2F8DA

Benm effector-binding domain crystallized from high ph conditions
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
221
structure length
221
Chain Sequence
EKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNWLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Oligomerization of BenM, a LysR-type transcriptional regulator: structural basis for the aggregation of proteins in this family.
pubmed doi rcsb
source organism Acinetobacter baylyi
molecule tags Gene regulation
total genus 70
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f8dA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2f8dA02
3VDFA 4PFWA 3EHUA 4H65A 2D3IA 3EHTA 2XXIA 3UK4A 2I48A 3OEKA 5TP9A 3IJXB 3QSLA 2X7QA 1OVBA 4GLIA 2NUVA 1MY0A 4JWXA 4LZ5A 1VFDA 2HAVA 3G3KA 2F36A 2RC9A 4LATA 5BUUA 3MW0A 4F3GA 5FTIA 3I6VA 3CFZA 5JTYA 3O97A 1M5BA 4ECFA 5KDTA 3CG1A 4NF8A 2XX8A 3N26A 3OEMA 3C33A 1B46A 3W9VA 4IB2A 4EF1A 2I3VA 4FECA 3HV1A 1WDNA 1NFTA 1AOVA 3KEIA 4H8JA 3PD8A 5AA2D 4BLAA 4ZS9A 1S7YA 3RT8A 4ELRA 2I0BA 3G3HA 4KYSA 3TFLA 3IK6B 1A7LA 3PMVA 4YKIA 1H3DA 1ZIUA 3IOTA 1IZ1A 2V84A 4YKPA 2OWTA 3VFJA 5FHMA 4H0WA 4GVOA 1OMPA 4DIGA 4IY6A 1OLAA 4F1YA 4F31B 3ONMA 1NNPA 1MH4A 3FVOA 2HAUA 2Q2CA 5K2YA 3BFTA 2ZYNA 3U94A 3GXAA 5IKBA 1LBBA 3TTRA 2HZKA 4YZZA 1N76A 3CG3A 4R74A 1NMUA 2ONSA 4XKQA 2I0CA 1FTJA 3VVFA 4ZEBA 3E4RA 3HO7A 1QJMA 3SEYA 1BTJA 4F18A 3O6GA 5BWJA 2DVZA 1S50A 1B5HA 5CMKA 3CR9A 5M2VA 2HEUA 3KN7A 3LBSA 3UIFA 3JYRA 2QJEA 4G68C 4XIGQ 4G68A 4IGRA 1R9QA 1FTOA 4OFLA 1Q35A 4ZECA 3S2VA 3K4UA 4GOTA 2Q2AA 2LAOA 4GF8A 3V8XB 1MQHA 3DP8A 1DSNA 4GRKA 2G29A 4LZ7A 5J1DA 4Q0CA 5I56B 3OXNA 1ZJLA 3TMGA 5DT6A 1CB6A 4F22A 3C31A 1FQDA 1IIWA 4XXUA 4E0WA 3THIA 3FV2A 5CM6A 1POTA 1B05A 4ZEDA 4YU0A 4AQ4A 3PD9A 1A55A 3T66A 4K3FA 2DXRA 2F7AA 4TQUQ 2QMWA 3TTKA 3CRBA 3SEUA 2O1MA 1QKAA 2I3WA 1JW4A 1SQYA 3USDA 3VV5A 3G3FA 5H8HA 3KG2A 3HCQA 3H7MA 2PMSA 3K6VA 3KBRA 1B3GA 3H03A 4O3CA 4OXVA 4F2QA 2A5TA 2H99A 2IEEA 1RYXA 5F7VA 4TOZA 1NH8A 4IO3A 2Z22A 1QW0A 4R9FA 5KCJA 4OFJA 5A5XA 1Y4CA 4OWDA 4H8IA 2B3FA 2F35A 2PYYA 4NF5A 1TXFA 4M4GA 4GXSB 5DEXB 3U1OA 4L17A 5HBCA 3TTMA 2P1SA 1UTHB 3H06B 2H9BA 4YMBA 5ICTA 1MDQA 3PUZE 3VVEA 2HCAA 2VP1A 4C0RA 2Y7IA 1SD3A 3MVYA 2E1SA 1B9JA 4OFOA 4KD5A 1MQDA 2CMOA 3C32A 3PMXA 1MPBA 4IO7A 4HCYA 1L5TA 1IUDA 2HXWA 1Z7NE 5DTBA 2Y7WA 1PB8A 4U1ZA 2P2AA 5CC2A 1A54A 3FXUA 1N7XA 1OVTA 3KFMA 3FUZA 3KN3A 3RNNA 5EHSA 2B65A 2V93A 3SDFA 5AE4A 5L9OA 4Z0IA 2F7BA 1A8EA 4PFYA 4U1OA 5H8SA 4KQPA 3M3FA 1NH7A 1D9VA 5CBSA 4GXAA 4POWA 3IB0A 4NMYA 3BFUA 5H8QB 4OQOA 2V25A 2V3QA 2HQ0A 2RC8A 3IR1A 4IGTA 1MRPA 4H1XA 4ZZAA 3ZSFA 4FATA 2F7CA 5I59B 4ESXA 2DSFA 3KJTA 4HW8A 3U93A 1Y4TA 3K1PA 3LSFB 4ZE9A 5KDTB 2QSXA 5EYFA 1JEVA 1Z7ME 3B7DA 1I6QA 4NF4A 1N04A 3FASA 1H45A 1YPNA 1LSTA 4FEBA 3I5OA 2XXYA 2Y84A 1SDXA 2DQVA 3KOSA 3IAZA 3TAJA 4NF6A 4XKNA 3W9WA 3ZKKA 4H5FA 2XXHA 1EZ9A 2HZLA 1ZBMA 5CMMA 3IL1B 4F3SA 2DWIA 4R6YA 3IO4A 1SW5A 4R72A 2XXUA 2XXVA 5LOMA 5ISUA 3SERA 2QS4A 1WVJA 3H6UA 2Y7PA 3RT6B 2D5WA 4ELQA 2R71A 4XKPA 1N7WA 1UIUA 4FJPA 3G3GA 4GQOA 4JDFA 4OERA 3SKPA 1DPEA 2V3TA 1MG1A 1FQCA 1YAEA 3FV1A 3EHSA 4OTEA 1QUIA 4WEPA 3WAEA 4YB7A 1DPPA 3MZ9A 4WEDA 4LVQA 3O2AA 1LAXA 3L6HA 1MPCA 2M8CA 4JWYA 2ZMBA 1IXCA 3K6XA 3VLVA 3D4CA 2PBWA 3U8QA 1MXVA 1MS7A 4EUOA 1II5A 1B4ZA 5F1QA 4G68B 5TU0A 4KCCA 3UA8A 4QFKA 4JXIA 1O64A 4DXUA 3L6GA 2VOZA 5JEIA 3DLNA 4ZDMA 4ELPA 2CZLA 3N6TA 2FYIA 4RA1A 2REGA 1UTBB 1H43A 3T9XB 3DP6A 2F6GA 1BP5A 1SYHA 4JB7A 3UN6A 2NXOA 4TLLB 4U2RA 3S9NC 3K00A 1PEBA 1SW1A 4IO2A 4DCYA 2DWAA 1LB9A 2O1LA 2XXQA 2PT2A 4UACA 1SVXB 1EZOA 5DVIA 1Y20A 1MXZA 1VFEA 3KSJA 2F34A 4BDQA 3VXBA 4R73A 3S9MC 4KYEA 2F97A 2NWJA 5AA3A 5JK4A 2Z23A 3C4MA 4QFNA 3AXFA 3RTFB 2D21A 3MZ1A 1AH5A 3S9EA 3QIMA 4MF3A 4LA9A 1ATGA 4C1UA 2UVIA 4C1TA 4E0XA 1P1QA 3HHFA 2ESNA 3MPLA 2DE2A 3SEVA 4Z7EA 4U4SA 3KOTA 1JQFA 4LP2B 3VXCA 3OELA 3G7WA 2A5TB 5AA1A 2AIXA 2Z8EA 3E13X 4TLMB 4R2FA 3B6QA 3PUYE 3ZS6A 3M3LA 1TFAA 1OQGA 1B5JA 5L8DA 3KJ7A 4YICA 3ZKLA 4P0GA 1B0LA 4OYVA 4KCDA 2RCBA 3IJOB 5H8NA 5I2KB 4N13A 5TPAA 3Q26A 3FXRA 4G2ZA 2Q8JA 2BJJX 3MUQA 5I58A 3LSXA 3FVNA 1O7TA 3UGWA 1F9BA 3I3VA 1LFGA 1TFDA 3RQTA 2XXTA 1I6BA 4I1DA 2O7UA 4RY1A 1MXWA 3V83A 1AIVA 3CVGA 2UVGA 1PC3A 1LAFE 1N84A 3MQ9A 4OMBA 2R9JA 3A3CA 5HPQA 1Y1ZA 3H3GA 1SW2A 4EDPA 1B1HA 4DZ1A 2ZNTA 4LQ5A 4YKKA 4X1BA 4HTGA 3FJMA 5I57B 1B5IA 4U4XA 1NL5A 2ALUA 3RY3A 2PVUA 3M8UA 1B52A 3O6HA 3VLUA 3EN3A 1LAGE 1CE2A 4AB6A 2ZNUA 3MAMA 2P0SA 4QHQA 4YAHX 2I4BA 3IX1A 4QF9A 2Z8DA 4G8MA 5L9SA 1TT1A 3LC8A 4OESA 4KYDA 3TPAA 4QSCA 1LB8A 2RINA 4YB5A 1LAHE 4RPOA 2WKYA 1B58A 5AA2A 5AA4A 1PDAA 5HM4B 2XXWA 5DVJA 2REJA 4UA8A 4IO6A 5L9MA 3QYTA 3N6UA 2Y7KA 3DP4A 1ZMGA 1IXHA 1NKXA 4JSDA 4IO5A 2QS1A 3TEPA 2O7IA 3PUXE 2H5YA 4X1DA 4NF4B 3O6IA 3MP8A 3GLBA 4ZZEA 4QSDA 1OQHA 2DE4A 5DYHA 2FA7A 2Q88A 3ECRA 1N0TA 4LUBA 2XXXA 1MY4A 3S4UA 1MQIA 2NVUB 4QRZA 5I2NA 1A8FA 1NNKA 3T96B 2AL4A 3PPQA 1KWHA 3IOWA 1PB7A 1XOCA 4FIMA 1FCKA 4H6DA 3PU5A 3GBBA 1XVXA 3CFXA 4NTLA 3TODA 4OVJA 3KSXA 2VGQA 3OOAA 1O63A 5H8FA 4FEDA 1PBPA 1ZTYA 2Q9TA 4BDOA 1XVYA 1B7UA 2O69A 2QMXA 4FE8A 1US4A 2DYXA 2O6AA 4ESWA 1MM7A 4RJZA 4HS7A 2OLBA 5CI5A 2DE3A 4OENA 3FVGA 3LR1A 3HSTA 3ODBA 4I62A 5B70A 2PX1A 5KZTA 1BKAA 3Q29A 4KI0E 1URSA 3SESA 5TP9B 1LGBC 4NEDA 3GBAA 2IA4A 3ILTB 3R26A 2UYFA 4O3AA 4MFIA 4DXCA 1LCFA 2QPQA 2RF1A 4F29A 4ND9A 5JTYB 4F19A 4NE4A 3VVDA 4EQ7A 1B51A 3DELB 2I58A 1T0KA 4NF8B 1R6ZA 2VHAA 1USYE 3FZVA 3SEXA 1QKBA 2ZYOA 4NWCA 3IO6A 1ZKBA 3TTNA 2XXRA 3LUYA 2G93A 1A40A 1MQJA 1FTLA 2H4IA 3OENA 4RK2A 4LQ2A 5EHMA 2OZZA 1I69A 1DTZA 2YLNA 4MBPA 4KHZE 1JEUA 1M5FA 3FATA 4QSEA 3PV0E 1N3WA 1Y3NA 3FXQA 4KPTA 1EZPA 1UTHA 3GZGA 4XTCQ 1URDA 3QXMA 3V89B 1QUJA 1FW0A 1LLSA 4Q8RA 5DVFA 2DP8A 3F11A 5CRYA 2GRVA 2HFBA 3G3IA 3FIRA 