2F8DA

Benm effector-binding domain crystallized from high ph conditions
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
221
structure length
221
Chain Sequence
EKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNWLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligomerization of BenM, a LysR-type transcriptional regulator: structural basis for the aggregation of proteins in this family.
pubmed doi rcsb
source organism Acinetobacter baylyi
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator benM
total genus 70
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f8dA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f8dA02
2VHAA 3O9PA 3T9VA 1S50A 4RK2A 2V3TA 3O6IA 4MFIA 4U4SA 1FTMA 3OXNA 1FW0A 1FTOA 2B3FA 3EHUA 3IB2A 2XD2A 3MBPA 4IO7A 3FVGA 3C33A 2ONRA 1IXCA 2XXRA 5AE4A 4FE8A 5DYHA 3CRBA 3IK6B 3VV5A 5I56A 3FUZA 1Q35A 2O1MA 2VOZA 3IO6A 4NE4A 4KR5A 4GL8A 2A5TB 3K00A 1SW5A 3B6WA 4JBZA 5ITPA 2PVUA 5KDTA 1H3DA 3BFTA 4DE8A 4YAHX 2DSFA 2F6GA 3W15C 1A99A 3W9VA 3IO4A 4QF9A 1I6QA 4JWXA 4TLMB 1JVYA 3V83A 2NOOA 2XXPA 1LAGE 1OQGA 2DE4A 3EHSA 3K6WA 3USDA 4EUOA 3PUZE 1N3WA 3FV1A 1N0TA 3K02A 4U22A 4XKQA 3TCHA 4ELQA 1IXHA 1Y20A 3MVWA 3MAMA 4BDOA 4EF2A 3TTLA 1QJMA 4QSDA 4HW8A 2B3BA 3A3CA 1MM7A 3Q25A 3TKDA 1PC3A 1TXFA 3I5OA 4OVJA 2DWIA 2I0BA 4R75A 4ONYA 1RKMA 1MQGA 3KJTA 4OTEA 3MVXA 4H8IA 1DOTA 1LGBC 1FTJA 5I2KA 4XTCQ 1A55A 5I57A 3C36A 2I0CA 5DVJA 1IEJA 2Z8EA 1ZBMA 4PFYA 3HHGA 3N5LA 4G68B 4HCYA 3TPAA 1YAEA 2ZNSA 1M5BA 1A7LA 3PU5A 3N6TA 4DXBA 1CB6A 2OCUA 2HAUA 2O6AA 3CFZA 2QS2A 1N84A 1NH7A 3ECRA 3EPEA 3DP8A 3FJ7A 4GLIA 2Y7IA 1MXZA 3H3GA 4R2BA 4R73A 4DZ1A 4EXKA 4ZEDA 4Q0CA 3IOVA 3FVNA 3GXAA 4R2FA 2OJTA 3CI8A 4G68A 2FYIA 2W7YA 2UVGA 2YLNA 5EHMA 3VXCA 5KZTA 3TZAA 1TFDA 2F35A 1P1QA 1WODA 2NXOA 1EZ9A 5EYFA 4MLVA 4H5GA 4OQOA 1B9JA 1M5FA 2DXYA 4UACA 3KEIA 4PFUA 4Q8RA 5L9MA 1AMFA 3U72A 3IX1A 5IAIA 3PMWA 1Y4TA 1B7UA 3N26A 2OK2A 3VVEA 4MLQA 5DTBA 5I57B 3PMVA 1US4A 4IGRA 2Q8JA 1B3EA 1HSLA 4OFLA 5CMCA 5I58A 4YKPA 1BIYA 1VFDA 3MWBA 4FECA 2HZKA 1TT1A 4YKJA 4QSCA 5DVIA 5H8SA 4H5FA 2DXRA 2O1LA 4N07A 5BUUA 3EF7A 3SEYA 4Z0IA 1M5EA 2H99A 4N13A 3H6UA 1N76A 3OEKA 2O68A 3CG1A 3T9XB 3VLUA 1Z7NE 2REJA 3UIFA 2RCAA 2QL3A 3R6UA 3JV9A 3QK6A 3M8UA 1MH3A 2UYFA 4DDDA 1OVBA 3CIJA 3K1MA 4H1XA 4M1VA 3HPIA 4QFOA 2Q2AA 4LONB 1IXIA 4QFNA 3H4ZA 3T22A 3MZ9A 3Q29A 3EHTA 3RY3A 1B3HA 4KCDA 3MVZA 4ZE9A 1R1NA 2FA7A 5H8NA 2ZMBA 3IB0A 4JWOA 4FORA 1D4NA 1JW4A 2PYYA 1DTGA 3T93B 3LBSA 1PB7A 3RTFB 2AIXA 2G29A 1B3FA 4G2ZA 5AA1A 3O2AA 1R6ZA 1DTZA 3CFLA 3WAEA 1UIVA 1URDA 1A40A 4F3BA 1I69A 2O51A 3MQ9A 2R71A 1R9LA 3EN3A 5I59B 4UA8A 2GFEA 4OMBA 3L6GA 1MM6A 1URGA 2Y7WA 3IAZA 3K6UA 1VFEA 4R6KA 4AQ4A 1DSNA 1A54A 4H0WA 4OENA 1B7HA 1JETA 2E0SA 2ZYOA 4F2QA 2ONSA 2OLBA 4F29A 1N7XA 5K2XA 5TPAA 1XHYA 3ILUB 3DM0A 3LC8A 3D4GA 2REGA 4KPTA 2NWJA 2OWTA 3JYRA 1SQYA 3CVGA 1MY2A 5H8QA 4F1VA 2Z22A 4C0RA 2P1SA 1POTA 4RYAA 3PV0E 2CZLA 3FVKA 2ONKE 4G8NA 5I2KB 3E4RA 3GZGA 3KN7A 4F3GA 3E9XA 5I59A 1B32A 4FEBA 2F36A 3LSWA 4ZE8A 2OWSA 2X7PA 3OO9A 4GOTA 3W9WA 4HCWA 4XKPA 4F31B 3SERA 5L9OA 1OLAA 1IQ7A 3HHFA 2P2AA 3R26A 3TTNA 4OERA 4XIGQ 3V89B 4YMBA 2QMXA 5A5XA 2I6EA 1MDP1 3RQTA 4RY1A 1B05A 4G4PA 5I58B 2GRVA 1H44A 3FIRA 3GLBA 2AL4A 1USYE 4KCCA 1MH4A 2PT1A 2XX8A 1JNFA 4R9GA 2Z8DA 3PUYE 4RPNA 2ZYKA 1MQJA 1MQHA 1XOCA 3T96B 1P1OA 3UN6A 1VSOA 1NMUA 3PUWE 1B40A 4EXLA 2VP1A 5AA3A 4BDQA 5L9SA 2DWAA 2GH9A 4H65A 2Y7KA 1PBPA 3I3VA 1AIVA 1Y1MA 1YPNA 2V84A 3IB1A 3MPLA 4IO2A 4ZEFA 4NF5A 4PETA 2QMWA 4I8CA 1LB8A 1MQIA 3LSXA 3GBAA 1D3KA 2I3WA 3OSRA 4YMAA 1LFGA 5I2NA 3TEPA 3V8XB 2O84X 2V3UA 1LB9A 2XXWA 1NKXA 3BKIB 3ZS6A 2ZNUA 4THIA 2DOJA 2H4IA 2XXQA 3CSBA 4XKRA 4YICA 5CBSA 4LQ5A 2NUVA 3E3KA 4ZEIA 3WAFA 2RC8A 4FAJA 5KCJB 2R6GE 3MUQA 4IY6A 4RNSA 1M5DA 3TCFA 4L17A 3Q28A 1B5HA 1RYXA 3R7XA 3TQWA 4OEUA 1QKBA 2I48A 3S2VA 2XD3A 2ZYNA 3G3FA 4RPOA 2XXTA 3VDFA 2HZLA 1FQEA 4N6PA 3C31A 2M8CA 3PUXE 3TODA 4E0WA 5HBCA 1P99A 3C4MA 2RCBA 5JTYB 3SEXA 2DP8A 3IJXB 3K0VA 5TP9A 3LUYA 3DP4A 3OOAA 3E13X 3S4UA 4GRKA 1ZTYA 4G77A 2F5XA 4OWDA 5H8HA 2RF1A 4ISUA 1FQDA 3ZKLA 5B70A 3RGYA 4ZZAA 1IUDA 3RPWA 4U23A 4JSDA 5FTHA 4Z7EA 3G3JA 1AH5A 3QUJA 3O28A 3O66A 4M4GA 1B1HA 1TWYA 3THIA 3C34A 4F3PA 2FNCA 3KN8A 1LAFE 4ZZEA 2VD2A 2HCAA 5CMBA 5I84A 5KDTB 3B6QA 2I4BA 4E0XA 2UVIA 3OO6A 4NEDA 4PFWA 1Q1KA 1NNTA 1PB8A 3JZJA 3PUVE 1NNPA 4ZS9A 5HPQA 4MH5A 1FQFA 4NWCA 3K6VA 5JK4A 1B52A 1S7YA 3IOTA 3KOSA 3H6WA 5ISUA 1JW5A 1SBPA 1LFIA 4YZZA 2O7IA 2UXAA 4NF6A 4NF4B 4OXVA 3S9LC 3PPNA 4OETA 1MPDA 3MP8A 4R74A 4WEPA 5AA2D 1EH3A 3S9EA 5DVFA 3HO7A 3CSGA 3KSJA 3LSFB 3TTKA 1MG1A 4NTLA 2XXUA 3VVFA 1LAXA 2AYSA 4ESXA 1JEUA 2G93A 2QPQA 1MRPA 2XXYA 1SVXB 4C1TA 1GVCA 5B7DA 1QKAA 1TFAA 3U1OA 1RYOA 4XKNA 3ONMA 3VXBA 3VLWA 4LQ2A 3IR1A 1IIWA 2Z23A 1EZPA 1SI0A 1O7TA 4NF6B 4GL0A 4LATA 4P11A 1NL5A 1Y9UA 3LR1A 3OD7A 1BP5A 1IXGA 1F9BA 1YCJA 4OYVA 2B65A 3PGFA 2GHAA 4F19A 3KZGA 1FQAA 3KJ7A 4KHZE 1SW4A 1BTJA 4DCXA 1H76A 1Y4CA 3EQ1A 2Y7RA 3MW0A 4ND9A 3IOWA 4BDLA 1PDAA 4R6HA 5IKBA 2VGQA 3IJOB 3SETA 2RC9A 1P1WA 3U92A 4OHNA 2PT2A 3G7WA 4HS7A 1GV8A 2HAVA 2BJJX 4U21A 1UQWA 2IA4A 3O97A 4ELPA 5AA2B 2D21A 1MY4A 2DYXA 1B0HA 4GQOA 4QHQA 2F8DA 1O63A 4Q5TA 3Q26A 4QRZA 4WKMA 4F2OA 2YJPA 2UYEA 3OSQA 3UORA 3BBRA 4BDNA 3K4UA 4RJZA 2A5SA 4BDRA 4HTGA 4R6YA 1OVTA 4ZEKA 2RC7A 4ELRA 1ATGA 3IL1B 1USYH 5CC2A 2I3VA 2ABHA 4Q30B 5EHSA 4O3CA 2RKMA 2QS1A 5H8HB 3OENA 1PB9A 4R9FA 5FHMA 4GXAA 3CG3A 3TYHA 5CMKA 4LP2B 1JW1A 1MQDA 1NFTA 1QUJA 2QRYA 3B6TA 2LAOA 3FXUA 4LVQA 4RA1A 2V25A 4LA9A 4TLLB 5CI5A 1LBCA 1VE4A 3MPKA 1SI1A 5ITOA 2HFBA 5H8FA 1Y3QA 4IO5A 2KLFA 4WEDA 3U8QA 4F18A 5ICTA 1S9TA 4KYSA 3HV1A 3M3KA 4ZDMA 3N94A 3AXFA 1XVYA 4GIZA 3FGSA 3TMGA 1FTLA 5JEIA 2F97A 5KCJA 2I4CA 3UA8A 3CFXA 3FATA 4H6DA 1UTHA 1J1NA 3VLVA 3SEWA 3U94A 2XX7A 5DEXB 2QS3A 4FATA 4BLAA 1UTBB 4YU0A 3RT8A 5FHOA 1DPEA 2X26A 1BKAA 4DXCA 4DCYA 2Z8FA 5H8NB 3IOUA 3SEVA 4JXIA 1MXWA 3ZKKA 5TU0A 4PQJA 1QVSA 2H98A 4LZ8A 2F6PA 4PP0A 4ELOA 1MXUA 3BFUA 2DQVA 1MY0A 2D3IA 3DELB 5F7VA 1D9VA 3FASA 1SW1A 3MP6A 3RLFE 1ZKBA 4EQBA 3RTWB 1FQCA 5TPAB 3QUFA 1H45A 4U1OA 5AA2A 3ODBA 5HM4B 1DMBA 3MZ1A 2F7BA 1H43A 2X7QA 3H6TA 1MPCA 2ALUA 5H8QB 4G8HA 4GWOA 2CMOA 3H03A 5LOMA 1SYHA 4OZ9A 2A5TA 3H7MA 5FTIA 2UVHA 4OFJA 3TCGA 1AL3A 2THIA 4U1ZA 2I58A 1EU8A 4FIMA 3T66A 4RK9A 3UK4A 3VVDA 2PMSA 1QULA 1D9YA 2Y84A 2YPNA 4GFRA 4JSOA 3T9HB 4F3SA 3SESA 4X1DA 1PBQA 2H25A 4MBPA 5A5XB 5DEXA 3M3LA 4NF4A 1UTBA 1UTHB 1LSTA 3FZVA 5L8DA 3TQLA 3ZSFA 3OO7A 3D4CA 1SW2A 4R72A 3ILTB 3PD8A 4F1YA 5I2NB 3K1PA 3HN0A 3A09A 2IEEA 4PFTA 1Y1ZA 3M3FA 1XVXA 4AB6A 5CMMA 3VFJA 1A8EA 1MPBA 3KGCA 4TOZA 3K1NA 1LAHE 1YTVA 2E1SA 2F34A 3LSLA 4X48A 4X9TA 5AA4B 1AOVA 3MC2A 2NVUB 1L5TA 2HXWA 5CBRA 1MY1A 2UVJA 4YB6A 4PE5B 1A8FA 3KG2A 1Y3NA 1MXYA 1SD3A 2HQ0A 1B3GA 4H67A 5CM6A 3L6HA 3MP1A 4LUBA 3SKPA 3PMXA 2O69A 3IORA 1EZOA 3O6HA 4IO3A 4KYEA 1T0KA 1I6AA 3U93A 3RN8A 2XXXA 4H8JA 4EDPA 2F7CA 4JWYA 1OMPA 2DVZA 1B4ZA 3K01A 3TELA 1II5A 3G3KA 3OELA 3MVYA 3Q27A 4MF3A 3TUSA 1ZIUA 4KFQA 4F1UA 4IO6A 1B1XA 4KQPA 1R9QA 4YB7A 3K6XA 1GR2A 3F11A 2H5YA 3O29A 4NF5B 3KFMA 2GHBA 4EF1A 3KBRA 1JQFA 4F39A 4YB5A 3RT6B 4I62A 4O3BA 1N7WA 3RNNA 1CE2A 1XC1A 1B5IA 4RXLA 4BDMA 2XHDA 3S9MC 1B0LA 1GGGA 1NNKA 1Z7ME 2HEUA 4EQ7A 1N3XA 3TTMA 3KOTA 1QW0A 3TTRA 2QSXA 1VR5A 1MDQA 3G3IA 1B3LA 3FXRA 4QFPA 5FHNA 3V5AA 2I49A 2Q89A 2DWJA 4O3AA 3H6VA 3K2DA 4DLDA 2Q2CA 2QS4A 4ZECA 3QIMA 2DS9A 3S9NC 2DE2A 3T9UA 3QAXA 2OZZA 3UGWA 1ZMGA 2PX1A 3DLNA 2ZYMA 3FVOA 4OESA 1US5A 5BWJA 3UP9A 3A3UA 1OLCA 5F1QA 1ZU0A 2ESNA 3QXMA 5K2YA 3G3HA 2Q88A 3SEUA 2RINA 1WVJA 1B6HA 1LCTA 2F78A 3PD9A 4KD5A 2ANJA 1FQBA 5DT6A 3HCQA 3FXQA 5ICQA 4XXUA 3VE1B 4ESWA 4YKIA 4G8MA 3KN3A 1DPPA 4F22A 1NH8A 1HSJA 1GTKA 4NF8A 1ANFA 2VD3A 4FJPA 2ZNTA 1N04A 1XS5A 3HSTA 3I6VA 4G68C 3OMBA 1MS7A 2D5WA 3H06B 4POWA 3N6UA 5H8FB 5M2VA 1MY3A 3FD3A 5AA4A 1B5JA 1FTKA 4GD5A 3QYTA 4WXJA 3MZBA 1FCKA 3KSXA 4C1UA 2H9BA 3CR9A 1LLSA 4NF8B 1HSEA 1P1NA 4U2RA 2Y7PA 4GXSB 3PPRA 1URSA 1KWHA 1I6BA 4TQUQ 4QSEA 1M5CA 2DVCA 4K3FA 4DIGA 5ELVA 1JEVA 1LCFA 1B46A 1POY1 1SYIA 1MXXA 1UIUA 2ZXTA 4I9DA 3PPQA 2DE3A 1BLFA 1MXVA 3MJNA 3O6GA 1ZLQA 3FJGA 4QFKA 1SDXA 2DWHA 2F7AA 3FV2A 4IY5A 2Q9TA 4OEVA 1ZJLA 4POXA 1Y3PA 2V93A 4ZEBA 4FEDA 3TAJA 1OQHA 3B7DA 4YKKA 3TDJA 5I56B 4LZ5A 1NNFA 1ELJA 4KYDA 4P0GA 3SDFA 4U4XA 4QFLA 1IITA 1B51A 3QSLA 4IO4A 4ECFA 3PPPA 5CRYA 5TP9B 4NMYA 5JTYA 2XXHA 1JVXA 4P0IA 4EQ9A 4DXUA 3C35A 4X1BA 1B4HA 1QUIA 2R9JA 3OEMA 1XT8A 4I1DA 3C9HA 3DP6A 4OFOA 2P0SA 4NWDA 1WDNA 2OBGA 3TFLA 3RUMA 1QUKA 2XXIA 3FJMA 2QJEA 4GF8A 1O64A 2WKYA 1B2HA 1IZ1A 1PEBA 2O7UA 3GBBA 3P7IA 2XX9A 2XXVA 4JB7A 1LBBA 4LZ7A 3PPOA 5J1DA 4IGTA 2PBWA 2V3QA 3OO8A 4JDFA 3C32A 1B7ZA 4GVOA 1P1UA 1B58A 4IB2A 4AB5A 1OIBA 1LFHA 2AL5A 3G3GA 4KI0E
