2F86B

The association domain of c. elegans camkii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
NDSEKAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFDGNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein K11E8.1d
publication title Oligomerization states of the association domain and the holoenyzme of Ca2+/CaM kinase II.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 36
structure length 129
sequence length 129
chains with identical sequence D, F, H, J, L, N
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f86B00
1OF5A 4CDLA 3FF2A 3LYGA 4XBTA 2XSHB 3EN8A 2UX0A 3G16A 3B4OA 2QIYA 1OPYA 5AEUB 3NM2A 4HM0B 1EA2A 3A76A 1CQSA 3H51A 2QGUA 3KKGA 5IENA 1Q42A 5HGRA 4IIAA 5TGNA 1DMMA 1O7PB 2GBXB 2YFLB 3DUKA 1BUQA 3JUPA 3DXOA 5BVBA 4WYKA 2F99A 3FH1A 4XDVA 5IF6A 3FGYA 2HMMB 5DREA 1O7HB 3EQQB 2BMOB 4H3UA 3UNLA 3NUVA 5CK6A 4PEJA 2XSOB 1A2KA 1GY5A 5D81A 2IMJA 4XBXA 3OWUA 5KP1A 3FSDA 1E3RA 4R9LA 1JKGA 4KVHA 1GS3A 3NXJA 3GZXB 3D9RA 5FW5A 5CLKA 5KP3A 3GWRA 4L8PA 3K0ZA 1ZX2A 1Z1SA 1HKXA 3F8HA 1NDOB 3KZTA 1UUWB 5AIIA 4LMIA 4L8OA 3EBYA 4MJDA 3F40A 1OH0A 3K7CA 3EC9A 5AIGA 1IDPA 1NU3A 1DMNA 2W2CA 3OWSA 1ASKA 5KP4A 4HM6B 3LZAA 1JB2A 3F7XA 3EJVA 3OX9A 2YFIB 1S5AA 3EHCA 4XM4A 3BLZA 1OHSA 3UJMA 3SOAA 3NHXA 3G8ZA 3HZPA 1OHOA 5AEWB 3GZRA 2BMRB 4J8TA 4R9KA 1ULJB 1K41A 3SOYA 3ECFA 3H3HA 3OXAA 5IG5A 5AIHA 4K1VA 4HM8B 3HK4A 3F14A 3OV4A 3MG1A 3B7CA 4WYKB 5G2GA 5D82A 5JPPA 4GB5A 1DMQA 3MSOA 2CKFB 4OUQA 1EG9B 4R1KA 2YFJB 3HX8A 3VGNA 3JUQA 3ROBA 6STDA 4OVMA 5AI1A 1GY7A 3SEDA 2Z77A 4U13A 5STDA 3B4PA 2GEXA 1JKGB 2I9WA 3DM8A 1O7MB 3ER7A 3EN1B 1W01A 5CXOA 1OGXA 2GBWB 1W6YA 8CHOA 5CF1A 3F8XA 1ZO2A 1ISKA 3NV0A 3MKIA 3CNMA 1E97A 2A15A 2OWPA 4X2OA 3S5CA 1UUVB 2B1XB 1E3VA 2INXA 5IERA 3MYTA 4LEHA 2HMNB 2R4IA 1Q40A 2RFRA 5D83A 5JPUA 3CU3A 1O7WB 3EF8A 5IG3A 1QMAA 3JUNA 5IG4A 4FCJA 3FKAA 4HVNA 1SJWA 4FCMA 3FLJA 4HM1B 3EBTA 2XR8B 1W02A 3GZBA 1JN5A 5IEOA 4WWUC 2Z7AA 3RGAA 1W00A 2RGQA 4XBYA 3E99A 1AR0A 2STDA 4HKVB 3IPTA 3OWYA 3EX9A 7STDA 3MG3A 5IEPA 4HM3B 5DRVA 3F9SA 1C7HA 2CHCA 4STDA 5CF2A 3WMDA 1U5OA 3RGRA 3STDA 4HM7B 4I4KA 1STDA 4XB5A 3FZWA 4Q53A 4HJLB 3JUMA 4L7KA 1WQLB 2HMLB 3MG2A 2B24B 1OCVA 1JB4A 4K1UA 5IG0A 3DZLA 3GZYB 4WP5A 3T8NA 3NV0B 3KSPA 4HZBB 3T8UA 3I0YA 1GY6A 4HZ9B 1JB5A 3Q90A 4J9AA 1GYBA 4HM4B 1Q40B 2F86B 4RZMA 3CNXA 4HM2B 5AIFA 3MHEA 3NBRA 2JQ5A 3CPOA 3M8CA 2Z76A 2PZVA 4LGQA 3VSYA 1OUNA 5EVHA 2HMKB 2GXFA 2HMOB 1VZZA 2HMJB 4XDWA 1JN5B 2BMQB 4HM5B 1TP6A 3GRDA 2K54A 4ORLA 1ULIB 3G0KA 1OHPA 3FF0A 5BXQA 2XRXB 3DMCA 1TUHA 4X2HA 1O7GB 3BB9A 1OGZA 3KE7A 2RCDA 1O7NB 3JUOA 1OF5B 2BNGA 4N3VA 2GEYA 3F7SA 2F98A 1QJGA 3B8LA 1NWWA
chains in the Genus database with same CATH superfamily
1OF5A 4CDLA 4R80A 3FF2A 4FR9A 3LYGA 1RGHA 3KIIA 4O8SA 1CEWI 4RNYA 4XBTA 2LYXA 4CCVA 2XSHB 3EN8A 5G1LA 2UX0A 3NBJA 3G16A 3BNDA 2XF3A 3HOHA 3B4OA 2QIYA 1OPYA 5AEUB 3NM2A 4HM0B 1IVWA 3X41A 2D42A 1EA2A 1UI7A 1X1XA 2XFSA 3NQZA 3MPHA 1X1WA 3S28A 3X42A 4BL3A 3A76A 1YI23 1G96A 3MWZA 4RNTA 5GSPA 4KFDA 1CQSA 1QAKA 2W0QA 3BNBA 3H51A 4J5KA 4MMZB 1YIJ3 1RGEA 1KD14 2QGUA 2FXTA 1R4CA 3KKGA 1BANA 2E2UA 5IENA 3CC73 1Q42A 1K8A4 4N6UA 1BUJA 1TFOA 2XFTA 5HGRA 1DYUA 3PXMA 2QEX3 1T3BA 4IIAA 1FGQA 2L1SA 5TGNA 2KAAA 3GSPA 4EC6A 1DMMA 1O7PB 2CFWA 1UCLA 2GBXB 1VQ53 1BU4A 3N9HA 2YFLB 3DUKA 5EEOA 3G4S3 3DGNA 1SIIA 3I563 4JF8A 1BUQA 3JUPA 2H0HA 3DXOA 1BSAA 3S27A 4WYKA 4CJNA 2F99A 5BVBA 1EKMA 2K0MA 1MWSA 3FH1A 4KFEA 1QVG2 4N6MA 3HIIA 4XDVA 3FGYA 5IF6A 3I553 1JBTA 3NM7A 1RMSA 2HMMB 5DREA 3BNEA 1O7HB 2L4VA 1W6GA 3EQQB 1GOYA 2BMOB 3LOYA 3KN4A 4H3UA 3UNLA 3WOFB 1B27A 1GD4A 3NUVA 5CK6A 3AHSA 2F4YA 4PEJA 2XSOB 4WHAA 1A2KA 2YX9A 4JRFA 4DKIA 1R4YA 1GY5A 3SVAA 4K61A 4FMCA 3Q3FA 2R41A 4BTXA 3D79A 1DETA 1LXEA 2CWUA 4MEIA 1IQYA 5IW9A 1FGRA 1ZS7A 1IVXA 5D81A 1IK3A 2IMJA 3CCV3 1B20A 1IYYA 4XBXA 3OWUA 4N6LA 1VQL3 5ELUA 5KP1A 2OTL3 3FSDA 2IUJA 1E3RA 1BOXA 4R9LA 2Q07A 1JKGA 3X3XA 1I8VA 2OTJ3 2MF7A 1GS3A 3IJEB 3NXJA 1G0TA 3GZXB 4KVHA 3D9RA 1M904 5FW5A 1B2SA 1TIJA 5CLKA 5KP3A 3GWRA 4GHOA 4L8PA 3CC43 1SARA 1TRPA 3K0ZA 1ZX2A 9RNTA 1BNFA 1Z1SA 4O02B 1RN7A 6GSPA 1HKXA 1SQWA 3WHOA 3F8HA 1RGAA 1NDOB 1Q7Y4 1IVVA 1UUWB 3KZTA 1JRQA 3S67A 2ZHXB 5AIIA 4LMIA 1PYLA 3VF1A 4L8OA 1M1XB 1BNJA 1FYSA 1V58A 3EBYA 3FCSB 4FCZA 