3QUJA 1EH3A 1YTVA 4DCXA 4PFUA 2X26A 3IB1A 1US5A 1IITA 2DOJA 5ELVA 5ITOA 1FQAA 1MXYA 3TKDA 1HSLA 3CFLA 2OJTA 2Y7RA 2F78A 1I6AA 4F3PA 4F3BA 3EPEA 4IY5A 3VLWA 3T9HB 4PQJA 3K6WA 1H76A 4HCWA 2QS3A 1FTKA 3MP1A 4R75A 4BDRA 3OO8A 1B4HA 1LCTA 1MPDA 3N5LA 4OHNA 3C9HA 1Y9UA 2ZYMA 3C36A 4GFRA 5TPAB 1D4NA 3MC2A 5H8QA 5FTHA 1LFIA 3LSLA 3EF7A 1MY3A 2A5SA 3O29A 4P11A 1HSEA 3K6UA 3O66A 3D4GA 2XXPA 4X48A 1RYOA 3H6VA 1LBCA 1XC1A 4YKJA 4KFQA 1B7ZA 1OIBA 5I59A 3FD3A 1MXXA 2AL5A 1B1XA 3OO9A 4PFTA 5CBRA 3QK6A 5K2XA 1S9TA 4THIA 1RKMA 1NNFA 4Q5TA 3PPNA 2F6PA 4G8NA 4FORA 4NWDA 2XX7A 4AB5A 3K1NA 1IEJA 3KN8A 1EU8A 4POXA 3N94A 2F8DA 2GFEA 3TCGA 3MVWA 2YJPA 2YPNA 1B40A 2OCUA 3RGYA 5B7DA 2KLFA 4ONYA 1B32A 3ILUB 3E9XA 3R7XA 3PPOA 2X7PA 1MY1A 2ONKE 3V5AA 1B3LA 3SEWA 1B2HA 5H8HB 1B3HA 4JBZA 3U72A 4N07A 2I4CA 3S9LC 2ONRA 3TYHA 1MY2A 3CIJA 3CSGA 1GR2A 4DDDA 1MXUA 4X9TA 3K0VA 4ZEIA 1P1OA 3KGCA 3FJ7A 3PPPA 5AA4B 5AA2B 3QUFA 4EXLA 1GTKA 2UVJA 5KCJB 2V3UA 5ICQA 1M5DA 1DTGA 4ZEKA 3TUSA 5A5XB 2FNCA 3UP9A 4XKRA 3BKIB 1MDP1 3G3JA 4RNSA 4F39A 3MVZA 1H44A 1OLCA 4GD5A 4H5GA 4NF5B 1XT8A 3FGSA 2O84X 3K1MA 1B7HA 2O51A 3SETA 3IOUA 4OEUA 3IB2A 4EQBA 1B6HA 3PMWA 3PPRA 3DM0A 4EF2A 3H6WA 2ANJA 1A99A 1FTMA 1AMFA 1VE4A 3C34A 5CMBA 1R9LA 3UORA 1MH3A 5I2NB 1JW5A 2GHBA 1ZLQA 2Z8FA 3JZJA 1PBQA 3RPWA 1M5CA 1URGA 1UTBA 3RLFE 4LZ8A 4RXLA 3WAFA 1JNFA 3TDJA 1B3FA 5H8FB 3KZGA 2F5XA 3RTWB 4BDMA 2XX9A 4PE5B 3T9VA 3H6TA 4ZEFA 1D3KA 4F2OA 1VSOA 3R6UA 3MVXA 3Q28A 5FHNA 2O68A 3TZAA 4R9GA 4OEVA 4OZ9A 1QVSA 3OO7A 2DWHA 1P1UA 2AYSA 1GGGA 3BBRA 1Y3QA 4G8HA 2VD2A 3OO6A 1BLFA 3MP6A 3TELA 3HHGA 1QULA 1P1NA 5IAIA 1SYIA 1TWYA 1HSJA 3Q25A 5FHOA 4U23A 1NNTA 4IO4A 4F1VA 4RPNA 1P99A 3FJGA 3OSQA 2OWSA 1FQFA 2W7YA 3FVKA 3B6WA 1IQ7A 1Y3PA 5CMCA 2Q89A 1XS5A 3EQ1A 3K02A 1GV8A 4DLDA 4NF6B 4DE8A 4DXBA 4GL8A 3W15C 4BDLA 2R6GE 3HPIA 5I2KA 2DVCA 3IORA 2RC7A 3B6TA 2UVHA 3PGFA 4YB6A 1JW1A 1GVCA 3M3KA 3Q27A 4R6KA 4ZE8A 2QS2A 1DMBA 1IXIA 3K01A 3QAXA 4ISUA 4RYAA 1POY1 5I56A 3U92A 1FQEA 2XD2A 4G77A 2VD3A 4U22A 3CSBA 3CI8A 1IXGA 2I6EA 1N3XA 5I57A 4PP0A 2GHAA 1JVXA 3TCHA 2ZYKA 2DXYA 1MQGA 1B0HA 4GL0A 4GWOA 3MZBA 4OETA 3H4ZA 2RCAA 2E0SA 1P1WA 1JVYA 3K2DA 4QFOA 2GH9A 1SI0A 1WODA 1SBPA 4R6HA 3VE1B 4MLVA 1ZU0A 2RKMA 4G4PA 4N6PA 3TCFA 1UIVA 1Q1KA 1AL3A 1SW4A 2DWJA 2PT1A 2THIA 3T22A 4I8CA 1ELJA 4WXJA 3RN8A 1YCJA 2NOOA 4M1VA 1QUKA 4Q30B 1DOTA 4U21A 1XHYA 3PUWE 2OBGA 4QFPA 3MJNA 4MH5A 3O28A 1J1NA 2I49A 3MPKA 4ELOA 4RK9A 4F1UA 5DEXA 5ITPA 1SI1A 3P7IA 4YMAA 1MM6A 3T93B 2XHDA 2ZNSA 4JWOA 3JV9A 4JSOA 4FAJA 3RUMA 3A09A 3HN0A 1VR5A 1JETA 4GIZA 2DS9A 1UQWA 2H98A 3TTLA 3A3UA 4QFLA 1M5EA 1D9YA 2UXAA 3O9PA 3OSRA 2XD3A 1BIYA 3IOVA 1Y1MA 3MWBA 2OK2A 2ZXTA 2UYEA 3E3KA 3C35A 4LONB 4I9DA 4MLQA 3OD7A 4PETA 3T9UA 4O3BA 2QRYA 3TQLA 1PB9A 4H67A 3PUVE 3LSWA 3TQWA 5I84A 1B3EA 3MBPA 1LFHA 2H25A 2QL3A 4KR5A 1USYH 4EXKA 1ANFA 2B3BA 3OMBA 1FQBA 4R2BA 4WKMA 2ABHA 1R1NA 5H8NB 4BDNA 5I58B 4EQ9A 4P0IA
chains in the Genus database with same CATH superfamily
3VDFA 4PFWA 3EHUA 4H65A 2D3IA 3EHTA 2XXIA 3UK4A 2I48A 3OEKA 5TP9A 1NV0A 3IJXB 3QSLA 2X7QA 1OVBA 4GLIA 2NUVA 4P1LA 1MY0A 4JWXA 1FPGA 2F3BA 4LZ5A 1VFDA 2HAVA 3G3KA 2F36A 2RC9A 4LATA 5BUUA 3MW0A 4F3GA 5FTIA 2GQ1A 3I6VA 4GWWA 3CFZA 5JTYA 4NAPA 3O97A 1M5BA 5EYGA 4ECFA 5KDTA 3CG1A 4NF8A 2XX8A 2XA5A 3N26A 3OEMA 3C33A 1B46A 3W9VA 4IB2A 4EF1A 2I3VA 4FECA 3HV1A 1WDNA 1NFTA 1AOVA 3IFCA 3KEIA 4H8JA 3PD8A 5IZ3B 5AA2D 4BLAA 4ZS9A 1S7YA 3RT8A 4ELRA 2I0BA 3G3HA 4KYSA 3TFLA 3IK6B 1A7LA 3PMVA 4YKIA 1H3DA 4GWSA 1ZIUA 3IOTA 4MIJA 1IZ1A 2V84A 4YKPA 2OWTA 3VFJA 5FHMA 4H0WA 5LTCA 4GVOA 2PFZA 1OMPA 4DIGA 4IY6A 1OLAA 4F1YA 4F31B 3ONMA 1NNPA 1MH4A 4JVIA 3FVOA 2HAUA 2QVVA 4GX6A 2Q2CA 5K2YA 3BFTA 4PFBA 2ZYNA 3U94A 3GXAA 5IKBA 2ZZWA 1EYJA 1LBBA 3TTRA 4PC9A 2HZKA 4YZZA 1N76A 3CG3A 2XWOA 4AS4A 2FIXA 4R74A 4DI4B 1NMUA 3RPLA 2ONSA 4XKQA 2I0CA 1FTJA 3VVFA 1FTAA 4ZEBA 3E4RA 3HO7A 1QJMA 3SEYA 4OVTA 2XWVA 1BTJA 2CZIA 4F18A 3O6GA 2Y5LA 5BWJA 2DVZA 4MMPA 1S50A 1B5HA 5CMKA 3CR9A 1SPIA 5M2VA 2HEUA 3KN7A 3LBSA 1LEVA 3UIFA 1KA1A 3JYRA 2QJEA 2FBPA 4G68C 4XIGQ 4G68A 4IGRA 1R9QA 1FTOA 4OFLA 1KZ8A 1Q35A 4ZECA 3A29A 3S2VA 3K4UA 4GOTA 4JVDA 2Q2AA 2LAOA 4GF8A 3V8XB 1MQHA 2XWIA 3DP8A 1DSNA 4GRKA 2G29A 4LZ7A 5J1DA 4Q0CA 5I56B 1XI6A 2XXKA 3OXNA 1ZJLA 3TMGA 5DT6A 1CB6A 2JJKA 4F22A 3C31A 1IMCA 1IMBA 2B4LA 1FQDA 1IIWA 4MX6A 4XXUA 4E0WA 3THIA 3FV2A 5CM6A 1POTA 1B05A 4ZEDA 4YU0A 4AQ4A 3PD9A 1A55A 3T66A 4K3FA 1NV5A 2DXRA 4MAGA 2F7AA 4TQUQ 1FBPA 2QMWA 3TTKA 3CRBA 1FBGA 3SEUA 2O1MA 1QKAA 2I3WA 1JW4A 1SQYA 3USDA 3VV5A 3G3FA 5H8HA 3KG2A 3HCQA 3H7MA 2PMSA 2KQZA 3K6VA 3KBRA 1B3GA 3H03A 4O3CA 4OXVA 4F2QA 2A5TA 2H99A 2IEEA 1RYXA 2HXRA 5F7VA 4TOZA 1NH8A 4IO3A 2Z22A 1VDWA 1QW0A 4R9FA 5KCJA 1QGXA 3NOHA 4OFJA 5A5XA 1Y4CA 4OWDA 4OVPA 4H8IA 4DI3D 2B3FA 2CEYA 2F35A 1FBCA 2PYYA 4NF5A 1TXFA 4M4GA 4GXSB 5DEXB 3U1OA 4L17A 5HBCA 3TTMA 2P1SA 1UTHB 3H06B 2H9BA 4YMBA 5ICTA 1MDQA 3PUZE 3VVEA 2HCAA 2VP1A 4C0RA 2Y7IA 1SD3A 3MVYA 2E1SA 4NF0A 2P3VA 1B9JA 4OFOA 4PF8A 4KD5A 4N6KA 1MQDA 2CMOA 3C32A 3PMXA 3BIHA 1MPBA 4IO7A 4HCYA 1L5TA 1IUDA 2HXWA 1DCUA 2Y5KA 1Z7NE 5DTBA 2Y7WA 1LBXA 1PB8A 4U1ZA 2P2AA 5CC2A 1A54A 3FXUA 1N7XA 1OVTA 3KFMA 3FUZA 2CEXA 3KN3A 3RNNA 5EHSA 2B65A 4I3EA 2V93A 2WYPA 4N8GA 3SDFA 5AE4A 5L9OA 4Z0IA 2F7BA 1A8EA 4PFYA 4U1OA 5H8SA 4KQPA 1FPIA 3M3FA 1NH7A 5IM2A 1D9VA 5CBSA 4GXAA 4POWA 3IB0A 4NMYA 3BFUA 5F24A 5H8QB 1NV7A 4OQOA 2V25A 2V3QA 3U65A 2HQ0A 4MCOA 2RC8A 3IR1A 4IGTA 1MRPA 4H1XA 4ZZAA 3ZSFA 4P56A 4FATA 2F7CA 1LBVA 1KA0A 5I59B 3CHGA 4ESXA 2DSFA 3KJTA 4HW8A 1FPJA 3U93A 1Y4TA 3K1PA 3LSFB 4ZE9A 5KDTB 2QSXA 5A5LA 5EYFA 1JEVA 4FBPA 3D1RA 1Z7ME 3B7DA 1D9QA 1I6QA 4NF4A 4LN5A 1N04A 3FASA 1H45A 1YPNA 1LSTA 1DK4A 4FEBA 4GWXA 3I5OA 2XXYA 2Y84A 1SDXA 2DQVA 3KOSA 3IAZA 