chains in the Genus database with same CATH superfamily
1S50A 4U4SA 3EHUA 3FVGA 4FE8A 1IMBA 3CRBA 3VV5A 4NE4A 5FBPA 2O1MA 3K00A 4JBZA 2PVUA 5KDTA 4DE8A 5T3JA 3W15C 4OVQA 3W9VA 4TLMB 3V83A 1LAGE 1OQGA 3K6WA 3T1BA 4U22A 1Y20A 4HW8A 3Q25A 1PC3A 3KJTA 4H8IA 2FHYA 3C36A 1IEJA 3N6TA 1N84A 2Y7IA 1MXZA 3H3GA 5EYGA 4Q0CA 4R2FA 2OJTA 2W7YA 3VXCA 2UVGA 5KZTA 1TFDA 1EZ9A 1FRPA 1B9JA 2DXYA 1NI9A 4PFUA 1AMFA 1B7UA 4MLQA 5DTBA 1US4A 4OFLA 5I58A 2P3NA 2QVUA 4FECA 2HZKA 4HE0A 5DVIA 4H5FA 5BUUA 4N07A 3EF7A 4Z0IA 1M5EA 4N13A 3H6UA 3T9XB 3R6UA 1MH3A 3K1MA 4H1XA 4M1VA 4N8GA 4QFOA 2Q2AA 3Q29A 5J16A 3IB0A 4P1LA 1DTGA 4KXPA 2FVZA 1URDA 1I69A 2BJIA 1IMCA 3K6UA 1B7HA 1XHYA 3IFCA 3D4GA 2REGA 4KPTA 2NWJA 3JYRA 4C0RA 2P1SA 4RYAA 4MHFA 4JVDA 2CZLA 3FVKA 4PBQA 3E9XA 1SPIA 5L9OA 3R26A 5A5XA 2QMXA 2I6EA 2GRVA 3GLBA 2AL4A 4KCCA 3E79A 3PUYE 2OX3A 2MKZA 5AA3A 1VSOA 1NMUA 4EXLA 2DWAA 1AIVA 3IB1A 1LB8A 2JJKA 3V8XB 2O84X 2XXWA 3BKIB 2ZNUA 3WAFA 2NUVA 5IZ1A 3TCFA 1B5HA 1RYXA 4OEUA 2XXKA 2HZLA 4N6PA 3C31A 2M8CA 3B50A 1P99A 2RCBA 5JTYB 5LDZA 3DP4A 4I3YA 3S4UA 1ZTYA 2F5XA 4OWDA 5H8HA 1IUDA 3G3JA 3QUJA 3C34A 4GWWA 5I84A 2I4BA 3OO6A 4PFWA 1Q1KA 1NNTA 1PB8A 4MH5A 3KOSA 4UABA 2OWZA 3B8BA 2O7IA 3S9LC 1EH3A 3KSJA 3TTKA 2AYSA 1MRPA 2L5VA 1QKAA 3U1OA 1RYOA 3VXBA 4P8BA 1IIWA 4I3EA 4NF6B 4LATA 1Y9UA 4OYVA 3LR1A 3OD7A 1IXGA 1F9BA 3PGFA 3KJ7A 4P47A 3MW0A 3IOWA 1PDAA 4R6HA 2RC9A 1DCUA 1P1WA 4OHNA 3U92A 4HS7A 4GQOA 4Q5TA 3OSQA 4OVSA 1EYJA 4RJZA 1OVTA 1ATGA 2ABHA 2WYPA 2RKMA 1PB9A 3CG3A 1JW1A 1MQDA 1NFTA 3FXUA 5CI5A 1LBCA 1SI1A 4WEDA 3U8QA 1S9TA 3M3KA 3CFXA 4H6DA 1LBZA 3SEWA 3U94A 5FHOA 2X26A 4H46A 3ZKKA 2H98A 1MXUA 3MP6A 1ZKBA 3RTWB 4DI3D 1DMBA 2X7QA 2ALUA 4G8HA 4GWOA 2CMOA 4MMPA 4OZ9A 5FTIA 1G0IA 2THIA 3VVDA 1EU8A 4RK9A 4F3SA 4GFRA 5A5XB 2PCRA 3TQLA 3FZVA 3ZSFA 3D4CA 1SW2A 4R72A 3PD8A 4F1YA 3K1PA 3HN0A 1LBYA 4O7IA 2E1SA 4X9TA 5CBRA 4PE5B 1A8FA 3KG2A 5CM6A 4PAFA 3SKPA 2CZHA 3IORA 4KYEA 1T0KA 4JWYA 1B4ZA 3K01A 3OELA 3MVYA 3Q27A 4MF3A 4KFQA 4P9KA 1B1XA 4KQPA 4YB7A 1DK4A 2GHBA 4EF1A 3KBRA 1JQFA 4I62A 1XC1A 4BDMA 2XHDA 4X8RA 1B0LA 1GGGA 2HEUA 1Z7ME 3TTMA 4N6KA 2QSXA 1VR5A 3G3IA 1B3LA 4QFPA 5ET8A 2I49A 4O3AA 3K2DA 2OZZA 2PX1A 1OLCA 2ESNA 5K2YA 3G3HA 2Q88A 1WVJA 1B6HA 1XI6A 2XWVA 2KR0A 2ANJA 5ICQA 4XXUA 4G8MA 2VD3A 1XS5A 3HSTA 4G68C 3H06B 4MEVA 1MY3A 4GD5A 3MZBA 1NV5A 1HSEA 1P1NA 2Y7PA 4GXSB 1URSA 2DVCA 4K3FA 1MXXA 1MXVA 3O6GA 1SDXA 4OEVA 4POXA 5CBSA 4ZEBA 2Q9TA 4FEDA 3B7DA 4LZ5A 1NNFA 1IITA 4GX4A 4IO4A 5TP9B 5JTYA 1JVXA 4P0IA 2PFZA 4X1BA 1QUIA 1G0HA 1XT8A 4I1DA 4GBWA 2P0SA 1WDNA 3RUMA 2VT5A 2O7UA 3P7IA 2XXVA 3PPOA 4NAPA 3OO8A 5A5LA 3C32A 1B7ZA 4MNCA 3G3GA 2VHAA 1FPGA 2V3TA 3O6IA 4MFIA 1FTMA 3OXNA 2B3FA 3C33A 2ONRA 1IXCA 2XXRA 1Q35A 3LV0A 1SW5A 1H3DA 2QVVA 1I6QA 4JWXA 2XXPA 3USDA 3MVWA 4BDOA 1INPA 4OVJA 2I0BA 4OTEA 2HPGA 1DOTA 5I57A 2Z8EA 1ZBMA 4PFYA 3HHGA 4G68B 3TPAA 1M5BA 1NV3A 3PU5A 4DXBA 2QS2A 3EPEA 4MNIA 3FJ7A 4FBPA 4EXKA 3IOVA 4GWXA 4O7MA 2FYIA 3TZAA 1WODA 2NXOA 4UACA 4Q8RA 5L9MA 3PMWA 3VVEA 5I57B 1B3EA 5CMCA 1BIYA 1TT1A 4QSCA 5H8SA 2O1LA 4N81A 3OEKA 3CG1A 2REJA 3UIFA 2P3VA 3JV9A 3QK6A 4DDDA 3D1RA 4G61A 1IXIA 4OVTA 3EHTA 3RY3A 1B3HA 1R1NA 2FA7A 4P1EA 2ZMBA 2PYYA 3T93B 3RTFB 2AIXA 4JVCA 2G29A 4G2ZA 3A29A 3CFLA 3EN3A 2GFEA 4OMBA 4AQ4A 3IAZA 1URGA 1VFEA 1DSNA 4H0WA 1JETA 4F2QA 2OLBA 4F29A 5K2XA 5TPAA 3DM0A 2ZZXA 2OWTA 5H8QA 4NG7A 4G8NA 1B32A 2OWSA 3OO9A 4F31B 3HHFA 2P2AA 4XIGQ 3RQTA 1B05A 5I58B 1USYE 2XX8A 2ZYKA 1XOCA 3T96B 3I3VA 1PBPA 2V84A 4ZEFA 4NF5A 4I8CA 3LSXA 3GBAA 3E78A 2I3WA 3OSRA 4YMAA 1LFGA 1LB9A 1NKXA 3KC0A 3CSBA 1FPDA 3E3KA 4GWYA 4H45A 2RC8A 4RNSA 3TQWA 4GWZA 2XD3A 4RPOA 2XXTA 5ET5A 3TODA 5HBCA 3C4MA 3SEXA 3IJXB 3LUYA 3OOAA 3E13X 2RF1A 4U23A 5FTHA 1AH5A 3THIA 4M4GA 4OVRA 3KN8A 2VD2A 2HCAA 5KDTB 2WBBA 2UVIA 2WX9A 4NEDA 4AS4A 3PUVE 3K6VA 5JK4A 3IOTA 4PDDA 1SBPA 4YZZA 4NF4B 4PGNA 2V4CA 3MP8A 3HO7A 5J1DA 2XXUA 1JEUA 2G93A 2QPQA 4C1TA 1GVCA 3VLWA 4LQ2A 2Z23A 4P11A 1YCJA 1D9QA 2B65A 4PFIA 2XWKA 4KHZE 1BTJA 1H76A 2Y7RA 4ND9A 4BDLA 2BJJX 5AA2B 3O97A 4ELPA 1MY4A 4QHQA 1B0HA 2F8DA 3Q26A 4BDNA 3K4UA 4P3LA 2A5SA 4BDRA 2PFYA 4XFEA 1USYH 2XWIA 5EHSA 3BIHA 5H8HB 3TYHA 5CMKA 1QUJA 4GX3A 3B6TA 4NQ8A 4O8MA 4LA9A 1Y3QA 4IO5A 2KLFA 1CNQA 4KYSA 3N94A 3AXFA 4GIZA 3T0JA 5JEIA 2I4CA 1UTHA 3VLVA 4FATA 2QS3A 4I40A 2QVRA 4NGUA 2Z8FA 3IOUA 1QVSA 1NUWA 4LZ8A 2F6PA 2ZZVA 4ELOA 3BFUA 2D3IA 4HE1A 3FASA 1SW1A 3RLFE 1VDWA 2HXRA 5TPAB 3QUFA 4P56A 4U1OA 3ODBA 5HM4B 3H6TA 5H8QB 3H03A 2A5TA 3H7MA 3TCGA 2UVHA 1AL3A 2Y5KA 4JSOA 3M3LA 1LSTA 1FBPA 4PFTA 3A09A 3M3FA 5F24A 1XVXA 3FXBA 3VFJA 3KGCA 2F34A 5AA4B 3MC2A 2NVUB 1L5TA 4MX6A 2F3BA 1MY1A 4H67A 1Y3NA 1SD3A 2HQ0A 2QFLA 4LUBA 5EQ9A 3QMFA 1I6AA 3U93A 3RN8A 4PC9A 3TELA 3G3KA 3TUSA 4XEQA 1R9QA 1KA1A 3O29A 4O3BA 1CE2A 4RXLA 4PCDA 3LUZA 3S9MC 2CEYA 3FXRA 1RDXA 3H6VA 3QIMA 1FPFA 2DS9A 3S9NC 3T9UA 1ZMGA 2R8TA 4OESA 3RPLA 3A3UA 1NUYA 1JP4A 4GWUA 5EQAA 4KD5A 3PD9A 1FBFA 3VE1B 3KN3A 1NH8A 4NF8A 2ZNTA 1N04A 3I6VA 1MS7A 3N6UA 3PTYA 1B5JA 3QYTA 4C1UA 1FCKA 4PFRA 4U2RA 1I6BA 1M5CA 4DIGA 1JEVA 3PPQA 2DE3A 4PFBA 1Y3PA 4YKKA 1FJ6A 3TDJA 1IMDA 3PPPA 4QBAA 4NMYA 1B4HA 4OFOA 4NWDA 3TFLA 1QUKA 4GF8A 2XXIA 2ZZWA 1O64A 4DXUA 5DW8A 1IZ1A 5IGAA 2PBWA 4JDFA 4GVOA 1B58A 4F39A 3O9PA 1FTOA 3IB2A 2XD2A 3MBPA 5AE4A 3IK6B 5I56A 3IO6A 4KR5A 4GL8A 2A5TB 3B6WA 3BFTA 2DSFA 1A99A 3IO4A 1JVYA 4PE3A 4MJOA 3FV1A 3K02A 4ELQA 3TCHA 3MAMA 4EF2A 1YZ0A 4QSDA 1MM7A 1TXFA 4R75A 2DWIA 1RKMA 2WBDA 1LGBC 1FTJA 4XTCQ 1A55A 5DVJA 4HCYA 1YAEA 2ZNSA 4AS5A 1CB6A 2OCUA 2O6AA 3CFZA 1NH7A 1QGXA 4R2BA 1NV0A 1FBGA 4PDHA 2Q74A 3FVNA 2F35A 1FPEA 4PAKA 5LTCA 3U72A 3IX1A 4PF6A 1Y4TA 4HE2A 2OK2A 4IGRA 1HSLA 4YKJA 1N76A 2O68A 3VLUA 4MAGA 4QFNA 3CHGA 3H4ZA 3T22A 3MVZA 5H8NA 4FORA 1D4NA 3LBSA 1B3FA 3O2AA 1R6ZA 3WAEA 1FSAA 4F3BA 2O51A 2R71A 1R9LA 4UA8A 2Y7WA 1A54A 4OA4A 2ZYOA 2ONSA 1N7XA 4XF5A 3LC8A 2F3DA 2VPNA 2HHMA 4GBVA 1MY2A 4OVPA 1POTA 1FPIA 3PV0E 4F3GA 3GZGA 3KN7A 5I59A 2F36A 2X7PA 3W9WA 4HCWA 4XKPA 3SERA 1OLAA 1IQ7A 3TTNA 3V89B 1FTAA 1NV2A 1MDP1 2CEXA 4G4PA 1H44A 3FIRA 4N15A 4R9GA 2Z8DA 1MQJA 1P1OA 3UN6A 4N91A 4BDQA 1FBDA 2QMWA 1D3KA 5I2NA 2V3UA 2H4IA 4XKRA 2R6GE 2GQ1A 1QKBA 3S2VA 3VDFA 1Q9DA 2Y5LA 4E0WA 5TP9A 4GRKA 5I3SA 4G77A 4N6DA 3ZKLA 3RGYA 4JSDA 4Z7EA 4F3PA 3O28A 3O66A 1B1HA 1TWYA 1NV4A 2FNCA 1LAFE 4ZZEA 4E0XA 1NNPA 1FQFA 4NWCA 1B52A 1S7YA 3H6WA 5ISUA 1LFIA 2UXAA 4NF6A 4OXVA 3PPNA 1MPDA 4R74A 4WEPA 5AA2D 5DVFA 3CSGA 3LSFB 4NTLA 1SVXB 5B7DA 3ONMA 3IR1A 1NL5A 4NX1A 2GHAA 4F19A 4DCXA 2VGQA 3IJOB 2PT2A 3G7WA 2HAVA 1UQWA 2IA4A 2D21A 4WKMA 1O63A 2B4MA 2YJPA 2UYEA 3MSTA 3BBRA 4R6YA 2I3VA 4Q30B 4O3CA 1IMAA 3OENA 1LBWA 4LP2B 4TLLB 4LVQA 3MPKA 2HFBA 5H8FA 5ICTA 4F18A 2CZKA 3HV1A 3FGSA 1FTLA 2F97A 3FATA 1J1NA 2XX7A 1UTBB 4YU0A 3RT8A 1DPEA 4DXCA 3SEVA 4JXIA 5TU0A 2DQVA 3DELB 1D9VA 3SZPA 4EQBA 1FQCA 1H45A 2F7BA 1KA0A 5LOMA 1SYHA 4U1ZA 4DI4B 2I58A 5I59B 3T66A 3UK4A 2WYKA 1QULA 2Y84A 3T9HB 5IZ3B 3SESA 4X1DA 4N17A 1UTBA 3OO7A 5I2NB 4LN5A 4GX6A 4AB6A 1MPBA 4TOZA 3K1NA 3LSLA 2Q8MA 2HXWA 4YB6A 1FJ9A 1MXYA 1B3GA 3L6HA 3MP1A 1EZOA 3MYUA 2XXXA 4H8JA 2F7CA 3KBZA 1OMPA 2DVZA 1ZIUA 4IO6A 2XWOA 4NF5B 3KFMA 4GWSA 4YB5A 3RT6B 3FBPA 4EQ7A 3KOTA 1QW0A 3TTRA 1MDQA 1NUZA 4DLDA 2QS4A 2DE2A 3QAXA 5BWJA 3DLNA 2ZYMA 3FVOA 3KC1A 1FBEA 1ZU0A 3QXMA 3SEUA 2RINA 3U65A 1LCTA 4PAIA 1FQBA 3GYYA 5IZZA 4YKIA 1GTKA 1FBCA 5H8FB 5M2VA 3FD3A 5AA4A 1FTKA 4WXJA 3KSXA 3CR9A 1LLSA 4NF8B 3HFUA 4QSEA 5ELVA 1LCFA 4MNPA 5I7IA 1B46A 1POY1 1SYIA 2ZXTA 5IZ3A 4QFKA 3MJNA 1ZLQA 3FV2A 2F7AA 4IY5A 1ZJLA 4NF0A 3TAJA 1OQHA 5ESYA 4ECFA 5CRYA 1K9ZA 2XXHA 1LEVA 3OEMA 3C9HA 1FPKA 4RA1A 2QJEA 2WKYA 1PEBA 4LZ7A 2XX9A 4JB7A 1P1UA 1OIBA 1LFHA 2AL5A 4EQ9A 4KI0E 5IM2A 3T9VA 4RK2A 1FW0A 4IO7A 5DYHA 3FUZA 2VOZA 3ISPA 5ITPA 4NN3A 4YAHX 2F6GA 4QF9A 2NOOA 2DE4A 4EUOA 3EHSA 3PUZE 1N3WA 