IF6A 1AQZA 4HM7B 2BMOB 3S5CA 2ML6A 2WGOA 1IU7A 1IVXA 1GMRA 2D42A 3PGBA 5FW5A 2JQ5A 5LC7A 1W4NA 1JKGB 4WP5A 3KFQC 1U8CB 3LYGA 3WOEB 1QJGA 1ZS7A 3N54B 4IPBA 5AEWB 2FXTA 4J5GA 3OX9A 2W56B 3F40A 1BRJA 1OF5B 2BNGA 1US1A 3U97A 1GYBA 3AGOA 5AIIA 2HMOB 1VQ43 1CH0A 3J7Yd 2R41A 1RGEA 2W03A 2QGUA 2CFKA 1MGRA 1TFOA 2CFGA 2KF3A 4BU4A 1B21A 3N8BA 5I97A 3B7CA 2F86B 1A90A 3D4AA 1W5ZA 1VQL3 2YFJB 1MGWA 3NM2A 1X1WA 1JJ22 4LGQA 1LXEA 3DGMA 1EG9B 1V74A 4XBYA 1TIJA 3GRDA 1BRIA 3EHCA 3IJEB 3KE7A 2BMRB 1NU3A 1PYLA 2UGIA 5FGOA 5KP3A 2K54A 3CU3A 1Q7Y4 2HMNB 1I8VA 2CWVA 1W6GA 4EYCA 3KN4A 4FMCA 5M19A 4NREA 6STDA 4AEQA 2O9UX 4L8PA 3E99A 1SARA 4HM4B 1T2IA 2BMQB 3AGNA 1VZZA 2RCDA 2RFRA 2GBXB 2KRTA 1HU9A 2BHMA 4HZBB 1DVCA 4JRFA 4ORLA 5CF1A 5AIFA 3WA3A 1A2KA 2E2UA 1C54A 2M7OA 1LOXA 5EEOA 2XF3A 3KZTA 2OCTA 3K63A 3NBJA 3G16A 1YVBI 1GSPA 1Q42A 2OWPA 3T8UA 3LOYA 3UJMA 1N8R4 1UW1A 4FCJA 4XB5A 4HM1B 1FYSA 3FG1A 6RNTA 1ROVA 4EXRA 3GSPA 4R9LA 4ZM8A 1E97A 1IV7A 3CXC2 2W9QA 1W6CA 1NB3I 3AHWA 2GU3A 4BL3A 1JBSA 4LMIA 3BNBA 4N6OB 1I2EA 4N3VA 1Q40B 2LQVA 1YJN3 4JF8A 4XBTA 1S5AA 1W7CA 3F7XA 5M18A 3KIIA 2XR8B 1Q814 5JBSA 2XSHB 4STDA 4N6UA 1M1K4 2W56A 2GXFA 3LT9A 3LTAA 1IYYA 3CCL3 3PZWA 3HI7A 1GD4A 1X1YA 2KXGA 3T8NA 1JN5A 1B27A 3ECFA 1RSNA 4G1MB 1C7HA 3AHSA 3VF1A 3FCSB 1N5HA 4HAAA 1BNSA 3ZG5A 1BOXA 1N5PA 3JUMA 4KT3B 1QVG2 1AY7A 1QVF2 1O7WB 1D6ZA 2HMLB 3WA2X 1VQM3 3Q90A 1JB2A 1OUNA 1B2ZA 4LZIA 1EKMA 1HYFA 3MG2A 4KZ1A 2F5WA 3OWUA 1HZ1A 1RLSA 5IENA 1BNJA 1LRAA 5IEOA 1CEWI 2IMJA 1Z1SA 1VQ73 1KSIA 3LTDA 2ZA4A 1BNRA 4GL6A 4EW5A 3RNTA 2C10A 2AADA 4FMBA 1LQMB 3CNXA 3D5IA 2XGNA 2IYJA 2W9PA 2OQEA 1CYVA 1RGGA 1RNBA 4FCZA 4GB5A 3FKAA 4H61A 1GMPA 1GY5A 1B2XA 2CFWA 4MEIA 4WFOA 3HOHA 2IUJA 1IT8A 2KCDA 4HM0B 3CMA3 1ZO2A 1O7NB 1OHOA 3NBRA 3SLUA 3X42A 2KAAA 1KD14 3CCS3 2Z77A 1K9M4 1SPUA 5BIRA 4HZ9B 2XGLA 1RGKA 3JUPA 1DVDA 3MG3A 4R1KA 2W6JH 7STDA 3G6E3 2QEX3 2CG0A 5G1LA 4OVMA 5HOHA 1VQN3 3V98A 4TX4A 3HIIA 3NBBA 3LXUX 2CC3A 2ZDJA 1N8QA 1TRPA 1QAKA 4CPKA 3NHXA 1B20A 3PYJA 4N6TA 3FF0A 3GWRA 1I0VA 1PFPA 5AI1A 4RZMA 5M1AA 3CCE3 3BB9A 1BNIA 1W2B2 1B3SA 2HMKB 3I0YA 3Q1CA 1BSAA 5GSPA 1BRNL 1BSCA 4RNZA 2CW9A 1IQ8A 1ZX2A 3F7SA 1BANA 1A2PA 1DMNA 1M904 2QIYA 3KCHA 2CG1A 3BU4A 1YIJ3 4KFDA 1QMAA 1R4CA 2L1SA 1Y4KA 2WOHA 3NV0B 3G713 1O7MB 1RGCA 2STDA 3FF2A 2L4VA 3RGRA 2C11A 4RNTA 5RNTA 1BRGA 1UUWB 3GZRA 5IEPA 4HM2B 1EQKA 4WYKB 1YHQ3 2CFDA 3CCU3 3DMCA 2OTJ3 3FGYA 4XDVA 3S29A 4EV2A 3LZAA 5A0OB 4HM5B 4FCMA 3NM7A 3MWZA 3X41A 3LH4A 2RNTA 4HVNA 4KFEA 1GOVA 3EC9A 1UI7A 2KF5A 2YX9A 3G8ZA 3H3HA 4K61A 3V92A 2XH9A 5G1KA 1WNHA 5HGRA 1TFKA 5ELUA 1OHSA 3WOFB 3OXAA 3X3XA 3EX9A 1RGFA 3DY5A 1W02A 2CWTA 2H0IA 2KF6A 4L7KA 3SVAA 3PS8A 4I4KA 1BSEA 1I2GA 1UUGB 1ULJB 3D5GA 4R9KA 3U1WA 4CDLA 3OWYA 2GU1A 1BIRA 1FUSA 1Q40A 1YGWA 5LC6A 4MMYB 3SOAA 1TJDA 1DYUA 1A67A 2YFIB 1MWRA 2XEPA 1RJOA 3MSOA 5BU4A 5JPPA 1JKGA 3G0KA 2D1WA 4MJDA 1IQXA 1G02A 2W2CA 1L5GB 1WQLB 1DMQA 1SJWA 3MPHA 6GSPA 1Q824 3URPA 2J8XB 3FG3A 2Z6BA 3PCRA 2WGQA 2JDIH 4KFFA 4N6LA 1OF5A 1R4YA 1OGXA 3DGYA 1B2MA 4NPBA 5BVBA 1GS3A 2W04A 2SARA 1Q9EA 2F5MA 1BSDA 2H0GA 3HIGA 3CPOA 2CK3H 1UGHI 4X2HA 3NX0A 5D81A 1YIT3 1RMSA 1X1UA 2CWUA 2OOVC 2Y74A 1VQ63 4DKIA 3OV4A 4O8SA 1V57A 4HKVB 1Q864 1G96A 1YGEA 1M1XB 2GBWB 1RHLA 1CYUA 1GMQA 3BNEA 1ZGXA 3EN8A 4HJLB 1BGSA 1BNEA 1IK3A 2QA43 4U13A 1IQYA 3HZPA 1BAOA 4XM4A 5EVHA 3WODG 1T5YA 3CPW2 3MG1A 1LVNA 3Q3FA 2WOFA 2CKFB 4J8TA 1T2HA 1B2SA 4N6NB 5IG4A 2R4IA 1FGTA 3HX8A 4FMDA 4IT7A 5BXQA 1OGZA 1YVSA 1JB5A 1ULIB 2O3OA 5STDA 1I70A 9RNTA 3A76A 1O7GB 4HM6B 5JPUA 1OCVA 3CC73 5DRVA 1LOWA 3EE1A 3DM8A 1E3VA 1I3IA 1RRHA 1W00A 2K0MA 2LYXA 5CK6A 1VQQA 4O02B 1KWIA 1YNVX 1NO3A 1VQ53 1MWUA 4FR9A 3GZXB 5AIGA 1IVWA 2E2TA 4J9AA 1BUJA 2UUGC 1WTHA 1IDPA 1SIIA 2P05A 3KSED 1YJW3 1CQSA 5CF2A 4HYZA 3MKIA 5IG3A 1LOVA 3A5EA 1D6YA 4GHOA 2PZVA 3ER7A 4LSOA 5EQLA 1N9JA 1KC84 5ELJA 4BIRA 1LNHA 3T0UA 1FUTA 1RRLA 3UB1A 1SIHA 1MOLA 3WHOA 1EEJA 