2OQEC 4MJDA 3CMA3 4TX4A 3F40A 1VQ83 1OH0A 2IA7A 3K7CA 2F5MA 3EC9A 4MMYB 5RNTA 5AIGA 1IDPA 1NU3A 3PYJA 3D5GA 3LTDA 1DMNA 2W2CA 3OWSA 1JNQA 1ASKA 3X40A 4HM6B 3LZAA 5KP4A 4O3VA 1JB2A 1A2VA 1RGGA 1KQS2 3F7XA 1AY7A 4HYZA 3DGLA 2GU1A 1FGMA 2ZA4A 3EJVA 2CFKA 2H0GA 2W56B 3WDGB 3PCSA 1C54A 3OX9A 1EEJA 3PGBA 2JDIH 1RGLA 2YFIB 3SX1A 3DGYA 1S5AA 2J8XB 3EHCA 3NX0A 1IQ8A 1RDSA 2BIRA 4XM4A 1VQ73 4G1MB 1GD3A 1BIRA 3BLZA 3LXUX 1BRKA 3X3ZA 3TDGA 1OHSA 3UJMA 3SOAA 3BU4A 3A5EA 2ML5A 3NHXA 2CFGA 2W9QA 2BHMA 3G8ZA 3HZPA 1KC84 1OHOA 2P09A 3KCHA 1K28A 2OCTA 1IQXA 2BT3A 1PY3A 2CWVA 2LQVA 1V74A 4KT3B 4OK0A 2CFLA 1B2ZA 4CPKA 1YJN3 1MGRA 1RLSA 1JV2B 4GL6A 5AEWB 3GZRA 7RNTA 1N9EA 2BMRB 1OACA 4J8TA 3KSED 3S29A 3ALAA 4EW5A 1UDII 3CME3 4R9KA 1ULJB 1K41A 1YVBI 7GSPA 1Y4KA 1U8CB 3SOYA 1LQMB 2D1WA 3ECFA 3H3HA 3OXAA 4FMDA 1NB5I 1QALA 4EBGA 1FUTA 4J5GA 5IG5A 3O8YA 1TU5A 3D5IA 5AIHA 1BNIA 1FA3A 1RJOA 4K1VA 4HM8B 1BRHA 3HK4A 1VQK3 1KWIA 3F14A 1DVDA 1MWTA 1FZUA 3OV4A 3G713 3MG1A 2CC3A 1CYVA 3B7CA 5EQLA 1FGTA 1TRQA 1VQN3 3WOEB 4WYKB 2SARA 1N9JA 1RN4A 3AGNA 5G2GA 5D82A 5JPPA 4GB5A 4LSOA 1I3IA 5AYSC 1DMQA 6RNTA 2KF6A 1AVKA 2CFDA 2P38A 2CKFB 2WOFA 3MSOA 4OUQA 3WODG 1BGSA 2CG1A 1EG9B 2CW9A 1B3SA 4R1KA 1UGIA 1W2ZA 2YFJB 3HX8A 2WGOA 2IY2A 1RHLA 1IT7A 2KF5A 3VGNA 3JUQA 3ROBA 3X3YA 1L5GB 1I0VA 6STDA 1HU9A 2WGQA 3DGOA 2UUGC 4OVMA 5AI1A 1GY7A 4FMAA 3BNCA 3SEDA 2Z77A 2HOHA 1BNSA 1LOVA 3NQYA 4U13A 5STDA 1I3FA 3KFQC 2SBLA 1A2PA 1WNHA 3B4PA 2GEXA 1JKGB 3RDEA 1W6CA 3D3LA 2M7OA 2I9WA 3DM8A 1BRIA 1O7MB 3ER7A 1V57A 5M18A 3EN1B 1W01A 1T2IA 1S723 5CXOA 1OGXA 1I2GA 2GBWB 5AYRB 1Q9EA 1BSEA 2CIUA 3V98A 4EYCA 4N6TA 3AMOA 1W6YA 1VQP3 3HIGA 3CCQ3 3N8BA 2IYJA 8CHOA 3SYUA 5CF1A 1QVF2 2KCDA 2FNQA 3F8XA 4H61A 1I2EA 3AGOA 1ZO2A 1UUGB 1VQ93 2XGNA 3V92A 1ISKA 1BNRA 3L0RA 3WA3A 3NV0A 3T0UA 3MKIA 1GOVA 3RNTA 1M9GA 4LYLB 4AKYA 1W4NA 3CNMA 3LMLA 1WMNA 1E97A 1UCKA 1RCLA 3CCS3 4RNZA 2A15A 1W7CA 2OWPA 4X2OA 3S5CA 1UGHI 4EXRA 1UUVB 2B1XB 1PU4A 1E3VA 2XGLA 2INXA 2F5WA 1YHQ3 2XH9A 4ILFA 3LTAA 1M1K4 1N5PA 5IERA 3MYTA 1WMOA 1LQGC 2OOVA 1SIHA 4LEHA 3PZWA 4N6NB 2HMNB 3CD63 3K5TA 2R4IA 1Q40A 2RFRA 5D83A 5LC7A 5JPUA 1X1YA 1BRSA 8RNTA 1UCJA 4ZM8A 1ZGXA 4NPBA 4EV5A 3CU3A 1O7WB 2GU3A 1AQZA 3WR2A 3EF8A 5IG3A 1YIT3 2RSXA 1BRJA 3QRDA 5ELJA 1B21A 1QMAA 3JUNA 1STFI 4GSPA 4QWTA 3ZFZA 5IG4A 3CCM3 2BO9B 2IUKA 4FCJA 1B2MA 3FKAA 5JBSA 1PFPA 5M19A 1LVNA 4HVNA 1YNVX 1W5ZA 1SJWA 1IV9A 3N54B 2P0XA 1NNVA 2PNCA 4FCMA 1BSDA 3FLJA 3SXXA 1MWUA 4HM1B 2AADA 3EBTA 1YGEA 2XR8B 1DE3A 1N8QA 1W02A 3GZBA 1JN5A 4HOHA 5IEOA 4WWUC 2Z7AA 3EE1A 2XEPA 1N8R4 3D4AA 1K9M4 3RGAA 1W00A 2RGQA 1FW7A 4XBYA 1YJ93 1B2XA 1D6YA 2P05A 1RRLA 4AKZA 1Q864 2CX0A 3E99A 4N6OB 2CG0A 2CX1A 3J7Yd 2KF4A 3LH4A 2CWTA 4K90B 1AR0A 3FG3A 1VQO3 2W6JH 3CCU3 3NBBA 1NB3I 2STDA 4HKVB 3IPTA 1BRGA 3OWYA 3PS8A 4BTWA 3EX9A 7STDA 1RGFA 3MG3A 3CCJ3 3EB8A 3CCE3 1I70A 2W03A 3HI7A 3CXC2 1TFKA 5IEPA 1HYFA 1I2FA 4HM3B 5DRVA 1A90A 3F9SA 1C7HA 1RGCA 2CHCA 4STDA 1T5YA 2E2VA 1VQQA 5CF2A 3WMDA 1U5OA 3RGRA 4KZ1A 3IMAB 4HAAA 2Y73A 1FUWA 2C4BA 2WO0A 4BTYA 3SLUA 5LC6A 2QA43 2UGIA 3STDA 1LNHA 4HBRA 1GOUA 2RNTA 1RNBA 4KFFA 1A67A 4HM7B 4I4KA 1GMPA 1GMRA 4RBNA 4AEQA 1MWRA 1STDA 1BVIA 2C10A 4MMXB 4XB5A 3FZWA 4Q53A 4HJLB 1AV4A 3JUMA 3LT8A 1CYUA 1RNTA 5I97A 4L7KA 1WQLB 1JZDA 1N5HA 2HMLB 2KXGA 3JVCA 1RRHA 3MG2A 5A0OB 1WTHA 1J2BA 2B24B 1VQ63 5FGOA 3AHWA 1OCVA 1IT8A 1X1UA 1NO3A 1UI8A 1JB4A 4K1UA 5G1KA 5IG0A 1SPUA 1LNIA 5M1AA 3URPA 3CC23 1RSNA 3DZLA 3QK9A 3U1WA 3WA2X 3AMOB 1IVUA 3LT9A 1VQM3 1KSIA 1RN1A 1DVCA 2O9UX 3GZYB 4WP5A 3T8NA 2Y74A 1RKYA 1LRAA 1MNLA 2FGTA 2K3DA 3NV0B 2C11A 3GAXA 1LOWA 1FUSA 2ML6A 3KSPA 4HZBB 3T8UA 1LOXA 3UL6A 1BNEA 3U97A 2P0MA 2H0IA 1B2UA 1F8NA 3I0YA 1GY6A 4HZ9B 4BL2A 2KF3A 5BIRA 1IU7A 1RTUA 3DH2A 3K9MC 1JB5A 3Q90A 4J9AA 1GYBA 1EQKA 2F56A 4HM4B 5HOHA 1Q40B 2F86B 4RZMA 3CCL3 3CNXA 4HM2B 5AIFA 3FG1A 3MHEA 4BU4A 3UB1A 3NBRA 2JQ5A 3CPOA 3LTBA 1BAOA 2OQEA 1JBSA 3M8CA 4BIRA 1MGWA 2Z76A 2PZVA 3DY5A 4R4KA 4LGQA 2GSPA 3VSYA 1OUNA 1BSBA 1G02A 4IT7A 5EVHA 2HMKB 1I0XA 3CCR3 2GXFA 1Q814 3Q1CA 1VQ43 5BU4A 1GSPA 1T2HA 2CH9A 1D6ZA 4FMBA 1GMQA 1FGOA 1US1A 1JZOA 3Q2PA 2KRTA 1BRNL 2AAEA 2HMOB 2OOVC 3BIRA 1HZ1A 1VZZA 1YVSA 2BU4A 4EV2A 2W04A 3FG4A 2HMJB 4XDWA 3CPW2 1BNGA 1JBRA 1TTOA 1ROVA 1JN5B 1Q7HA 3DGMA 2BMQB 2E2TA 4HM5B 1YGWA 4N6V0 2ZL8A 3ZG5A 2ZDJA 2RBIA 1TP6A 2Z6BA 3K63A 3GRDA 2K54A 1W2B2 2W9PA 1RGKA 1D6UA 1AVLA 3G6E3 1TJDA 4NREA 4ORLA 1QAFA 1ULIB 1IV7A 2WOHA 3G0KA 1OHPA 3FF0A 4O2HA 5BXQA 1K734 1YJW3 1JJ22 1CH0A 2XRXB 3DMCA 1TUHA 4I5QA 4LZIA 1MOLA 1O7GB 4X2HA 3BB9A 2MC8A 1UCIA 1RCKA 3PCRA 1OGZA 3KE7A 2RCDA 4NHFA 4WFOA 3V99A 1NJI4 1ROAA 4IPBA 1O7NB 2CK3H 3JUOA 1Q824 1BSCA 2V1LA 1OF5B 1EUIC 2BNGA 2W56A 4N3VA 3OW22 3ZG0A 1UW1A 1LOYA 2GEYA 3UL5A 3F7SA 2F98A 1QJGA 3B8LA 1WMPA 2O3OA 3LTCA 1NWWA