1N0TA 1RDZA 4XKQA 1IXHA 3TTLA 1QJMA 2B3BA 3A3CA 3TKDA 3I5OA 5I5PA 4ONYA 1MQGA 5I2KA 3MVXA 4OANA 3NOHA 2KQZA 2I0CA 3N5LA 1A7LA 2HAUA 4MIJA 3ECRA 1NUXA 3DP8A 4GLIA 4R73A 4DZ1A 4ZEDA 3GXAA 3CI8A 4G68A 2YLNA 5EHMA 1P1QA 5EYFA 4MLVA 4H5GA 4OQOA 1M5FA 3KEIA 5IAIA 3N26A 3PMVA 2Q8JA 4YKPA 1VFDA 3MWBA 2DXRA 3SEYA 2H99A 1Z7NE 2RCAA 2QL3A 3M8UA 2UYFA 1OVBA 3CIJA 3HPIA 4LONB 3MZ9A 4KCDA 4ZE9A 4JWOA 1JW4A 1PB7A 5AA1A 1DTZA 1UIVA 1A40A 3MQ9A 2B4LA 1KZ8A 3BIGA 3RYDA 3L6GA 1MM6A 4OENA 2E0SA 3ILUB 1SQYA 3CVGA 4F1VA 2Z22A 2ONKE 5I2KB 3E4RA 1AWBA 4FEBA 3LSWA 4ZE8A 4GOTA 4OERA 4YMBA 4RY1A 3ROJA 1MH4A 2PT1A 1JNFA 4RPNA 1MQHA 3PUWE 1B40A 1LBVA 2VP1A 4X04A 5L9SA 2GH9A 4H65A 2Y7KA 1Y1MA 1YPNA 3MPLA 4IO2A 4PETA 5EQ7A 1MQIA 5EYHA 4PBHA 2CZIA 3TEPA 4THIA 2DOJA 2XXQA 4YICA 4LQ5A 4FAJA 4ZEIA 5KCJB 4IY6A 3MUQA 1M5DA 4L17A 3Q28A 2I48A 2ZYNA 3G3FA 1FQEA 1FBHA 4QXDA 3PUXE 1FPBA 1K9YA 2DP8A 3K0VA 2FIXA 1DBZA 4ISUA 1FQDA 5B70A 4ZZAA 3RPWA 5CMBA 3B6QA 1FPJA 3JZJA 4ZS9A 5HPQA 1BK4A 1JW5A 4OETA 1YYZA 3S9EA 3VVFA 1MG1A 1LAXA 4ESXA 2XXYA 1NV7A 1TFAA 1FPLA 4XKNA 1EZPA 1SI0A 1O7TA 4PF8A 4GL0A 1BP5A 3KZGA 1FQAA 1SW4A 1EYIA 1Y4CA 1EYKA 3EQ1A 5IKBA 3SETA 1GV8A 4U21A 2DYXA 4F2OA 4QRZA 3UORA 1YXIA 4HTGA 4ZEKA 2RC7A 4ELRA 3IL1B 2XA5A 5CC2A 4HXVA 5EQ8A 2QS1A 4R9FA 5FHMA 2DDKA 4GXAA 2QRYA 2LAOA 2V25A 1VE4A 5ITOA 4ZDMA 2WEFA 1XVYA 3TMGA 3UA8A 4AB5A 5DEXB 4BLAA 2FIEA 1NV6A 1BKAA 4DCYA 5H8NB 1MXWA 1IMFA 4PQJA 4PP0A 5F7VA 1MY0A 5AA2A 3MZ1A 1H43A 1MPCA 4IR8A 4OFJA 4FIMA 2PMSA 2YPNA 1D9YA 1PBQA 2H25A 4MBPA 5DEXA 4NF4A 1UTHB 5L8DA 2VPOA 3ILTB 2IEEA 1Y1ZA 3RPLB 5CMMA 1A8EA 1LAHE 1YTVA 4X48A 1AOVA 2UVJA 3PMXA 2O69A 3O6HA 4IO3A 1RDYA 4EDPA 1II5A 4F1UA 3K6XA 1GR2A 3F11A 2H5YA 1N7WA 3RNNA 1IMEA 1B5IA 1NNKA 1N3XA 1NV1A 4JVIA 3V5AA 5FHNA 2Q89A 2DWJA 4ZECA 2Q2CA 3EKIA 3UGWA 1US5A 3UP9A 5F1QA 4O94A 1LBXA 4PGPA 2F78A 5DT6A 3HCQA 3FXQA 4ESWA 1DPPA 4F22A 1HSJA 4NHBA 1ANFA 4FJPA 4N4UA 3OMBA 2D5WA 4POWA 2H9BA 5ET7A 3PPRA 1KWHA 4TQUQ 1UIUA 4I9DA 3IFAA 1BLFA 2FBPA 3ZS6A 5KCJA 3FJGA 2DWHA 2V93A 5I56B 1ELJA 4KYDA 4P0GA 3SDFA 4U4XA 4QFLA 1B51A 3QSLA 3C35A 2R9JA 5ET6A 3DP6A 2OBGA 4R6KA 3FJMA 4MCOA 3R7XA 1B2HA 3GBBA 1LBBA 4IGTA 2V3QA 4IB2A 4N8YA 4PTKA
chains in the Genus database with same CATH topology
2VHAA 3O9PA 3T9VA 1S50A 4RK2A 2V3TA 3O6IA 4MFIA 4U4SA 1FTMA 3OXNA 1FW0A 1FTOA 2B3FA 3EHUA 3IB2A 2XD2A 3MBPA 4IO7A 3FVGA 3C33A 2ONRA 1IXCA 2XXRA 5AE4A 4FE8A 5DYHA 3CRBA 3IK6B 3VV5A 5I56A 3FUZA 1Q35A 2O1MA 2VOZA 3IO6A 4NE4A 4KR5A 4GL8A 2A5TB 3K00A 1SW5A 3B6WA 4JBZA 5ITPA 2PVUA 5KDTA 1H3DA 3BFTA 4DE8A 4YAHX 2DSFA 2F6GA 3W15C 1A99A 3W9VA 3IO4A 4QF9A 1I6QA 4JWXA 4TLMB 1JVYA 3V83A 2NOOA 2XXPA 1LAGE 1OQGA 2DE4A 3EHSA 3K6WA 3USDA 4EUOA 3PUZE 1N3WA 3FV1A 1N0TA 3K02A 4U22A 4XKQA 3TCHA 4ELQA 1IXHA 1Y20A 3MVWA 3MAMA 4BDOA 4EF2A 3TTLA 1QJMA 4QSDA 4HW8A 2B3BA 3A3CA 1MM7A 3Q25A 3TKDA 1PC3A 1TXFA 3I5OA 4OVJA 2DWIA 2I0BA 4R75A 4ONYA 1RKMA 1MQGA 3KJTA 4OTEA 3MVXA 4H8IA 1DOTA 1LGBC 1FTJA 5I2KA 4XTCQ 1A55A 5I57A 3C36A 2I0CA 5DVJA 1IEJA 2Z8EA 1ZBMA 4PFYA 3HHGA 3N5LA 4G68B 4HCYA 3TPAA 1YAEA 2ZNSA 1M5BA 1A7LA 3PU5A 3N6TA 4DXBA 1CB6A 2OCUA 2HAUA 2O6AA 3CFZA 2QS2A 1N84A 1NH7A 3ECRA 3EPEA 3DP8A 3FJ7A 4GLIA 2Y7IA 1MXZA 3H3GA 4R2BA 4R73A 4DZ1A 4EXKA 4ZEDA 4Q0CA 3IOVA 3FVNA 3GXAA 4R2FA 2OJTA 3CI8A 4G68A 2FYIA 2W7YA 2UVGA 2YLNA 5EHMA 3VXCA 5KZTA 3TZAA 1TFDA 2F35A 1P1QA 1WODA 2NXOA 1EZ9A 5EYFA 4MLVA 4H5GA 4OQOA 1B9JA 1M5FA 2DXYA 4UACA 3KEIA 4PFUA 4Q8RA 5L9MA 1AMFA 3U72A 3IX1A 5IAIA 3PMWA 1Y4TA 1B7UA 3N26A 2OK2A 3VVEA 4MLQA 5DTBA 5I57B 3PMVA 1US4A 4IGRA 2Q8JA 1B3EA 1HSLA 4OFLA 5CMCA 5I58A 4YKPA 1BIYA 1VFDA 3MWBA 4FECA 2HZKA 1TT1A 4YKJA 4QSCA 5DVIA 5H8SA 4H5FA 2DXRA 2O1LA 4N07A 5BUUA 3EF7A 3SEYA 4Z0IA 1M5EA 2H99A 4N13A 3H6UA 1N76A 3OEKA 2O68A 3CG1A 3T9XB 3VLUA 1Z7NE 2REJA 3UIFA 2RCAA 2QL3A 3R6UA 3JV9A 3QK6A 3M8UA 1MH3A 2UYFA 4DDDA 1OVBA 3CIJA 3K1MA 4H1XA 4M1VA 3HPIA 4QFOA 2Q2AA 4LONB 1IXIA 4QFNA 3H4ZA 3T22A 3MZ9A 3Q29A 3EHTA 3RY3A 1B3HA 4KCDA 3MVZA 4ZE9A 1R1NA 2FA7A 5H8NA 2ZMBA 3IB0A 4JWOA 4FORA 1D4NA 1JW4A 2PYYA 1DTGA 3T93B 3LBSA 1PB7A 3RTFB 2AIXA 2G29A 1B3FA 4G2ZA 5AA1A 3O2AA 1R6ZA 1DTZA 3CFLA 3WAEA 1UIVA 1URDA 1A40A 4F3BA 1I69A 2O51A 3MQ9A 2R71A 1R9LA 3EN3A 5I59B 4UA8A 2GFEA 4OMBA 3L6GA 1MM6A 1URGA 2Y7WA 3IAZA 3K6UA 1VFEA 4R6KA 4AQ4A 1DSNA 1A54A 4H0WA 4OENA 1B7HA 1JETA 2E0SA 2ZYOA 4F2QA 2ONSA 2OLBA 4F29A 1N7XA 5K2XA 5TPAA 1XHYA 3ILUB 3DM0A 3LC8A 3D4GA 2REGA 4KPTA 2NWJA 2OWTA 3JYRA 1SQYA 3CVGA 1MY2A 5H8QA 4F1VA 2Z22A 4C0RA 2P1SA 1POTA 4RYAA 3PV0E 2CZLA 3FVKA 2ONKE 4G8NA 5I2KB 3E4RA 3GZGA 3KN7A 4F3GA 3E9XA 5I59A 1B32A 4FEBA 2F36A 3LSWA 4ZE8A 2OWSA 2X7PA 3OO9A 4GOTA 3W9WA 4HCWA 4XKPA 4F31B 3SERA 5L9OA 1OLAA 1IQ7A 3HHFA 2P2AA 3R26A 3TTNA 4OERA 4XIGQ 3V89B 4YMBA 2QMXA 5A5XA 2I6EA 1MDP1 3RQTA 4RY1A 1B05A 4G4PA 5I58B 2GRVA 1H44A 3FIRA 3GLBA 2AL4A 1USYE 4KCCA 1MH4A 2PT1A 2XX8A 1JNFA 4R9GA 2Z8DA 3PUYE 4RPNA 2ZYKA 1MQJA 1MQHA 1XOCA 3T96B 1P1OA 3UN6A 1VSOA 1NMUA 3PUWE 1B40A 4EXLA 2VP1A 5AA3A 4BDQA 5L9SA 2DWAA 2GH9A 4H65A 2Y7KA 1PBPA 3I3VA 1AIVA 1Y1MA 1YPNA 2V84A 3IB1A 3MPLA 4IO2A 4ZEFA 4NF5A 4PETA 2QMWA 4I8CA 1LB8A 1MQIA 3LSXA 3GBAA 1D3KA 2I3WA 3OSRA 4YMAA 1LFGA 5I2NA 3TEPA 3V8XB 2O84X 2V3UA 1LB9A 2XXWA 1NKXA 3BKIB 3ZS6A 2ZNUA 4THIA 2DOJA 2H4IA 2XXQA 3CSBA 4XKRA 4YICA 5CBSA 4LQ5A 2NUVA 3E3KA 4ZEIA 3WAFA 2RC8A 4FAJA 5KCJB 2R6GE 3MUQA 4IY6A 4RNSA 1M5DA 3TCFA 4L17A 3Q28A 1B5HA 1RYXA 3R7XA 3TQWA 4OEUA 1QKBA 2I48A 3S2VA 2XD3A 2ZYNA 3G3FA 4RPOA 2XXTA 3VDFA 2HZLA 1FQEA 4N6PA 3C31A 2M8CA 3PUXE 3TODA 4E0WA 5HBCA 1P99A 3C4MA 2RCBA 5JTYB 3SEXA 2DP8A 3IJXB 3K0VA 5TP9A 3LUYA 3DP4A 3OOAA 3E13X 3S4UA 4GRKA 1ZTYA 4G77A 2F5XA 4OWDA 5H8HA 2RF1A 4ISUA 1FQDA 3ZKLA 5B70A 3RGYA 4ZZAA 1IUDA 3RPWA 4U23A 4JSDA 5FTHA 4Z7EA 3G3JA 1AH5A 3QUJA 3O28A 3O66A 4M4GA 1B1HA 1TWYA 3THIA 3C34A 4F3PA 2FNCA 3KN8A 1LAFE 4ZZEA 2VD2A 2HCAA 5CMBA 5I84A 5KDTB 3B6QA 2I4BA 4E0XA 2UVIA 3OO6A 4NEDA 4PFWA 1Q1KA 1NNTA 1PB8A 3JZJA 3PUVE 1NNPA 4ZS9A 5HPQA 4MH5A 1FQFA 4NWCA 3K6VA 5JK4A 1B52A 1S7YA 3IOTA 3KOSA 3H6WA 5ISUA 1JW5A 1SBPA 1LFIA 4YZZA 2O7IA 2UXAA 4NF6A 4NF4B 4OXVA 3S9LC 3PPNA 4OETA 1MPDA 3MP8A 4R74A 4WEPA 5AA2D 1EH3A 3S9EA 5DVFA 3HO7A 3CSGA 3KSJA 3LSFB 3TTKA 1MG1A 4NTLA 2XXUA 3VVFA 1LAXA 2AYSA 4ESXA 1JEUA 2G93A 2QPQA 1MRPA 2XXYA 1SVXB 4C1TA 1GVCA 5B7DA 1QKAA 1TFAA 3U1OA 1RYOA 4XKNA 3ONMA 3VXBA 3VLWA 4LQ2A 3IR1A 1IIWA 2Z23A 1EZPA 1SI0A 1O7TA 4NF6B 4GL0A 4LATA 4P11A 1NL5A 1Y9UA 3LR1A 3OD7A 1BP5A 1IXGA 1F9BA 1YCJA 4OYVA 2B65A 3PGFA 2GHAA 4F19A 3KZGA 1FQAA 3KJ7A 4KHZE 1SW4A 1BTJA 4DCXA 1H76A 1Y4CA 3EQ1A 2Y7RA 3MW0A 4ND9A 3IOWA 4BDLA 1PDAA 4R6HA 5IKBA 2VGQA 3IJOB 3SETA 2RC9A 1P1WA 3U92A 4OHNA 2PT2A 3G7WA 4HS7A 1GV8A 2HAVA 2BJJX 4U21A 1UQWA 2IA4A 3O97A 4ELPA 5AA2B 2D21A 1MY4A 2DYXA 1B0HA 4GQOA 4QHQA 2F8DA 1O63A 4Q5TA 3Q26A 4QRZA 4WKMA 4F2OA 2YJPA 2UYEA 3OSQA 3UORA 3BBRA 4BDNA 3K4UA 4RJZA 2A5SA 4BDRA 4HTGA 4R6YA 1OVTA 4ZEKA 2RC7A 4ELRA 1ATGA 3IL1B 1USYH 5CC2A 2I3VA 2ABHA 4Q30B 5EHSA 4O3CA 2RKMA 2QS1A 5H8HB 3OENA 1PB9A 4R9FA 5FHMA 4GXAA 3CG3A 3TYHA 5CMKA 4LP2B 1JW1A 1MQDA 1NFTA 1QUJA 2QRYA 3B6TA 2LAOA 3FXUA 4LVQA 4RA1A 2V25A 4LA9A 4TLLB 5CI5A 1LBCA 1VE4A 3MPKA 1SI1A 5ITOA 2HFBA 5H8FA 1Y3QA 4IO5A 2KLFA 4WEDA 3U8QA 4F18A 5ICTA 1S9TA 4KYSA 3HV1A 3M3KA 4ZDMA 3N94A 3AXFA 1XVYA 4GIZA 3FGSA 3TMGA 1FTLA 5JEIA 2F97A 5KCJA 2I4CA 3UA8A 3CFXA 3FATA 4H6DA 1UTHA 1J1NA 3VLVA 3SEWA 3U94A 2XX7A 5DEXB 2QS3A 4FATA 4BLAA 1UTBB 4YU0A 3RT8A 5FHOA 1DPEA 2X26A 1BKAA 4DXCA 4DCYA 2Z8FA 5H8NB 3IOUA 3SEVA 4JXIA 1MXWA 3ZKKA 5TU0A 4PQJA 1QVSA 2H98A 4LZ8A 2F6PA 4PP0A 4ELOA 1MXUA 3BFUA 2DQVA 1MY0A 2D3IA 3DELB 5F7VA 1D9VA 3FASA 1SW1A 3MP6A 3RLFE 1ZKBA 4EQBA 3RTWB 1FQCA 5TPAB 3QUFA 1H45A 4U1OA 5AA2A 3ODBA 5HM4B 1DMBA 3MZ1A 2F7BA 1H43A 2X7QA 3H6TA 1MPCA 2ALUA 5H8QB 4G8HA 4GWOA 2CMOA 3H03A 5LOMA 1SYHA 4OZ9A 2A5TA 3H7MA 5FTIA 2UVHA 4OFJA 3TCGA 1AL3A 2THIA 4U1ZA 2I58A 1EU8A 4FIMA 3T66A 4RK9A 3UK4A 3VVDA 2PMSA 1QULA 1D9YA 2Y84A 2YPNA 4GFRA 4JSOA 3T9HB 4F3SA 3SESA 4X1DA 1PBQA 2H25A 4MBPA 5A5XB 5DEXA 3M3LA 4NF4A 1UTBA 1UTHB 1LSTA 3FZVA 5L8DA 3TQLA 3ZSFA 3OO7A 3D4CA 1SW2A 4R72A 3ILTB 3PD8A 4F1YA 5I2NB 3K1PA 3HN0A 3A09A 2IEEA 4PFTA 1Y1ZA 3M3FA 1XVXA 4AB6A 5CMMA 3VFJA 1A8EA 1MPBA 3KGCA 4TOZA 3K1NA 1LAHE 1YTVA 2E1SA 2F34A 3LSLA 4X48A 4X9TA 5AA4B 1AOVA 3MC2A 2NVUB 