3PCSA 2ZHXB 2GEYA 4OK0A 1MWSA 1UCJA 3NXJA 3TDGA 1BVIA 1A2VA 1IV9A 1WMOA 3K5TA 1UUVB 1YJ93 4WWUC 3SX1A 7RNTA 3D3LA 1Q7HA 1WMPA 3B8LA 3EN1B 4CCVA 2OTL3 2MF7A 1O7HB 1PY3A 2A15A 2XRXB 3X40A 1J2BA 1BRKA 1RN4A 4EV5A 4WHAA 3CC23 1BU4A 1G0TA 3HK4A 1GD3A 1TP6A 3FZWA 5D83A 2ZL8A 4HBRA 5KP1A 5IW9A 2IY2A 2F56A 2Z7AA 3F14A 3KKGA 5D82A 3SYUA 1TRQA 2SBLA 3IPTA 1V58A 3CCJ3 3CC43 1B2UA 3FG4A 4HOHA 2MC8A 1DMMA 1YI23 4OUQA 1EUIC 4O3VA 3CD63 3I553 1GOYA 2OOVA 1FGMA 1OH0A 3BIRA 1GY6A 1NDOB 3VGNA 3LT8A 1JBTA 3X3YA 2E2VA 1RNTA 1TTOA 3DUKA 3BNCA 4GSPA 4NHFA 4XBXA 3Q2PA 4EBGA 3DGLA 1STDA 1X1XA 4LYLB 1JN5B 1F8NA 3AMOB 3NQYA 5G2GA 2F99A 2BT3A 1FA3A 2W0QA 4ILFA 1K41A 4RBNA 4R4KA 1RKYA 2CX1A 3LTBA 1UCKA 2Q07A 3DZLA 2FNQA 2Y73A 1IVUA 3LTCA 2F4YA 4CJNA 1JZOA 3EB8A 4X2OA 3EF8A 4XDWA 3D79A 4I5QA 4FMAA 3PXMA 2ML5A 1LQGC 2OQEC 2IA7A 2C4BA 1MWTA 2AAEA 3FLJA 4AKYA 2FGTA 3I563 5IERA 5IG5A 3S67A 1FGOA 2CIUA 3ROBA 1ISKA 8CHOA 1I2FA 1NWWA 3LMLA 2BU4A 2HMMB 1QALA 3FSDA 3B4OA 1IT7A 5AYSC 3B4PA 2XFTA 3V99A 3G4S3 3MYTA 1K734 1LOYA 1LNIA 1TU5A 5DREA 1O7PB 5AEUB 3OW22 2CFLA 2P0MA 1K8A4 1QAFA 3EBYA 3X3ZA 1DE3A 3GZBA 7GSPA 1UCLA 1WMNA 2HOHA 4IIAA 3CCR3 1JB4A 4L8OA 1FGRA 1W2ZA 3NUVA 2IUKA 1AR0A 3SXXA 4BTYA 4HM3B 1U5OA 1VQO3 4EC6A 2I9WA 4BL2A 4Q53A 3DGOA 1K28A 1RN1A 4KVHA 1MNLA 3IMAB 1RN7A 2WO0A 3ZFZA 4R80A 3KSPA 3RDEA 3OWSA 1UI8A 3EQQB 3F8XA 4PEJA 3K7CA 1BUQA 1VQK3 1FZUA 5CXOA 1ASKA 3NV0A 4QWTA 2RSXA 1NNVA 4MMXB 1JRQA 3SEDA 1T3BA 1JV2B 3RGAA 1JNQA 3UNLA 3WMDA 3CME3 2P0XA 4K1UA 4WYKA 3F9SA 1FUWA 4O2HA 4AKZA 3S28A 3GAXA 3AMOA 1FGQA 5TGNA 1VQ93 1ROAA 1RGAA 1STFI 3M8CA 4K90B 1UDII 3STDA 5KP4A 2B1XB 2HMJB 4J5KA 3JUOA 2KF4A 1S723 5CLKA 1RCLA 2YFLB 3BLZA 1RGHA 1UGIA 3ALAA 3JVCA 2V1LA 3QK9A 1JBRA 1IVVA 3D9RA 2CH9A 2GSPA 2PNCA 3F8HA 1EA2A 4HM8B 4N6V0 2K3DA 2CHCA 2RGQA 5AYRB 3CCQ3 2B24B 2P09A 3SOYA 3NQZA 3CCM3 1GOUA 3O8YA 4MMZB 2P38A 3UL6A 5IG0A 2BIRA 1E3RA 2UX0A 1RGLA 1AVLA 3DXOA 1AV4A 2Z76A 8RNTA 2F98A 1NB5I 3DH2A 1OHPA 4RNYA 1DETA 1FW7A 1I0XA 3JUQA 2RBIA 2GEXA 1BRSA 1BNGA 1OACA 5AIHA 4LEHA 1UCIA 3K0ZA 3WR2A 1BNFA 3L0RA 2CX0A 3ZG0A 4BTWA 1KQS2 1M9GA 3CNMA 1OPYA 2XFSA 3MHEA 3VSYA 3N9HA 3H51A 1PU4A 1VQP3 4N6MA 3GZYB 4BTXA 1W01A 1W6YA 1SQWA 3DGNA 3EBTA 3UL5A 1NJI4 1JZDA 1D6UA 2H0HA 3WDGB 1VQ83 1RTUA 3FH1A 3JUNA 3S27A 1BRHA 3QRDA 2XSOB 4K1VA 1AVKA 4H3UA 3K9MC 1N9EA 1HKXA 1I3FA 3BNDA 2INXA 1RCKA 1TUHA 2BO9B 3CCV3 1RDSA
chains in the Genus database with same CATH topology
3EJVA 1GY7A 5IF6A 4HM7B 2BMOB 3S5CA 2ML6A 2WGOA 1IU7A 1IVXA 2D42A 5LC7A 3PGBA 5FW5A 2JQ5A 1W4NA 1JKGB 4WP5A 3KFQC 1U8CB 3LYGA 3WOEB 1QJGA 3N54B 4IPBA 5AEWB 2FXTA 3OX9A 2W56B 3F40A 1OF5B 2BNGA 1US1A 3U97A 1GYBA 5AIIA 2HMOB 1VQ43 3J7Yd 2W03A 2QGUA 2CFKA 1TFOA 2CFGA 3N8BA 5I97A 3B7CA 2F86B 1A90A 1VQL3 1W5ZA 2YFJB 3NM2A 1JJ22 4LGQA 1LXEA 3DGMA 1EG9B 1V74A 4XBYA 1TIJA 3GRDA 3KE7A 3EHCA 3IJEB 3V99A 2BMRB 1NU3A 5FGOA 5KP3A 2K54A 3CU3A 1Q7Y4 2HMNB 2CWVA 1W6GA 4EYCA 3KN4A 4FMCA 4NREA 6STDA 4AEQA 2O9UX 4L8PA 3E99A 4HM4B 2BMQB 1VZZA 2RCDA 2RFRA 2GBXB 2KRTA 1HU9A 2BHMA 4HZBB 1DVCA 4JRFA 4ORLA 5CF1A 5AIFA 3WA3A 1A2KA 2E2UA 2M7OA 1LOXA 5EEOA 2XF3A 3KZTA 2OCTA 3K63A 3NBJA 3G16A 1YVBI 1Q42A 2OWPA 3T8UA 3UJMA 3LOYA 1N8R4 1UW1A 4FCJA 4XB5A 4HM1B 3FG1A 1ROVA 4EXRA 4R9LA 4ZM8A 1E97A 1IV7A 3CXC2 2W9QA 1W6CA 1NB3I 2GU3A 4LMIA 3BNBA 4N6OB 4N3VA 2LQVA 1YJN3 4JF8A 4XBTA 1S5AA 1W7CA 3F7XA 1Q814 3KIIA 2XR8B 5JBSA 2XSHB 4STDA 4N6UA 1M1K4 2W56A 2GXFA 3LT9A 3LTAA 3CCL3 3PZWA 3HI7A 1GD4A 2KXGA 3T8NA 1JN5A 3ECFA 4G1MB 1C7HA 3VF1A 3FCSB 1N5HA 1N5PA 3JUMA 1QVG2 1QVF2 1O7WB 1D6ZA 2HMLB 3WA2X 1VQM3 3Q90A 1JB2A 1OUNA 4LZIA 1EKMA 3MG2A 4KZ1A 3OWUA 5IENA 5IEOA 1CEWI 2IMJA 1Z1SA 1VQ73 1KSIA 3LTDA 4GL6A 2C10A 4FMBA 3CNXA 2XGNA 2W9PA 2OQEA 1CYVA 4FCZA 4GB5A 3FKAA 4H61A 1GY5A 2CFWA 4MEIA 4WFOA 2IUJA 1IT8A 2KCDA 4HM0B 3CMA3 1ZO2A 1O7NB 1OHOA 3NBRA 3SLUA 3X42A 1KD14 3CCS3 2Z77A 1K9M4 1SPUA 4HZ9B 2XGLA 3JUPA 1DVDA 3MG3A 4R1KA 