5J16A 1JP4A 3TAJA 4NF6A 4XKNA 3W9WA 3ZKKA 4H5FA 2XXHA 1EZ9A 2HZLA 1ZBMA 4NHBA 5CMMA 3IL1B 4H46A 4F3SA 2DWIA 4JVCA 4R6YA 3IO4A 1SW5A 4R72A 2WBDA 2XXUA 2XXVA 5LOMA 5ISUA 3SERA 2QS4A 1WVJA 3H6UA 2Y7PA 3RT6B 2D5WA 4ELQA 2CZKA 4UABA 1NUZA 2R71A 4XKPA 1N7WA 1UIUA 4FJPA 3G3GA 4GQOA 4JDFA 4OERA 3SKPA 1DPEA 2V3TA 1MG1A 5ESYA 1FQCA 1YAEA 3FV1A 3EHSA 4OTEA 1QUIA 4WEPA 3WAEA 4YB7A 1DPPA 3MZ9A 4WEDA 4LVQA 3O2AA 1LAXA 3L6HA 4PE3A 1MPCA 2M8CA 5EQ9A 4JWYA 5LDZA 2ZMBA 2WYKA 5I7IA 1IXCA 3K6XA 3VLVA 3D4CA 2PBWA 3U8QA 1MXVA 1MS7A 4EUOA 1II5A 1B4ZA 5F1QA 4G68B 5TU0A 4KCCA 3UA8A 4QBAA 4QFKA 5EYHA 4JXIA 1O64A 4DXUA 3L6GA 2VOZA 5JEIA 1BK4A 3DLNA 4ZDMA 4ELPA 2CZLA 1NI9A 3N6TA 2FYIA 4RA1A 2REGA 1UTBB 1H43A 3T9XB 3DP6A 2F6GA 1BP5A 1SYHA 3B8BA 4P8BA 3FBPA 4N6DA 3LUZA 4JB7A 3UN6A 2NXOA 4TLLB 4U2RA 3S9NC 3K00A 1PEBA 1SW1A 4IO2A 4DCYA 2DWAA 1LB9A 2O1LA 2XXQA 2PT2A 4UACA 1NV4A 1SVXB 1EZOA 5DVIA 1Y20A 1MXZA 1VFEA 3KSJA 2F34A 4BDQA 3VXBA 4R73A 3S9MC 4KYEA 2F97A 3MYUA 4N91A 2NWJA 5IZZA 5AA3A 5JK4A 2Z23A 3C4MA 4QFNA 3AXFA 3RTFB 2D21A 3MZ1A 1AH5A 3S9EA 3QIMA 4MF3A 4LA9A 1ATGA 4C1UA 2UVIA 4GWZA 4C1TA 4E0XA 1P1QA 2PCRA 3HHFA 2ESNA 3MPLA 2DE2A 3SEVA 4Z7EA 4PGNA 3KOTA 4U4SA 2MKZA 1JQFA 4LP2B 3VXCA 3OELA 4GX4A 3G7WA 4PCDA 2A5TB 1FBEA 1IMDA 5I5PA 5AA1A 2AIXA 2Z8EA 3E13X 4TLMB 4R2FA 4IR8A 3B6QA 3PUYE 3ZS6A 3M3LA 1TFAA 4N4UA 1OQGA 4MNCA 1B5JA 5L8DA 3KJ7A 4YICA 3ZKLA 1DBZA 4P0GA 4PAFA 1B0LA 4OYVA 4KCDA 1FPDA 2RCBA 3IJOB 5H8NA 5I2KB 4N13A 5TPAA 3Q26A 3FXRA 4G2ZA 2Q8JA 2BJJX 3MUQA 5I58A 3LSXA 3FVNA 1O7TA 4QXDA 3UGWA 1F9BA 3I3VA 1LFGA 1TFDA 3RQTA 2XXTA 2ZZVA 1I6BA 4I1DA 2O7UA 4RY1A 1MXWA 3V83A 1AIVA 3CVGA 2UVGA 1PC3A 1LAFE 1N84A 3MQ9A 4OMBA 2R9JA 3A3CA 5HPQA 1Y1ZA 3H3GA 1SW2A 4EDPA 1B1HA 4DZ1A 2ZNTA 4LQ5A 4YKKA 4X1BA 4HTGA 3FJMA 5I57B 1B5IA 4U4XA 1NL5A 2ALUA 4NX1A 1FBHA 4PFRA 3RY3A 4NGUA 2PVUA 4MNPA 3M8UA 1B52A 3O6HA 3VLUA 3EN3A 4P9KA 1LAGE 1CE2A 4AB6A 2ZNUA 3MAMA 2VPOA 2P0SA 4QHQA 4YAHX 2I4BA 3IX1A 4QF9A 2Z8DA 4G8MA 4PGPA 5L9SA 1FPFA 1TT1A 3LC8A 4OESA 4KYDA 3TPAA 3B50A 4QSCA 1LB8A 2RINA 4MEVA 4YB5A 1LAHE 1IMEA 4RPOA 2WKYA 1B58A 5AA2A 5AA4A 1PDAA 4PF6A 5HM4B 2XXWA 5DVJA 2REJA 4UA8A 4IO6A 4HE2A 5L9MA 3QYTA 3N6UA 2WBBA 2Y7KA 3DP4A 1ZMGA 1IXHA 1NKXA 4JSDA 4X04A 4IO5A 2QS1A 3TEPA 2O7IA 3PUXE 2H5YA 4X8RA 4X1DA 3SZPA 4NF4B 3O6IA 3MP8A 3GLBA 2HPGA 4ZZEA 1INPA 4QSDA 1OQHA 2DE4A 5DYHA 2FA7A 4I3YA 2Q88A 3ECRA 3KC1A 1N0TA 4LUBA 2XXXA 1MY4A 3S4UA 1MQIA 2NVUB 4QRZA 5I2NA 1A8FA 1NNKA 3T96B 2AL4A 2V4CA 3PPQA 1KWHA 4GWYA 3IOWA 1PB7A 1XOCA 4FIMA 1FCKA 4H6DA 3PU5A 3GBBA 1XVXA 4PDHA 3CFXA 4NTLA 3TODA 4OVJA 1K9ZA 3KSXA 1NUXA 2VGQA 3OOAA 1O63A 5H8FA 4FEDA 4OVSA 1PBPA 1ZTYA 2Q9TA 4BDOA 1NV3A 1XVYA 1B7UA 2O69A 2QMXA 4FE8A 1US4A 2P3NA 2DYXA 4MHFA 2O6AA 4ESWA 4OA4A 1MM7A 4RJZA 5FBPA 4HS7A 2OLBA 5CI5A 2DE3A 4OENA 3FVGA 3LR1A 3HSTA 3ODBA 4I62A 5B70A 2PX1A 5KZTA 4OVQA 1BKAA 3Q29A 4KI0E 1URSA 3SESA 4MJOA 5TP9B 1LGBC 4NEDA 4O7MA 3GBAA 2IA4A 4GBWA 3ILTB 3R26A 2UYFA 4O3AA 4MFIA 4DXCA 1LCFA 2QPQA 2RF1A 4F29A 4ND9A 5JTYB 4AS5A 4F19A 4NE4A 3VVDA 4EQ7A 1B51A 4HE1A 3DELB 2I58A 1T0KA 4NF8B 1R6ZA 1G0IA 2R8TA 2VHAA 1USYE 3FZVA 1LBWA 3SEXA 1FJ9A 1QKBA 2ZYOA 4NWCA 4P1EA 3IO6A 1ZKBA 3TTNA 2XXRA 3LUYA 2G93A 1A40A 1MQJA 1FTLA 2H4IA 3OENA 4RK2A 4LQ2A 5EHMA 2OZZA 1I69A 1DTZA 1EYIA 2YLNA 2DDKA 4MBPA 4KHZE 1JEUA 1M5FA 3FATA 1AWBA 4QSEA 3PV0E 1N3WA 1Y3NA 3FXQA 4KPTA 1EZPA 1UTHA 3GZGA 4XTCQ 1URDA 3QXMA 3V89B 1QUJA 1FW0A 1LLSA 4Q8RA 5DVFA 5IGAA 2DP8A 3F11A 5CRYA 2GRVA 2HFBA 3G3IA 3FIRA 1YZ0A 3QUJA 1EH3A 1YTVA 4DCXA 4PFUA 2X26A 3IB1A 1US5A 1IITA 2DOJA 5ELVA 5ITOA 1FQAA 1MXYA 3TKDA 1HSLA 3IFAA 3CFLA 2FVZA 2OJTA 2Y7RA 2F78A 1I6AA 4F3PA 3RPLB 4F3BA 1RDXA 3EPEA 4IY5A 3VLWA 3T9HB 2QVUA 4PQJA 3K6WA 3QMFA 4PAIA 1H76A 4HCWA 2QS3A 3E78A 1FTKA 3MP1A 5ET8A 4R75A 4BDRA 4N8YA 5ET5A 3OO8A 1B4HA 1LCTA 1MPDA 3N5LA 1NV1A 4XEQA 4OHNA 3C9HA 1Y9UA 2ZYMA 3C36A 4GFRA 5TPAB 1D4NA 3MC2A 5H8QA 2XWKA 5FTHA 1LFIA 3LSLA 3EF7A 1MY3A 2A5SA 1LBZA 3O29A 4P11A 1HSEA 3K6UA 2OWZA 3O66A 3D4GA 2XXPA 4X48A 1RYOA 3H6VA 1LBCA 1XC1A 3KBZA 4YKJA 4KFQA 1NUWA 4N15A 1B7ZA 1OIBA 5I59A 3FD3A 5EQ8A 1MXXA 2AL5A 1B1XA 3OO9A 2HHMA 4PFTA 5CBRA 3QK6A 1S9TA 4THIA 5K2XA 1RKMA 1NNFA 4Q5TA 3PPNA 2F6PA 4G8NA 4FORA 4NWDA 2XX7A 4AB5A 3K1NA 1IEJA 3KN8A 1EU8A 4POXA 3N94A 2F8DA 5ET6A 2GFEA 3TCGA 3MVWA 2YJPA 2YPNA 1B40A 4P3LA 4P47A 2OCUA 2Q74A 3RGYA 5B7DA 4PBHA 2KLFA 4ONYA 1B32A 3ILUB 3E9XA 3R7XA 3PPOA 2X7PA 4I40A 1MY1A 2ONKE 3V5AA 1B3LA 3SEWA 1B2HA 5H8HB 1B3HA 4JBZA 2CZHA 3U72A 4N07A 2Q8MA 2I4CA 3S9LC 2ONRA 3TYHA 1MY2A 3CIJA 3CSGA 1GR2A 4DDDA 1MXUA 4X9TA 3K0VA 4N17A 4ZEIA 1P1OA 3KGCA 3FJ7A 5DW8A 3PPPA 5AA4B 5AA2B 3QUFA 4EXLA 1GTKA 2UVJA 5KCJB 2V3UA 5ICQA 1M5DA 1DTGA 4ZEKA 3TUSA 5A5XB 2FNCA 3UP9A 4XKRA 3BKIB 1MDP1 3G3JA 4RNSA 4F39A 3MVZA 1H44A 1OLCA 4GD5A 4H5GA 4NF5B 1XT8A 3FGSA 1CNQA 2O84X 3K1MA 1B7HA 1FPBA 2O51A 5T3JA 3SETA 3IOUA 4OEUA 3IB2A 4EQBA 1B6HA 3PMWA 3PPRA 3DM0A 4GBVA 4EF2A 3H6WA 2ANJA 1A99A 1FTMA 1AMFA 1VE4A 3C34A 4H45A 5CMBA 4NQ8A 2BJIA 1R9LA 3UORA 1RDYA 1MH3A 5I2NB 1JW5A 4PAKA 2GHBA 1ZLQA 2Z8FA 3JZJA 1PBQA 3RPWA 1M5CA 4PBQA 1URGA 1UTBA 3RLFE 1FBDA 1NV2A 4LZ8A 4RXLA 3WAFA 1JNFA 3TDJA 1B3FA 5H8FB 3KZGA 2F5XA 2WX9A 3RTWB 4BDMA 2PFYA 2B4MA 2XX9A 4PE5B 1G0HA 3T9VA 3H6TA 4ZEFA 1D3KA 4F2OA 1VSOA 3GYYA 3R6UA 3MVXA 1FRPA 1FPLA 3Q28A 5IZ3A 5FHNA 2O68A 3TZAA 4R9GA 4OEVA 4OZ9A 1QVSA 3OO7A 5ET7A 2DWHA 1P1UA 2AYSA 4OVRA 1GGGA 2FHYA 3BBRA 1Y3QA 2F3DA 4G8HA 5EQAA 3LV0A 2VD2A 3OO6A 1BLFA 4NG7A 3MP6A 3TELA 3HHGA 1QULA 4N81A 1P1NA 5IAIA 1SYIA 1TWYA 1HSJA 2WEFA 5EQ7A 3Q25A 5FHOA 4U23A 1NNTA 4IO4A 2QFLA 4F1VA 4RPNA 1P99A 1FJ6A 3FJGA 3OSQA 2OWSA 1FQFA 2W7YA 5IZ1A 3FVKA 3B6WA 4OANA 1NUYA 1IQ7A 1Y3PA 5CMCA 2Q89A 1XS5A 3EQ1A 3K02A 1GV8A 4DLDA 4NF6B 4HXVA 4DE8A 4DXBA 4GL8A 