1L5TA 2HXWA 5CBRA 1MY1A 2UVJA 4YB6A 4PE5B 1A8FA 3KG2A 1Y3NA 1MXYA 1SD3A 2HQ0A 1B3GA 4H67A 5CM6A 3L6HA 3MP1A 4LUBA 3SKPA 3PMXA 2O69A 3IORA 1EZOA 3O6HA 4IO3A 4KYEA 1T0KA 1I6AA 3U93A 3RN8A 2XXXA 4H8JA 4EDPA 2F7CA 4JWYA 1OMPA 2DVZA 1B4ZA 3K01A 3TELA 1II5A 3G3KA 3OELA 3MVYA 3Q27A 4MF3A 3TUSA 1ZIUA 4KFQA 4F1UA 4IO6A 1B1XA 4KQPA 1R9QA 4YB7A 3K6XA 1GR2A 3F11A 2H5YA 3O29A 4NF5B 3KFMA 2GHBA 4EF1A 3KBRA 1JQFA 4F39A 4YB5A 3RT6B 4I62A 4O3BA 1N7WA 3RNNA 1CE2A 1XC1A 1B5IA 4RXLA 4BDMA 2XHDA 3S9MC 1B0LA 1GGGA 1NNKA 1Z7ME 2HEUA 4EQ7A 1N3XA 3TTMA 3KOTA 1QW0A 3TTRA 2QSXA 1VR5A 1MDQA 3G3IA 1B3LA 3FXRA 4QFPA 5FHNA 3V5AA 2I49A 2Q89A 2DWJA 4O3AA 3H6VA 3K2DA 4DLDA 2Q2CA 2QS4A 4ZECA 3QIMA 2DS9A 3S9NC 2DE2A 3T9UA 3QAXA 2OZZA 3UGWA 1ZMGA 2PX1A 3DLNA 2ZYMA 3FVOA 4OESA 1US5A 5BWJA 3UP9A 3A3UA 1OLCA 5F1QA 1ZU0A 2ESNA 3QXMA 5K2YA 3G3HA 2Q88A 3SEUA 2RINA 1WVJA 1B6HA 1LCTA 2F78A 3PD9A 4KD5A 2ANJA 1FQBA 5DT6A 3HCQA 3FXQA 5ICQA 4XXUA 3VE1B 4ESWA 4YKIA 4G8MA 3KN3A 1DPPA 4F22A 1NH8A 1HSJA 1GTKA 4NF8A 1ANFA 2VD3A 4FJPA 2ZNTA 1N04A 1XS5A 3HSTA 3I6VA 4G68C 3OMBA 1MS7A 2D5WA 3H06B 4POWA 3N6UA 5H8FB 5M2VA 1MY3A 3FD3A 5AA4A 1B5JA 1FTKA 4GD5A 3QYTA 4WXJA 3MZBA 1FCKA 3KSXA 4C1UA 2H9BA 3CR9A 1LLSA 4NF8B 1HSEA 1P1NA 4U2RA 2Y7PA 4GXSB 3PPRA 1URSA 1KWHA 1I6BA 4TQUQ 4QSEA 1M5CA 2DVCA 4K3FA 4DIGA 5ELVA 1JEVA 1LCFA 1B46A 1POY1 1SYIA 1MXXA 1UIUA 2ZXTA 4I9DA 3PPQA 2DE3A 1BLFA 1MXVA 3MJNA 3O6GA 1ZLQA 3FJGA 4QFKA 1SDXA 2DWHA 2F7AA 3FV2A 4IY5A 2Q9TA 4OEVA 1ZJLA 4POXA 1Y3PA 2V93A 4ZEBA 4FEDA 3TAJA 1OQHA 3B7DA 4YKKA 3TDJA 5I56B 4LZ5A 1NNFA 1ELJA 4KYDA 4P0GA 3SDFA 4U4XA 4QFLA 1IITA 1B51A 3QSLA 4IO4A 4ECFA 3PPPA 5CRYA 5TP9B 4NMYA 5JTYA 2XXHA 1JVXA 4P0IA 4EQ9A 4DXUA 3C35A 4X1BA 1B4HA 1QUIA 2R9JA 3OEMA 1XT8A 4I1DA 3C9HA 3DP6A 4OFOA 2P0SA 4NWDA 1WDNA 2OBGA 3TFLA 3RUMA 1QUKA 2XXIA 3FJMA 2QJEA 4GF8A 1O64A 2WKYA 1B2HA 1IZ1A 1PEBA 2O7UA 3GBBA 3P7IA 2XX9A 2XXVA 4JB7A 1LBBA 4LZ7A 3PPOA 5J1DA 4IGTA 2PBWA 2V3QA 3OO8A 4JDFA 3C32A 1B7ZA 4GVOA 1P1UA 1B58A 4IB2A 4AB5A 1OIBA 1LFHA 2AL5A 3G3GA 4KI0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VHA A;  3O9P A;  3T9V A;  1S50 A;  4RK2 A;  2V3T A;  3O6I A;  4MFI A;  4U4S A;  1FTM A;  3OXN A;  1FW0 A;  1FTO A;  2B3F A;  3EHU A;  3IB2 A;  2XD2 A;  3MBP A;  4IO7 A;  3FVG A;  3C33 A;  2ONR A;  1IXC A;  2XXR A;  5AE4 A;  4FE8 A;  5DYH A;  3CRB A;  3IK6 B;  3VV5 A;  5I56 A;  3FUZ A;  1Q35 A;  2O1M A;  2VOZ A;  3IO6 A;  4NE4 A;  4KR5 A;  4GL8 A;  2A5T B;  3K00 A;  1SW5 A;  3B6W A;  4JBZ A;  5ITP A;  2PVU A;  5KDT A;  1H3D A;  3BFT A;  4DE8 A;  4YAH X;  2DSF A;  2F6G A;  3W15 C;  1A99 A;  3W9V A;  3IO4 A;  4QF9 A;  1I6Q A;  4JWX A;  4TLM B;  1JVY A;  3V83 A;  2NOO A;  2XXP A;  1LAG E;  1OQG A;  2DE4 A;  3EHS A;  3K6W A;  3USD A;  4EUO A;  3PUZ E;  1N3W A;  3FV1 A;  1N0T A;  3K02 A;  4U22 A;  4XKQ A;  3TCH A;  4ELQ A;  1IXH A;  1Y20 A;  3MVW A;  3MAM A;  4BDO A;  4EF2 A;  3TTL A;  1QJM A;  4QSD A;  4HW8 A;  2B3B A;  3A3C A;  1MM7 A;  3Q25 A;  3TKD A;  1PC3 A;  1TXF A;  3I5O A;  4OVJ A;  2DWI A;  2I0B A;  4R75 A;  4ONY A;  1RKM A;  1MQG A;  3KJT A;  4OTE A;  3MVX A;  4H8I A;  1DOT A;  1LGB C;  1FTJ A;  5I2K A;  4XTC Q;  1A55 A;  5I57 A;  3C36 A;  2I0C A;  5DVJ A;  1IEJ A;  2Z8E A;  1ZBM A;  4PFY A;  3HHG A;  3N5L A;  4G68 B;  4HCY A;  3TPA A;  1YAE A;  2ZNS A;  1M5B A;  1A7L A;  3PU5 A;  3N6T A;  4DXB A;  1CB6 A;  2OCU A;  2HAU A;  2O6A A;  3CFZ A;  2QS2 A;  1N84 A;  1NH7 A;  3ECR A;  3EPE A;  3DP8 A;  3FJ7 A;  4GLI A;  2Y7I A;  1MXZ A;  3H3G A;  4R2B A;  4R73 A;  4DZ1 A;  4EXK A;  4ZED A;  4Q0C A;  3IOV A;  3FVN A;  3GXA A;  4R2F A;  2OJT A;  3CI8 A;  4G68 A;  2FYI A;  2W7Y A;  2UVG A;  2YLN A;  5EHM A;  3VXC A;  5KZT A;  3TZA A;  1TFD A;  2F35 A;  1P1Q A;  1WOD A;  2NXO A;  1EZ9 A;  5EYF A;  4MLV A;  4H5G A;  4OQO A;  1B9J A;  1M5F A;  2DXY A;  4UAC A;  3KEI A;  4PFU A;  4Q8R A;  5L9M A;  1AMF A;  3U72 A;  3IX1 A;  5IAI A;  3PMW A;  1Y4T A;  1B7U A;  3N26 A;  2OK2 A;  3VVE A;  4MLQ A;  5DTB A;  5I57 B;  3PMV A;  1US4 A;  4IGR A;  2Q8J A;  1B3E A;  1HSL A;  4OFL A;  5CMC A;  5I58 A;  4YKP A;  1BIY A;  1VFD A;  3MWB A;  4FEC A;  2HZK A;  1TT1 A;  4YKJ A;  4QSC A;  5DVI A;  5H8S A;  4H5F A;  2DXR A;  2O1L A;  4N07 A;  5BUU A;  3EF7 A;  3SEY A;  4Z0I A;  1M5E A;  2H99 A;  4N13 A;  3H6U A;  1N76 A;  3OEK A;  2O68 A;  3CG1 A;  3T9X B;  3VLU A;  1Z7N E;  2REJ A;  3UIF A;  2RCA A;  2QL3 A;  3R6U A;  3JV9 A;  3QK6 A;  3M8U A;  1MH3 A;  2UYF A;  4DDD A;  1OVB A;  3CIJ A;  3K1M A;  4H1X A;  4M1V A;  3HPI A;  4QFO A;  2Q2A A;  4LON B;  1IXI A;  4QFN A;  3H4Z A;  3T22 A;  3MZ9 A;  3Q29 A;  3EHT A;  3RY3 A;  1B3H A;  4KCD A;  3MVZ A;  4ZE9 A;  1R1N A;  2FA7 A;  5H8N A;  2ZMB A;  3IB0 A;  4JWO A;  4FOR A;  1D4N A;  1JW4 A;  2PYY A;  1DTG A;  3T93 B;  3LBS A;  1PB7 A;  3RTF B;  2AIX A;  2G29 A;  1B3F A;  4G2Z A;  5AA1 A;  3O2A A;  1R6Z A;  1DTZ A;  3CFL A;  3WAE A;  1UIV A;  1URD A;  1A40 A;  4F3B A;  1I69 A;  2O51 A;  3MQ9 A;  2R71 A;  1R9L A;  3EN3 A;  5I59 B;  4UA8 A;  2GFE A;  4OMB A;  3L6G A;  1MM6 A;  1URG A;  2Y7W A;  3IAZ A;  3K6U A;  1VFE A;  4R6K A;  4AQ4 A;  1DSN A;  1A54 A;  4H0W A;  4OEN A;  1B7H A;  1JET A;  2E0S A;  2ZYO A;  4F2Q A;  2ONS A;  2OLB A;  4F29 A;  1N7X A;  5K2X A;  5TPA A;  1XHY A;  3ILU B;  3DM0 A;  3LC8 A;  3D4G A;  2REG A;  4KPT A;  2NWJ A;  2OWT A;  3JYR A;  1SQY A;  3CVG A;  1MY2 A;  5H8Q A;  4F1V A;  2Z22 A;  4C0R A;  2P1S A;  1POT A;  4RYA A;  3PV0 E;  2CZL A;  3FVK A;  2ONK E;  4G8N A;  5I2K B;  3E4R A;  3GZG A;  3KN7 A;  4F3G A;  3E9X A;  5I59 A;  1B32 A;  4FEB A;  2F36 A;  3LSW A;  4ZE8 A;  2OWS A;  2X7P A;  3OO9 A;  4GOT A;  3W9W A;  4HCW A;  4XKP A;  4F31 B;  3SER A;  5L9O A;  1OLA A;  1IQ7 A;  3HHF A;  2P2A A;  3R26 A;  3TTN A;  4OER A;  4XIG Q;  3V89 B;  4YMB A;  2QMX A;  5A5X A;  2I6E A;  1MDP 1;  3RQT A;  4RY1 A;  1B05 A;  4G4P A;  5I58 B;  2GRV A;  1H44 A;  3FIR A;  3GLB A;  2AL4 A;  1USY E;  4KCC A;  1MH4 A;  2PT1 A;  2XX8 A;  1JNF A;  4R9G A;  2Z8D A;  3PUY E;  4RPN A;  2ZYK A;  1MQJ A;  1MQH A;  1XOC A;  3T96 B;  1P1O A;  3UN6 A;  1VSO A;  1NMU A;  3PUW E;  1B40 A;  4EXL A;  2VP1 A;  5AA3 A;  4BDQ A;  5L9S A;  2DWA A;  2GH9 A;  4H65 A;  2Y7K A;  1PBP A;  3I3V A;  1AIV A;  1Y1M A;  1YPN A;  2V84 A;  3IB1 A;  3MPL A;  4IO2 A;  4ZEF A;  4NF5 A;  4PET A;  2QMW A;  4I8C A;  1LB8 A;  1MQI A;  3LSX A;  3GBA A;  1D3K A;  2I3W A;  3OSR A;  4YMA A;  1LFG A;  5I2N A;  3TEP A;  3V8X B;  2O84 X;  2V3U A;  1LB9 A;  2XXW A;  1NKX A;  3BKI B;  3ZS6 A;  2ZNU A;  4THI A;  2DOJ A;  2H4I A;  2XXQ A;  3CSB A;  4XKR A;  4YIC A;  5CBS A;  4LQ5 A;  2NUV A;  3E3K A;  4ZEI A;  3WAF A;  2RC8 A;  4FAJ A;  5KCJ B;  2R6G E;  3MUQ A;  4IY6 A;  4RNS A;  1M5D A;  3TCF A;  4L17 A;  3Q28 A;  1B5H A;  1RYX A;  3R7X A;  3TQW A;  4OEU A;  1QKB A;  2I48 A;  3S2V A;  2XD3 A;  2ZYN A;  3G3F A;  4RPO A;  2XXT A;  3VDF A;  2HZL A;  1FQE A;  4N6P A;  3C31 A;  2M8C A;  3PUX E;  3TOD A;  4E0W A;  5HBC A;  1P99 A;  3C4M A;  2RCB A;  5JTY B;  3SEX A;  2DP8 A;  3IJX B;  3K0V A;  5TP9 A;  3LUY A;  3DP4 A;  3OOA A;  3E13 X;  3S4U A;  4GRK A;  1ZTY A;  4G77 A;  2F5X A;  4OWD A;  5H8H A;  2RF1 A;  4ISU A;  1FQD A;  3ZKL A;  5B70 A;  3RGY A;  4ZZA A;  1IUD A;  3RPW A;  4U23 A;  4JSD A;  5FTH A;  4Z7E A;  3G3J A;  1AH5 A;  3QUJ A;  3O28 A;  3O66 A;  4M4G A;  1B1H A;  1TWY A;  3THI A;  3C34 A;  4F3P A;  2FNC A;  3KN8 A;  1LAF E;  4ZZE A;  2VD2 A;  2HCA A;  5CMB A;  5I84 A;  5KDT B;  3B6Q A;  2I4B A;  4E0X A;  2UVI A;  3OO6 A;  4NED A;  4PFW A;  1Q1K A;  1NNT A;  1PB8 A;  3JZJ A;  3PUV E;  1NNP A;  4ZS9 A;  5HPQ A;  4MH5 A;  1FQF A;  4NWC A;  3K6V A;  5JK4 A;  1B52 A;  1S7Y A;  3IOT A;  3KOS A;  3H6W A;  5ISU A;  1JW5 A;  1SBP A;  1LFI A;  4YZZ A;  2O7I A;  2UXA A;  4NF6 A;  4NF4 B;  4OXV A;  3S9L C;  3PPN A;  4OET A;  1MPD A;  3MP8 A;  4R74 A;  4WEP A;  5AA2 D;  1EH3 A;  3S9E A;  5DVF A;  3HO7 A;  3CSG A;  3KSJ A;  3LSF B;  3TTK A;  1MG1 A;  4NTL A;  2XXU A;  3VVF A;  1LAX A;  2AYS A;  4ESX A;  1JEU A;  2G93 A;  2QPQ A;  1MRP A;  2XXY A;  1SVX B;  4C1T A;  1GVC A;  5B7D A;  1QKA A;  1TFA A;  3U1O A;  1RYO A;  4XKN A;  3ONM A;  3VXB A;  3VLW A;  4LQ2 A;  3IR1 A;  1IIW A;  2Z23 A;  1EZP A;  1SI0 A;  1O7T A;  