2W6JH 7STDA 3G6E3 2QEX3 2CG0A 4OVMA 1VQN3 3V98A 4TX4A 3HIIA 3NBBA 3LXUX 2CC3A 2ZDJA 1N8QA 1QAKA 3NHXA 4N6TA 3PYJA 3FF0A 3GWRA 1PFPA 5AI1A 4RZMA 3CCE3 3BB9A 1W2B2 2HMKB 3I0YA 3Q1CA 4RNZA 2CW9A 1IQ8A 1ZX2A 3F7SA 1DMNA 1M904 2QIYA 2CG1A 1YIJ3 4KFDA 1QMAA 1R4CA 1Y4KA 2WOHA 3NV0B 3G713 1O7MB 2STDA 3FF2A 2L4VA 3RGRA 2C11A 1UUWB 3GZRA 5IEPA 4HM2B 1EQKA 4WYKB 1YHQ3 2CFDA 3CCU3 3DMCA 2OTJ3 3FGYA 4XDVA 3S29A 4EV2A 3LZAA 5A0OB 4HM5B 4FCMA 3NM7A 3MWZA 3X41A 3LH4A 4HVNA 4KFEA 3EC9A 1UI7A 3G8ZA 2YX9A 3H3HA 4K61A 3V92A 2XH9A 1WNHA 5HGRA 1TFKA 5ELUA 1OHSA 3WOFB 3OXAA 3X3XA 3EX9A 3DY5A 1W02A 2CWTA 3SVAA 4L7KA 3PS8A 4I4KA 1ULJB 4R9KA 4CDLA 3U1WA 3OWYA 2GU1A 1Q40A 5LC6A 4MMYB 3SOAA 1DYUA 1A67A 2YFIB 3MSOA 2XEPA 1RJOA 5JPPA 1JKGA 3G0KA 2D1WA 4MJDA 1IQXA 2W2CA 1L5GB 1WQLB 1DMQA 1SJWA 3MPHA 1Q824 3FG3A 4N6LA 2Z6BA 3PCRA 2WGQA 2JDIH 4KFFA 4RNYA 1OF5A 1OGXA 5BVBA 1GS3A 2W04A 3HIGA 3CPOA 2CK3H 4X2HA 3NX0A 5D81A 1YIT3 2CWUA 2OOVC 2Y74A 1VQ63 3OV4A 4O8SA 4HKVB 1Q864 1G96A 1YGEA 1M1XB 2GBWB 1CYUA 3EN8A 3BNEA 4HJLB 1IK3A 2QA43 4U13A 1IQYA 3HZPA 4XM4A 5EVHA 3WODG 1T5YA 3CPW2 3MG1A 1LVNA 2WOFA 2CKFB 4J8TA 4N6NB 5IG4A 2R4IA 1FGTA 3HX8A 4FMDA 4IT7A 5BXQA 1OGZA 1JB5A 1ULIB 2O3OA 5STDA 3A76A 1O7GB 4HM6B 5JPUA 1OCVA 3CC73 5DRVA 3EE1A 3DM8A 1E3VA 1RRHA 1W00A 2K0MA 5CK6A 2LYXA 4O02B 1KWIA 1VQ53 1NO3A 4FR9A 3GZXB 5AIGA 1IVWA 2E2TA 4J9AA 1WTHA 1IDPA 1SIIA 2P05A 3KSED 1YJW3 1CQSA 5CF2A 4HYZA 3MKIA 5IG3A 1D6YA 4LSOA 2PZVA 3ER7A 5EQLA 1KC84 1N9JA 5ELJA 1LNHA 3T0UA 1RRLA 3UB1A 1SIHA 1MOLA 3PCSA 2GEYA 4OK0A 3TDGA 3NXJA 1A2VA 1IV9A 1WMOA 3K5TA 1UUVB 1YJ93 4WWUC 3SX1A 3D3LA 1WMPA 3B8LA 3EN1B 4CCVA 2OTL3 2MF7A 1O7HB 3X40A 2A15A 2XRXB 1J2BA 3CC23 4EV5A 4WHAA 3HK4A 1GD3A 1TP6A 3FZWA 5D83A 2ZL8A 4HBRA 5KP1A 5IW9A 2Z7AA 3F14A 5D82A 2SBLA 3CCJ3 3IPTA 3CC43 3FG4A 2MC8A 1DMMA 1YI23 4OUQA 4O3VA 3CD63 3I553 2OOVA 1FGMA 1OH0A 1GY6A 1NDOB 3VGNA 3LT8A 3X3YA 2E2VA 3DUKA 4XBXA 4NHFA 3BNCA 3Q2PA 4EBGA 3DGLA 1STDA 1JN5B 1F8NA 3AMOB 3NQYA 5G2GA 2F99A 2BT3A 1FA3A 2W0QA 4RBNA 1K41A 4R4KA 1RKYA 3LTBA 2Q07A 3DZLA 2FNQA 2Y73A 1IVUA 3LTCA 3EB8A 4X2OA 3EF8A 4XDWA 4FMAA 3PXMA 2ML5A 2OQEC 2IA7A 4AKYA 3I563 3FLJA 2FGTA 5IERA 5IG5A 3S67A 1FGOA 2CIUA 3ROBA 1ISKA 8CHOA 1NWWA 3LMLA 2HMMB 1QALA 3FSDA 3B4OA 1IT7A 5AYSC 3B4PA 2XFTA 3G4S3 3MYTA 1K734 1TU5A 5DREA 1O7PB 5AEUB 3OW22 2CFLA 2P0MA 1K8A4 1QAFA 3EBYA 3X3ZA 3GZBA 1WMNA 4IIAA 3CCR3 1JB4A 4L8OA 1FGRA 1W2ZA 3NUVA 2IUKA 1AR0A 3SXXA 4BTYA 4HM3B 1U5OA 1VQO3 4EC6A 2I9WA 4Q53A 3DGOA 1K28A 4KVHA 1MNLA 3IMAB 1RN7A 2WO0A 4R80A 3KSPA 3RDEA 3OWSA 1UI8A 3EQQB 3F8XA 4PEJA 3K7CA 1BUQA 1VQK3 5CXOA 1ASKA 3NV0A 4QWTA 2RSXA 4MMXB 1JRQA 3SEDA 1JV2B 3RGAA 1JNQA 3UNLA 3WMDA 3CME3 2P0XA 4K1UA 4WYKA 3F9SA 1FUWA 4O2HA 4AKZA 3S28A 3GAXA 3AMOA 1FGQA 5TGNA 1VQ93 1ROAA 1STFI 3M8CA 4K90B 3STDA 5KP4A 2B1XB 2HMJB 3JUOA 1S723 5CLKA 2YFLB 3BLZA 3ALAA 3JVCA 2V1LA 3QK9A 1IVVA 3D9RA 2CH9A 2PNCA 3F8HA 1EA2A 4HM8B 4N6V0 2RGQA 2CHCA 3CCQ3 5AYRB 2B24B 2P09A 3SOYA 3NQZA 3CCM3 3O8YA 4MMZB 2P38A 3UL6A 5IG0A 1E3RA 2UX0A 3DXOA 1AVLA 1AV4A 2Z76A 2F98A 1NB5I 1OHPA 3JUQA 2GEXA 1OACA 5AIHA 4LEHA 3K0ZA 3L0RA 4BTWA 1KQS2 1M9GA 3CNMA 1OPYA 2XFSA 3MHEA 3VSYA 3N9HA 3H51A 1PU4A 1VQP3 4N6MA 3GZYB 4BTXA 1W01A 1W6YA 1SQWA 3DGNA 3EBTA 3UL5A 1NJI4 1D6UA 1VQ83 3WDGB 3FH1A 3JUNA 3S27A 3QRDA 2XSOB 4K1VA 1AVKA 4H3UA 3K9MC 1N9EA 1HKXA 3BNDA 2INXA 1Q40B 1TUHA 2BO9B 3CCV3 3KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJV A;  1GY7 A;  5IF6 A;  4HM7 B;  2BMO B;  3S5C A;  5FW5 A;  2JQ5 A;  1JKG B;  4WP5 A;  3LYG A;  1QJG A;  5AEW B;  3OX9 A;  3F40 A;  1OF5 B;  2BNG A;  1GYB A;  5AII A;  2HMO B;  2QGU A;  3B7C A;  2F86 B;  2YFJ B;  3NM2 A;  4LGQ A;  1EG9 B;  4XBY A;  3GRD A;  3KE7 A;  3EHC A;  2BMR B;  1NU3 A;  5KP3 A;  2K54 A;  3CU3 A;  2HMN B;  6STD A;  4L8P A;  3E99 A;  4HM4 B;  2BMQ B;  1VZZ A;  2RCD A;  2RFR A;  2GBX B;  4HZB B;  5CF1 A;  4ORL A;  5AIF A;  1A2K A;  3KZT