3W15C 1NV6A 4BDLA 2R6GE 3HPIA 5I2KA 2DVCA 3IORA 2RC7A 1EYKA 3B6TA 4GWUA 2UVHA 4PTKA 3PGFA 4YB6A 1JW1A 1GVCA 3M3KA 3Q27A 4R6KA 4ZE8A 2L5VA 2QS2A 4O7IA 1DMBA 2KR0A 1IXIA 3K01A 3QAXA 4ISUA 4RYAA 1POY1 3ROJA 5I56A 4O8MA 1IMAA 3U92A 4PFIA 1FQEA 2XD2A 4G77A 2VD3A 4U22A 3CSBA 3CI8A 1IXGA 2I6EA 1N3XA 5I57A 4PP0A 2GHAA 3RYDA 3FXBA 1JVXA 3TCHA 2QVRA 2ZYKA 1LBYA 2DXYA 1MQGA 1B0HA 1FSAA 4GL0A 1FBFA 4GWOA 3MZBA 2VT5A 4OETA 4XF5A 3H4ZA 2RCAA 2E0SA 1P1WA 1JVYA 3K2DA 4QFOA 2GH9A 1SI0A 1WODA 1SBPA 1YXIA 4R6HA 3VE1B 4MLVA 1ZU0A 2RKMA 4G4PA 4N6PA 2FIEA 3HFUA 3TCFA 1UIVA 1Q1KA 3MSTA 1AL3A 1SW4A 2DWJA 3EKIA 1FPEA 1RDZA 2PT1A 2THIA 3T22A 4I8CA 1ELJA 4WXJA 3RN8A 1YCJA 2NOOA 4M1VA 1QUKA 2ZZXA 4Q30B 1DOTA 4U21A 1XHYA 4HE0A 4NN3A 3PUWE 2OBGA 4QFPA 3MJNA 3PTYA 4MH5A 3O28A 1J1NA 2I49A 3MPKA 4ELOA 4RK9A 4F1UA 5DEXA 5ITPA 1SI1A 3T0JA 3P7IA 4YMAA 1MM6A 3E79A 3T1BA 3T93B 5I3SA 2XHDA 2ZNSA 4JWOA 3JV9A 4PDDA 4JSOA 4FAJA 3RUMA 3A09A 1Q9DA 3HN0A 1VR5A 1JETA 4GX3A 4GIZA 2DS9A 1UQWA 2H98A 3TTLA 3A3UA 4QFLA 1M5EA 1D9YA 2UXAA 3O9PA 3OSRA 2XD3A 1BIYA 3IOVA 1Y1MA 2VPNA 3MWBA 2OK2A 1YYZA 2ZXTA 2UYEA 3E3KA 3C35A 4LONB 1IMFA 4KXPA 4I9DA 4MLQA 3OD7A 2OX3A 3KC0A 4G61A 4PETA 3T9UA 4O3BA 2QRYA 3TQLA 1PB9A 4H67A 3PUVE 3LSWA 3TQWA 1K9YA 5I84A 1B3EA 3MBPA 3ISPA 1LFHA 2H25A 2QL3A 4KR5A 1USYH 4EXKA 1ANFA 2B3BA 4XFEA 1FPKA 3OMBA 1FQBA 4R2BA 4WKMA 2ABHA 1R1NA 5H8NB 4O94A 3BIGA 4BDNA 5I58B 4EQ9A 4P0IA 4MNIA
chains in the Genus database with same CATH topology
3VDFA 4PFWA 3EHUA 4H65A 2D3IA 3EHTA 2XXIA 3UK4A 2I48A 3OEKA 5TP9A 3IJXB 3QSLA 2X7QA 1OVBA 4GLIA 2NUVA 1MY0A 4JWXA 4LZ5A 1VFDA 2HAVA 3G3KA 2F36A 2RC9A 4LATA 5BUUA 3MW0A 4F3GA 5FTIA 3I6VA 3CFZA 5JTYA 3O97A 1M5BA 4ECFA 5KDTA 3CG1A 4NF8A 2XX8A 3N26A 3OEMA 3C33A 1B46A 3W9VA 4IB2A 4EF1A 2I3VA 4FECA 3HV1A 1WDNA 1NFTA 1AOVA 3KEIA 4H8JA 3PD8A 5AA2D 4BLAA 4ZS9A 1S7YA 3RT8A 4ELRA 2I0BA 3G3HA 4KYSA 3TFLA 3IK6B 1A7LA 3PMVA 4YKIA 1H3DA 1ZIUA 3IOTA 1IZ1A 2V84A 4YKPA 2OWTA 3VFJA 5FHMA 4H0WA 4GVOA 1OMPA 4DIGA 4IY6A 1OLAA 4F1YA 4F31B 3ONMA 1NNPA 1MH4A 3FVOA 2HAUA 2Q2CA 5K2YA 3BFTA 2ZYNA 3U94A 3GXAA 5IKBA 1LBBA 3TTRA 2HZKA 4YZZA 1N76A 3CG3A 4R74A 1NMUA 2ONSA 4XKQA 2I0CA 1FTJA 3VVFA 4ZEBA 3E4RA 3HO7A 1QJMA 3SEYA 1BTJA 4F18A 3O6GA 5BWJA 2DVZA 1S50A 1B5HA 5CMKA 3CR9A 5M2VA 2HEUA 3KN7A 3LBSA 3UIFA 3JYRA 2QJEA 4G68C 4XIGQ 4G68A 4IGRA 1R9QA 1FTOA 4OFLA 1Q35A 4ZECA 3S2VA 3K4UA 4GOTA 2Q2AA 2LAOA 4GF8A 3V8XB 1MQHA 3DP8A 1DSNA 4GRKA 2G29A 4LZ7A 5J1DA 4Q0CA 5I56B 3OXNA 1ZJLA 3TMGA 5DT6A 1CB6A 4F22A 3C31A 1FQDA 1IIWA 4XXUA 4E0WA 3THIA 3FV2A 5CM6A 1POTA 1B05A 4ZEDA 4YU0A 4AQ4A 3PD9A 1A55A 3T66A 4K3FA 2DXRA 2F7AA 4TQUQ 2QMWA 3TTKA 3CRBA 3SEUA 2O1MA 1QKAA 2I3WA 1JW4A 1SQYA 3USDA 3VV5A 3G3FA 5H8HA 3KG2A 3HCQA 3H7MA 2PMSA 3K6VA 3KBRA 1B3GA 3H03A 4O3CA 4OXVA 4F2QA 2A5TA 2H99A 2IEEA 1RYXA 5F7VA 4TOZA 1NH8A 4IO3A 2Z22A 1QW0A 4R9FA 5KCJA 4OFJA 5A5XA 1Y4CA 4OWDA 4H8IA 2B3FA 2F35A 2PYYA 4NF5A 1TXFA 4M4GA 4GXSB 5DEXB 3U1OA 4L17A 5HBCA 3TTMA 2P1SA 1UTHB 3H06B 2H9BA 4YMBA 5ICTA 1MDQA 3PUZE 3VVEA 2HCAA 2VP1A 4C0RA 2Y7IA 1SD3A 3MVYA 2E1SA 1B9JA 4OFOA 4KD5A 1MQDA 2CMOA 3C32A 3PMXA 1MPBA 4IO7A 4HCYA 1L5TA 1IUDA 2HXWA 1Z7NE 5DTBA 2Y7WA 1PB8A 4U1ZA 2P2AA 5CC2A 1A54A 3FXUA 1N7XA 1OVTA 3KFMA 3FUZA 3KN3A 3RNNA 5EHSA 2B65A 2V93A 3SDFA 5AE4A 5L9OA 4Z0IA 2F7BA 1A8EA 4PFYA 4U1OA 5H8SA 4KQPA 3M3FA 1NH7A 1D9VA 5CBSA 4GXAA 4POWA 3IB0A 4NMYA 3BFUA 5H8QB 4OQOA 2V25A 2V3QA 2HQ0A 2RC8A 3IR1A 4IGTA 1MRPA 4H1XA 4ZZAA 3ZSFA 4FATA 2F7CA 5I59B 4ESXA 2DSFA 3KJTA 4HW8A 3U93A 1Y4TA 3K1PA 3LSFB 4ZE9A 5KDTB 2QSXA 5EYFA 1JEVA 1Z7ME 3B7DA 1I6QA 4NF4A 1N04A 3FASA 1H45A 1YPNA 1LSTA 4FEBA 3I5OA 2XXYA 2Y84A 1SDXA 2DQVA 3KOSA 3IAZA 3TAJA 4NF6A 4XKNA 3W9WA 3ZKKA 4H5FA 2XXHA 1EZ9A 2HZLA 1ZBMA 5CMMA 3IL1B 4F3SA 2DWIA 4R6YA 3IO4A 1SW5A 4R72A 2XXUA 2XXVA 5LOMA 5ISUA 3SERA 2QS4A 1WVJA 3H6UA 2Y7PA 3RT6B 2D5WA 4ELQA 2R71A 4XKPA 1N7WA 1UIUA 4FJPA 3G3GA 4GQOA 4JDFA 4OERA 3SKPA 1DPEA 2V3TA 1MG1A 1FQCA 1YAEA 3FV1A 3EHSA 4OTEA 1QUIA 4WEPA 3WAEA 4YB7A 1DPPA 3MZ9A 4WEDA 4LVQA 3O2AA 1LAXA 3L6HA 1MPCA 2M8CA 4JWYA 2ZMBA 1IXCA 3K6XA 3VLVA 3D4CA 2PBWA 3U8QA 1MXVA 1MS7A 4EUOA 1II5A 1B4ZA 5F1QA 4G68B 5TU0A 4KCCA 3UA8A 4QFKA 4JXIA 1O64A 4DXUA 3L6GA 2VOZA 5JEIA 3DLNA 4ZDMA 4ELPA 2CZLA 3N6TA 2FYIA 4RA1A 2REGA 1UTBB 1H43A 3T9XB 3DP6A 2F6GA 1BP5A 1SYHA 4JB7A 3UN6A 2NXOA 4TLLB 4U2RA 3S9NC 3K00A 1PEBA 1SW1A 4IO2A 4DCYA 2DWAA 1LB9A 2O1LA 2XXQA 2PT2A 4UACA 1SVXB 1EZOA 5DVIA 1Y20A 1MXZA 1VFEA 3KSJA 2F34A 4BDQA 3VXBA 4R73A 3S9MC 4KYEA 2F97A 2NWJA 5AA3A 5JK4A 2Z23A 3C4MA 4QFNA 3AXFA 3RTFB 2D21A 3MZ1A 1AH5A 3S9EA 3QIMA 4MF3A 4LA9A 1ATGA 4C1UA 2UVIA 4C1TA 4E0XA 1P1QA 3HHFA 2ESNA 3MPLA 2DE2A 3SEVA 4Z7EA 4U4SA 3KOTA 1JQFA 4LP2B 3VXCA 3OELA 3G7WA 2A5TB 5AA1A 2AIXA 2Z8EA 3E13X 4TLMB 4R2FA 3B6QA 3PUYE 3ZS6A 3M3LA 1TFAA 1OQGA 1B5JA 5L8DA 3KJ7A 4YICA 3ZKLA 4P0GA 1B0LA 4OYVA 4KCDA 2RCBA 3IJOB 5H8NA 5I2KB 4N13A 5TPAA 3Q26A 3FXRA 4G2ZA 2Q8JA 2BJJX 3MUQA 5I58A 3LSXA 3FVNA 1O7TA 3UGWA 1F9BA 3I3VA 1LFGA 1TFDA 3RQTA 2XXTA 1I6BA 4I1DA 2O7UA 4RY1A 1MXWA 3V83A 1AIVA 3CVGA 2UVGA 1PC3A 1LAFE 1N84A 3MQ9A 4OMBA 2R9JA 3A3CA 5HPQA 1Y1ZA 3H3GA 1SW2A 4EDPA 1B1HA 4DZ1A 2ZNTA 4LQ5A 4YKKA 4X1BA 4HTGA 3FJMA 5I57B 1B5IA 4U4XA 1NL5A 2ALUA 3RY3A 2PVUA 3M8UA 1B52A 3O6HA 3VLUA 3EN3A 1LAGE 1CE2A 4AB6A 2ZNUA 3MAMA 2P0SA 4QHQA 4YAHX 2I4BA 3IX1A 4QF9A 2Z8DA 4G8MA 5L9SA 1TT1A 3LC8A 4OESA 4KYDA 3TPAA 4QSCA 1LB8A 2RINA 4YB5A 1LAHE 4RPOA 2WKYA 1B58A 5AA2A 5AA4A 1PDAA 5HM4B 2XXWA 5DVJA 2REJA 4UA8A 4IO6A 5L9MA 3QYTA 3N6UA 2Y7KA 3DP4A 1ZMGA 1IXHA 1NKXA 4JSDA 4IO5A 2QS1A 3TEPA 2O7IA 3PUXE 2H5YA 4X1DA 4NF4B 3O6IA 3MP8A 3GLBA 4ZZEA 4QSDA 1OQHA 2DE4A 5DYHA 2FA7A 2Q88A 3ECRA 1N0TA 4LUBA 2XXXA 1MY4A 3S4UA 1MQIA 2NVUB 4QRZA 5I2NA 1A8FA 1NNKA 3T96B 2AL4A 3PPQA 1KWHA 