4NF6 B;  4GL0 A;  4LAT A;  4P11 A;  1NL5 A;  1Y9U A;  3LR1 A;  3OD7 A;  1BP5 A;  1IXG A;  1F9B A;  1YCJ A;  4OYV A;  2B65 A;  3PGF A;  2GHA A;  4F19 A;  3KZG A;  1FQA A;  3KJ7 A;  4KHZ E;  1SW4 A;  1BTJ A;  4DCX A;  1H76 A;  1Y4C A;  3EQ1 A;  2Y7R A;  3MW0 A;  4ND9 A;  3IOW A;  4BDL A;  1PDA A;  4R6H A;  5IKB A;  2VGQ A;  3IJO B;  3SET A;  2RC9 A;  1P1W A;  3U92 A;  4OHN A;  2PT2 A;  3G7W A;  4HS7 A;  1GV8 A;  2HAV A;  2BJJ X;  4U21 A;  1UQW A;  2IA4 A;  3O97 A;  4ELP A;  5AA2 B;  2D21 A;  1MY4 A;  2DYX A;  1B0H A;  4GQO A;  4QHQ A;  2F8D A;  1O63 A;  4Q5T A;  3Q26 A;  4QRZ A;  4WKM A;  4F2O A;  2YJP A;  2UYE A;  3OSQ A;  3UOR A;  3BBR A;  4BDN A;  3K4U A;  4RJZ A;  2A5S A;  4BDR A;  4HTG A;  4R6Y A;  1OVT A;  4ZEK A;  2RC7 A;  4ELR A;  1ATG A;  3IL1 B;  1USY H;  5CC2 A;  2I3V A;  2ABH A;  4Q30 B;  5EHS A;  4O3C A;  2RKM A;  2QS1 A;  5H8H B;  3OEN A;  1PB9 A;  4R9F A;  5FHM A;  4GXA A;  3CG3 A;  3TYH A;  5CMK A;  4LP2 B;  1JW1 A;  1MQD A;  1NFT A;  1QUJ A;  2QRY A;  3B6T A;  2LAO A;  3FXU A;  4LVQ A;  4RA1 A;  2V25 A;  4LA9 A;  4TLL B;  5CI5 A;  1LBC A;  1VE4 A;  3MPK A;  1SI1 A;  5ITO A;  2HFB A;  5H8F A;  1Y3Q A;  4IO5 A;  2KLF A;  4WED A;  3U8Q A;  4F18 A;  5ICT A;  1S9T A;  4KYS A;  3HV1 A;  3M3K A;  4ZDM A;  3N94 A;  3AXF A;  1XVY A;  4GIZ A;  3FGS A;  3TMG A;  1FTL A;  5JEI A;  2F97 A;  5KCJ A;  2I4C A;  3UA8 A;  3CFX A;  3FAT A;  4H6D A;  1UTH A;  1J1N A;  3VLV A;  3SEW A;  3U94 A;  2XX7 A;  5DEX B;  2QS3 A;  4FAT A;  4BLA A;  1UTB B;  4YU0 A;  3RT8 A;  5FHO A;  1DPE A;  2X26 A;  1BKA A;  4DXC A;  4DCY A;  2Z8F A;  5H8N B;  3IOU A;  3SEV A;  4JXI A;  1MXW A;  3ZKK A;  5TU0 A;  4PQJ A;  1QVS A;  2H98 A;  4LZ8 A;  2F6P A;  4PP0 A;  4ELO A;  1MXU A;  3BFU A;  2DQV A;  1MY0 A;  2D3I A;  3DEL B;  5F7V A;  1D9V A;  3FAS A;  1SW1 A;  3MP6 A;  3RLF E;  1ZKB A;  4EQB A;  3RTW B;  1FQC A;  5TPA B;  3QUF A;  1H45 A;  4U1O A;  5AA2 A;  3ODB A;  5HM4 B;  1DMB A;  3MZ1 A;  2F7B A;  1H43 A;  2X7Q A;  3H6T A;  1MPC A;  2ALU A;  5H8Q B;  4G8H A;  4GWO A;  2CMO A;  3H03 A;  5LOM A;  1SYH A;  4OZ9 A;  2A5T A;  3H7M A;  5FTI A;  2UVH A;  4OFJ A;  3TCG A;  1AL3 A;  2THI A;  4U1Z A;  2I58 A;  1EU8 A;  4FIM A;  3T66 A;  4RK9 A;  3UK4 A;  3VVD A;  2PMS A;  1QUL A;  1D9Y A;  2Y84 A;  2YPN A;  4GFR A;  4JSO A;  3T9H B;  4F3S A;  3SES A;  4X1D A;  1PBQ A;  2H25 A;  4MBP A;  5A5X B;  5DEX A;  3M3L A;  4NF4 A;  1UTB A;  1UTH B;  1LST A;  3FZV A;  5L8D A;  3TQL A;  3ZSF A;  3OO7 A;  3D4C A;  1SW2 A;  4R72 A;  3ILT B;  3PD8 A;  4F1Y A;  5I2N B;  3K1P A;  3HN0 A;  3A09 A;  2IEE A;  4PFT A;  1Y1Z A;  3M3F A;  1XVX A;  4AB6 A;  5CMM A;  3VFJ A;  1A8E A;  1MPB A;  3KGC A;  4TOZ A;  3K1N A;  1LAH E;  1YTV A;  2E1S A;  2F34 A;  3LSL A;  4X48 A;  4X9T A;  5AA4 B;  1AOV A;  3MC2 A;  2NVU B;  1L5T A;  2HXW A;  5CBR A;  1MY1 A;  2UVJ A;  4YB6 A;  4PE5 B;  1A8F A;  3KG2 A;  1Y3N A;  1MXY A;  1SD3 A;  2HQ0 A;  1B3G A;  4H67 A;  5CM6 A;  3L6H A;  3MP1 A;  4LUB A;  3SKP A;  3PMX A;  2O69 A;  3IOR A;  1EZO A;  3O6H A;  4IO3 A;  4KYE A;  1T0K A;  1I6A A;  3U93 A;  3RN8 A;  2XXX A;  4H8J A;  4EDP A;  2F7C A;  4JWY A;  1OMP A;  2DVZ A;  1B4Z A;  3K01 A;  3TEL A;  1II5 A;  3G3K A;  3OEL A;  3MVY A;  3Q27 A;  4MF3 A;  3TUS A;  1ZIU A;  4KFQ A;  4F1U A;  4IO6 A;  1B1X A;  4KQP A;  1R9Q A;  4YB7 A;  3K6X A;  1GR2 A;  3F11 A;  2H5Y A;  3O29 A;  4NF5 B;  3KFM A;  2GHB A;  4EF1 A;  3KBR A;  1JQF A;  4F39 A;  4YB5 A;  3RT6 B;  4I62 A;  4O3B A;  1N7W A;  3RNN A;  1CE2 A;  1XC1 A;  1B5I A;  4RXL A;  4BDM A;  2XHD A;  3S9M C;  1B0L A;  1GGG A;  1NNK A;  1Z7M E;  2HEU A;  4EQ7 A;  1N3X A;  3TTM A;  3KOT A;  1QW0 A;  3TTR A;  2QSX A;  1VR5 A;  1MDQ A;  3G3I A;  1B3L A;  3FXR A;  4QFP A;  5FHN A;  3V5A A;  2I49 A;  2Q89 A;  2DWJ A;  4O3A A;  3H6V A;  3K2D A;  4DLD A;  2Q2C A;  2QS4 A;  4ZEC A;  3QIM A;  2DS9 A;  3S9N C;  2DE2 A;  3T9U A;  3QAX A;  2OZZ A;  3UGW A;  1ZMG A;  2PX1 A;  3DLN A;  2ZYM A;  3FVO A;  4OES A;  1US5 A;  5BWJ A;  3UP9 A;  3A3U A;  1OLC A;  5F1Q A;  1ZU0 A;  2ESN A;  3QXM A;  5K2Y A;  3G3H A;  2Q88 A;  3SEU A;  2RIN A;  1WVJ A;  1B6H A;  1LCT A;  2F78 A;  3PD9 A;  4KD5 A;  2ANJ A;  1FQB A;  5DT6 A;  3HCQ A;  3FXQ A;  5ICQ A;  4XXU A;  3VE1 B;  4ESW A;  4YKI A;  4G8M A;  3KN3 A;  1DPP A;  4F22 A;  1NH8 A;  1HSJ A;  1GTK A;  4NF8 A;  1ANF A;  2VD3 A;  4FJP A;  2ZNT A;  1N04 A;  1XS5 A;  3HST A;  3I6V A;  4G68 C;  3OMB A;  1MS7 A;  2D5W A;  3H06 B;  4POW A;  3N6U A;  5H8F B;  5M2V A;  1MY3 A;  3FD3 A;  5AA4 A;  1B5J A;  1FTK A;  4GD5 A;  3QYT A;  4WXJ A;  3MZB A;  1FCK A;  3KSX A;  4C1U A;  2H9B A;  3CR9 A;  1LLS A;  4NF8 B;  1HSE A;  1P1N A;  4U2R A;  2Y7P A;  4GXS B;  3PPR A;  1URS A;  1KWH A;  1I6B A;  4TQU Q;  4QSE A;  1M5C A;  2DVC A;  4K3F A;  4DIG A;  5ELV A;  1JEV A;  1LCF A;  1B46 A;  1POY 1;  1SYI A;  1MXX A;  1UIU A;  2ZXT A;  4I9D A;  3PPQ A;  2DE3 A;  1BLF A;  1MXV A;  3MJN A;  3O6G A;  1ZLQ A;  3FJG A;  4QFK A;  1SDX A;  2DWH A;  2F7A A;  3FV2 A;  4IY5 A;  2Q9T A;  4OEV A;  1ZJL A;  4POX A;  1Y3P A;  2V93 A;  4ZEB A;  4FED A;  3TAJ A;  1OQH A;  3B7D A;  4YKK A;  3TDJ A;  5I56 B;  4LZ5 A;  1NNF A;  1ELJ A;  4KYD A;  4P0G A;  3SDF A;  4U4X A;  4QFL A;  1IIT A;  1B51 A;  3QSL A;  4IO4 A;  4ECF A;  3PPP A;  5CRY A;  5TP9 B;  4NMY A;  5JTY A;  2XXH A;  1JVX A;  4P0I A;  4EQ9 A;  4DXU A;  3C35 A;  4X1B A;  1B4H A;  1QUI A;  2R9J A;  3OEM A;  1XT8 A;  4I1D A;  3C9H A;  3DP6 A;  4OFO A;  2P0S A;  4NWD A;  1WDN A;  2OBG A;  3TFL A;  3RUM A;  1QUK A;  2XXI A;  3FJM A;  2QJE A;  4GF8 A;  1O64 A;  2WKY A;  1B2H A;  1IZ1 A;  1PEB A;  2O7U A;  3GBB A;  3P7I A;  2XX9 A;  2XXV A;  4JB7 A;  1LBB A;  4LZ7 A;  3PPO A;  5J1D A;  4IGT A;  2PBW A;  2V3Q A;  3OO8 A;  4JDF A;  3C32 A;  1B7Z A;  4GVO A;  1P1U A;  1B58 A;  4IB2 A;  4AB5 A;  1OIB A;  1LFH A;  2AL5 A;  3G3G A;  4KI0 E; 
#chains in the Genus database with same CATH topology
 1S50 A;  4U4S A;  3EHU A;  3FVG A;  4FE8 A;  1IMB A;  3CRB A;  3VV5 A;  4NE4 A;  5FBP A;  2O1M A;  3K00 A;  4JBZ A;  2PVU A;  5KDT A;  4DE8 A;  5T3J A;  3W15 C;  4OVQ A;  3W9V A;  4TLM B;  3V83 A;  1LAG E;  1OQG A;  3K6W A;  3T1B A;  4U22 A;  1Y20 A;  4HW8 A;  3Q25 A;  1PC3 A;  3KJT A;  4H8I A;  2FHY A;  3C36 A;  1IEJ A;  3N6T A;  1N84 A;  2Y7I A;  1MXZ A;  3H3G A;  5EYG A;  4Q0C A;  4R2F A;  2OJT A;  2W7Y A;  3VXC A;  2UVG A;  5KZT A;  1TFD A;  1EZ9 A;  1FRP A;  1B9J A;  2DXY A;  1NI9 A;  4PFU A;  1AMF A;  1B7U A;  4MLQ A;  5DTB A;  1US4 A;  4OFL A;  5I58 A;  2P3N A;  2QVU A;  4FEC A;  2HZK A;  4HE0 A;  5DVI A;  4H5F A;  5BUU A;  4N07 A;  3EF7 A;  4Z0I A;  1M5E A;  4N13 A;  3H6U A;  3T9X B;  3R6U A;  1MH3 A;  3K1M A;  4H1X A;  4M1V A;  4N8G A;  4QFO A;  2Q2A A;  3Q29 A;  5J16 A;  3IB0 A;  4P1L A;  1DTG A;  4KXP A;  2FVZ A;  1URD A;  1I69 A;  2BJI A;  1IMC A;  3K6U A;  1B7H A;  1XHY A;  3IFC A;  3D4G A;  2REG A;  4KPT A;  2NWJ A;  3JYR A;  4C0R A;  2P1S A;  4RYA A;  4MHF A;  4JVD A;  2CZL A;  3FVK A;  4PBQ A;  3E9X A;  1SPI A;  5L9O A;  3R26 A;  5A5X A;  2QMX A;  2I6E A;  2GRV A;  3GLB A;  2AL4 A;  4KCC A;  3E79 A;  3PUY E;  2OX3 A;  2MKZ A;  5AA3 A;  1VSO A;  1NMU A;  4EXL A;  2DWA A;  1AIV A;  3IB1 A;  1LB8 A;  2JJK A;  3V8X B;  2O84 X;  2XXW A;  3BKI B;  2ZNU A;  3WAF A;  2NUV A;  5IZ1 A;  3TCF A;  1B5H A;  1RYX A;  4OEU A;  2XXK A;  2HZL A;  4N6P A;  3C31 A;  2M8C A;  3B50 A;  1P99 A;  2RCB A;  5JTY B;  5LDZ A;  3DP4 A;  4I3Y A;  3S4U A;  1ZTY A;  2F5X A;  4OWD A;  5H8H A;  1IUD A;  3G3J A;  3QUJ A;  3C34 A;  4GWW A;  5I84 A;  2I4B A;  3OO6 A;  4PFW A;  1Q1K A;  1NNT A;  1PB8 A;  4MH5 A;  3KOS A;  4UAB A;  2OWZ A;  3B8B A;  2O7I A;  3S9L C;  1EH3 A;  3KSJ A;  3TTK A;  2AYS A;  1MRP A;  2L5V A;  1QKA A;  3U1O A;  1RYO A;  3VXB A;  4P8B A;  1IIW A;  4I3E A;  4NF6 B;  4LAT A;  1Y9U A;  4OYV A;  3LR1 A;  3OD7 A;  1IXG A;  1F9B A;  3PGF A;  3KJ7 A;  4P47 A;  3MW0 A;  3IOW A;  1PDA A;  4R6H A;  2RC9 A;  1DCU A;  1P1W A;  4OHN A;  3U92 A;  4HS7 A;  4GQO A;  4Q5T A;  3OSQ A;  4OVS A;  1EYJ A;  4RJZ A;  1OVT A;  1ATG A;  2ABH A;  2WYP A;  2RKM A;  1PB9 A;  3CG3 A;  1JW1 A;  1MQD A;  1NFT A;  3FXU A;  5CI5 A;  1LBC A;  1SI1 A;  4WED A;  3U8Q A;  1S9T A;  3M3K A;  3CFX A;  