A;  3G16 A;  1Q42 A;  2OWP A;  3T8U A;  3UJM A;  4FCJ A;  4XB5 A;  4HM1 B;  4R9L A;  1E97 A;  4LMI A;  4N3V A;  4XBT A;  1S5A A;  3F7X A;  2XR8 B;  2XSH B;  4STD A;  2GXF A;  3T8N A;  1JN5 A;  3ECF A;  1C7H A;  3JUM A;  1O7W B;  2HML B;  3Q90 A;  1JB2 A;  1OUN A;  3MG2 A;  3OWU A;  5IEN A;  5IEO A;  2IMJ A;  1Z1S A;  3CNX A;  4GB5 A;  3FKA A;  1GY5 A;  4HM0 B;  1ZO2 A;  1O7N B;  1OHO A;  3NBR A;  2Z77 A;  4HZ9 B;  3JUP A;  3MG3 A;  4R1K A;  7STD A;  4OVM A;  3NHX A;  3FF0 A;  3GWR A;  5AI1 A;  4RZM A;  3BB9 A;  2HMK B;  3I0Y A;  1ZX2 A;  3F7S A;  1DMN A;  2QIY A;  1QMA A;  3NV0 B;  1O7M B;  2STD A;  3FF2 A;  3RGR A;  1UUW B;  3GZR A;  5IEP A;  4HM2 B;  4WYK B;  3DMC A;  3FGY A;  4XDV A;  3LZA A;  4HM5 B;  4FCM A;  4HVN A;  3EC9 A;  3G8Z A;  3H3H A;  5HGR A;  1OHS A;  3OXA A;  3EX9 A;  1W02 A;  4L7K A;  4I4K A;  1ULJ B;  4R9K A;  4CDL A;  3OWY A;  1Q40 A;  3SOA A;  2YFI B;  3MSO A;  5JPP A;  1JKG A;  3G0K A;  4MJD A;  2W2C A;  1WQL B;  1DMQ A;  1SJW A;  1OF5 A;  1OGX A;  5BVB A;  1GS3 A;  3CPO A;  4X2H A;  5D81 A;  3OV4 A;  4HKV B;  2GBW B;  3EN8 A;  4HJL B;  4U13 A;  3HZP A;  4XM4 A;  5EVH A;  3MG1 A;  2CKF B;  4J8T A;  5IG4 A;  2R4I A;  3HX8 A;  5BXQ A;  1OGZ A;  1JB5 A;  1ULI B;  5STD A;  3A76 A;  1O7G B;  4HM6 B;  5JPU A;  1OCV A;  5DRV A;  3DM8 A;  1E3V A;  1W00 A;  5CK6 A;  3GZX B;  5AIG A;  4J9A A;  1IDP A;  1CQS A;  5CF2 A;  5IG3 A;  3MKI A;  2PZV A;  3ER7 A;  2GEY A;  3NXJ A;  1UUV B;  4WWU C;  3B8L A;  3EN1 B;  1O7H B;  2A15 A;  2XRX B;  3HK4 A;  5D83 A;  1TP6 A;  3FZW A;  5KP1 A;  2Z7A A;  3F14 A;  5D82 A;  3IPT A;  1DMM A;  4OUQ A;  1OH0 A;  1GY6 A;  1NDO B;  3VGN A;  3DUK A;  4XBX A;  1STD A;  1JN5 B;  5G2G A;  2F99 A;  1K41 A;  3DZL A;  4X2O A;  3EF8 A;  4XDW A;  3FLJ A;  5IER A;  5IG5 A;  3ROB A;  1ISK A;  8CHO A;  1NWW A;  2HMM B;  3FSD A;  3B4O A;  3B4P A;  3MYT A;  5DRE A;  1O7P B;  5AEU B;  3EBY A;  3GZB A;  4IIA A;  1JB4 A;  4L8O A;  3NUV A;  1AR0 A;  4HM3 B;  1U5O A;  2I9W A;  4Q53 A;  4KVH A;  3KSP A;  3OWS A;  3EQQ B;  4PEJ A;  3F8X A;  1BUQ A;  3K7C A;  5CXO A;  1ASK A;  3NV0 A;  3SED A;  3WMD A;  3RGA A;  3UNL A;  4K1U A;  4WYK A;  3F9S A;  5TGN A;  3M8C A;  3STD A;  5KP4 A;  2B1X B;  2HMJ B;  3JUO A;  5CLK A;  2YFL B;  3BLZ A;  3D9R A;  3F8H A;  1EA2 A;  4HM8 B;  2RGQ A;  2CHC A;  2B24 B;  3SOY A;  5IG0 A;  1E3R A;  2UX0 A;  3DXO A;  2Z76 A;  2F98 A;  1OHP A;  3JUQ A;  2GEX A;  5AIH A;  4LEH A;  3K0Z A;  3CNM A;  1OPY A;  3MHE A;  3VSY A;  3H51 A;  3GZY B;  1W01 A;  1W6Y A;  3EBT A;  3FH1 A;  3JUN A;  2XSO B;  4K1V A;  4H3U A;  1HKX A;  2INX A;  1Q40 B;  1TUH A;  3KKG A; 
#chains in the Genus database with same CATH topology
 3EJV A;  1BSB A;  1GY7 A;  5IF6 A;  1AQZ A;  4HM7 B;  2BMO B;  3S5C A;  2ML6 A;  2WGO A;  1IU7 A;  1IVX A;  1GMR A;  2D42 A;  3PGB A;  5FW5 A;  2JQ5 A;  5LC7 A;  1W4N A;  1JKG B;  4WP5 A;  3KFQ C;  1U8C B;  3LYG A;  3WOE B;  1QJG A;  1ZS7 A;  3N54 B;  4IPB A;  5AEW B;  2FXT A;  4J5G A;  3OX9 A;  2W56 B;  3F40 A;  1BRJ A;  1OF5 B;  2BNG A;  1US1 A;  3U97 A;  1GYB A;  3AGO A;  5AII A;  2HMO B;  1VQ4 3;  1CH0 A;  3J7Y d;  2R41 A;  1RGE A;  2W03 A;  2QGU A;  2CFK A;  1MGR A;  1TFO A;  2CFG A;  2KF3 A;  4BU4 A;  1B21 A;  3N8B A;  5I97 A;  3B7C A;  2F86 B;  1A90 A;  3D4A A;  1W5Z A;  1VQL 3;  2YFJ B;  1MGW A;  3NM2 A;  1X1W A;  1JJ2 2;  4LGQ A;  1LXE A;  3DGM A;  1EG9 B;  1V74 A;  4XBY A;  1TIJ A;  3GRD A;  1BRI A;  3EHC A;  3IJE B;  3KE7 A;  2BMR B;  1NU3 A;  1PYL A;  2UGI A;  5FGO A;  5KP3 A;  2K54 A;  3CU3 A;  1Q7Y 4;  2HMN B;  1I8V A;  2CWV A;  1W6G A;  4EYC A;  3KN4 A;  4FMC A;  5M19 A;  4NRE A;  6STD A;  4AEQ A;  2O9U X;  4L8P A;  3E99 A;  1SAR A;  4HM4 B;  1T2I A;  2BMQ B;  3AGN A;  1VZZ A;  2RCD A;  2RFR A;  2GBX B;  2KRT A;  1HU9 A;  2BHM A;  4HZB B;  1DVC A;  4JRF A;  4ORL A;  5CF1 A;  5AIF A;  3WA3 A;  1A2K A;  2E2U A;  1C54 A;  2M7O A;  