3IOWA 1PB7A 1XOCA 4FIMA 1FCKA 4H6DA 3PU5A 3GBBA 1XVXA 3CFXA 4NTLA 3TODA 4OVJA 3KSXA 2VGQA 3OOAA 1O63A 5H8FA 4FEDA 1PBPA 1ZTYA 2Q9TA 4BDOA 1XVYA 1B7UA 2O69A 2QMXA 4FE8A 1US4A 2DYXA 2O6AA 4ESWA 1MM7A 4RJZA 4HS7A 2OLBA 5CI5A 2DE3A 4OENA 3FVGA 3LR1A 3HSTA 3ODBA 4I62A 5B70A 2PX1A 5KZTA 1BKAA 3Q29A 4KI0E 1URSA 3SESA 5TP9B 1LGBC 4NEDA 3GBAA 2IA4A 3ILTB 3R26A 2UYFA 4O3AA 4MFIA 4DXCA 1LCFA 2QPQA 2RF1A 4F29A 4ND9A 5JTYB 4F19A 4NE4A 3VVDA 4EQ7A 1B51A 3DELB 2I58A 1T0KA 4NF8B 1R6ZA 2VHAA 1USYE 3FZVA 3SEXA 1QKBA 2ZYOA 4NWCA 3IO6A 1ZKBA 3TTNA 2XXRA 3LUYA 2G93A 1A40A 1MQJA 1FTLA 2H4IA 3OENA 4RK2A 4LQ2A 5EHMA 2OZZA 1I69A 1DTZA 2YLNA 4MBPA 4KHZE 1JEUA 1M5FA 3FATA 4QSEA 3PV0E 1N3WA 1Y3NA 3FXQA 4KPTA 1EZPA 1UTHA 3GZGA 4XTCQ 1URDA 3QXMA 3V89B 1QUJA 1FW0A 1LLSA 4Q8RA 5DVFA 2DP8A 3F11A 5CRYA 2GRVA 2HFBA 3G3IA 3FIRA 3QUJA 1EH3A 1YTVA 4DCXA 4PFUA 2X26A 3IB1A 1US5A 1IITA 2DOJA 5ELVA 5ITOA 1FQAA 1MXYA 3TKDA 1HSLA 3CFLA 2OJTA 2Y7RA 2F78A 1I6AA 4F3PA 4F3BA 3EPEA 4IY5A 3VLWA 3T9HB 4PQJA 3K6WA 1H76A 4HCWA 2QS3A 1FTKA 3MP1A 4R75A 4BDRA 3OO8A 1B4HA 1LCTA 1MPDA 3N5LA 4OHNA 3C9HA 1Y9UA 2ZYMA 3C36A 4GFRA 5TPAB 1D4NA 3MC2A 5H8QA 5FTHA 1LFIA 3LSLA 3EF7A 1MY3A 2A5SA 3O29A 4P11A 1HSEA 3K6UA 3O66A 3D4GA 2XXPA 4X48A 1RYOA 3H6VA 1LBCA 1XC1A 4YKJA 4KFQA 1B7ZA 1OIBA 5I59A 3FD3A 1MXXA 2AL5A 1B1XA 3OO9A 4PFTA 5CBRA 3QK6A 5K2XA 1S9TA 4THIA 1RKMA 1NNFA 4Q5TA 3PPNA 2F6PA 4G8NA 4FORA 4NWDA 2XX7A 4AB5A 3K1NA 1IEJA 3KN8A 1EU8A 4POXA 3N94A 2F8DA 2GFEA 3TCGA 3MVWA 2YJPA 2YPNA 1B40A 2OCUA 3RGYA 5B7DA 2KLFA 4ONYA 1B32A 3ILUB 3E9XA 3R7XA 3PPOA 2X7PA 1MY1A 2ONKE 3V5AA 1B3LA 3SEWA 1B2HA 5H8HB 1B3HA 4JBZA 3U72A 4N07A 2I4CA 3S9LC 2ONRA 3TYHA 1MY2A 3CIJA 3CSGA 1GR2A 4DDDA 1MXUA 4X9TA 3K0VA 4ZEIA 1P1OA 3KGCA 3FJ7A 3PPPA 5AA4B 5AA2B 3QUFA 4EXLA 1GTKA 2UVJA 5KCJB 2V3UA 5ICQA 1M5DA 1DTGA 4ZEKA 3TUSA 5A5XB 2FNCA 3UP9A 4XKRA 3BKIB 1MDP1 3G3JA 4RNSA 4F39A 3MVZA 1H44A 1OLCA 4GD5A 4H5GA 4NF5B 1XT8A 3FGSA 2O84X 3K1MA 1B7HA 2O51A 3SETA 3IOUA 4OEUA 3IB2A 4EQBA 1B6HA 3PMWA 3PPRA 3DM0A 4EF2A 3H6WA 2ANJA 1A99A 1FTMA 1AMFA 1VE4A 3C34A 5CMBA 1R9LA 3UORA 1MH3A 5I2NB 1JW5A 2GHBA 1ZLQA 2Z8FA 3JZJA 1PBQA 3RPWA 1M5CA 1URGA 1UTBA 3RLFE 4LZ8A 4RXLA 3WAFA 1JNFA 3TDJA 1B3FA 5H8FB 3KZGA 2F5XA 3RTWB 4BDMA 2XX9A 4PE5B 3T9VA 3H6TA 4ZEFA 1D3KA 4F2OA 1VSOA 3R6UA 3MVXA 3Q28A 5FHNA 2O68A 3TZAA 4R9GA 4OEVA 4OZ9A 1QVSA 3OO7A 2DWHA 1P1UA 2AYSA 1GGGA 3BBRA 1Y3QA 4G8HA 2VD2A 3OO6A 1BLFA 3MP6A 3TELA 3HHGA 1QULA 1P1NA 5IAIA 1SYIA 1TWYA 1HSJA 3Q25A 5FHOA 4U23A 1NNTA 4IO4A 4F1VA 4RPNA 1P99A 3FJGA 3OSQA 2OWSA 1FQFA 2W7YA 3FVKA 3B6WA 1IQ7A 1Y3PA 5CMCA 2Q89A 1XS5A 3EQ1A 3K02A 1GV8A 4DLDA 4NF6B 4DE8A 4DXBA 4GL8A 3W15C 4BDLA 2R6GE 3HPIA 5I2KA 2DVCA 3IORA 2RC7A 3B6TA 2UVHA 3PGFA 4YB6A 1JW1A 1GVCA 3M3KA 3Q27A 4R6KA 4ZE8A 2QS2A 1DMBA 1IXIA 3K01A 3QAXA 4ISUA 4RYAA 1POY1 5I56A 3U92A 1FQEA 2XD2A 4G77A 2VD3A 4U22A 3CSBA 3CI8A 1IXGA 2I6EA 1N3XA 5I57A 4PP0A 2GHAA 1JVXA 3TCHA 2ZYKA 2DXYA 1MQGA 1B0HA 4GL0A 4GWOA 3MZBA 4OETA 3H4ZA 2RCAA 2E0SA 1P1WA 1JVYA 3K2DA 4QFOA 2GH9A 1SI0A 1WODA 1SBPA 4R6HA 3VE1B 4MLVA 1ZU0A 2RKMA 4G4PA 4N6PA 3TCFA 1UIVA 1Q1KA 1AL3A 1SW4A 2DWJA 2PT1A 2THIA 3T22A 4I8CA 1ELJA 4WXJA 3RN8A 1YCJA 2NOOA 4M1VA 1QUKA 4Q30B 1DOTA 4U21A 1XHYA 3PUWE 2OBGA 4QFPA 3MJNA 4MH5A 3O28A 1J1NA 2I49A 3MPKA 4ELOA 4RK9A 4F1UA 5DEXA 5ITPA 1SI1A 3P7IA 4YMAA 1MM6A 3T93B 2XHDA 2ZNSA 4JWOA 3JV9A 4JSOA 4FAJA 3RUMA 3A09A 3HN0A 1VR5A 1JETA 4GIZA 2DS9A 1UQWA 2H98A 3TTLA 3A3UA 4QFLA 1M5EA 1D9YA 2UXAA 3O9PA 3OSRA 2XD3A 1BIYA 3IOVA 1Y1MA 3MWBA 2OK2A 2ZXTA 2UYEA 3E3KA 3C35A 4LONB 4I9DA 4MLQA 3OD7A 4PETA 3T9UA 4O3BA 2QRYA 3TQLA 1PB9A 4H67A 3PUVE 3LSWA 3TQWA 5I84A 1B3EA 3MBPA 1LFHA 2H25A 2QL3A 4KR5A 1USYH 4EXKA 1ANFA 2B3BA 3OMBA 1FQBA 4R2BA 4WKMA 2ABHA 1R1NA 5H8NB 4BDNA 5I58B 4EQ9A 4P0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDF A;  4PFW A;  3EHU A;  4H65 A;  2D3I A;  3EHT A;  2XXI A;  3UK4 A;  2I48 A;  3OEK A;  5TP9 A;  3IJX B;  3QSL A;  2X7Q A;  1OVB A;  4GLI A;  2NUV A;  1MY0 A;  4JWX A;  4LZ5 A;  1VFD A;  2HAV A;  3G3K A;  2F36 A;  2RC9 A;  4LAT A;  5BUU A;  3MW0 A;  4F3G A;  5FTI A;  3I6V A;  3CFZ A;  5JTY A;  3O97 A;  1M5B A;  4ECF A;  5KDT A;  3CG1 A;  4NF8 A;  2XX8 A;  3N26 A;  3OEM A;  3C33 A;  1B46 A;  3W9V A;  4IB2 A;  4EF1 A;  2I3V A;  4FEC A;  3HV1 A;  1WDN A;  1NFT A;  1AOV A;  3KEI A;  4H8J A;  3PD8 A;  5AA2 D;  4BLA A;  4ZS9 A;  1S7Y A;  3RT8 A;  4ELR A;  2I0B A;  3G3H A;  4KYS A;  3TFL A;  3IK6 B;  1A7L A;  3PMV A;  4YKI A;  1H3D A;  1ZIU A;  3IOT A;  1IZ1 A;  2V84 A;  4YKP A;  2OWT A;  3VFJ A;  5FHM A;  4H0W A;  4GVO A;  1OMP A;  4DIG A;  4IY6 A;  1OLA A;  4F1Y A;  4F31 B;  3ONM A;  1NNP A;  1MH4 A;  3FVO A;  2HAU A;  2Q2C A;  5K2Y A;  3BFT A;  2ZYN A;  3U94 A;  3GXA A;  5IKB A;  1LBB A;  3TTR A;  2HZK A;  4YZZ A;  1N76 A;  3CG3 A;  4R74 A;  1NMU A;  2ONS A;  4XKQ A;  2I0C A;  1FTJ A;  3VVF A;  4ZEB A;  3E4R A;  3HO7 A;  1QJM A;  3SEY A;  1BTJ A;  4F18 A;  3O6G A;  5BWJ A;  2DVZ A;  1S50 A;  1B5H A;  5CMK A;  3CR9 A;  5M2V A;  2HEU A;  3KN7 A;  3LBS A;  3UIF A;  3JYR A;  2QJE A;  4G68 C;  4XIG Q;  4G68 A;  4IGR A;  1R9Q A;  1FTO A;  4OFL A;  1Q35 A;  4ZEC A;  3S2V A;  3K4U A;  4GOT A;  2Q2A A;  2LAO A;  4GF8 A;  3V8X B;  1MQH A;  3DP8 A;  1DSN A;  4GRK A;  2G29 A;  4LZ7 A;  5J1D A;  4Q0C A;  5I56 B;  3OXN A;  1ZJL A;  3TMG A;  5DT6 A;  1CB6 A;  4F22 A;  3C31 A;  1FQD A;  1IIW A;  4XXU A;  4E0W A;  3THI A;  3FV2 A;  5CM6 A;  1POT A;  1B05 A;  4ZED A;  4YU0 A;  4AQ4 A;  3PD9 A;  1A55 A;  3T66 A;  4K3F A;  2DXR A;  2F7A A;  4TQU Q;  2QMW A;  3TTK A;  3CRB A;  3SEU A;  2O1M A;  1QKA A;  2I3W A;  1JW4 A;  1SQY A;  3USD A;  3VV5 A;  3G3F A;  5H8H A;  3KG2 A;  3HCQ A;  3H7M A;  2PMS A;  3K6V A;  3KBR A;  1B3G