chains in the Genus database with same CATH topology
1OF5A 4CDLA 4R80A 3FF2A 4FR9A 3LYGA 3KIIA 4O8SA 4CCVA 1CEWI 4RNYA 4XBTA 2LYXA 2XSHB 3EN8A 2UX0A 3NBJA 3G16A 3BNDA 2XF3A 3B4OA 2QIYA 1OPYA 5AEUB 3NM2A 4HM0B 1IVWA 3X41A 2D42A 1EA2A 1UI7A 2XFSA 3NQZA 3MPHA 3X42A 3S28A 1YI23 3A76A 1G96A 3MWZA 4KFDA 1CQSA 1QAKA 2W0QA 3BNBA 3H51A 4MMZB 1YIJ3 1KD14 2QGUA 2FXTA 1R4CA 3KKGA 5IENA 2E2UA 3CC73 1Q42A 1K8A4 4N6UA 1TFOA 2XFTA 5HGRA 1DYUA 3PXMA 2QEX3 4IIAA 1FGQA 5TGNA 4EC6A 1DMMA 1O7PB 2CFWA 2GBXB 1VQ53 3N9HA 2YFLB 3DUKA 5EEOA 3G4S3 3DGNA 1SIIA 3I563 4JF8A 1BUQA 3JUPA 3DXOA 3S27A 5BVBA 4WYKA 2F99A 1EKMA 2K0MA 3FH1A 4KFEA 1QVG2 4N6MA 3HIIA 4XDVA 3FGYA 5IF6A 3I553 3NM7A 2HMMB 5DREA 3BNEA 1O7HB 2L4VA 1W6GA 3EQQB 3LOYA 2BMOB 3KN4A 4H3UA 3UNLA 3WOFB 1GD4A 3NUVA 5CK6A 4PEJA 2XSOB 4WHAA 1A2KA 2YX9A 4JRFA 1GY5A 3SVAA 4K61A 4FMCA 4BTXA 2CWUA 1LXEA 4MEIA 1IQYA 5IW9A 1FGRA 1IVXA 5D81A 1IK3A 2IMJA 3CCV3 4XBXA 3OWUA 4N6LA 1VQL3 5ELUA 5KP1A 2OTL3 3FSDA 2IUJA 1E3RA 4R9LA 3X3XA 2Q07A 1JKGA 2OTJ3 2MF7A 1GS3A 3IJEB 3NXJA 3GZXB 4KVHA 3D9RA 1M904 5FW5A 1TIJA 5CLKA 5KP3A 3GWRA 4L8PA 3CC43 3K0ZA 1ZX2A 1Z1SA 4O02B 1RN7A 1HKXA 1SQWA 3F8HA 1NDOB 1Q7Y4 1IVVA 1UUWB 3KZTA 1JRQA 3S67A 5AIIA 4LMIA 3VF1A 4L8OA 1M1XB 3FCSB 3EBYA 4FCZA 2OQEC 4MJDA 3CMA3 4TX4A 3F40A 1VQ83 1OH0A 2IA7A 3K7CA 4MMYB 3EC9A 5AIGA 1IDPA 1NU3A 3PYJA 3LTDA 1DMNA 2W2CA 3OWSA 1JNQA 1ASKA 3X40A 4HM6B 3LZAA 5KP4A 4O3VA 1JB2A 1A2VA 1KQS2 3F7XA 4HYZA 3DGLA 2GU1A 1FGMA 3EJVA 2CFKA 2W56B 3WDGB 3PCSA 3OX9A 3PGBA 2JDIH 2YFIB 3SX1A 1S5AA 3EHCA 3NX0A 1IQ8A 4XM4A 1VQ73 4G1MB 1GD3A 3BLZA 3LXUX 3X3ZA 3TDGA 1OHSA 3UJMA 3SOAA 3NHXA 2ML5A 2CFGA 2W9QA 2BHMA 3G8ZA 3HZPA 1KC84 1OHOA 2P09A 1K28A 2OCTA 1IQXA 2BT3A 2CWVA 2LQVA 1V74A 1YJN3 4OK0A 2CFLA 1JV2B 4GL6A 5AEWB 3GZRA 1N9EA 2BMRB 1OACA 4J8TA 3KSED 3S29A 3ALAA 3CME3 4R9KA 1ULJB 1K41A 1YVBI 1Y4KA 1U8CB 3SOYA 2D1WA 3ECFA 3H3HA 3OXAA 4FMDA 1NB5I 1QALA 4EBGA 5IG5A 3O8YA 1TU5A 5AIHA 1FA3A 1RJOA 4K1VA 4HM8B 1VQK3 3HK4A 1DVDA 1KWIA 3F14A 3OV4A 3G713 3MG1A 2CC3A 1CYVA 3B7CA 5EQLA 1FGTA 1VQN3 3WOEB 4WYKB 1N9JA 5G2GA 5D82A 5JPPA 4GB5A 4LSOA 5AYSC 1DMQA 2P38A 2WOFA 1AVKA 2CFDA 2CKFB 3MSOA 4OUQA 3WODG 2CG1A 1EG9B 2CW9A 4R1KA 1W2ZA 2YFJB 3HX8A 2WGOA 1IT7A 3VGNA 3JUQA 3ROBA 3X3YA 1L5GB 6STDA 1HU9A 2WGQA 3DGOA 4OVMA 5AI1A 1GY7A 4FMAA 3BNCA 3SEDA 2Z77A 3NQYA 4U13A 5STDA 3KFQC 2SBLA 1WNHA 3B4PA 2GEXA 1JKGB 3RDEA 1W6CA 3D3LA 2M7OA 2I9WA 3DM8A 1O7MB 3ER7A 3EN1B 1W01A 1S723 5CXOA 1OGXA 2GBWB 5AYRB 4EYCA 2CIUA 3V98A 4N6TA 3AMOA 1W6YA 1VQP3 3HIGA 3CCQ3 3N8BA 8CHOA 5CF1A 1QVF2 2KCDA 2FNQA 3F8XA 4H61A 1ZO2A 1VQ93 2XGNA 3V92A 1ISKA 3L0RA 3WA3A 3NV0A 3T0UA 3MKIA 1M9GA 4AKYA 1W4NA 3CNMA 3LMLA 1WMNA 1E97A 3CCS3 4RNZA 2A15A 1W7CA 2OWPA 4X2OA 3S5CA 4EXRA 1UUVB 2B1XB 1PU4A 1E3VA 2XGLA 2INXA 1YHQ3 2XH9A 1M1K4 3LTAA 1N5PA 5IERA 3MYTA 1WMOA 2OOVA 1SIHA 4LEHA 3PZWA 4N6NB 2HMNB 3CD63 3K5TA 2R4IA 1Q40A 2RFRA 5D83A 5LC7A 5JPUA 4ZM8A 4EV5A 3CU3A 1O7WB 2GU3A 3EF8A 5IG3A 1YIT3 2RSXA 5ELJA 3QRDA 1QMAA 3JUNA 1STFI 4QWTA 5IG4A 3CCM3 2BO9B 2IUKA 4FCJA 3FKAA 5JBSA 1PFPA 1LVNA 4HVNA 1W5ZA 1SJWA 1IV9A 3N54B 2P0XA 2PNCA 4FCMA 3FLJA 3SXXA 4HM1B 3EBTA 1YGEA 2XR8B 1N8QA 1W02A 3GZBA 1JN5A 5IEOA 4WWUC 2Z7AA 3EE1A 2XEPA 1N8R4 1K9M4 3RGAA 1W00A 2RGQA 4XBYA 1YJ93 1D6YA 2P05A 1RRLA 4AKZA 1Q864 4N6OB 3E99A 2CG0A 3J7Yd 3LH4A 2CWTA 4K90B 1AR0A 3FG3A 1VQO3 2W6JH 3CCU3 3NBBA 1NB3I 2STDA 4HKVB 3IPTA 3OWYA 3PS8A 4BTWA 3EX9A 7STDA 3MG3A 3CCJ3 3EB8A 3CCE3 3HI7A 2W03A 3CXC2 1TFKA 5IEPA 4HM3B 5DRVA 1A90A 3F9SA 1C7HA 2CHCA 4STDA 1T5YA 2E2VA 5CF2A 3WMDA 1U5OA 3RGRA 4KZ1A 3IMAB 2Y73A 1FUWA 2WO0A 4BTYA 3SLUA 5LC6A 2QA43 3STDA 1LNHA 4HBRA 4KFFA 1A67A 4HM7B 4I4KA 4RBNA 4AEQA 1STDA 2C10A 4MMXB 4XB5A 3FZWA 4Q53A 4HJLB 1AV4A 