1LOX A;  5EEO A;  2XF3 A;  3KZT A;  2OCT A;  3K63 A;  3NBJ A;  3G16 A;  1YVB I;  1GSP A;  1Q42 A;  2OWP A;  3T8U A;  3LOY A;  3UJM A;  1N8R 4;  1UW1 A;  4FCJ A;  4XB5 A;  4HM1 B;  1FYS A;  3FG1 A;  6RNT A;  1ROV A;  4EXR A;  3GSP A;  4R9L A;  4ZM8 A;  1E97 A;  1IV7 A;  3CXC 2;  2W9Q A;  1W6C A;  1NB3 I;  3AHW A;  2GU3 A;  4BL3 A;  1JBS A;  4LMI A;  3BNB A;  4N6O B;  1I2E A;  4N3V A;  1Q40 B;  2LQV A;  1YJN 3;  4JF8 A;  4XBT A;  1S5A A;  1W7C A;  3F7X A;  5M18 A;  3KII A;  2XR8 B;  1Q81 4;  5JBS A;  2XSH B;  4STD A;  4N6U A;  1M1K 4;  2W56 A;  2GXF A;  3LT9 A;  3LTA A;  1IYY A;  3CCL 3;  3PZW A;  3HI7 A;  1GD4 A;  1X1Y A;  2KXG A;  3T8N A;  1JN5 A;  1B27 A;  3ECF A;  1RSN A;  4G1M B;  1C7H A;  3AHS A;  3VF1 A;  3FCS B;  1N5H A;  4HAA A;  1BNS A;  3ZG5 A;  1BOX A;  1N5P A;  3JUM A;  4KT3 B;  1QVG 2;  1AY7 A;  1QVF 2;  1O7W B;  1D6Z A;  2HML B;  3WA2 X;  1VQM 3;  3Q90 A;  1JB2 A;  1OUN A;  1B2Z A;  4LZI A;  1EKM A;  1HYF A;  3MG2 A;  4KZ1 A;  2F5W A;  3OWU A;  1HZ1 A;  1RLS A;  5IEN A;  1BNJ A;  1LRA A;  5IEO A;  1CEW I;  2IMJ A;  1Z1S A;  1VQ7 3;  1KSI A;  3LTD A;  2ZA4 A;  1BNR A;  4GL6 A;  4EW5 A;  3RNT A;  2C10 A;  2AAD A;  4FMB A;  1LQM B;  3CNX A;  3D5I A;  2XGN A;  2IYJ A;  2W9P A;  2OQE A;  1CYV A;  1RGG A;  1RNB A;  4FCZ A;  4GB5 A;  3FKA A;  4H61 A;  1GMP A;  1GY5 A;  1B2X A;  2CFW A;  4MEI A;  4WFO A;  3HOH A;  2IUJ A;  1IT8 A;  2KCD A;  4HM0 B;  3CMA 3;  1ZO2 A;  1O7N B;  1OHO A;  3NBR A;  3SLU A;  3X42 A;  2KAA A;  1KD1 4;  3CCS 3;  2Z77 A;  1K9M 4;  1SPU A;  5BIR A;  4HZ9 B;  2XGL A;  1RGK A;  3JUP A;  1DVD A;  3MG3 A;  4R1K A;  2W6J H;  7STD A;  3G6E 3;  2QEX 3;  2CG0 A;  5G1L A;  4OVM A;  5HOH A;  1VQN 3;  3V98 A;  4TX4 A;  3HII A;  3NBB A;  3LXU X;  2CC3 A;  2ZDJ A;  1N8Q A;  1TRP A;  1QAK A;  4CPK A;  3NHX A;  1B20 A;  3PYJ A;  4N6T A;  3FF0 A;  3GWR A;  1I0V A;  1PFP A;  5AI1 A;  4RZM A;  5M1A A;  3CCE 3;  3BB9 A;  1BNI A;  1W2B 2;  1B3S A;  2HMK B;  3I0Y A;  3Q1C A;  1BSA A;  5GSP A;  1BRN L;  1BSC A;  4RNZ A;  2CW9 A;  1IQ8 A;  1ZX2 A;  3F7S A;  1BAN A;  1A2P A;  1DMN A;  1M90 4;  2QIY A;  3KCH A;  2CG1 A;  3BU4 A;  1YIJ 3;  4KFD A;  1QMA A;  1R4C A;  2L1S A;  1Y4K A;  2WOH A;  3NV0 B;  3G71 3;  1O7M B;  1RGC A;  2STD A;  3FF2 A;  2L4V A;  3RGR A;  2C11 A;  4RNT A;  5RNT A;  1BRG A;  1UUW B;  3GZR A;  5IEP A;  4HM2 B;  1EQK A;  4WYK B;  1YHQ 3;  2CFD A;  3CCU 3;  3DMC A;  2OTJ 3;  3FGY A;  4XDV A;  3S29 A;  4EV2 A;  3LZA A;  5A0O B;  4HM5 B;  4FCM A;  3NM7 A;  3MWZ A;  3X41 A;  3LH4 A;  2RNT A;  4HVN A;  4KFE A;  1GOV A;  3EC9 A;  1UI7 A;  2KF5 A;  2YX9 A;  3G8Z A;  3H3H A;  4K61 A;  3V92 A;  2XH9 A;  5G1K A;  1WNH A;  5HGR A;  1TFK A;  5ELU A;  1OHS A;  3WOF B;  3OXA A;  3X3X A;  3EX9 A;  1RGF A;  3DY5 A;  1W02 A;  2CWT A;  2H0I A;  2KF6 A;  4L7K A;  3SVA A;  3PS8 A;  4I4K A;  1BSE A;  1I2G A;  1UUG B;  1ULJ B;  3D5G A;  4R9K A;  3U1W A;  4CDL A;  3OWY A;  2GU1 A;  1BIR A;  1FUS A;  1Q40 A;  1YGW A;  5LC6 A;  4MMY B;  3SOA A;  1TJD A;  1DYU A;  1A67 A;  2YFI B;  1MWR A;  2XEP A;  1RJO A;  3MSO A;  5BU4 A;  5JPP A;  1JKG A;  3G0K A;  2D1W A;  4MJD A;  1IQX A;  1G02 A;  2W2C A;  1L5G B;  1WQL B;  1DMQ A;  1SJW A;  3MPH A;  6GSP A;  1Q82 4;  3URP A;  2J8X B;  3FG3 A;  2Z6B A;  3PCR A;  2WGQ A;  2JDI H;  4KFF A;  4N6L A;  1OF5 A;  1R4Y A;  1OGX A;  3DGY A;  1B2M A;  4NPB A;  5BVB A;  1GS3 A;  2W04 A;  2SAR A;  1Q9E A;  2F5M A;  1BSD A;  2H0G A;  3HIG A;  3CPO A;  2CK3 H;  1UGH I;  4X2H A;  3NX0 A;  5D81 A;  1YIT 3;  1RMS A;  1X1U A;  2CWU A;  2OOV C;  2Y74 A;  1VQ6 3;  4DKI A;  3OV4 A;  4O8S A;  1V57 A;  4HKV B;  1Q86 4;  1G96 A;  1YGE A;  1M1X B;  2GBW B;  1RHL A;  1CYU A;  1GMQ A;  3BNE A;  1ZGX A;  3EN8 A;  4HJL B;  1BGS A;  1BNE A;  1IK3 A;  2QA4 3;  4U13 A;  1IQY A;  3HZP A;  1BAO A;  4XM4 A;  5EVH A;  3WOD G;  1T5Y A;  3CPW 2;  3MG1 A;  1LVN A;  3Q3F A;  2WOF A;  2CKF B;  