A;  3H03 A;  4O3C A;  4OXV A;  4F2Q A;  2A5T A;  2H99 A;  2IEE A;  1RYX A;  5F7V A;  4TOZ A;  1NH8 A;  4IO3 A;  2Z22 A;  1QW0 A;  4R9F A;  5KCJ A;  4OFJ A;  5A5X A;  1Y4C A;  4OWD A;  4H8I A;  2B3F A;  2F35 A;  2PYY A;  4NF5 A;  1TXF A;  4M4G A;  4GXS B;  5DEX B;  3U1O A;  4L17 A;  5HBC A;  3TTM A;  2P1S A;  1UTH B;  3H06 B;  2H9B A;  4YMB A;  5ICT A;  1MDQ A;  3PUZ E;  3VVE A;  2HCA A;  2VP1 A;  4C0R A;  2Y7I A;  1SD3 A;  3MVY A;  2E1S A;  1B9J A;  4OFO A;  4KD5 A;  1MQD A;  2CMO A;  3C32 A;  3PMX A;  1MPB A;  4IO7 A;  4HCY A;  1L5T A;  1IUD A;  2HXW A;  1Z7N E;  5DTB A;  2Y7W A;  1PB8 A;  4U1Z A;  2P2A A;  5CC2 A;  1A54 A;  3FXU A;  1N7X A;  1OVT A;  3KFM A;  3FUZ A;  3KN3 A;  3RNN A;  5EHS A;  2B65 A;  2V93 A;  3SDF A;  5AE4 A;  5L9O A;  4Z0I A;  2F7B A;  1A8E A;  4PFY A;  4U1O A;  5H8S A;  4KQP A;  3M3F A;  1NH7 A;  1D9V A;  5CBS A;  4GXA A;  4POW A;  3IB0 A;  4NMY A;  3BFU A;  5H8Q B;  4OQO A;  2V25 A;  2V3Q A;  2HQ0 A;  2RC8 A;  3IR1 A;  4IGT A;  1MRP A;  4H1X A;  4ZZA A;  3ZSF A;  4FAT A;  2F7C A;  5I59 B;  4ESX A;  2DSF A;  3KJT A;  4HW8 A;  3U93 A;  1Y4T A;  3K1P A;  3LSF B;  4ZE9 A;  5KDT B;  2QSX A;  5EYF A;  1JEV A;  1Z7M E;  3B7D A;  1I6Q A;  4NF4 A;  1N04 A;  3FAS A;  1H45 A;  1YPN A;  1LST A;  4FEB A;  3I5O A;  2XXY A;  2Y84 A;  1SDX A;  2DQV A;  3KOS A;  3IAZ A;  3TAJ A;  4NF6 A;  4XKN A;  3W9W A;  3ZKK A;  4H5F A;  2XXH A;  1EZ9 A;  2HZL A;  1ZBM A;  5CMM A;  3IL1 B;  4F3S A;  2DWI A;  4R6Y A;  3IO4 A;  1SW5 A;  4R72 A;  2XXU A;  2XXV A;  5LOM A;  5ISU A;  3SER A;  2QS4 A;  1WVJ A;  3H6U A;  2Y7P A;  3RT6 B;  2D5W A;  4ELQ A;  2R71 A;  4XKP A;  1N7W A;  1UIU A;  4FJP A;  3G3G A;  4GQO A;  4JDF A;  4OER A;  3SKP A;  1DPE A;  2V3T A;  1MG1 A;  1FQC A;  1YAE A;  3FV1 A;  3EHS A;  4OTE A;  1QUI A;  4WEP A;  3WAE A;  4YB7 A;  1DPP A;  3MZ9 A;  4WED A;  4LVQ A;  3O2A A;  1LAX A;  3L6H A;  1MPC A;  2M8C A;  4JWY A;  2ZMB A;  1IXC A;  3K6X A;  3VLV A;  3D4C A;  2PBW A;  3U8Q A;  1MXV A;  1MS7 A;  4EUO A;  1II5 A;  1B4Z A;  5F1Q A;  4G68 B;  5TU0 A;  4KCC A;  3UA8 A;  4QFK A;  4JXI A;  1O64 A;  4DXU A;  3L6G A;  2VOZ A;  5JEI A;  3DLN A;  4ZDM A;  4ELP A;  2CZL A;  3N6T A;  2FYI A;  4RA1 A;  2REG A;  1UTB B;  1H43 A;  3T9X B;  3DP6 A;  2F6G A;  1BP5 A;  1SYH A;  4JB7 A;  3UN6 A;  2NXO A;  4TLL B;  4U2R A;  3S9N C;  3K00 A;  1PEB A;  1SW1 A;  4IO2 A;  4DCY A;  2DWA A;  1LB9 A;  2O1L A;  2XXQ A;  2PT2 A;  4UAC A;  1SVX B;  1EZO A;  5DVI A;  1Y20 A;  1MXZ A;  1VFE A;  3KSJ A;  2F34 A;  4BDQ A;  3VXB A;  4R73 A;  3S9M C;  4KYE A;  2F97 A;  2NWJ A;  5AA3 A;  5JK4 A;  2Z23 A;  3C4M A;  4QFN A;  3AXF A;  3RTF B;  2D21 A;  3MZ1 A;  1AH5 A;  3S9E A;  3QIM A;  4MF3 A;  4LA9 A;  1ATG A;  4C1U A;  2UVI A;  4C1T A;  4E0X A;  1P1Q A;  3HHF A;  2ESN A;  3MPL A;  2DE2 A;  3SEV A;  4Z7E A;  4U4S A;  3KOT A;  1JQF A;  4LP2 B;  3VXC A;  3OEL A;  3G7W A;  2A5T B;  5AA1 A;  2AIX A;  2Z8E A;  3E13 X;  4TLM B;  4R2F A;  3B6Q A;  3PUY E;  3ZS6 A;  3M3L A;  1TFA A;  1OQG A;  1B5J A;  5L8D A;  3KJ7 A;  4YIC A;  3ZKL A;  4P0G A;  1B0L A;  4OYV A;  4KCD A;  2RCB A;  3IJO B;  5H8N A;  5I2K B;  4N13 A;  5TPA A;  3Q26 A;  3FXR A;  4G2Z A;  2Q8J A;  2BJJ X;  3MUQ A;  5I58 A;  3LSX A;  3FVN A;  1O7T A;  3UGW A;  1F9B A;  3I3V A;  1LFG A;  1TFD A;  3RQT A;  2XXT A;  1I6B A;  4I1D A;  2O7U A;  4RY1 A;  1MXW A;  3V83 A;  1AIV A;  3CVG A;  2UVG A;  1PC3 A;  1LAF E;  1N84 A;  3MQ9 A;  4OMB A;  2R9J A;  3A3C A;  5HPQ A;  1Y1Z A;  3H3G A;  1SW2 A;  4EDP A;  1B1H A;  4DZ1 A;  2ZNT A;  4LQ5 A;  4YKK A;  4X1B A;  4HTG A;  3FJM A;  5I57 B;  1B5I A;  4U4X A;  1NL5 A;  2ALU A;  3RY3 A;  2PVU A;  3M8U A;  1B52 A;  3O6H A;  3VLU A;  3EN3 A;  1LAG E;  1CE2 A;  4AB6 A;  2ZNU A;  3MAM A;  2P0S A;  4QHQ A;  4YAH X;  2I4B A;  3IX1 A;  4QF9 A;  2Z8D A;  4G8M A;  5L9S A;  1TT1 A;  3LC8 A;  4OES A;  4KYD A;  3TPA A;  4QSC A;  1LB8 A;  2RIN A;  4YB5 A;  1LAH E;  4RPO A;  2WKY A;  1B58 A;  5AA2 A;  5AA4 A;  1PDA A;  5HM4 B;  2XXW A;  5DVJ A;  2REJ A;  4UA8 A;  4IO6 A;  5L9M A;  3QYT A;  3N6U A;  2Y7K A;  3DP4 A;  1ZMG A;  1IXH A;  1NKX A;  4JSD A;  4IO5 A;  2QS1 A;  3TEP A;  2O7I A;  3PUX E;  2H5Y A;  4X1D A;  4NF4 B;  3O6I A;  3MP8 A;  3GLB A;  4ZZE A;  4QSD A;  1OQH A;  2DE4 A;  5DYH A;  2FA7 A;  2Q88 A;  3ECR A;  1N0T A;  4LUB A;  2XXX A;  1MY4 A;  3S4U A;  1MQI A;  2NVU B;  4QRZ A;  5I2N A;  1A8F A;  1NNK A;  3T96 B;  2AL4 A;  3PPQ A;  1KWH A;  3IOW A;  1PB7 A;  1XOC A;  4FIM A;  1FCK A;  4H6D A;  3PU5 A;  3GBB A;  1XVX A;  3CFX A;  4NTL A;  3TOD A;  4OVJ A;  3KSX A;  2VGQ A;  3OOA A;  1O63 A;  5H8F A;  4FED A;  1PBP A;  1ZTY A;  2Q9T A;  4BDO A;  1XVY A;  1B7U A;  2O69 A;  2QMX A;  4FE8 A;  1US4 A;  2DYX A;  2O6A A;  4ESW A;  1MM7 A;  4RJZ A;  4HS7 A;  2OLB A;  5CI5 A;  2DE3 A;  4OEN A;  3FVG A;  3LR1 A;  3HST A;  3ODB A;  4I62 A;  5B70 A;  2PX1 A;  5KZT A;  1BKA A;  3Q29 A;  4KI0 E;  1URS A;  3SES A;  5TP9 B;  1LGB C;  4NED A;  3GBA A;  2IA4 A;  3ILT B;  3R26 A;  2UYF A;  4O3A A;  4MFI A;  4DXC A;  1LCF A;  2QPQ A;  2RF1 A;  4F29 A;  4ND9 A;  5JTY B;  4F19 A;  4NE4 A;  3VVD A;  4EQ7 A;  1B51 A;  3DEL B;  2I58 A;  1T0K A;  4NF8 B;  1R6Z A;  2VHA A;  1USY E;  3FZV A;  3SEX A;  1QKB A;  2ZYO A;  4NWC A;  3IO6 A;  1ZKB A;  3TTN A;  2XXR A;  3LUY A;  2G93 A;  1A40 A;  1MQJ A;  1FTL A;  2H4I A;  3OEN A;  4RK2 A;  4LQ2 A;  5EHM A;  2OZZ A;  1I69 A;  1DTZ A;  2YLN A;  4MBP A;  4KHZ E;  1JEU A;  1M5F A;  3FAT A;  4QSE A;  3PV0 E;  1N3W A;  1Y3N A;  3FXQ A;  4KPT A;  1EZP A;  1UTH A;  3GZG A;  4XTC Q;  1URD A;  3QXM A;  3V89 B;  1QUJ A;  1FW0 A;  1LLS A;  4Q8R A;  5DVF A;  2DP8 A;  3F11 A;  5CRY A;  2GRV A;  2HFB A;  3G3I A;  3FIR A;  3QUJ A;  1EH3 A;  