4H6D A;  1LBZ A;  3SEW A;  3U94 A;  5FHO A;  2X26 A;  4H46 A;  3ZKK A;  2H98 A;  1MXU A;  3MP6 A;  1ZKB A;  3RTW B;  4DI3 D;  1DMB A;  2X7Q A;  2ALU A;  4G8H A;  4GWO A;  2CMO A;  4MMP A;  4OZ9 A;  5FTI A;  1G0I A;  2THI A;  3VVD A;  1EU8 A;  4RK9 A;  4F3S A;  4GFR A;  5A5X B;  2PCR A;  3TQL A;  3FZV A;  3ZSF A;  3D4C A;  1SW2 A;  4R72 A;  3PD8 A;  4F1Y A;  3K1P A;  3HN0 A;  1LBY A;  4O7I A;  2E1S A;  4X9T A;  5CBR A;  4PE5 B;  1A8F A;  3KG2 A;  5CM6 A;  4PAF A;  3SKP A;  2CZH A;  3IOR A;  4KYE A;  1T0K A;  4JWY A;  1B4Z A;  3K01 A;  3OEL A;  3MVY A;  3Q27 A;  4MF3 A;  4KFQ A;  4P9K A;  1B1X A;  4KQP A;  4YB7 A;  1DK4 A;  2GHB A;  4EF1 A;  3KBR A;  1JQF A;  4I62 A;  1XC1 A;  4BDM A;  2XHD A;  4X8R A;  1B0L A;  1GGG A;  2HEU A;  1Z7M E;  3TTM A;  4N6K A;  2QSX A;  1VR5 A;  3G3I A;  1B3L A;  4QFP A;  5ET8 A;  2I49 A;  4O3A A;  3K2D A;  2OZZ A;  2PX1 A;  1OLC A;  2ESN A;  5K2Y A;  3G3H A;  2Q88 A;  1WVJ A;  1B6H A;  1XI6 A;  2XWV A;  2KR0 A;  2ANJ A;  5ICQ A;  4XXU A;  4G8M A;  2VD3 A;  1XS5 A;  3HST A;  4G68 C;  3H06 B;  4MEV A;  1MY3 A;  4GD5 A;  3MZB A;  1NV5 A;  1HSE A;  1P1N A;  2Y7P A;  4GXS B;  1URS A;  2DVC A;  4K3F A;  1MXX A;  1MXV A;  3O6G A;  1SDX A;  4OEV A;  4POX A;  5CBS A;  4ZEB A;  2Q9T A;  4FED A;  3B7D A;  4LZ5 A;  1NNF A;  1IIT A;  4GX4 A;  4IO4 A;  5TP9 B;  5JTY A;  1JVX A;  4P0I A;  2PFZ A;  4X1B A;  1QUI A;  1G0H A;  1XT8 A;  4I1D A;  4GBW A;  2P0S A;  1WDN A;  3RUM A;  2VT5 A;  2O7U A;  3P7I A;  2XXV A;  3PPO A;  4NAP A;  3OO8 A;  5A5L A;  3C32 A;  1B7Z A;  4MNC A;  3G3G A;  2VHA A;  1FPG A;  2V3T A;  3O6I A;  4MFI A;  1FTM A;  3OXN A;  2B3F A;  3C33 A;  2ONR A;  1IXC A;  2XXR A;  1Q35 A;  3LV0 A;  1SW5 A;  1H3D A;  2QVV A;  1I6Q A;  4JWX A;  2XXP A;  3USD A;  3MVW A;  4BDO A;  1INP A;  4OVJ A;  2I0B A;  4OTE A;  2HPG A;  1DOT A;  5I57 A;  2Z8E A;  1ZBM A;  4PFY A;  3HHG A;  4G68 B;  3TPA A;  1M5B A;  1NV3 A;  3PU5 A;  4DXB A;  2QS2 A;  3EPE A;  4MNI A;  3FJ7 A;  4FBP A;  4EXK A;  3IOV A;  4GWX A;  4O7M A;  2FYI A;  3TZA A;  1WOD A;  2NXO A;  4UAC A;  4Q8R A;  5L9M A;  3PMW A;  3VVE A;  5I57 B;  1B3E A;  5CMC A;  1BIY A;  1TT1 A;  4QSC A;  5H8S A;  2O1L A;  4N81 A;  3OEK A;  3CG1 A;  2REJ A;  3UIF A;  2P3V A;  3JV9 A;  3QK6 A;  4DDD A;  3D1R A;  4G61 A;  1IXI A;  4OVT A;  3EHT A;  3RY3 A;  1B3H A;  1R1N A;  2FA7 A;  4P1E A;  2ZMB A;  2PYY A;  3T93 B;  3RTF B;  2AIX A;  4JVC A;  2G29 A;  4G2Z A;  3A29 A;  3CFL A;  3EN3 A;  2GFE A;  4OMB A;  4AQ4 A;  3IAZ A;  1URG A;  1VFE A;  1DSN A;  4H0W A;  1JET A;  4F2Q A;  2OLB A;  4F29 A;  5K2X A;  5TPA A;  3DM0 A;  2ZZX A;  2OWT A;  5H8Q A;  4NG7 A;  4G8N A;  1B32 A;  2OWS A;  3OO9 A;  4F31 B;  3HHF A;  2P2A A;  4XIG Q;  3RQT A;  1B05 A;  5I58 B;  1USY E;  2XX8 A;  2ZYK A;  1XOC A;  3T96 B;  3I3V A;  1PBP A;  2V84 A;  4ZEF A;  4NF5 A;  4I8C A;  3LSX A;  3GBA A;  3E78 A;  2I3W A;  3OSR A;  4YMA A;  1LFG A;  1LB9 A;  1NKX A;  3KC0 A;  3CSB A;  1FPD A;  3E3K A;  4GWY A;  4H45 A;  2RC8 A;  4RNS A;  3TQW A;  4GWZ A;  2XD3 A;  4RPO A;  2XXT A;  5ET5 A;  3TOD A;  5HBC A;  3C4M A;  3SEX A;  3IJX B;  3LUY A;  3OOA A;  3E13 X;  2RF1 A;  4U23 A;  5FTH A;  1AH5 A;  3THI A;  4M4G A;  4OVR A;  3KN8 A;  2VD2 A;  2HCA A;  5KDT B;  2WBB A;  2UVI A;  2WX9 A;  4NED A;  4AS4 A;  3PUV E;  3K6V A;  5JK4 A;  3IOT A;  4PDD A;  1SBP A;  4YZZ A;  4NF4 B;  4PGN A;  2V4C A;  3MP8 A;  3HO7 A;  5J1D A;  2XXU A;  1JEU A;  2G93 A;  2QPQ A;  4C1T A;  1GVC A;  3VLW A;  4LQ2 A;  2Z23 A;  4P11 A;  1YCJ A;  1D9Q A;  2B65 A;  4PFI A;  2XWK A;  4KHZ E;  1BTJ A;  1H76 A;  2Y7R A;  4ND9 A;  4BDL A;  2BJJ X;  5AA2 B;  3O97 A;  4ELP A;  1MY4 A;  4QHQ A;  1B0H A;  2F8D A;  3Q26 A;  4BDN A;  3K4U A;  4P3L A;  2A5S A;  4BDR A;  2PFY A;  4XFE A;  1USY H;  2XWI A;  5EHS A;  3BIH A;  5H8H B;  3TYH A;  5CMK A;  1QUJ A;  4GX3 A;  3B6T A;  4NQ8 A;  4O8M A;  4LA9 A;  1Y3Q A;  4IO5 A;  2KLF A;  1CNQ A;  4KYS A;  3N94 A;  3AXF A;  4GIZ A;  3T0J A;  5JEI A;  2I4C A;  1UTH A;  3VLV A;  4FAT A;  2QS3 A;  4I40 A;  2QVR A;  4NGU A;  2Z8F A;  3IOU A;  1QVS A;  1NUW A;  4LZ8 A;  2F6P A;  2ZZV A;  4ELO A;  3BFU A;  2D3I A;  4HE1 A;  3FAS A;  1SW1 A;  3RLF E;  1VDW A;  2HXR A;  5TPA B;  3QUF A;  4P56 A;  4U1O A;  3ODB A;  5HM4 B;  3H6T A;  5H8Q B;  3H03 A;  2A5T A;  3H7M A;  3TCG A;  2UVH A;  1AL3 A;  2Y5K A;  4JSO A;  3M3L A;  1LST A;  1FBP A;  4PFT A;  3A09 A;  3M3F A;  5F24 A;  1XVX A;  3FXB A;  3VFJ A;  3KGC A;  2F34 A;  5AA4 B;  3MC2 A;  2NVU B;  1L5T A;  4MX6 A;  2F3B A;  1MY1 A;  4H67 A;  1Y3N A;  1SD3 A;  2HQ0 A;  2QFL A;  4LUB A;  5EQ9 A;  3QMF A;  1I6A A;  3U93 A;  3RN8 A;  4PC9 A;  3TEL A;  3G3K A;  3TUS A;  4XEQ A;  1R9Q A;  1KA1 A;  3O29 A;  4O3B A;  1CE2 A;  4RXL A;  4PCD A;  3LUZ A;  3S9M C;  2CEY A;  3FXR A;  1RDX A;  3H6V A;  3QIM A;  1FPF A;  2DS9 A;  3S9N C;  3T9U A;  1ZMG A;  2R8T A;  4OES A;  3RPL A;  3A3U A;  1NUY A;  1JP4 A;  4GWU A;  5EQA A;  4KD5 A;  3PD9 A;  1FBF A;  3VE1 B;  3KN3 A;  1NH8 A;  4NF8 A;  2ZNT A;  1N04 A;  3I6V A;  1MS7 A;  3N6U A;  3PTY A;  1B5J A;  3QYT A;  4C1U A;  1FCK A;  4PFR A;  4U2R A;  1I6B A;  1M5C A;  4DIG A;  1JEV A;  3PPQ A;  2DE3 A;  4PFB A;  1Y3P A;  4YKK A;  1FJ6 A;  3TDJ A;  1IMD A;  3PPP A;  4QBA A;  4NMY A;  1B4H A;  4OFO A;  4NWD A;  3TFL A;  1QUK A;  4GF8 A;  2XXI A;  2ZZW A;  1O64 A;  4DXU A;  5DW8 A;  1IZ1 A;  5IGA A;  2PBW A;  4JDF A;  4GVO A;  1B58 A;  4F39 A;  3O9P A;  1FTO A;  3IB2 A;  2XD2 A;  3MBP A;  5AE4 A;  3IK6 B;  5I56 A;  3IO6 A;  4KR5 A;  4GL8 A;  2A5T B;  3B6W A;  3BFT A;  2DSF A;  1A99 A;  3IO4 A;  1JVY A;  4PE3 A;  4MJO A;  3FV1 A;  3K02 A;  4ELQ A;  3TCH A;  3MAM A;  4EF2 A;  1YZ0 A;  4QSD A;  1MM7 A;  1TXF A;  4R75 A;  2DWI A;  1RKM A;  2WBD A;  1LGB C;  1FTJ A;  4XTC Q;  1A55 A;  5DVJ A;  4HCY A;  1YAE A;  2ZNS A;  4AS5 A;  1CB6 A;  2OCU A;  2O6A A;  3CFZ A;  1NH7 A;  1QGX A;  4R2B A;  1NV0 A;  1FBG A;  4PDH A;  2Q74 A;  3FVN A;  2F35 A;  1FPE A;  4PAK A;  5LTC A;  3U72 A;  3IX1 A;  4PF6 A;  1Y4T A;  4HE2 A;  2OK2 A;  4IGR A;  1HSL A;  4YKJ A;  1N76 A;  2O68 A;  3VLU A;  4MAG A;  4QFN A;  3CHG A;  3H4Z A;  3T22 A;  3MVZ A;  5H8N A;  4FOR A;  1D4N A;  3LBS A;  1B3F A;  3O2A A;  1R6Z A;  3WAE A;  1FSA A;  4F3B A;  2O51 A;  2R71 A;  1R9L A;  4UA8 A;  2Y7W A;  1A54 A;  4OA4 A;  2ZYO A;  2ONS A;  1N7X A;  4XF5 A;  3LC8 A;  2F3D A;  2VPN A;  2HHM A;  4GBV A;  1MY2 A;  4OVP A;  1POT A;  1FPI A;  3PV0 E;  4F3G A;  3GZG A;  3KN7 A;  5I59 A;  2F36 A;  2X7P A;  3W9W A;  4HCW A;  4XKP A;  3SER A;  1OLA A;  1IQ7 A;  3TTN A;  3V89 B;  1FTA A;  1NV2 A;  1MDP 1;  2CEX A;  4G4P A;  1H44 A;  3FIR A;  4N15 A;  4R9G A;  2Z8D A;  1MQJ A;  1P1O A;  3UN6 A;  4N91 A;  4BDQ A;  1FBD A;  2QMW A;  1D3K A;  5I2N A;  2V3U A;  2H4I A;  4XKR A;  2R6G E;  2GQ1 A;  1QKB A;  3S2V A;  3VDF A;  1Q9D A;  2Y5L A;  4E0W A;  5TP9 A;  4GRK A;  5I3S A;  4G77 A;  4N6D A;  3ZKL A;  3RGY A;  4JSD A;  4Z7E A;  4F3P A;  3O28 A;  3O66 A;  1B1H A;  1TWY A;  1NV4 A;  2FNC A;  1LAF E;  4ZZE A;  4E0X A;  1NNP A;  1FQF A;  4NWC A;  1B52 A;  1S7Y A;  3H6W A;  5ISU A;  1LFI A;  2UXA A;  4NF6 A;  4OXV A;  3PPN A;  1MPD A;  4R74 A;  4WEP A;  5AA2 D;  5DVF A;  3CSG A;  3LSF B;  4NTL A;  1SVX B;  5B7D A;  3ONM A;  3IR1 A;  1NL5 A;  4NX1 A;  2GHA A;  4F19 A;  4DCX A;  2VGQ A;  3IJO B;  2PT2 A;  3G7W A;  2HAV A;  1UQW A;  2IA4 A;  2D21 A;  4WKM A;  1O63 A;  2B4M A;  2YJP A;  2UYE A;  3MST A;  3BBR A;  4R6Y A;  2I3V A;  4Q30 B;  4O3C A;  1IMA A;  3OEN A;  1LBW A;  4LP2 B;  4TLL B;  4LVQ A;  3MPK A;  2HFB A;  5H8F A;  5ICT A;  4F18 A;  2CZK A;  3HV1 A;  3FGS A;  1FTL A;  2F97 A;  3FAT A;  1J1N A;  2XX7 A;  1UTB B;  4YU0 A;  3RT8 A;  1DPE A;  4DXC A;  3SEV A;  4JXI A;  5TU0 A;  2DQV A;  3DEL B;  1D9V A;  3SZP A;  4EQB A;  1FQC A;  1H45 A;  2F7B A;  1KA0 A;  5LOM A;  1SYH A;  4U1Z A;  4DI4 B;  2I58 A;  5I59 B;  3T66 A;  3UK4 A;  2WYK A;  1QUL A;  2Y84 A;  3T9H B;  5IZ3 B;  3SES A;  4X1D A;  4N17 A;  1UTB A;  3OO7 A;  5I2N B;  4LN5 A;  4GX6 A;  4AB6 A;  1MPB A;  4TOZ A;  3K1N A;  3LSL A;  2Q8M A;  2HXW A;  4YB6 A;  1FJ9 A;  1MXY A;  1B3G A;  3L6H A;  3MP1 A;  1EZO A;  3MYU A;  2XXX A;  4H8J A;  2F7C A;  3KBZ A;  1OMP A;  2DVZ A;  1ZIU A;  