4J8T A;  1T2H A;  1B2S A;  4N6N B;  5IG4 A;  2R4I A;  1FGT A;  3HX8 A;  4FMD A;  4IT7 A;  5BXQ A;  1OGZ A;  1YVS A;  1JB5 A;  1ULI B;  2O3O A;  5STD A;  1I70 A;  9RNT A;  3A76 A;  1O7G B;  4HM6 B;  5JPU A;  1OCV A;  3CC7 3;  5DRV A;  1LOW A;  3EE1 A;  3DM8 A;  1E3V A;  1I3I A;  1RRH A;  1W00 A;  2K0M A;  2LYX A;  5CK6 A;  1VQQ A;  4O02 B;  1KWI A;  1YNV X;  1NO3 A;  1VQ5 3;  1MWU A;  4FR9 A;  3GZX B;  5AIG A;  1IVW A;  2E2T A;  4J9A A;  1BUJ A;  2UUG C;  1WTH A;  1IDP A;  1SII A;  2P05 A;  3KSE D;  1YJW 3;  1CQS A;  5CF2 A;  4HYZ A;  3MKI A;  5IG3 A;  1LOV A;  3A5E A;  1D6Y A;  4GHO A;  2PZV A;  3ER7 A;  4LSO A;  5EQL A;  1N9J A;  1KC8 4;  5ELJ A;  4BIR A;  1LNH A;  3T0U A;  1FUT A;  1RRL A;  3UB1 A;  1SIH A;  1MOL A;  3WHO A;  1EEJ A;  3PCS A;  2ZHX B;  2GEY A;  4OK0 A;  1MWS A;  1UCJ A;  3NXJ A;  3TDG A;  1BVI A;  1A2V A;  1IV9 A;  1WMO A;  3K5T A;  1UUV B;  1YJ9 3;  4WWU C;  3SX1 A;  7RNT A;  3D3L A;  1Q7H A;  1WMP A;  3B8L A;  3EN1 B;  4CCV A;  2OTL 3;  2MF7 A;  1O7H B;  1PY3 A;  2A15 A;  2XRX B;  3X40 A;  1J2B A;  1BRK A;  1RN4 A;  4EV5 A;  4WHA A;  3CC2 3;  1BU4 A;  1G0T A;  3HK4 A;  1GD3 A;  1TP6 A;  3FZW A;  5D83 A;  2ZL8 A;  4HBR A;  5KP1 A;  5IW9 A;  2IY2 A;  2F56 A;  2Z7A A;  3F14 A;  3KKG A;  5D82 A;  3SYU A;  1TRQ A;  2SBL A;  3IPT A;  1V58 A;  3CCJ 3;  3CC4 3;  1B2U A;  3FG4 A;  4HOH A;  2MC8 A;  1DMM A;  1YI2 3;  4OUQ A;  1EUI C;  4O3V A;  3CD6 3;  3I55 3;  1GOY A;  2OOV A;  1FGM A;  1OH0 A;  3BIR A;  1GY6 A;  1NDO B;  3VGN A;  3LT8 A;  1JBT A;  3X3Y A;  2E2V A;  1RNT A;  1TTO A;  3DUK A;  3BNC A;  4GSP A;  4NHF A;  4XBX A;  3Q2P A;  4EBG A;  3DGL A;  1STD A;  1X1X A;  4LYL B;  1JN5 B;  1F8N A;  3AMO B;  3NQY A;  5G2G A;  2F99 A;  2BT3 A;  1FA3 A;  2W0Q A;  4ILF A;  1K41 A;  4RBN A;  4R4K A;  1RKY A;  2CX1 A;  3LTB A;  1UCK A;  2Q07 A;  3DZL A;  2FNQ A;  2Y73 A;  1IVU A;  3LTC A;  2F4Y A;  4CJN A;  1JZO A;  3EB8 A;  4X2O A;  3EF8 A;  4XDW A;  3D79 A;  4I5Q A;  4FMA A;  3PXM A;  2ML5 A;  1LQG C;  2OQE C;  2IA7 A;  2C4B A;  1MWT A;  2AAE A;  3FLJ A;  4AKY A;  2FGT A;  3I56 3;  5IER A;  5IG5 A;  3S67 A;  1FGO A;  2CIU A;  3ROB A;  1ISK A;  8CHO A;  1I2F A;  1NWW A;  3LML A;  2BU4 A;  2HMM B;  1QAL A;  3FSD A;  3B4O A;  1IT7 A;  5AYS C;  3B4P A;  2XFT A;  3V99 A;  3G4S 3;  3MYT A;  1K73 4;  1LOY A;  1LNI A;  1TU5 A;  5DRE A;  1O7P B;  5AEU B;  3OW2 2;  2CFL A;  2P0M A;  1K8A 4;  1QAF A;  3EBY A;  3X3Z A;  1DE3 A;  3GZB A;  7GSP A;  1UCL A;  1WMN A;  2HOH A;  4IIA A;  3CCR 3;  1JB4 A;  4L8O A;  1FGR A;  1W2Z A;  3NUV A;  2IUK A;  1AR0 A;  3SXX A;  4BTY A;  4HM3 B;  1U5O A;  1VQO 3;  4EC6 A;  2I9W A;  4BL2 A;  4Q53 A;  3DGO A;  1K28 A;  1RN1 A;  4KVH A;  1MNL A;  3IMA B;  1RN7 A;  2WO0 A;  3ZFZ A;  4R80 A;  3KSP A;  3RDE A;  3OWS A;  1UI8 A;  3EQQ B;  3F8X A;  4PEJ A;  3K7C A;  1BUQ A;  1VQK 3;  1FZU A;  5CXO A;  1ASK A;  3NV0 A;  4QWT A;  2RSX A;  1NNV A;  4MMX B;  1JRQ A;  3SED A;  1T3B A;  1JV2 B;  3RGA A;  1JNQ A;  3UNL A;  3WMD A;  3CME 3;  2P0X A;  4K1U A;  4WYK A;  3F9S A;  1FUW A;  4O2H A;  4AKZ A;  3S28 A;  3GAX A;  3AMO A;  1FGQ A;  5TGN A;  1VQ9 3;  1ROA A;  1RGA A;  1STF I;  3M8C A;  4K90 B;  1UDI I;  3STD A;  5KP4 A;  2B1X B;  2HMJ B;  4J5K A;  3JUO A;  2KF4 A;  1S72 3;  5CLK A;  1RCL A;  2YFL B;  3BLZ A;  1RGH A;  1UGI A;  3ALA A;  3JVC A;  2V1L A;  3QK9 A;  1JBR A;  1IVV A;  3D9R A;  2CH9 A;  2GSP A;  2PNC A;  3F8H A;  1EA2 A;  4HM8 B;  4N6V 0;  2K3D A;  2CHC A;  2RGQ A;  5AYR B;  3CCQ 3;  2B24 B;  2P09 A;  3SOY A;  3NQZ A;  3CCM 3;  1GOU A;  3O8Y A;  4MMZ B;  2P38 A;  3UL6 A;  5IG0 A;  2BIR A;  1E3R A;  2UX0 A;  1RGL A;  1AVL A;  3DXO A;  1AV4 A;  2Z76 A;  8RNT A;  2F98 A;  1NB5 I;  3DH2 A;  1OHP A;  4RNY A;  1DET A;  1FW7 A;  1I0X A;  3JUQ A;  2RBI A;  2GEX A;  1BRS A;  1BNG A;  1OAC A;  5AIH A;  4LEH A;  1UCI A;  3K0Z A;  3WR2 A;  1BNF A;  3L0R A;  2CX0 A;  3ZG0 A;  4BTW A;  1KQS 2;  1M9G A;  3CNM A;  1OPY A;  2XFS A;  3MHE A;  3VSY A;  3N9H A;  3H51 A;  1PU4 A;  1VQP 3;  4N6M A;  3GZY B;  4BTX A;  1W01 A;  1W6Y A;  1SQW A;  3DGN A;  3EBT A;  3UL5 A;  1NJI 4;  1JZD A;  1D6U A;  2H0H A;  3WDG B;  1VQ8 3;  1RTU A;  3FH1 A;  3JUN A;  3S27 A;  1BRH A;  3QRD A;  2XSO B;  4K1V A;  1AVK A;  4H3U A;  3K9M C;  1N9E A;  1HKX A;  1I3F A;  3BND A;  2INX A;  1RCK A;  1TUH A;  2BO9 B;  3CCV 3;  1RDS A; 