3JUMA 3LT8A 1CYUA 5I97A 4L7KA 1WQLB 1N5HA 2HMLB 2KXGA 3JVCA 5A0OB 1RRHA 3MG2A 1WTHA 1J2BA 2B24B 1VQ63 5FGOA 1OCVA 1IT8A 1NO3A 1UI8A 1JB4A 4K1UA 5IG0A 1SPUA 3CC23 3DZLA 3QK9A 3U1WA 3WA2X 3AMOB 1IVUA 3LT9A 1VQM3 1KSIA 1DVCA 2O9UX 3GZYB 4WP5A 3T8NA 2Y74A 1RKYA 1MNLA 2FGTA 3NV0B 2C11A 3GAXA 2ML6A 3KSPA 4HZBB 3T8UA 1LOXA 3UL6A 3U97A 2P0MA 1F8NA 3I0YA 1GY6A 4HZ9B 1IU7A 3K9MC 1JB5A 3Q90A 4J9AA 1GYBA 1EQKA 4HM4B 1Q40B 2F86B 4RZMA 3CCL3 3CNXA 4HM2B 5AIFA 3FG1A 3MHEA 3UB1A 3NBRA 2JQ5A 3CPOA 3LTBA 2OQEA 3M8CA 2Z76A 2PZVA 3DY5A 4R4KA 4LGQA 3VSYA 1OUNA 4IT7A 5EVHA 2HMKB 3CCR3 2GXFA 1Q814 3Q1CA 1VQ43 2CH9A 1D6ZA 4FMBA 1FGOA 1US1A 3Q2PA 2KRTA 2HMOB 2OOVC 1VZZA 4EV2A 2W04A 3FG4A 2HMJB 4XDWA 3CPW2 1ROVA 1JN5B 3DGMA 2BMQB 2E2TA 4HM5B 4N6V0 2ZL8A 2ZDJA 2Z6BA 1TP6A 1W2B2 3K63A 3GRDA 2K54A 2W9PA 1D6UA 1AVLA 3G6E3 4NREA 4ORLA 1QAFA 1ULIB 1IV7A 2WOHA 3G0KA 1OHPA 3FF0A 4O2HA 5BXQA 1K734 1YJW3 1JJ22 2XRXB 3DMCA 1TUHA 4X2HA 4LZIA 1MOLA 1O7GB 3BB9A 2MC8A 3PCRA 1OGZA 3KE7A 2RCDA 4NHFA 4WFOA 3V99A 1NJI4 1ROAA 4IPBA 1O7NB 2CK3H 3JUOA 1Q824 2V1LA 1OF5B 2BNGA 2W56A 4N3VA 3OW22 1UW1A 2GEYA 3UL5A 3F7SA 2F98A 1QJGA 3B8LA 1WMPA 2O3OA 3LTCA 1NWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OF5 A;  4CDL A;  3FF2 A;  3LYG A;  4XBT A;  2XSH B;  3EN8 A;  2UX0 A;  3G16 A;  3B4O A;  2QIY A;  1OPY A;  5AEU B;  3NM2 A;  4HM0 B;  1EA2 A;  3A76 A;  1CQS A;  3H51 A;  2QGU A;  3KKG A;  5IEN A;  1Q42 A;  5HGR A;  4IIA A;  5TGN A;  1DMM A;  1O7P B;  2GBX B;  2YFL B;  3DUK A;  1BUQ A;  3JUP A;  3DXO A;  5BVB A;  4WYK A;  2F99 A;  3FH1 A;  4XDV A;  5IF6 A;  3FGY A;  2HMM B;  5DRE A;  1O7H B;  3EQQ B;  2BMO B;  4H3U A;  3UNL A;  3NUV A;  5CK6 A;  4PEJ A;  2XSO B;  1A2K A;  1GY5 A;  5D81 A;  2IMJ A;  4XBX A;  3OWU A;  5KP1 A;  3FSD A;  1E3R A;  4R9L A;  1JKG A;  4KVH A;  1GS3 A;  3NXJ A;  3GZX B;  3D9R A;  5FW5 A;  5CLK A;  5KP3 A;  3GWR A;  4L8P A;  3K0Z A;  1ZX2 A;  1Z1S A;  1HKX A;  3F8H A;  1NDO B;  3KZT A;  1UUW B;  5AII A;  4LMI A;  4L8O A;  3EBY A;  4MJD A;  3F40 A;  1OH0 A;  3K7C A;  3EC9 A;  5AIG A;  1IDP A;  1NU3 A;  1DMN A;  2W2C A;  3OWS A;  1ASK A;  5KP4 A;  4HM6 B;  3LZA A;  1JB2 A;  3F7X A;  3EJV A;  3OX9 A;  2YFI B;  1S5A A;  3EHC A;  4XM4 A;  3BLZ A;  1OHS A;  3UJM A;  3SOA A;  3NHX A;  3G8Z A;  3HZP A;  1OHO A;  5AEW B;  3GZR A;  2BMR B;  4J8T A;  4R9K A;  1ULJ B;  1K41 A;  3SOY A;  3ECF A;  3H3H A;  3OXA A;  5IG5 A;  5AIH A;  4K1V A;  4HM8 B;  3HK4 A;  3F14 A;  3OV4 A;  3MG1 A;  3B7C A;  4WYK B;  5G2G A;  5D82 A;  5JPP A;  4GB5 A;  1DMQ A;  3MSO A;  2CKF B;  4OUQ A;  1EG9 B;  4R1K A;  2YFJ B;  3HX8 A;  3VGN A;  3JUQ A;  3ROB A;  6STD A;  4OVM A;  5AI1 A;  1GY7 A;  3SED A;  2Z77 A;  4U13 A;  5STD A;  3B4P A;  2GEX A;  1JKG B;  2I9W A;  3DM8 A;  1O7M B;  3ER7 A;  3EN1 B;  1W01 A;  5CXO A;  1OGX A;  2GBW B;  1W6Y A;  8CHO A;  5CF1 A;  3F8X A;  1ZO2 A;  1ISK A;  3NV0 A;  3MKI A;  3CNM A;  1E97 A;  2A15 A;  2OWP A;  4X2O A;  3S5C A;  1UUV B;  2B1X B;  1E3V A;  2INX A;  5IER A;  3MYT A;  4LEH A;  2HMN B;  2R4I A;  1Q40 A;  2RFR A;  5D83 A;  5JPU A;  3CU3 A;  1O7W B;  3EF8 A;  5IG3 A;  1QMA A;  3JUN A;  5IG4 A;  4FCJ A;  3FKA A;  4HVN A;  1SJW A;  4FCM A;  3FLJ A;  4HM1 B;  3EBT A;  2XR8 B;  1W02 A;  3GZB A;  1JN5 A;  5IEO A;  4WWU C;  2Z7A A;  3RGA A;  1W00 A;  2RGQ A;  4XBY A;  3E99 A;  1AR0 A;  2STD A;  4HKV B;  3IPT A;  3OWY A;  3EX9 A;  7STD A;  3MG3 A;  5IEP A;  4HM3 B;  5DRV A;  3F9S A;  1C7H A;  2CHC A;  4STD A;  5CF2 A;  3WMD A;  1U5O A;  3RGR A;  3STD A;  4HM7 B;  4I4K A;  1STD A;  4XB5 A;  3FZW A;  4Q53 A;  4HJL B;  3JUM A;  4L7K A;  1WQL B;  2HML B;  3MG2 A;  2B24 B;  1OCV A;  1JB4 A;  4K1U A;  5IG0 A;  3DZL A;  3GZY B;  4WP5 A;  3T8N A;  3NV0 B;  3KSP A;  4HZB B;  3T8U A;  3I0Y A;  1GY6 A;  4HZ9 B;  1JB5 A;  3Q90 A;  4J9A A;  1GYB A;  4HM4 B;  1Q40 B;  2F86 B;  4RZM A;  3CNX A;  4HM2 B;  5AIF A;  3MHE A;  3NBR A;  2JQ5 A;  3CPO A;  3M8C A;  2Z76 A;  2PZV A;  4LGQ A;  3VSY A;  1OUN A;  5EVH A;  2HMK B;  2GXF A;  2HMO B;  1VZZ A;  2HMJ B;  4XDW A;  1JN5 B;  2BMQ B;  4HM5 B;  1TP6 A;  3GRD A;  2K54 A;  4ORL A;  1ULI B;  3G0K A;  1OHP A;  3FF0 A;  5BXQ A;  2XRX B;  3DMC A;  1TUH A;  4X2H A;  1O7G B;  3BB9 A;  1OGZ A;  3KE7 A;  2RCD A;  1O7N B;  3JUO A;  1OF5 B;  2BNG A;  4N3V A;  2GEY A;  3F7S A;  2F98 A;  1QJG A;  3B8L A;  1NWW A; 