4IO6 A;  2XWO A;  4NF5 B;  3KFM A;  4GWS A;  4YB5 A;  3RT6 B;  3FBP A;  4EQ7 A;  3KOT A;  1QW0 A;  3TTR A;  1MDQ A;  1NUZ A;  4DLD A;  2QS4 A;  2DE2 A;  3QAX A;  5BWJ A;  3DLN A;  2ZYM A;  3FVO A;  3KC1 A;  1FBE A;  1ZU0 A;  3QXM A;  3SEU A;  2RIN A;  3U65 A;  1LCT A;  4PAI A;  1FQB A;  3GYY A;  5IZZ A;  4YKI A;  1GTK A;  1FBC A;  5H8F B;  5M2V A;  3FD3 A;  5AA4 A;  1FTK A;  4WXJ A;  3KSX A;  3CR9 A;  1LLS A;  4NF8 B;  3HFU A;  4QSE A;  5ELV A;  1LCF A;  4MNP A;  5I7I A;  1B46 A;  1POY 1;  1SYI A;  2ZXT A;  5IZ3 A;  4QFK A;  3MJN A;  1ZLQ A;  3FV2 A;  2F7A A;  4IY5 A;  1ZJL A;  4NF0 A;  3TAJ A;  1OQH A;  5ESY A;  4ECF A;  5CRY A;  1K9Z A;  2XXH A;  1LEV A;  3OEM A;  3C9H A;  1FPK A;  4RA1 A;  2QJE A;  2WKY A;  1PEB A;  4LZ7 A;  2XX9 A;  4JB7 A;  1P1U A;  1OIB A;  1LFH A;  2AL5 A;  4EQ9 A;  4KI0 E;  5IM2 A;  3T9V A;  4RK2 A;  1FW0 A;  4IO7 A;  5DYH A;  3FUZ A;  2VOZ A;  3ISP A;  5ITP A;  4NN3 A;  4YAH X;  2F6G A;  4QF9 A;  2NOO A;  2DE4 A;  4EUO A;  3EHS A;  3PUZ E;  1N3W A;  1N0T A;  1RDZ A;  4XKQ A;  1IXH A;  3TTL A;  1QJM A;  2B3B A;  3A3C A;  3TKD A;  3I5O A;  5I5P A;  4ONY A;  1MQG A;  5I2K A;  3MVX A;  4OAN A;  3NOH A;  2KQZ A;  2I0C A;  3N5L A;  1A7L A;  2HAU A;  4MIJ A;  3ECR A;  1NUX A;  3DP8 A;  4GLI A;  4R73 A;  4DZ1 A;  4ZED A;  3GXA A;  3CI8 A;  4G68 A;  2YLN A;  5EHM A;  1P1Q A;  5EYF A;  4MLV A;  4H5G A;  4OQO A;  1M5F A;  3KEI A;  5IAI A;  3N26 A;  3PMV A;  2Q8J A;  4YKP A;  1VFD A;  3MWB A;  2DXR A;  3SEY A;  2H99 A;  1Z7N E;  2RCA A;  2QL3 A;  3M8U A;  2UYF A;  1OVB A;  3CIJ A;  3HPI A;  4LON B;  3MZ9 A;  4KCD A;  4ZE9 A;  4JWO A;  1JW4 A;  1PB7 A;  5AA1 A;  1DTZ A;  1UIV A;  1A40 A;  3MQ9 A;  2B4L A;  1KZ8 A;  3BIG A;  3RYD A;  3L6G A;  1MM6 A;  4OEN A;  2E0S A;  3ILU B;  1SQY A;  3CVG A;  4F1V A;  2Z22 A;  2ONK E;  5I2K B;  3E4R A;  1AWB A;  4FEB A;  3LSW A;  4ZE8 A;  4GOT A;  4OER A;  4YMB A;  4RY1 A;  3ROJ A;  1MH4 A;  2PT1 A;  1JNF A;  4RPN A;  1MQH A;  3PUW E;  1B40 A;  1LBV A;  2VP1 A;  4X04 A;  5L9S A;  2GH9 A;  4H65 A;  2Y7K A;  1Y1M A;  1YPN A;  3MPL A;  4IO2 A;  4PET A;  5EQ7 A;  1MQI A;  5EYH A;  4PBH A;  2CZI A;  3TEP A;  4THI A;  2DOJ A;  2XXQ A;  4YIC A;  4LQ5 A;  4FAJ A;  4ZEI A;  5KCJ B;  4IY6 A;  3MUQ A;  1M5D A;  4L17 A;  3Q28 A;  2I48 A;  2ZYN A;  3G3F A;  1FQE A;  1FBH A;  4QXD A;  3PUX E;  1FPB A;  1K9Y A;  2DP8 A;  3K0V A;  2FIX A;  1DBZ A;  4ISU A;  1FQD A;  5B70 A;  4ZZA A;  3RPW A;  5CMB A;  3B6Q A;  1FPJ A;  3JZJ A;  4ZS9 A;  5HPQ A;  1BK4 A;  1JW5 A;  4OET A;  1YYZ A;  3S9E A;  3VVF A;  1MG1 A;  1LAX A;  4ESX A;  2XXY A;  1NV7 A;  1TFA A;  1FPL A;  4XKN A;  1EZP A;  1SI0 A;  1O7T A;  4PF8 A;  4GL0 A;  1BP5 A;  3KZG A;  1FQA A;  1SW4 A;  1EYI A;  1Y4C A;  1EYK A;  3EQ1 A;  5IKB A;  3SET A;  1GV8 A;  4U21 A;  2DYX A;  4F2O A;  4QRZ A;  3UOR A;  1YXI A;  4HTG A;  4ZEK A;  2RC7 A;  4ELR A;  3IL1 B;  2XA5 A;  5CC2 A;  4HXV A;  5EQ8 A;  2QS1 A;  4R9F A;  5FHM A;  2DDK A;  4GXA A;  2QRY A;  2LAO A;  2V25 A;  1VE4 A;  5ITO A;  4ZDM A;  2WEF A;  1XVY A;  3TMG A;  3UA8 A;  4AB5 A;  5DEX B;  4BLA A;  2FIE A;  1NV6 A;  1BKA A;  4DCY A;  5H8N B;  1MXW A;  1IMF A;  4PQJ A;  4PP0 A;  5F7V A;  1MY0 A;  5AA2 A;  3MZ1 A;  1H43 A;  1MPC A;  4IR8 A;  4OFJ A;  4FIM A;  2PMS A;  2YPN A;  1D9Y A;  1PBQ A;  2H25 A;  4MBP A;  5DEX A;  4NF4 A;  1UTH B;  5L8D A;  2VPO A;  3ILT B;  2IEE A;  1Y1Z A;  3RPL B;  5CMM A;  1A8E A;  1LAH E;  1YTV A;  4X48 A;  1AOV A;  2UVJ A;  3PMX A;  2O69 A;  3O6H A;  4IO3 A;  1RDY A;  4EDP A;  1II5 A;  4F1U A;  3K6X A;  1GR2 A;  3F11 A;  2H5Y A;  1N7W A;  3RNN A;  1IME A;  1B5I A;  1NNK A;  1N3X A;  1NV1 A;  4JVI A;  3V5A A;  5FHN A;  2Q89 A;  2DWJ A;  4ZEC A;  2Q2C A;  3EKI A;  3UGW A;  1US5 A;  3UP9 A;  5F1Q A;  4O94 A;  1LBX A;  4PGP A;  2F78 A;  5DT6 A;  3HCQ A;  3FXQ A;  4ESW A;  1DPP A;  4F22 A;  1HSJ A;  4NHB A;  1ANF A;  4FJP A;  4N4U A;  3OMB A;  2D5W A;  4POW A;  2H9B A;  5ET7 A;  3PPR A;  1KWH A;  4TQU Q;  1UIU A;  4I9D A;  3IFA A;  1BLF A;  2FBP A;  3ZS6 A;  5KCJ A;  3FJG A;  2DWH A;  2V93 A;  5I56 B;  1ELJ A;  4KYD A;  4P0G A;  3SDF A;  4U4X A;  4QFL A;  1B51 A;  3QSL A;  3C35 A;  2R9J A;  5ET6 A;  3DP6 A;  2OBG A;  4R6K A;  3FJM A;  4MCO A;  3R7X A;  1B2H A;  3GBB A;  1LBB A;  4IGT A;  2V3Q A;  4IB2 A;  4N8Y A;  4PTK A; 
#chains in the Genus database with same CATH homology
 2VHA A;  3O9P A;  3T9V A;  1S50 A;  4RK2 A;  2V3T A;  3O6I A;  4MFI A;  4U4S A;  1FTM A;  3OXN A;  1FW0 A;  1FTO A;  2B3F A;  3EHU A;  3IB2 A;  2XD2 A;  3MBP A;  4IO7 A;  3FVG A;  3C33 A;  2ONR A;  1IXC A;  2XXR A;  5AE4 A;  4FE8 A;  5DYH A;  3CRB A;  3IK6 B;  3VV5 A;  5I56 A;  3FUZ A;  1Q35 A;  2O1M A;  2VOZ A;  3IO6 A;  4NE4 A;  4KR5 A;  4GL8 A;  2A5T B;  3K00 A;  1SW5 A;  3B6W A;  4JBZ A;  5ITP A;  2PVU A;  5KDT A;  1H3D A;  3BFT A;  4DE8 A;  4YAH X;  2DSF A;  2F6G A;  3W15 C;  1A99 A;  3W9V A;  3IO4 A;  4QF9 A;  1I6Q A;  4JWX A;  4TLM B;  1JVY A;  3V83 A;  2NOO A;  2XXP A;  1LAG E;  1OQG A;  2DE4 A;  3EHS A;  3K6W A;  3USD A;  4EUO A;  3PUZ E;  1N3W A;  3FV1 A;  1N0T A;  3K02 A;  4U22 A;  4XKQ A;  3TCH A;  4ELQ A;  1IXH A;  1Y20 A;  3MVW A;  3MAM A;  4BDO A;  4EF2 A;  3TTL A;  1QJM A;  4QSD A;  4HW8 A;  2B3B A;  3A3C A;  1MM7 A;  3Q25 A;  3TKD A;  1PC3 A;  1TXF A;  3I5O A;  4OVJ A;  2DWI A;  2I0B A;  4R75 A;  4ONY A;  1RKM A;  1MQG A;  3KJT A;  4OTE A;  3MVX A;  4H8I A;  1DOT A;  1LGB C;  1FTJ A;  5I2K A;  4XTC Q;  1A55 A;  5I57 A;  3C36 A;  2I0C A;  5DVJ A;  1IEJ A;  2Z8E A;  1ZBM A;  4PFY A;  3HHG A;  3N5L A;  4G68 B;  4HCY A;  3TPA A;  1YAE A;  2ZNS A;  1M5B A;  1A7L A;  3PU5 A;  3N6T A;  4DXB A;  1CB6 A;  2OCU A;  2HAU A;  2O6A A;  3CFZ A;  2QS2 A;  1N84 A;  1NH7 A;  3ECR A;  3EPE A;  3DP8 A;  3FJ7 A;  4GLI A;  2Y7I A;  1MXZ A;  3H3G A;  4R2B A;  4R73 A;  4DZ1 A;  4EXK A;  4ZED A;  4Q0C A;  3IOV A;  3FVN A;  3GXA A;  4R2F A;  2OJT A;  3CI8 A;  4G68 A;  2FYI A;  2W7Y A;  2UVG A;  2YLN A;  5EHM A;  3VXC A;  5KZT A;  3TZA A;  1TFD A;  2F35 A;  1P1Q A;  1WOD A;  2NXO A;  1EZ9 A;  5EYF A;  4MLV A;  4H5G A;  4OQO A;  1B9J A;  1M5F A;  2DXY A;  4UAC A;  3KEI A;  4PFU A;  4Q8R A;  5L9M A;  1AMF A;  3U72 A;  3IX1 A;  5IAI A;  3PMW A;  1Y4T A;  1B7U A;  3N26 A;  2OK2 A;  3VVE A;  4MLQ A;  5DTB A;  5I57 B;  3PMV A;  1US4 A;  4IGR A;  2Q8J A;  1B3E A;  1HSL A;  4OFL A;  5CMC A;  5I58 A;  4YKP A;  1BIY A;  1VFD A;  3MWB A;  4FEC A;  2HZK A;  1TT1 A;  4YKJ A;  4QSC A;  5DVI A;  5H8S A;  4H5F A;  2DXR A;  2O1L A;  4N07 A;  5BUU A;  3EF7 A;  3SEY A;  4Z0I A;  1M5E A;  2H99 A;  4N13 A;  3H6U A;  1N76 A;  3OEK A;  2O68 A;  3CG1 A;  3T9X B;  3VLU A;  1Z7N E;  2REJ A;  3UIF A;  2RCA A;  2QL3 A;  3R6U A;  3JV9 A;  3QK6 A;  3M8U A;  1MH3 A;  2UYF A;  4DDD A;  1OVB A;  3CIJ A;  3K1M A;  4H1X A;  4M1V A;  3HPI A;  4QFO A;  2Q2A A;  4LON B;  1IXI A;  4QFN A;  3H4Z A;  3T22 A;  3MZ9 A;  3Q29 A;  3EHT A;  3RY3 A;  1B3H A;  4KCD A;  3MVZ A;  4ZE9 A;  1R1N A;  2FA7 A;  5H8N A;  2ZMB A;  3IB0 A;  4JWO A;  4FOR A;  1D4N A;  1JW4 A;  2PYY A;  1DTG A;  3T93 B;  3LBS A;  1PB7 A;  3RTF B;  2AIX A;  2G29 A;  1B3F A;  4G2Z A;  5AA1 A;  3O2A A;  1R6Z A;  1DTZ A;  3CFL A;  3WAE A;  1UIV A;  1URD A;  1A40 A;  4F3B A;  1I69 A;  2O51 A;  3MQ9 A;  2R71 A;  1R9L A;  3EN3 A;  5I59 B;  4UA8 A;  2GFE A;  4OMB A;  3L6G A;  1MM6 A;  1URG A;  2Y7W A;  3IAZ A;  3K6U A;  1VFE A;  4R6K A;  4AQ4 A;  1DSN A;  1A54 A;  4H0W A;  4OEN A;  1B7H A;  1JET A;  2E0S A;  2ZYO A;  4F2Q A;  2ONS A;  2OLB A;  4F29 A;  1N7X A;  5K2X A;  5TPA A;  1XHY A;  3ILU B;  3DM0 A;  3LC8 A;  3D4G A;  2REG A;  4KPT A;  2NWJ A;  2OWT A;  3JYR A;  1SQY A;  3CVG A;  1MY2 A;  5H8Q A;  4F1V A;  2Z22 A;  4C0R A;  2P1S A;  1POT A;  4RYA A;  3PV0 E;  2CZL A;  3FVK A;  2ONK E;  4G8N A;  5I2K B;  3E4R A;  3GZG A;  3KN7 A;  4F3G A;  3E9X A;  5I59 A;  1B32 A;  4FEB A;  2F36 A;  3LSW A;  4ZE8 A;  2OWS A;  2X7P A;  3OO9 A;  4GOT A;  3W9W A;  4HCW A;  4XKP A;  4F31 B;  3SER A;  5L9O A;  1OLA A;  1IQ7 A;  3HHF A;  2P2A A;  3R26 A;  3TTN A;  4OER A;  4XIG Q;  3V89 B;  4YMB A;  2QMX A;  5A5X A;  2I6E A;  1MDP 1;  3RQT A;  4RY1 A;  1B05 A;  4G4P A;  5I58 B;  2GRV A;  1H44 A;  3FIR A;  3GLB A;  2AL4 A;  1USY