#chains in the Genus database with same CATH homology
 3EJV A;  1GY7 A;  5IF6 A;  4HM7 B;  2BMO B;  3S5C A;  2ML6 A;  2WGO A;  1IU7 A;  1IVX A;  2D42 A;  5LC7 A;  3PGB A;  5FW5 A;  2JQ5 A;  1W4N A;  1JKG B;  4WP5 A;  3KFQ C;  1U8C B;  3LYG A;  3WOE B;  1QJG A;  3N54 B;  4IPB A;  5AEW B;  2FXT A;  3OX9 A;  2W56 B;  3F40 A;  1OF5 B;  2BNG A;  1US1 A;  3U97 A;  1GYB A;  5AII A;  2HMO B;  1VQ4 3;  3J7Y d;  2W03 A;  2QGU A;  2CFK A;  1TFO A;  2CFG A;  3N8B A;  5I97 A;  3B7C A;  2F86 B;  1A90 A;  1VQL 3;  1W5Z A;  2YFJ B;  3NM2 A;  1JJ2 2;  4LGQ A;  1LXE A;  3DGM A;  1EG9 B;  1V74 A;  4XBY A;  1TIJ A;  3GRD A;  3KE7 A;  3EHC A;  3IJE B;  3V99 A;  2BMR B;  1NU3 A;  5FGO A;  5KP3 A;  2K54 A;  3CU3 A;  1Q7Y 4;  2HMN B;  2CWV A;  1W6G A;  4EYC A;  3KN4 A;  4FMC A;  4NRE A;  6STD A;  4AEQ A;  2O9U X;  4L8P A;  3E99 A;  4HM4 B;  2BMQ B;  1VZZ A;  2RCD A;  2RFR A;  2GBX B;  2KRT A;  1HU9 A;  2BHM A;  4HZB B;  1DVC A;  4JRF A;  4ORL A;  5CF1 A;  5AIF A;  3WA3 A;  1A2K A;  2E2U A;  2M7O A;  1LOX A;  5EEO A;  2XF3 A;  3KZT A;  2OCT A;  3K63 A;  3NBJ A;  3G16 A;  1YVB I;  1Q42 A;  2OWP A;  3T8U A;  3UJM A;  3LOY A;  1N8R 4;  1UW1 A;  4FCJ A;  4XB5 A;  4HM1 B;  3FG1 A;  1ROV A;  4EXR A;  4R9L A;  4ZM8 A;  1E97 A;  1IV7 A;  3CXC 2;  2W9Q A;  1W6C A;  1NB3 I;  2GU3 A;  4LMI A;  3BNB A;  4N6O B;  4N3V A;  2LQV A;  1YJN 3;  4JF8 A;  4XBT A;  1S5A A;  1W7C A;  3F7X A;  1Q81 4;  3KII A;  2XR8 B;  5JBS A;  2XSH B;  4STD A;  4N6U A;  1M1K 4;  2W56 A;  2GXF A;  3LT9 A;  3LTA A;  3CCL 3;  3PZW A;  3HI7 A;  1GD4 A;  2KXG A;  3T8N A;  1JN5 A;  3ECF A;  4G1M B;  1C7H A;  3VF1 A;  3FCS B;  1N5H A;  1N5P A;  3JUM A;  1QVG 2;  1QVF 2;  1O7W B;  1D6Z A;  2HML B;  3WA2 X;  1VQM 3;  3Q90 A;  1JB2 A;  1OUN A;  4LZI A;  1EKM A;  3MG2 A;  4KZ1 A;  3OWU A;  5IEN A;  5IEO A;  1CEW I;  2IMJ A;  1Z1S A;  1VQ7 3;  1KSI A;  3LTD A;  4GL6 A;  2C10 A;  4FMB A;  3CNX A;  2XGN A;  2W9P A;  2OQE A;  1CYV A;  4FCZ A;  4GB5 A;  3FKA A;  4H61 A;  1GY5 A;  2CFW A;  4MEI A;  4WFO A;  2IUJ A;  1IT8 A;  2KCD A;  4HM0 B;  3CMA 3;  1ZO2 A;  1O7N B;  1OHO A;  3NBR A;  3SLU A;  3X42 A;  1KD1 4;  3CCS 3;  2Z77 A;  1K9M 4;  1SPU A;  4HZ9 B;  2XGL A;  3JUP A;  1DVD A;  3MG3 A;  4R1K A;  2W6J H;  7STD A;  3G6E 3;  2QEX 3;  2CG0 A;  4OVM A;  1VQN 3;  3V98 A;  4TX4 A;  3HII A;  3NBB A;  3LXU X;  2CC3 A;  2ZDJ A;  1N8Q A;  1QAK A;  3NHX A;  4N6T A;  3PYJ A;  3FF0 A;  3GWR A;  1PFP A;  5AI1 A;  4RZM A;  3CCE 3;  3BB9 A;  1W2B 2;  2HMK B;  3I0Y A;  3Q1C A;  4RNZ A;  2CW9 A;  1IQ8 A;  1ZX2 A;  3F7S A;  1DMN A;  1M90 4;  2QIY A;  2CG1 A;  1YIJ 3;  4KFD A;  1QMA A;  1R4C A;  1Y4K A;  2WOH A;  3NV0 B;  3G71 3;  1O7M B;  2STD A;  3FF2 A;  2L4V A;  3RGR A;  2C11 A;  1UUW B;  3GZR A;  5IEP A;  4HM2 B;  1EQK A;  4WYK B;  1YHQ 3;  2CFD A;  3CCU 3;  3DMC A;  2OTJ 3;  3FGY A;  4XDV A;  3S29 A;  4EV2 A;  3LZA A;  5A0O B;  4HM5 B;  4FCM A;  3NM7 A;  3MWZ A;  3X41 A;  3LH4 A;  4HVN A;  4KFE A;  3EC9 A;  1UI7 A;  3G8Z A;  2YX9 A;  3H3H A;  4K61 A;  3V92 A;  2XH9 A;  1WNH A;  5HGR A;  1TFK A;  5ELU A;  1OHS A;  3WOF B;  3OXA A;  3X3X A;  3EX9 A;  3DY5 A;  1W02 A;  2CWT A;  3SVA A;  4L7K A;  3PS8 A;  4I4K A;  1ULJ B;  4R9K A;  4CDL A;  3U1W A;  3OWY A;  2GU1 A;  1Q40 A;  5LC6 A;  4MMY B;  3SOA A;  1DYU A;  1A67 A;  2YFI B;  3MSO A;  2XEP A;  1RJO A;  5JPP A;  1JKG A;  3G0K A;  2D1W A;  4MJD A;  1IQX A;  2W2C A;  1L5G B;  1WQL B;  1DMQ A;  1SJW A;  