1YTV A;  4DCX A;  4PFU A;  2X26 A;  3IB1 A;  1US5 A;  1IIT A;  2DOJ A;  5ELV A;  5ITO A;  1FQA A;  1MXY A;  3TKD A;  1HSL A;  3CFL A;  2OJT A;  2Y7R A;  2F78 A;  1I6A A;  4F3P A;  4F3B A;  3EPE A;  4IY5 A;  3VLW A;  3T9H B;  4PQJ A;  3K6W A;  1H76 A;  4HCW A;  2QS3 A;  1FTK A;  3MP1 A;  4R75 A;  4BDR A;  3OO8 A;  1B4H A;  1LCT A;  1MPD A;  3N5L A;  4OHN A;  3C9H A;  1Y9U A;  2ZYM A;  3C36 A;  4GFR A;  5TPA B;  1D4N A;  3MC2 A;  5H8Q A;  5FTH A;  1LFI A;  3LSL A;  3EF7 A;  1MY3 A;  2A5S A;  3O29 A;  4P11 A;  1HSE A;  3K6U A;  3O66 A;  3D4G A;  2XXP A;  4X48 A;  1RYO A;  3H6V A;  1LBC A;  1XC1 A;  4YKJ A;  4KFQ A;  1B7Z A;  1OIB A;  5I59 A;  3FD3 A;  1MXX A;  2AL5 A;  1B1X A;  3OO9 A;  4PFT A;  5CBR A;  3QK6 A;  5K2X A;  1S9T A;  4THI A;  1RKM A;  1NNF A;  4Q5T A;  3PPN A;  2F6P A;  4G8N A;  4FOR A;  4NWD A;  2XX7 A;  4AB5 A;  3K1N A;  1IEJ A;  3KN8 A;  1EU8 A;  4POX A;  3N94 A;  2F8D A;  2GFE A;  3TCG A;  3MVW A;  2YJP A;  2YPN A;  1B40 A;  2OCU A;  3RGY A;  5B7D A;  2KLF A;  4ONY A;  1B32 A;  3ILU B;  3E9X A;  3R7X A;  3PPO A;  2X7P A;  1MY1 A;  2ONK E;  3V5A A;  1B3L A;  3SEW A;  1B2H A;  5H8H B;  1B3H A;  4JBZ A;  3U72 A;  4N07 A;  2I4C A;  3S9L C;  2ONR A;  3TYH A;  1MY2 A;  3CIJ A;  3CSG A;  1GR2 A;  4DDD A;  1MXU A;  4X9T A;  3K0V A;  4ZEI A;  1P1O A;  3KGC A;  3FJ7 A;  3PPP A;  5AA4 B;  5AA2 B;  3QUF A;  4EXL A;  1GTK A;  2UVJ A;  5KCJ B;  2V3U A;  5ICQ A;  1M5D A;  1DTG A;  4ZEK A;  3TUS A;  5A5X B;  2FNC A;  3UP9 A;  4XKR A;  3BKI B;  1MDP 1;  3G3J A;  4RNS A;  4F39 A;  3MVZ A;  1H44 A;  1OLC A;  4GD5 A;  4H5G A;  4NF5 B;  1XT8 A;  3FGS A;  2O84 X;  3K1M A;  1B7H A;  2O51 A;  3SET A;  3IOU A;  4OEU A;  3IB2 A;  4EQB A;  1B6H A;  3PMW A;  3PPR A;  3DM0 A;  4EF2 A;  3H6W A;  2ANJ A;  1A99 A;  1FTM A;  1AMF A;  1VE4 A;  3C34 A;  5CMB A;  1R9L A;  3UOR A;  1MH3 A;  5I2N B;  1JW5 A;  2GHB A;  1ZLQ A;  2Z8F A;  3JZJ A;  1PBQ A;  3RPW A;  1M5C A;  1URG A;  1UTB A;  3RLF E;  4LZ8 A;  4RXL A;  3WAF A;  1JNF A;  3TDJ A;  1B3F A;  5H8F B;  3KZG A;  2F5X A;  3RTW B;  4BDM A;  2XX9 A;  4PE5 B;  3T9V A;  3H6T A;  4ZEF A;  1D3K A;  4F2O A;  1VSO A;  3R6U A;  3MVX A;  3Q28 A;  5FHN A;  2O68 A;  3TZA A;  4R9G A;  4OEV A;  4OZ9 A;  1QVS A;  3OO7 A;  2DWH A;  1P1U A;  2AYS A;  1GGG A;  3BBR A;  1Y3Q A;  4G8H A;  2VD2 A;  3OO6 A;  1BLF A;  3MP6 A;  3TEL A;  3HHG A;  1QUL A;  1P1N A;  5IAI A;  1SYI A;  1TWY A;  1HSJ A;  3Q25 A;  5FHO A;  4U23 A;  1NNT A;  4IO4 A;  4F1V A;  4RPN A;  1P99 A;  3FJG A;  3OSQ A;  2OWS A;  1FQF A;  2W7Y A;  3FVK A;  3B6W A;  1IQ7 A;  1Y3P A;  5CMC A;  2Q89 A;  1XS5 A;  3EQ1 A;  3K02 A;  1GV8 A;  4DLD A;  4NF6 B;  4DE8 A;  4DXB A;  4GL8 A;  3W15 C;  4BDL A;  2R6G E;  3HPI A;  5I2K A;  2DVC A;  3IOR A;  2RC7 A;  3B6T A;  2UVH A;  3PGF A;  4YB6 A;  1JW1 A;  1GVC A;  3M3K A;  3Q27 A;  4R6K A;  4ZE8 A;  2QS2 A;  1DMB A;  1IXI A;  3K01 A;  3QAX A;  4ISU A;  4RYA A;  1POY 1;  5I56 A;  3U92 A;  1FQE A;  2XD2 A;  4G77 A;  2VD3 A;  4U22 A;  3CSB A;  3CI8 A;  1IXG A;  2I6E A;  1N3X A;  5I57 A;  4PP0 A;  2GHA A;  1JVX A;  3TCH A;  2ZYK A;  2DXY A;  1MQG A;  1B0H A;  4GL0 A;  4GWO A;  3MZB A;  4OET A;  3H4Z A;  2RCA A;  2E0S A;  1P1W A;  1JVY A;  3K2D A;  4QFO A;  2GH9 A;  1SI0 A;  1WOD A;  1SBP A;  4R6H A;  3VE1 B;  4MLV A;  1ZU0 A;  2RKM A;  4G4P A;  4N6P A;  3TCF A;  1UIV A;  1Q1K A;  1AL3 A;  1SW4 A;  2DWJ A;  2PT1 A;  2THI A;  3T22 A;  4I8C A;  1ELJ A;  4WXJ A;  3RN8 A;  1YCJ A;  2NOO A;  4M1V A;  1QUK A;  4Q30 B;  1DOT A;  4U21 A;  1XHY A;  3PUW E;  2OBG A;  4QFP A;  3MJN A;  4MH5 A;  3O28 A;  1J1N A;  2I49 A;  3MPK A;  4ELO A;  4RK9 A;  4F1U A;  5DEX A;  5ITP A;  1SI1 A;  3P7I A;  4YMA A;  1MM6 A;  3T93 B;  2XHD A;  2ZNS A;  4JWO A;  3JV9 A;  4JSO A;  4FAJ A;  3RUM A;  3A09 A;  3HN0 A;  1VR5 A;  1JET A;  4GIZ A;  2DS9 A;  1UQW A;  2H98 A;  3TTL A;  3A3U A;  4QFL A;  1M5E A;  1D9Y A;  2UXA A;  3O9P A;  3OSR A;  2XD3 A;  1BIY A;  3IOV A;  1Y1M A;  3MWB A;  2OK2 A;  2ZXT A;  2UYE A;  3E3K A;  3C35 A;  4LON B;  4I9D A;  4MLQ A;  3OD7 A;  4PET A;  3T9U A;  4O3B A;  2QRY A;  3TQL A;  1PB9 A;  4H67 A;  3PUV E;  3LSW A;  3TQW A;  5I84 A;  1B3E A;  3MBP A;  1LFH A;  2H25 A;  2QL3 A;  4KR5 A;  1USY H;  4EXK A;  1ANF A;  2B3B A;  3OMB A;  1FQB A;  4R2B A;  4WKM A;  2ABH A;  1R1N A;  5H8N B;  4BDN A;  5I58 B;  4EQ9 A;  4P0I A; 
#chains in the Genus database with same CATH topology
 3VDF A;  4PFW A;  3EHU A;  4H65 A;  2D3I A;  3EHT A;  2XXI A;  3UK4 A;  2I48 A;  3OEK A;  5TP9 A;  1NV0 A;  3IJX B;  3QSL A;  2X7Q A;  1OVB A;  4GLI A;  2NUV A;  4P1L A;  1MY0 A;  4JWX A;  1FPG A;  2F3B A;  4LZ5 A;  1VFD A;  2HAV A;  3G3K A;  2F36 A;  2RC9 A;  4LAT A;  5BUU A;  3MW0 A;  4F3G A;  5FTI A;  2GQ1 A;  3I6V A;  4GWW A;  3CFZ A;  5JTY A;  4NAP A;  3O97 A;  1M5B A;  5EYG A;  4ECF A;  5KDT A;  3CG1 A;  4NF8 A;  2XX8 A;  2XA5 A;  3N26 A;  3OEM A;  3C33 A;  1B46 A;  3W9V A;  4IB2 A;  4EF1 A;  2I3V A;  4FEC A;  3HV1 A;  1WDN A;  1NFT A;  1AOV A;  3IFC A;  3KEI A;  4H8J A;  3PD8 A;  5IZ3 B;  5AA2 D;  4BLA A;  4ZS9 A;  1S7Y A;  3RT8 A;  4ELR A;  2I0B A;  3G3H A;  4KYS A;  3TFL A;  3IK6 B;  1A7L A;  3PMV A;  4YKI A;  1H3D A;  4GWS A;  1ZIU A;  3IOT A;  4MIJ A;  1IZ1 A;  2V84 A;  4YKP A;  2OWT A;  3VFJ A;  5FHM A;  4H0W A;  5LTC A;  4GVO A;  2PFZ A;  1OMP A;  4DIG A;  4IY6 A;  1OLA A;  4F1Y A;  4F31 B;  3ONM A;  1NNP A;  1MH4 A;  4JVI A;  3FVO A;  2HAU A;  2QVV A;  4GX6 A;  2Q2C A;  5K2Y A;  3BFT A;  4PFB A;  2ZYN A;  3U94 A;  3GXA A;  5IKB A;  2ZZW A;  1EYJ A;  1LBB A;  3TTR A;  4PC9 A;  2HZK A;  4YZZ A;  1N76 A;  3CG3 A;  2XWO A;  4AS4 A;  2FIX A;  4R74 A;  4DI4 B;  1NMU A;  3RPL A;  2ONS A;  4XKQ A;  2I0C A;  1FTJ A;  