#chains in the Genus database with same CATH topology
 1OF5 A;  4CDL A;  4R80 A;  3FF2 A;  4FR9 A;  3LYG A;  1RGH A;  3KII A;  4O8S A;  1CEW I;  4RNY A;  4XBT A;  2LYX A;  4CCV A;  2XSH B;  3EN8 A;  5G1L A;  2UX0 A;  3NBJ A;  3G16 A;  3BND A;  2XF3 A;  3HOH A;  3B4O A;  2QIY A;  1OPY A;  5AEU B;  3NM2 A;  4HM0 B;  1IVW A;  3X41 A;  2D42 A;  1EA2 A;  1UI7 A;  1X1X A;  2XFS A;  3NQZ A;  3MPH A;  1X1W A;  3S28 A;  3X42 A;  4BL3 A;  3A76 A;  1YI2 3;  1G96 A;  3MWZ A;  4RNT A;  5GSP A;  4KFD A;  1CQS A;  1QAK A;  2W0Q A;  3BNB A;  3H51 A;  4J5K A;  4MMZ B;  1YIJ 3;  1RGE A;  1KD1 4;  2QGU A;  2FXT A;  1R4C A;  3KKG A;  1BAN A;  2E2U A;  5IEN A;  3CC7 3;  1Q42 A;  1K8A 4;  4N6U A;  1BUJ A;  1TFO A;  2XFT A;  5HGR A;  1DYU A;  3PXM A;  2QEX 3;  1T3B A;  4IIA A;  1FGQ A;  2L1S A;  5TGN A;  2KAA A;  3GSP A;  4EC6 A;  1DMM A;  1O7P B;  2CFW A;  1UCL A;  2GBX B;  1VQ5 3;  1BU4 A;  3N9H A;  2YFL B;  3DUK A;  5EEO A;  3G4S 3;  3DGN A;  1SII A;  3I56 3;  4JF8 A;  1BUQ A;  3JUP A;  2H0H A;  3DXO A;  1BSA A;  3S27 A;  4WYK A;  4CJN A;  2F99 A;  5BVB A;  1EKM A;  2K0M A;  1MWS A;  3FH1 A;  4KFE A;  1QVG 2;  4N6M A;  3HII A;  4XDV A;  3FGY A;  5IF6 A;  3I55 3;  1JBT A;  3NM7 A;  1RMS A;  2HMM B;  5DRE A;  3BNE A;  1O7H B;  2L4V A;  1W6G A;  3EQQ B;  1GOY A;  2BMO B;  3LOY A;  3KN4 A;  4H3U A;  3UNL A;  3WOF B;  1B27 A;  1GD4 A;  3NUV A;  5CK6 A;  3AHS A;  2F4Y A;  4PEJ A;  2XSO B;  4WHA A;  1A2K A;  2YX9 A;  4JRF A;  4DKI A;  1R4Y A;  1GY5 A;  3SVA A;  4K61 A;  4FMC A;  3Q3F A;  2R41 A;  4BTX A;  3D79 A;  1DET A;  1LXE A;  2CWU A;  4MEI A;  1IQY A;  5IW9 A;  1FGR A;  1ZS7 A;  1IVX A;  5D81 A;  1IK3 A;  2IMJ A;  3CCV 3;  1B20 A;  1IYY A;  4XBX A;  3OWU A;  4N6L A;  1VQL 3;  5ELU A;  5KP1 A;  2OTL 3;  3FSD A;  2IUJ A;  1E3R A;  1BOX A;  4R9L A;  2Q07 A;  1JKG A;  3X3X A;  1I8V A;  2OTJ 3;  2MF7 A;  1GS3 A;  3IJE B;  3NXJ A;  1G0T A;  3GZX B;  4KVH A;  3D9R A;  1M90 4;  5FW5 A;  1B2S A;  1TIJ A;  5CLK A;  5KP3 A;  3GWR A;  4GHO A;  4L8P A;  3CC4 3;  1SAR A;  1TRP A;  3K0Z A;  1ZX2 A;  9RNT A;  1BNF A;  1Z1S A;  4O02 B;  1RN7 A;  6GSP A;  1HKX A;  1SQW A;  3WHO A;  3F8H A;  1RGA A;  1NDO B;  1Q7Y 4;  1IVV A;  1UUW B;  3KZT A;  1JRQ A;  3S67 A;  2ZHX B;  5AII A;  4LMI A;  1PYL A;  3VF1 A;  4L8O A;  1M1X B;  1BNJ A;  1FYS A;  1V58 A;  3EBY A;  3FCS B;  4FCZ A;  2OQE C;  4MJD A;  3CMA 3;  4TX4 A;  3F40 A;  1VQ8 3;  1OH0 A;  2IA7 A;  3K7C A;  2F5M A;  3EC9 A;  4MMY B;  5RNT A;  5AIG A;  1IDP A;  1NU3 A;  3PYJ A;  3D5G A;  3LTD A;  1DMN A;  2W2C A;  3OWS A;  1JNQ A;  1ASK A;  3X40 A;  4HM6 B;  3LZA A;  5KP4 A;  4O3V A;  1JB2 A;  1A2V A;  1RGG A;  1KQS 2;  3F7X A;  1AY7 A;  4HYZ A;  3DGL A;  2GU1 A;  1FGM A;  2ZA4 A;  3EJV A;  2CFK A;  2H0G A;  2W56 B;  3WDG B;  3PCS A;  1C54 A;  3OX9 A;  1EEJ A;  3PGB A;  2JDI H;  1RGL A;  2YFI B;  3SX1 A;  3DGY A;  1S5A A;  2J8X B;  3EHC A;  3NX0 A;  1IQ8 A;  1RDS A;  2BIR A;  4XM4 A;  1VQ7 3;  4G1M B;  1GD3 A;  1BIR A;  3BLZ A;  3LXU X;  1BRK A;  3X3Z A;  3TDG A;  1OHS A;  3UJM A;  3SOA A;  3BU4 A;  3A5E A;  2ML5 A;  3NHX A;  2CFG A;  2W9Q A;  2BHM A;  3G8Z A;  3HZP A;  1KC8 4;  1OHO A;  2P09 A;  3KCH A;  1K28 A;  2OCT A;  1IQX A;  2BT3 A;  1PY3 A;  2CWV A;  2LQV A;  1V74 A;  4KT3 B;  4OK0 A;  2CFL A;  1B2Z A;  4CPK A;  1YJN 3;  1MGR A;  1RLS A;  1JV2 B;  4GL6 A;  5AEW B;  3GZR A;  7RNT A;  1N9E A;  2BMR B;  1OAC A;  4J8T A;  3KSE D;  3S29 A;  3ALA A;  4EW5 A;  1UDI I;  3CME 3;  4R9K A;  1ULJ B;  1K41 A;  1YVB I;  7GSP A;  1Y4K A;  1U8C B;  3SOY A;  1LQM B;  2D1W A;  3ECF A;  3H3H A;  3OXA A;  4FMD A;  1NB5 I;  1QAL A;  4EBG A;  1FUT A;  4J5G A;  5IG5 A;  3O8Y A;  1TU5 A;  3D5I A;  5AIH A;  1BNI A;  1FA3 A;  1RJO A;  4K1V A;  4HM8 B;  1BRH A;  3HK4 A;  1VQK 3;  1KWI A;  3F14 A;  1DVD A;  1MWT A;  1FZU A;  3OV4 A;  3G71 3;  3MG1 A;  2CC3 A;  1CYV A;  3B7C A;  5EQL A;  1FGT A;  1TRQ A;  1VQN 3;  3WOE B;  4WYK B;  2SAR A;  1N9J A;  1RN4 A;  3AGN A;  5G2G A;  5D82 A;  5JPP A;  4GB5 A;  4LSO A;  1I3I A;  5AYS C;  1DMQ A;  6RNT A;  2KF6 A;  1AVK A;  2CFD A;  2P38 A;  2CKF B;  2WOF A;  3MSO A;  4OUQ A;  3WOD G;  1BGS