3MPH A;  1Q82 4;  3FG3 A;  4N6L A;  2Z6B A;  3PCR A;  2WGQ A;  2JDI H;  4KFF A;  4RNY A;  1OF5 A;  1OGX A;  5BVB A;  1GS3 A;  2W04 A;  3HIG A;  3CPO A;  2CK3 H;  4X2H A;  3NX0 A;  5D81 A;  1YIT 3;  2CWU A;  2OOV C;  2Y74 A;  1VQ6 3;  3OV4 A;  4O8S A;  4HKV B;  1Q86 4;  1G96 A;  1YGE A;  1M1X B;  2GBW B;  1CYU A;  3EN8 A;  3BNE A;  4HJL B;  1IK3 A;  2QA4 3;  4U13 A;  1IQY A;  3HZP A;  4XM4 A;  5EVH A;  3WOD G;  1T5Y A;  3CPW 2;  3MG1 A;  1LVN A;  2WOF A;  2CKF B;  4J8T A;  4N6N B;  5IG4 A;  2R4I A;  1FGT A;  3HX8 A;  4FMD A;  4IT7 A;  5BXQ A;  1OGZ A;  1JB5 A;  1ULI B;  2O3O A;  5STD A;  3A76 A;  1O7G B;  4HM6 B;  5JPU A;  1OCV A;  3CC7 3;  5DRV A;  3EE1 A;  3DM8 A;  1E3V A;  1RRH A;  1W00 A;  2K0M A;  5CK6 A;  2LYX A;  4O02 B;  1KWI A;  1VQ5 3;  1NO3 A;  4FR9 A;  3GZX B;  5AIG A;  1IVW A;  2E2T A;  4J9A A;  1WTH A;  1IDP A;  1SII A;  2P05 A;  3KSE D;  1YJW 3;  1CQS A;  5CF2 A;  4HYZ A;  3MKI A;  5IG3 A;  1D6Y A;  4LSO A;  2PZV A;  3ER7 A;  5EQL A;  1KC8 4;  1N9J A;  5ELJ A;  1LNH A;  3T0U A;  1RRL A;  3UB1 A;  1SIH A;  1MOL A;  3PCS A;  2GEY A;  4OK0 A;  3TDG A;  3NXJ A;  1A2V A;  1IV9 A;  1WMO A;  3K5T A;  1UUV B;  1YJ9 3;  4WWU C;  3SX1 A;  3D3L A;  1WMP A;  3B8L A;  3EN1 B;  4CCV A;  2OTL 3;  2MF7 A;  1O7H B;  3X40 A;  2A15 A;  2XRX B;  1J2B A;  3CC2 3;  4EV5 A;  4WHA A;  3HK4 A;  1GD3 A;  1TP6 A;  3FZW A;  5D83 A;  2ZL8 A;  4HBR A;  5KP1 A;  5IW9 A;  2Z7A A;  3F14 A;  5D82 A;  2SBL A;  3CCJ 3;  3IPT A;  3CC4 3;  3FG4 A;  2MC8 A;  1DMM A;  1YI2 3;  4OUQ A;  4O3V A;  3CD6 3;  3I55 3;  2OOV A;  1FGM A;  1OH0 A;  1GY6 A;  1NDO B;  3VGN A;  3LT8 A;  3X3Y A;  2E2V A;  3DUK A;  4XBX A;  4NHF A;  3BNC A;  3Q2P A;  4EBG A;  3DGL A;  1STD A;  1JN5 B;  1F8N A;  3AMO B;  3NQY A;  5G2G A;  2F99 A;  2BT3 A;  1FA3 A;  2W0Q A;  4RBN A;  1K41 A;  4R4K A;  1RKY A;  3LTB A;  2Q07 A;  3DZL A;  2FNQ A;  2Y73 A;  1IVU A;  3LTC A;  3EB8 A;  4X2O A;  3EF8 A;  4XDW A;  4FMA A;  3PXM A;  2ML5 A;  2OQE C;  2IA7 A;  4AKY A;  3I56 3;  3FLJ A;  2FGT A;  5IER A;  5IG5 A;  3S67 A;  1FGO A;  2CIU A;  3ROB A;  1ISK A;  8CHO A;  1NWW A;  3LML A;  2HMM B;  1QAL A;  3FSD A;  3B4O A;  1IT7 A;  5AYS C;  3B4P A;  2XFT A;  3G4S 3;  3MYT A;  1K73 4;  1TU5 A;  5DRE A;  1O7P B;  5AEU B;  3OW2 2;  2CFL A;  2P0M A;  1K8A 4;  1QAF A;  3EBY A;  3X3Z A;  3GZB A;  1WMN A;  4IIA A;  3CCR 3;  1JB4 A;  4L8O A;  1FGR A;  1W2Z A;  3NUV A;  2IUK A;  1AR0 A;  3SXX A;  4BTY A;  4HM3 B;  1U5O A;  1VQO 3;  4EC6 A;  2I9W A;  4Q53 A;  3DGO A;  1K28 A;  4KVH A;  1MNL A;  3IMA B;  1RN7 A;  2WO0 A;  4R80 A;  3KSP A;  3RDE A;  3OWS A;  1UI8 A;  3EQQ B;  3F8X A;  4PEJ A;  3K7C A;  1BUQ A;  1VQK 3;  5CXO A;  1ASK A;  3NV0 A;  4QWT A;  2RSX A;  4MMX B;  1JRQ A;  3SED A;  1JV2 B;  3RGA A;  1JNQ A;  3UNL A;  3WMD A;  3CME 3;  2P0X A;  4K1U A;  4WYK A;  3F9S A;  1FUW A;  4O2H A;  4AKZ A;  3S28 A;  3GAX A;  3AMO A;  1FGQ A;  5TGN A;  1VQ9 3;  1ROA A;  1STF I;  3M8C A;  4K90 B;  3STD A;  5KP4 A;  2B1X B;  2HMJ B;  3JUO A;  1S72 3;  5CLK A;  2YFL B;  3BLZ A;  3ALA A;  3JVC A;  2V1L A;  3QK9 A;  1IVV A;  3D9R A;  2CH9 A;  2PNC A;  3F8H A;  1EA2 A;  4HM8 B;  4N6V 0;  2RGQ A;  2CHC A;  3CCQ 3;  5AYR B;  2B24 B;  2P09 A;  3SOY A;  3NQZ A;  3CCM 3;  3O8Y A;  4MMZ B;  2P38 A;  3UL6 A;  5IG0 A;  1E3R A;  2UX0 A;  3DXO A;  1AVL A;  1AV4 A;  2Z76 A;  2F98 A;  1NB5 I;  1OHP A;  3JUQ A;  2GEX A;  1OAC A;  5AIH A;  4LEH A;  3K0Z A;  3L0R A;  4BTW A;  1KQS 2;  1M9G A;  3CNM A;  1OPY A;  2XFS A;  3MHE A;  3VSY A;  3N9H A;  3H51 A;  1PU4 A;  1VQP 3;  4N6M A;  3GZY B;  4BTX A;  1W01 A;  1W6Y A;  1SQW A;  3DGN A;  3EBT A;  3UL5 A;  1NJI 4;  1D6U A;  1VQ8 3;  3WDG B;  3FH1 A;  3JUN A;  3S27 A;  3QRD A;  2XSO B;  4K1V A;  1AVK A;  4H3U A;  3K9M C;  1N9E A;  1HKX A;  3BND A;  2INX A;  1Q40 B;  1TUH A;  2BO9 B;  3CCV 3;  3KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...