E;  4KCC A;  1MH4 A;  2PT1 A;  2XX8 A;  1JNF A;  4R9G A;  2Z8D A;  3PUY E;  4RPN A;  2ZYK A;  1MQJ A;  1MQH A;  1XOC A;  3T96 B;  1P1O A;  3UN6 A;  1VSO A;  1NMU A;  3PUW E;  1B40 A;  4EXL A;  2VP1 A;  5AA3 A;  4BDQ A;  5L9S A;  2DWA A;  2GH9 A;  4H65 A;  2Y7K A;  1PBP A;  3I3V A;  1AIV A;  1Y1M A;  1YPN A;  2V84 A;  3IB1 A;  3MPL A;  4IO2 A;  4ZEF A;  4NF5 A;  4PET A;  2QMW A;  4I8C A;  1LB8 A;  1MQI A;  3LSX A;  3GBA A;  1D3K A;  2I3W A;  3OSR A;  4YMA A;  1LFG A;  5I2N A;  3TEP A;  3V8X B;  2O84 X;  2V3U A;  1LB9 A;  2XXW A;  1NKX A;  3BKI B;  3ZS6 A;  2ZNU A;  4THI A;  2DOJ A;  2H4I A;  2XXQ A;  3CSB A;  4XKR A;  4YIC A;  5CBS A;  4LQ5 A;  2NUV A;  3E3K A;  4ZEI A;  3WAF A;  2RC8 A;  4FAJ A;  5KCJ B;  2R6G E;  3MUQ A;  4IY6 A;  4RNS A;  1M5D A;  3TCF A;  4L17 A;  3Q28 A;  1B5H A;  1RYX A;  3R7X A;  3TQW A;  4OEU A;  1QKB A;  2I48 A;  3S2V A;  2XD3 A;  2ZYN A;  3G3F A;  4RPO A;  2XXT A;  3VDF A;  2HZL A;  1FQE A;  4N6P A;  3C31 A;  2M8C A;  3PUX E;  3TOD A;  4E0W A;  5HBC A;  1P99 A;  3C4M A;  2RCB A;  5JTY B;  3SEX A;  2DP8 A;  3IJX B;  3K0V A;  5TP9 A;  3LUY A;  3DP4 A;  3OOA A;  3E13 X;  3S4U A;  4GRK A;  1ZTY A;  4G77 A;  2F5X A;  4OWD A;  5H8H A;  2RF1 A;  4ISU A;  1FQD A;  3ZKL A;  5B70 A;  3RGY A;  4ZZA A;  1IUD A;  3RPW A;  4U23 A;  4JSD A;  5FTH A;  4Z7E A;  3G3J A;  1AH5 A;  3QUJ A;  3O28 A;  3O66 A;  4M4G A;  1B1H A;  1TWY A;  3THI A;  3C34 A;  4F3P A;  2FNC A;  3KN8 A;  1LAF E;  4ZZE A;  2VD2 A;  2HCA A;  5CMB A;  5I84 A;  5KDT B;  3B6Q A;  2I4B A;  4E0X A;  2UVI A;  3OO6 A;  4NED A;  4PFW A;  1Q1K A;  1NNT A;  1PB8 A;  3JZJ A;  3PUV E;  1NNP A;  4ZS9 A;  5HPQ A;  4MH5 A;  1FQF A;  4NWC A;  3K6V A;  5JK4 A;  1B52 A;  1S7Y A;  3IOT A;  3KOS A;  3H6W A;  5ISU A;  1JW5 A;  1SBP A;  1LFI A;  4YZZ A;  2O7I A;  2UXA A;  4NF6 A;  4NF4 B;  4OXV A;  3S9L C;  3PPN A;  4OET A;  1MPD A;  3MP8 A;  4R74 A;  4WEP A;  5AA2 D;  1EH3 A;  3S9E A;  5DVF A;  3HO7 A;  3CSG A;  3KSJ A;  3LSF B;  3TTK A;  1MG1 A;  4NTL A;  2XXU A;  3VVF A;  1LAX A;  2AYS A;  4ESX A;  1JEU A;  2G93 A;  2QPQ A;  1MRP A;  2XXY A;  1SVX B;  4C1T A;  1GVC A;  5B7D A;  1QKA A;  1TFA A;  3U1O A;  1RYO A;  4XKN A;  3ONM A;  3VXB A;  3VLW A;  4LQ2 A;  3IR1 A;  1IIW A;  2Z23 A;  1EZP A;  1SI0 A;  1O7T A;  4NF6 B;  4GL0 A;  4LAT A;  4P11 A;  1NL5 A;  1Y9U A;  3LR1 A;  3OD7 A;  1BP5 A;  1IXG A;  1F9B A;  1YCJ A;  4OYV A;  2B65 A;  3PGF A;  2GHA A;  4F19 A;  3KZG A;  1FQA A;  3KJ7 A;  4KHZ E;  1SW4 A;  1BTJ A;  4DCX A;  1H76 A;  1Y4C A;  3EQ1 A;  2Y7R A;  3MW0 A;  4ND9 A;  3IOW A;  4BDL A;  1PDA A;  4R6H A;  5IKB A;  2VGQ A;  3IJO B;  3SET A;  2RC9 A;  1P1W A;  3U92 A;  4OHN A;  2PT2 A;  3G7W A;  4HS7 A;  1GV8 A;  2HAV A;  2BJJ X;  4U21 A;  1UQW A;  2IA4 A;  3O97 A;  4ELP A;  5AA2 B;  2D21 A;  1MY4 A;  2DYX A;  1B0H A;  4GQO A;  4QHQ A;  2F8D A;  1O63 A;  4Q5T A;  3Q26 A;  4QRZ A;  4WKM A;  4F2O A;  2YJP A;  2UYE A;  3OSQ A;  3UOR A;  3BBR A;  4BDN A;  3K4U A;  4RJZ A;  2A5S A;  4BDR A;  4HTG A;  4R6Y A;  1OVT A;  4ZEK A;  2RC7 A;  4ELR A;  1ATG A;  3IL1 B;  1USY H;  5CC2 A;  2I3V A;  2ABH A;  4Q30 B;  5EHS A;  4O3C A;  2RKM A;  2QS1 A;  5H8H B;  3OEN A;  1PB9 A;  4R9F A;  5FHM A;  4GXA A;  3CG3 A;  3TYH A;  5CMK A;  4LP2 B;  1JW1 A;  1MQD A;  1NFT A;  1QUJ A;  2QRY A;  3B6T A;  2LAO A;  3FXU A;  4LVQ A;  4RA1 A;  2V25 A;  4LA9 A;  4TLL B;  5CI5 A;  1LBC A;  1VE4 A;  3MPK A;  1SI1 A;  5ITO A;  2HFB A;  5H8F A;  1Y3Q A;  4IO5 A;  2KLF A;  4WED A;  3U8Q A;  4F18 A;  5ICT A;  1S9T A;  4KYS A;  3HV1 A;  3M3K A;  4ZDM A;  3N94 A;  3AXF A;  1XVY A;  4GIZ A;  3FGS A;  3TMG A;  1FTL A;  5JEI A;  2F97 A;  5KCJ A;  2I4C A;  3UA8 A;  3CFX A;  3FAT A;  4H6D A;  1UTH A;  1J1N A;  3VLV A;  3SEW A;  3U94 A;  2XX7 A;  5DEX B;  2QS3 A;  4FAT A;  4BLA A;  1UTB B;  4YU0 A;  3RT8 A;  5FHO A;  1DPE A;  2X26 A;  1BKA A;  4DXC A;  4DCY A;  2Z8F A;  5H8N B;  3IOU A;  3SEV A;  4JXI A;  1MXW A;  3ZKK A;  5TU0 A;  4PQJ A;  1QVS A;  2H98 A;  4LZ8 A;  2F6P A;  4PP0 A;  4ELO A;  1MXU A;  3BFU A;  2DQV A;  1MY0 A;  2D3I A;  3DEL B;  5F7V A;  1D9V A;  3FAS A;  1SW1 A;  3MP6 A;  3RLF E;  1ZKB A;  4EQB A;  3RTW B;  1FQC A;  5TPA B;  3QUF A;  1H45 A;  4U1O A;  5AA2 A;  3ODB A;  5HM4 B;  1DMB A;  3MZ1 A;  2F7B A;  1H43 A;  2X7Q A;  3H6T A;  1MPC A;  2ALU A;  5H8Q B;  4G8H A;  4GWO A;  2CMO A;  3H03 A;  5LOM A;  1SYH A;  4OZ9 A;  2A5T A;  3H7M A;  5FTI A;  2UVH A;  4OFJ A;  3TCG A;  1AL3 A;  2THI A;  4U1Z A;  2I58 A;  1EU8 A;  4FIM A;  3T66 A;  4RK9 A;  3UK4 A;  3VVD A;  2PMS A;  1QUL A;  1D9Y A;  2Y84 A;  2YPN A;  4GFR A;  4JSO A;  3T9H B;  4F3S A;  3SES A;  4X1D A;  1PBQ A;  2H25 A;  4MBP A;  5A5X B;  5DEX A;  3M3L A;  4NF4 A;  1UTB A;  1UTH B;  1LST A;  3FZV A;  5L8D A;  3TQL A;  3ZSF A;  3OO7 A;  3D4C A;  1SW2 A;  4R72 A;  3ILT B;  3PD8 A;  4F1Y A;  5I2N B;  3K1P A;  3HN0 A;  3A09 A;  2IEE A;  4PFT A;  1Y1Z A;  3M3F A;  1XVX A;  4AB6 A;  5CMM A;  3VFJ A;  1A8E A;  1MPB A;  3KGC A;  4TOZ A;  3K1N A;  1LAH E;  1YTV A;  2E1S A;  2F34 A;  3LSL A;  4X48 A;  4X9T A;  5AA4 B;  1AOV A;  3MC2 A;  2NVU B;  1L5T A;  2HXW A;  5CBR A;  1MY1 A;  2UVJ A;  4YB6 A;  4PE5 B;  1A8F A;  3KG2 A;  1Y3N A;  1MXY A;  1SD3 A;  2HQ0 A;  1B3G A;  4H67 A;  5CM6 A;  3L6H A;  3MP1 A;  4LUB A;  3SKP A;  3PMX A;  2O69 A;  3IOR A;  1EZO A;  3O6H A;  4IO3 A;  4KYE A;  1T0K A;  1I6A A;  3U93 A;  3RN8 A;  2XXX A;  4H8J A;  4EDP A;  2F7C A;  4JWY A;  1OMP A;  2DVZ A;  1B4Z A;  3K01 A;  3TEL A;  1II5 A;  3G3K A;  3OEL A;  3MVY A;  3Q27 A;  4MF3 A;  3TUS A;  1ZIU A;  4KFQ A;  4F1U A;  4IO6 A;  1B1X A;  4KQP A;  1R9Q A;  4YB7 A;  3K6X A;  1GR2 A;  3F11 A;  2H5Y A;  3O29 A;  4NF5 B;  3KFM A;  2GHB A;  4EF1 A;  3KBR A;  1JQF A;  4F39 A;  4YB5 A;  3RT6 B;  4I62 A;  4O3B A;  1N7W A;  3RNN A;  1CE2 A;  1XC1 A;  1B5I A;  4RXL A;  4BDM A;  2XHD A;  3S9M C;  1B0L A;  1GGG A;  1NNK A;  1Z7M E;  2HEU A;  4EQ7 A;  1N3X A;  3TTM A;  3KOT A;  1QW0 A;  3TTR A;  2QSX A;  1VR5 A;  1MDQ A;  3G3I A;  1B3L A;  3FXR A;  4QFP A;  5FHN A;  3V5A A;  2I49 A;  2Q89 A;  2DWJ A;  4O3A A;  3H6V A;  3K2D A;  4DLD A;  2Q2C A;  2QS4 A;  4ZEC A;  3QIM A;  2DS9 A;  3S9N C;  2DE2 A;  3T9U A;  3QAX A;  2OZZ A;  3UGW A;  1ZMG A;  2PX1 A;  3DLN A;  2ZYM A;  3FVO A;  4OES A;  1US5 A;  5BWJ A;  3UP9 A;  3A3U A;  1OLC A;  5F1Q A;  1ZU0 A;  2ESN A;  3QXM A;  5K2Y A;  3G3H A;  2Q88 A;  3SEU A;  2RIN A;  1WVJ A;  1B6H A;  1LCT A;  2F78 A;  3PD9 A;  4KD5 A;  2ANJ A;  1FQB A;  5DT6 A;  3HCQ A;  3FXQ A;  5ICQ A;  4XXU A;  3VE1 B;  4ESW A;  4YKI A;  4G8M A;  3KN3 A;  1DPP A;  4F22 A;  1NH8 A;  1HSJ A;  1GTK A;  4NF8 A;  1ANF A;  2VD3 A;  4FJP A;  2ZNT A;  1N04 A;  1XS5 A;  3HST A;  3I6V A;  4G68 C;  3OMB A;  1MS7 A;  2D5W A;  3H06 B;  4POW A;  3N6U A;  5H8F B;  5M2V A;  1MY3 A;  3FD3 A;  5AA4 A;  1B5J A;  1FTK A;  4GD5 A;  3QYT A;  4WXJ A;  3MZB A;  1FCK A;  3KSX A;  4C1U A;  2H9B A;  3CR9 A;  1LLS A;  4NF8 B;  1HSE A;  1P1N A;  4U2R A;  2Y7P A;  4GXS B;  3PPR A;  1URS A;  1KWH A;  1I6B A;  4TQU Q;  4QSE A;  1M5C A;  2DVC A;  4K3F A;  4DIG A;  5ELV A;  1JEV A;  1LCF A;  1B46 A;  1POY 1;  1SYI A;  1MXX A;  1UIU A;  2ZXT A;  4I9D A;  3PPQ A;  2DE3 A;  1BLF A;  1MXV A;  3MJN A;  3O6G A;  1ZLQ A;  3FJG A;  4QFK A;  1SDX A;  2DWH A;  2F7A A;  3FV2 A;  4IY5 A;  2Q9T A;  4OEV A;  1ZJL A;  4POX A;  1Y3P A;  2V93 A;  4ZEB A;  4FED A;  3TAJ A;  1OQH A;  3B7D A;  4YKK A;  3TDJ A;  5I56 B;  4LZ5 A;  1NNF A;  1ELJ A;  4KYD A;  4P0G A;  3SDF A;  4U4X A;  4QFL A;  1IIT A;  1B51 A;  3QSL A;  4IO4 A;  4ECF A;  3PPP A;  5CRY A;  5TP9 B;  4NMY A;  5JTY A;  2XXH A;  1JVX A;  4P0I A;  4EQ9 A;  4DXU A;  3C35 A;  4X1B A;  1B4H A;  1QUI A;  2R9J A;  3OEM A;  1XT8 A;  4I1D A;  3C9H A;  3DP6 A;  4OFO A;  2P0S A;  4NWD A;  1WDN A;  2OBG A;  3TFL A;  3RUM A;  1QUK A;  2XXI A;  3FJM A;  2QJE A;  4GF8 A;  1O64 A;  2WKY A;  1B2H A;  1IZ1 A;  1PEB A;  2O7U A;  3GBB A;  3P7I A;  2XX9 A;  2XXV A;  4JB7 A;  1LBB A;  4LZ7 A;  3PPO A;  5J1D A;  4IGT A;  2PBW A;  2V3Q A;  3OO8 A;  4JDF A;  3C32 A;  1B7Z A;  4GVO A;  1P1U A;  1B58 A;  4IB2 A;  4AB5 A;  1OIB A;  1LFH A;  2AL5 A;  3G3G A;  4KI0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...