A;  2CG1 A;  1EG9 B;  2CW9 A;  1B3S A;  4R1K A;  1UGI A;  1W2Z A;  2YFJ B;  3HX8 A;  2WGO A;  2IY2 A;  1RHL A;  1IT7 A;  2KF5 A;  3VGN A;  3JUQ A;  3ROB A;  3X3Y A;  1L5G B;  1I0V A;  6STD A;  1HU9 A;  2WGQ A;  3DGO A;  2UUG C;  4OVM A;  5AI1 A;  1GY7 A;  4FMA A;  3BNC A;  3SED A;  2Z77 A;  2HOH A;  1BNS A;  1LOV A;  3NQY A;  4U13 A;  5STD A;  1I3F A;  3KFQ C;  2SBL A;  1A2P A;  1WNH A;  3B4P A;  2GEX A;  1JKG B;  3RDE A;  1W6C A;  3D3L A;  2M7O A;  2I9W A;  3DM8 A;  1BRI A;  1O7M B;  3ER7 A;  1V57 A;  5M18 A;  3EN1 B;  1W01 A;  1T2I A;  1S72 3;  5CXO A;  1OGX A;  1I2G A;  2GBW B;  5AYR B;  1Q9E A;  1BSE A;  2CIU A;  3V98 A;  4EYC A;  4N6T A;  3AMO A;  1W6Y A;  1VQP 3;  3HIG A;  3CCQ 3;  3N8B A;  2IYJ A;  8CHO A;  3SYU A;  5CF1 A;  1QVF 2;  2KCD A;  2FNQ A;  3F8X A;  4H61 A;  1I2E A;  3AGO A;  1ZO2 A;  1UUG B;  1VQ9 3;  2XGN A;  3V92 A;  1ISK A;  1BNR A;  3L0R A;  3WA3 A;  3NV0 A;  3T0U A;  3MKI A;  1GOV A;  3RNT A;  1M9G A;  4LYL B;  4AKY A;  1W4N A;  3CNM A;  3LML A;  1WMN A;  1E97 A;  1UCK A;  1RCL A;  3CCS 3;  4RNZ A;  2A15 A;  1W7C A;  2OWP A;  4X2O A;  3S5C A;  1UGH I;  4EXR A;  1UUV B;  2B1X B;  1PU4 A;  1E3V A;  2XGL A;  2INX A;  2F5W A;  1YHQ 3;  2XH9 A;  4ILF A;  3LTA A;  1M1K 4;  1N5P A;  5IER A;  3MYT A;  1WMO A;  1LQG C;  2OOV A;  1SIH A;  4LEH A;  3PZW A;  4N6N B;  2HMN B;  3CD6 3;  3K5T A;  2R4I A;  1Q40 A;  2RFR A;  5D83 A;  5LC7 A;  5JPU A;  1X1Y A;  1BRS A;  8RNT A;  1UCJ A;  4ZM8 A;  1ZGX A;  4NPB A;  4EV5 A;  3CU3 A;  1O7W B;  2GU3 A;  1AQZ A;  3WR2 A;  3EF8 A;  5IG3 A;  1YIT 3;  2RSX A;  1BRJ A;  3QRD A;  5ELJ A;  1B21 A;  1QMA A;  3JUN A;  1STF I;  4GSP A;  4QWT A;  3ZFZ A;  5IG4 A;  3CCM 3;  2BO9 B;  2IUK A;  4FCJ A;  1B2M A;  3FKA A;  5JBS A;  1PFP A;  5M19 A;  1LVN A;  4HVN A;  1YNV X;  1W5Z A;  1SJW A;  1IV9 A;  3N54 B;  2P0X A;  1NNV A;  2PNC A;  4FCM A;  1BSD A;  3FLJ A;  3SXX A;  1MWU A;  4HM1 B;  2AAD A;  3EBT A;  1YGE A;  2XR8 B;  1DE3 A;  1N8Q A;  1W02 A;  3GZB A;  1JN5 A;  4HOH A;  5IEO A;  4WWU C;  2Z7A A;  3EE1 A;  2XEP A;  1N8R 4;  3D4A A;  1K9M 4;  3RGA A;  1W00 A;  2RGQ A;  1FW7 A;  4XBY A;  1YJ9 3;  1B2X A;  1D6Y A;  2P05 A;  1RRL A;  4AKZ A;  1Q86 4;  2CX0 A;  3E99 A;  4N6O B;  2CG0 A;  2CX1 A;  3J7Y d;  2KF4 A;  3LH4 A;  2CWT A;  4K90 B;  1AR0 A;  3FG3 A;  1VQO 3;  2W6J H;  3CCU 3;  3NBB A;  1NB3 I;  2STD A;  4HKV B;  3IPT A;  1BRG A;  3OWY A;  3PS8 A;  4BTW A;  3EX9 A;  7STD A;  1RGF A;  3MG3 A;  3CCJ 3;  3EB8 A;  3CCE 3;  1I70 A;  2W03 A;  3HI7 A;  3CXC 2;  1TFK A;  5IEP A;  1HYF A;  1I2F A;  4HM3 B;  5DRV A;  1A90 A;  3F9S A;  1C7H A;  1RGC A;  2CHC A;  4STD A;  1T5Y A;  2E2V A;  1VQQ A;  5CF2 A;  3WMD A;  1U5O A;  3RGR A;  4KZ1 A;  3IMA B;  4HAA A;  2Y73 A;  1FUW A;  2C4B A;  2WO0 A;  4BTY A;  3SLU A;  5LC6 A;  2QA4 3;  2UGI A;  3STD A;  1LNH A;  4HBR A;  1GOU A;  2RNT A;  1RNB A;  4KFF A;  1A67 A;  4HM7 B;  4I4K A;  1GMP A;  1GMR A;  4RBN A;  4AEQ A;  1MWR A;  1STD A;  1BVI A;  2C10 A;  4MMX B;  4XB5 A;  3FZW A;  4Q53 A;  4HJL B;  1AV4 A;  3JUM A;  3LT8 A;  1CYU A;  1RNT A;  5I97 A;  4L7K A;  1WQL B;  1JZD A;  1N5H A;  2HML B;  2KXG A;  3JVC A;  1RRH A;  3MG2 A;  5A0O B;  1WTH A;  1J2B A;  2B24 B;  1VQ6 3;  5FGO A;  3AHW A;  1OCV A;  1IT8 A;  1X1U A;  1NO3 A;  1UI8 A;  1JB4 A;  4K1U A;  5G1K A;  5IG0 A;  1SPU A;  1LNI A;  5M1A A;  3URP A;  3CC2 3;  1RSN A;  3DZL A;  3QK9 A;  3U1W A;  3WA2 X;  3AMO B;  1IVU A;  3LT9 A;  1VQM 3;  1KSI A;  1RN1 A;  1DVC A;  2O9U X;  3GZY B;  4WP5 A;  3T8N A;  2Y74 A;  1RKY A;  1LRA A;  1MNL A;  2FGT A;  2K3D A;  3NV0 B;  2C11 A;  3GAX A;  1LOW A;  1FUS A;  2ML6 A;  3KSP A;  4HZB B;  3T8U A;  1LOX A;  3UL6 A;  1BNE A;  3U97 A;  2P0M A;  2H0I A;  1B2U A;  1F8N A;  3I0Y A;  1GY6 A;  4HZ9 B;  4BL2 A;  2KF3 A;  5BIR A;  1IU7 A;  1RTU A;  3DH2 A;  3K9M C;  1JB5 A;  3Q90 A;  4J9A A;  1GYB A;  1EQK A;  2F56 A;  4HM4 B;  5HOH A;  1Q40 B;  2F86 B;  4RZM A;  3CCL 3;  3CNX A;  4HM2 B;  5AIF A;  3FG1 A;  3MHE A;  4BU4 A;  3UB1 A;  3NBR A;  2JQ5 A;  3CPO A;  3LTB A;  1BAO A;  2OQE A;  1JBS A;  3M8C A;  4BIR A;  1MGW A;  2Z76 A;  2PZV A;  3DY5 A;  4R4K A;  4LGQ A;  2GSP A;  3VSY A;  1OUN A;  1BSB A;  1G02 A;  4IT7 A;  5EVH A;  2HMK B;  1I0X A;  3CCR 3;  2GXF A;  1Q81 4;  3Q1C A;  1VQ4 3;  5BU4 A;  1GSP A;  1T2H A;  2CH9 A;  1D6Z A;  4FMB A;  1GMQ A;  1FGO A;  1US1 A;  1JZO A;  3Q2P A;  2KRT A;  1BRN L;  2AAE A;  2HMO B;  2OOV C;  3BIR A;  1HZ1 A;  1VZZ A;  1YVS A;  2BU4 A;  4EV2 A;  2W04 A;  3FG4 A;  2HMJ B;  4XDW A;  3CPW 2;  1BNG A;  1JBR A;  1TTO A;  1ROV A;  1JN5 B;  1Q7H A;  3DGM A;  2BMQ B;  2E2T A;  4HM5 B;  1YGW A;  4N6V 0;  2ZL8 A;  3ZG5 A;  2ZDJ A;  2RBI A;  1TP6 A;  2Z6B A;  3K63 A;  3GRD A;  2K54 A;  1W2B 2;  2W9P A;  1RGK A;  1D6U A;  1AVL A;  3G6E 3;  1TJD A;  4NRE A;  4ORL A;  1QAF A;  1ULI B;  1IV7 A;  2WOH A;  3G0K A;  1OHP A;  3FF0 A;  4O2H A;  5BXQ A;  1K73 4;  1YJW 3;  1JJ2 2;  1CH0 A;  2XRX B;  3DMC A;  1TUH A;  4I5Q A;  4LZI A;  1MOL A;  1O7G B;  4X2H A;  3BB9 A;  2MC8 A;  1UCI A;  1RCK A;  3PCR A;  1OGZ A;  3KE7 A;  2RCD A;  4NHF A;  4WFO A;  3V99 A;  1NJI 4;  1ROA A;  4IPB A;  1O7N B;  2CK3 H;  3JUO A;  1Q82 4;  1BSC A;  2V1L A;  1OF5 B;  1EUI C;  2BNG A;  2W56 A;  4N3V A;  3OW2 2;  3ZG0 A;  1UW1 A;  1LOY A;  2GEY A;  3UL5 A;  3F7S A;  2F98 A;  1QJG A;  3B8L A;  1WMP A;  2O3O A;  3LTC A;  1NWW A; 
#chains in the Genus database with same CATH homology
 1OF5 A;  4CDL A;  4R80 A;  3FF2 A;  4FR9 A;  3LYG A;  3KII A;  4O8S A;  4CCV A;  1CEW I;  4RNY A;  4XBT A;  2LYX A;  2XSH B;  3EN8 A;  2UX0 A;  3NBJ A;  3G16 A;  3BND A;  2XF3 A;  3B4O A;  2QIY A;  1OPY A;  5AEU B;  3NM2 A;  4HM0 B;  1IVW A;  3X41 A;  2D42 A;  1EA2 A;  1UI7 A;  2XFS A;  3NQZ A;  3MPH A;  3X42 A;  3S28 A;  1YI2 3;  3A76 A;  1G96 A;  3MWZ A;  4KFD A;  1CQS A;  1QAK A;  2W0Q A;  3BNB A;  3H51 A;  4MMZ B;  1YIJ 3;  1KD1 4;  2QGU A;  2FXT A;  1R4C A;  3KKG A;  5IEN A;  2E2U A;  3CC7 3;  1Q42 A;  1K8A 4;  4N6U A;  1TFO A;  2XFT A;  5HGR A;  1DYU A;  3PXM A;  2QEX 3;  4IIA A;  1FGQ A;  5TGN A;  4EC6 A;  1DMM A;  1O7P B;  2CFW A;  2GBX B;  1VQ5 3;  3N9H A;  2YFL B;  3DUK A;  5EEO A;  3G4S 3;  3DGN A;  1SII A;  3I56 3;  4JF8 A;  1BUQ A;  3JUP A;  3DXO A;  3S27 A;  5BVB A;  4WYK A;  2F99 A;  1EKM A;  2K0M A;  3FH1 A;  4KFE A;  1QVG 2;  4N6M A;  3HII A;  4XDV A;  3FGY A;  5IF6 A;  3I55 3;  3NM7 A;  2HMM B;  5DRE A;  3BNE A;  1O7H B;  2L4V A;  1W6G A;  3EQQ B;  3LOY A;  2BMO B;  3KN4 A;  4H3U A;  3UNL A;  3WOF B;  1GD4 A;  3NUV A;  5CK6 A;  4PEJ A;  2XSO B;  4WHA A;  1A2K A;  2YX9 A;  4JRF A;  1GY5 A;  3SVA A;  4K61 A;  4FMC A;  4BTX A;  2CWU A;  1LXE A;  4MEI A;  1IQY A;  5IW9 A;  1FGR A;  1IVX A;  5D81 A;  1IK3 A;  2IMJ A;  3CCV 3;  4XBX A;  3OWU A;  4N6L A;  1VQL 3;  5ELU A;  5KP1 A;  2OTL 3;  3FSD A;  2IUJ A;  1E3R A;  4R9L A;  3X3X A;  2Q07 A;  1JKG A;  2OTJ 3;  2MF7 A;  1GS3 A;  3IJE B;  3NXJ A;  3GZX B;  4KVH A;  3D9R A;  1M90 4;  5FW5 A;  1TIJ A;  5CLK A;  5KP3 A;  3GWR A;  4L8P A;  3CC4 3;  3K0Z A;  1ZX2 A;  1Z1S A;  4O02 B;  1RN7 A;  1HKX A;  1SQW A;  3F8H A;  1NDO B;  1Q7Y 4;  1IVV A;  1UUW B;  3KZT A;  1JRQ A;  3S67 A;  5AII A;  4LMI A;  3VF1 A;  4L8O A;  1M1X B;  3FCS B;  3EBY A;  4FCZ A;  2OQE C;  4MJD A;  3CMA 3;  4TX4 A;  3F40 A;  1VQ8 3;  1OH0 A;  2IA7 A;  3K7C A;  4MMY B;  3EC9 A;  5AIG A;  1IDP A;  1NU3 A;  3PYJ A;  3LTD A;  1DMN A;  2W2C A;  3OWS A;  1JNQ A;  1ASK A;  3X40 A;  4HM6 B;  3LZA A;  5KP4 A;  4O3V A;  1JB2 A;  1A2V A;  1KQS 2;  3F7X A;  4HYZ A;  3DGL A;  2GU1 A;  1FGM A;  3EJV A;  2CFK A;  2W56 B;  3WDG B;  3PCS A;  3OX9 A;  3PGB A;  2JDI H;  2YFI B;  3SX1 A;  1S5A A;  3EHC A;  3NX0 A;  1IQ8 A;  4XM4 A;  1VQ7 3;  4G1M B;  1GD3 A;  3BLZ A;  3LXU X;  3X3Z A;  3TDG A;  1OHS A;  3UJM A;  3SOA A;  3NHX A;  2ML5 A;  2CFG A;  2W9Q A;  2BHM A;  3G8Z A;  3HZP A;  1KC8 4;  1OHO A;  2P09 A;  1K28 A;  2OCT A;  1IQX A;  2BT3 A;  2CWV A;  2LQV A;  1V74 A;  1YJN 3;  4OK0 A;  2CFL A;  1JV2 B;  4GL6 A;  5AEW B;  3GZR A;  1N9E A;  2BMR B;  1OAC A;  4J8T A;  3KSE D;  3S29 A;  3ALA A;  3CME 3;  4R9K A;  1ULJ B;  1K41 A;  1YVB I;  1Y4K A;  1U8C B;  3SOY A;  2D1W A;  3ECF A;  3H3H A;  3OXA A;  4FMD A;  1NB5 I;  1QAL A;  4EBG A;  5IG5 A;  3O8Y A;  1TU5 A;  5AIH A;  1FA3 A;  1RJO A;  4K1V A;  4HM8 B;  1VQK 3;  3HK4 A;  1DVD A;  1KWI A;  3F14 A;  3OV4 A;  3G71 3;  3MG1 A;  2CC3 A;  1CYV A;  3B7C A;  5EQL A;  1FGT A;  1VQN 3;  3WOE B;  4WYK B;  1N9J A;  5G2G A;  5D82 A;  5JPP A;  4GB5 A;  4LSO A;  5AYS C;  1DMQ A;  2P38 A;  2WOF A;  1AVK A;  2CFD A;  2CKF B;  3MSO A;  4OUQ A;  3WOD G;  2CG1 A;  1EG9 B;  2CW9 A;  4R1K A;  1W2Z A;  2YFJ B;  3HX8 A;  2WGO A;  1IT7 A;  3VGN A;  3JUQ A;  3ROB A;  3X3Y A;  1L5G B;  6STD A;  1HU9 A;  2WGQ A;  3DGO A;  4OVM A;  5AI1 A;  1GY7 A;  4FMA A;  3BNC A;  3SED A;  2Z77 A;  3NQY A;  4U13 A;  5STD A;  3KFQ C;  2SBL A;  1WNH A;  3B4P A;  2GEX A;  1JKG B;  3RDE A;  1W6C A;  3D3L A;  2M7O A;  2I9W A;  3DM8 A;  1O7M B;  3ER7 A;  3EN1 B;  1W01 A;  1S72 3;  5CXO A;  1OGX A;  2GBW B;  5AYR B;  4EYC A;  2CIU A;  3V98 A;  4N6T A;  3AMO A;  1W6Y A;  1VQP 3;  3HIG A;  3CCQ 3;  3N8B A;  8CHO A;  5CF1 A;  1QVF 2;  2KCD A;  2FNQ A;  3F8X A;  4H61 A;  1ZO2 A;  1VQ9 3;  2XGN A;  3V92 A;  1ISK A;  3L0R A;  3WA3 A;  3NV0 A;  3T0U A;  3MKI A;  1M9G A;  4AKY A;  1W4N A;  3CNM A;  3LML A;  1WMN A;  1E97 A;  3CCS 3;  4RNZ A;  2A15 A;  1W7C A;  2OWP A;  4X2O A;  3S5C A;  4EXR A;  1UUV B;  2B1X B;  1PU4 A;  1E3V A;  2XGL A;  2INX A;  1YHQ 3;  2XH9 A;  1M1K 4;  3LTA A;  1N5P A;  5IER A;  3MYT A;  1WMO A;  2OOV A;  1SIH A;  4LEH A;  3PZW A;  4N6N B;  2HMN B;  3CD6 3;  3K5T A;  2R4I A;  1Q40 A;  2RFR A;  5D83 A;  5LC7 A;  5JPU A;  4ZM8 A;  4EV5 A;  3CU3 A;  1O7W B;  2GU3 A;  3EF8 A;  5IG3 A;  1YIT 3;  2RSX A;  5ELJ A;  3QRD A;  1QMA A;  3JUN A;  1STF I;  4QWT A;  5IG4 A;  3CCM 3;  2BO9 B;  2IUK A;  4FCJ A;  3FKA A;  5JBS A;  1PFP A;  1LVN A;  4HVN A;  1W5Z A;  1SJW A;  1IV9 A;  3N54 B;  2P0X A;  2PNC A;  4FCM A;  3FLJ A;  3SXX A;  4HM1 B;  3EBT A;  1YGE A;  2XR8 B;  1N8Q A;  1W02 A;  3GZB A;  1JN5 A;  5IEO A;  4WWU C;  2Z7A A;  3EE1 A;  2XEP A;  1N8R 4;  1K9M 4;  3RGA A;  1W00 A;  2RGQ A;  4XBY A;  1YJ9 3;  1D6Y A;  2P05 A;  1RRL A;  4AKZ A;  1Q86 4;  4N6O B;  3E99 A;  2CG0 A;  3J7Y d;  3LH4 A;  2CWT A;  4K90 B;  1AR0 A;  3FG3 A;  1VQO 3;  2W6J H;  3CCU 3;  3NBB A;  1NB3 I;  2STD A;  4HKV B;  3IPT A;  3OWY A;  3PS8 A;  4BTW A;  3EX9 A;  7STD A;  3MG3 A;  3CCJ 3;  3EB8 A;  3CCE 3;  3HI7 A;  2W03 A;  3CXC 2;  1TFK A;  5IEP A;  4HM3 B;  5DRV A;  1A90 A;  3F9S A;  1C7H A;  2CHC A;  4STD A;  1T5Y A;  2E2V A;  5CF2 A;  3WMD A;  1U5O A;  3RGR A;  4KZ1 A;  3IMA B;  2Y73 A;  1FUW A;  2WO0 A;  4BTY A;  3SLU A;  5LC6 A;  2QA4 3;  3STD A;  1LNH A;  4HBR A;  4KFF A;  1A67 A;  4HM7 B;  4I4K A;  4RBN A;  4AEQ A;  1STD A;  2C10 A;  4MMX B;  4XB5 A;  3FZW A;  4Q53 A;  4HJL B;  1AV4 A;  3JUM A;  3LT8 A;  1CYU A;  5I97 A;  4L7K A;  1WQL B;  1N5H A;  2HML B;  2KXG A;  3JVC A;  5A0O B;  1RRH A;  3MG2 A;  1WTH A;  1J2B A;  2B24 B;  1VQ6 3;  5FGO A;  1OCV A;  1IT8 A;  1NO3 A;  1UI8 A;  1JB4 A;  4K1U A;  5IG0 A;  1SPU A;  3CC2 3;  3DZL A;  3QK9 A;  3U1W A;  3WA2 X;  3AMO B;  1IVU A;  3LT9 A;  1VQM 3;  1KSI A;  1DVC A;  2O9U X;  3GZY B;  4WP5 A;  3T8N A;  2Y74 A;  1RKY A;  1MNL A;  2FGT A;  3NV0 B;  2C11 A;  3GAX A;  2ML6 A;  3KSP A;  4HZB B;  3T8U A;  1LOX A;  3UL6 A;  3U97 A;  2P0M A;  1F8N A;  3I0Y A;  1GY6 A;  4HZ9 B;  1IU7 A;  3K9M C;  1JB5 A;  3Q90 A;  4J9A A;  1GYB A;  1EQK A;  4HM4 B;  1Q40 B;  2F86 B;  4RZM A;  3CCL 3;  3CNX A;  4HM2 B;  5AIF A;  3FG1 A;  3MHE A;  3UB1 A;  3NBR A;  2JQ5 A;  3CPO A;  3LTB A;  2OQE A;  3M8C A;  2Z76 A;  2PZV A;  3DY5 A;  4R4K A;  4LGQ A;  3VSY A;  1OUN A;  4IT7 A;  5EVH A;  2HMK B;  3CCR 3;  2GXF A;  1Q81 4;  3Q1C A;  1VQ4 3;  2CH9 A;  1D6Z A;  4FMB A;  1FGO A;  1US1 A;  3Q2P A;  2KRT A;  2HMO B;  2OOV C;  1VZZ A;  4EV2 A;  2W04 A;  3FG4 A;  2HMJ B;  4XDW A;  3CPW 2;  1ROV A;  1JN5 B;  3DGM A;  2BMQ B;  2E2T A;  4HM5 B;  4N6V 0;  2ZL8 A;  2ZDJ A;  2Z6B A;  1TP6 A;  1W2B 2;  3K63 A;  3GRD A;  2K54 A;  2W9P A;  1D6U A;  1AVL A;  3G6E 3;  4NRE A;  4ORL A;  1QAF A;  1ULI B;  1IV7 A;  2WOH A;  3G0K A;  1OHP A;  3FF0 A;  4O2H A;  5BXQ A;  1K73 4;  1YJW 3;  1JJ2 2;  2XRX B;  3DMC A;  1TUH A;  4X2H A;  4LZI A;  1MOL A;  1O7G B;  3BB9 A;  2MC8 A;  3PCR A;  1OGZ A;  3KE7 A;  2RCD A;  4NHF A;  4WFO A;  3V99 A;  1NJI 4;  1ROA A;  4IPB A;  1O7N B;  2CK3 H;  3JUO A;  1Q82 4;  2V1L A;  1OF5 B;  2BNG A;  2W56 A;  4N3V A;  3OW2 2;  1UW1 A;  2GEY A;  3UL5 A;  3F7S A;  2F98 A;  1QJG A;  3B8L A;  1WMP A;  2O3O A;  3LTC A;  1NWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...