3VVF A;  1FTA A;  4ZEB A;  3E4R A;  3HO7 A;  1QJM A;  3SEY A;  4OVT A;  2XWV A;  1BTJ A;  2CZI A;  4F18 A;  3O6G A;  2Y5L A;  5BWJ A;  2DVZ A;  4MMP A;  1S50 A;  1B5H A;  5CMK A;  3CR9 A;  1SPI A;  5M2V A;  2HEU A;  3KN7 A;  3LBS A;  1LEV A;  3UIF A;  1KA1 A;  3JYR A;  2QJE A;  2FBP A;  4G68 C;  4XIG Q;  4G68 A;  4IGR A;  1R9Q A;  1FTO A;  4OFL A;  1KZ8 A;  1Q35 A;  4ZEC A;  3A29 A;  3S2V A;  3K4U A;  4GOT A;  4JVD A;  2Q2A A;  2LAO A;  4GF8 A;  3V8X B;  1MQH A;  2XWI A;  3DP8 A;  1DSN A;  4GRK A;  2G29 A;  4LZ7 A;  5J1D A;  4Q0C A;  5I56 B;  1XI6 A;  2XXK A;  3OXN A;  1ZJL A;  3TMG A;  5DT6 A;  1CB6 A;  2JJK A;  4F22 A;  3C31 A;  1IMC A;  1IMB A;  2B4L A;  1FQD A;  1IIW A;  4MX6 A;  4XXU A;  4E0W A;  3THI A;  3FV2 A;  5CM6 A;  1POT A;  1B05 A;  4ZED A;  4YU0 A;  4AQ4 A;  3PD9 A;  1A55 A;  3T66 A;  4K3F A;  1NV5 A;  2DXR A;  4MAG A;  2F7A A;  4TQU Q;  1FBP A;  2QMW A;  3TTK A;  3CRB A;  1FBG A;  3SEU A;  2O1M A;  1QKA A;  2I3W A;  1JW4 A;  1SQY A;  3USD A;  3VV5 A;  3G3F A;  5H8H A;  3KG2 A;  3HCQ A;  3H7M A;  2PMS A;  2KQZ A;  3K6V A;  3KBR A;  1B3G A;  3H03 A;  4O3C A;  4OXV A;  4F2Q A;  2A5T A;  2H99 A;  2IEE A;  1RYX A;  2HXR A;  5F7V A;  4TOZ A;  1NH8 A;  4IO3 A;  2Z22 A;  1VDW A;  1QW0 A;  4R9F A;  5KCJ A;  1QGX A;  3NOH A;  4OFJ A;  5A5X A;  1Y4C A;  4OWD A;  4OVP A;  4H8I A;  4DI3 D;  2B3F A;  2CEY A;  2F35 A;  1FBC A;  2PYY A;  4NF5 A;  1TXF A;  4M4G A;  4GXS B;  5DEX B;  3U1O A;  4L17 A;  5HBC A;  3TTM A;  2P1S A;  1UTH B;  3H06 B;  2H9B A;  4YMB A;  5ICT A;  1MDQ A;  3PUZ E;  3VVE A;  2HCA A;  2VP1 A;  4C0R A;  2Y7I A;  1SD3 A;  3MVY A;  2E1S A;  4NF0 A;  2P3V A;  1B9J A;  4OFO A;  4PF8 A;  4KD5 A;  4N6K A;  1MQD A;  2CMO A;  3C32 A;  3PMX A;  3BIH A;  1MPB A;  4IO7 A;  4HCY A;  1L5T A;  1IUD A;  2HXW A;  1DCU A;  2Y5K A;  1Z7N E;  5DTB A;  2Y7W A;  1LBX A;  1PB8 A;  4U1Z A;  2P2A A;  5CC2 A;  1A54 A;  3FXU A;  1N7X A;  1OVT A;  3KFM A;  3FUZ A;  2CEX A;  3KN3 A;  3RNN A;  5EHS A;  2B65 A;  4I3E A;  2V93 A;  2WYP A;  4N8G A;  3SDF A;  5AE4 A;  5L9O A;  4Z0I A;  2F7B A;  1A8E A;  4PFY A;  4U1O A;  5H8S A;  4KQP A;  1FPI A;  3M3F A;  1NH7 A;  5IM2 A;  1D9V A;  5CBS A;  4GXA A;  4POW A;  3IB0 A;  4NMY A;  3BFU A;  5F24 A;  5H8Q B;  1NV7 A;  4OQO A;  2V25 A;  2V3Q A;  3U65 A;  2HQ0 A;  4MCO A;  2RC8 A;  3IR1 A;  4IGT A;  1MRP A;  4H1X A;  4ZZA A;  3ZSF A;  4P56 A;  4FAT A;  2F7C A;  1LBV A;  1KA0 A;  5I59 B;  3CHG A;  4ESX A;  2DSF A;  3KJT A;  4HW8 A;  1FPJ A;  3U93 A;  1Y4T A;  3K1P A;  3LSF B;  4ZE9 A;  5KDT B;  2QSX A;  5A5L A;  5EYF A;  1JEV A;  4FBP A;  3D1R A;  1Z7M E;  3B7D A;  1D9Q A;  1I6Q A;  4NF4 A;  4LN5 A;  1N04 A;  3FAS A;  1H45 A;  1YPN A;  1LST A;  1DK4 A;  4FEB A;  4GWX A;  3I5O A;  2XXY A;  2Y84 A;  1SDX A;  2DQV A;  3KOS A;  3IAZ A;  5J16 A;  1JP4 A;  3TAJ A;  4NF6 A;  4XKN A;  3W9W A;  3ZKK A;  4H5F A;  2XXH A;  1EZ9 A;  2HZL A;  1ZBM A;  4NHB A;  5CMM A;  3IL1 B;  4H46 A;  4F3S A;  2DWI A;  4JVC A;  4R6Y A;  3IO4 A;  1SW5 A;  4R72 A;  2WBD A;  2XXU A;  2XXV A;  5LOM A;  5ISU A;  3SER A;  2QS4 A;  1WVJ A;  3H6U A;  2Y7P A;  3RT6 B;  2D5W A;  4ELQ A;  2CZK A;  4UAB A;  1NUZ A;  2R71 A;  4XKP A;  1N7W A;  1UIU A;  4FJP A;  3G3G A;  4GQO A;  4JDF A;  4OER A;  3SKP A;  1DPE A;  2V3T A;  1MG1 A;  5ESY A;  1FQC A;  1YAE A;  3FV1 A;  3EHS A;  4OTE A;  1QUI A;  4WEP A;  3WAE A;  4YB7 A;  1DPP A;  3MZ9 A;  4WED A;  4LVQ A;  3O2A A;  1LAX A;  3L6H A;  4PE3 A;  1MPC A;  2M8C A;  5EQ9 A;  4JWY A;  5LDZ A;  2ZMB A;  2WYK A;  5I7I A;  1IXC A;  3K6X A;  3VLV A;  3D4C A;  2PBW A;  3U8Q A;  1MXV A;  1MS7 A;  4EUO A;  1II5 A;  1B4Z A;  5F1Q A;  4G68 B;  5TU0 A;  4KCC A;  3UA8 A;  4QBA A;  4QFK A;  5EYH A;  4JXI A;  1O64 A;  4DXU A;  3L6G A;  2VOZ A;  5JEI A;  1BK4 A;  3DLN A;  4ZDM A;  4ELP A;  2CZL A;  1NI9 A;  3N6T A;  2FYI A;  4RA1 A;  2REG A;  1UTB B;  1H43 A;  3T9X B;  3DP6 A;  2F6G A;  1BP5 A;  1SYH A;  3B8B A;  4P8B A;  3FBP A;  4N6D A;  3LUZ A;  4JB7 A;  3UN6 A;  2NXO A;  4TLL B;  4U2R A;  3S9N C;  3K00 A;  1PEB A;  1SW1 A;  4IO2 A;  4DCY A;  2DWA A;  1LB9 A;  2O1L A;  2XXQ A;  2PT2 A;  4UAC A;  1NV4 A;  1SVX B;  1EZO A;  5DVI A;  1Y20 A;  1MXZ A;  1VFE A;  3KSJ A;  2F34 A;  4BDQ A;  3VXB A;  4R73 A;  3S9M C;  4KYE A;  2F97 A;  3MYU A;  4N91 A;  2NWJ A;  5IZZ A;  5AA3 A;  5JK4 A;  2Z23 A;  3C4M A;  4QFN A;  3AXF A;  3RTF B;  2D21 A;  3MZ1 A;  1AH5 A;  3S9E A;  3QIM A;  4MF3 A;  4LA9 A;  1ATG A;  4C1U A;  2UVI A;  4GWZ A;  4C1T A;  4E0X A;  1P1Q A;  2PCR A;  3HHF A;  2ESN A;  3MPL A;  2DE2 A;  3SEV A;  4Z7E A;  4PGN A;  3KOT A;  4U4S A;  2MKZ A;  1JQF A;  4LP2 B;  3VXC A;  3OEL A;  4GX4 A;  3G7W A;  4PCD A;  2A5T B;  1FBE A;  1IMD A;  5I5P A;  5AA1 A;  2AIX A;  2Z8E A;  3E13 X;  4TLM B;  4R2F A;  4IR8 A;  3B6Q A;  3PUY E;  3ZS6 A;  3M3L A;  1TFA A;  4N4U A;  1OQG A;  4MNC A;  1B5J A;  5L8D A;  3KJ7 A;  4YIC A;  3ZKL A;  1DBZ A;  4P0G A;  4PAF A;  1B0L A;  4OYV A;  4KCD A;  1FPD A;  2RCB A;  3IJO B;  5H8N A;  5I2K B;  4N13 A;  5TPA A;  3Q26 A;  3FXR A;  4G2Z A;  2Q8J A;  2BJJ X;  3MUQ A;  5I58 A;  3LSX A;  3FVN A;  1O7T A;  4QXD A;  3UGW A;  1F9B A;  3I3V A;  1LFG A;  1TFD A;  3RQT A;  2XXT A;  2ZZV A;  1I6B A;  4I1D A;  2O7U A;  4RY1 A;  1MXW A;  3V83 A;  1AIV A;  3CVG A;  2UVG A;  1PC3 A;  1LAF E;  1N84 A;  3MQ9 A;  4OMB A;  2R9J A;  3A3C A;  5HPQ A;  1Y1Z A;  3H3G A;  1SW2 A;  4EDP A;  1B1H A;  4DZ1 A;  2ZNT A;  4LQ5 A;  4YKK A;  4X1B A;  4HTG A;  3FJM A;  5I57 B;  1B5I A;  4U4X A;  1NL5 A;  2ALU A;  4NX1 A;  1FBH A;  4PFR A;  3RY3 A;  4NGU A;  2PVU A;  4MNP A;  3M8U A;  1B52 A;  3O6H A;  3VLU A;  3EN3 A;  4P9K A;  1LAG E;  1CE2 A;  4AB6 A;  2ZNU A;  3MAM A;  2VPO A;  2P0S A;  4QHQ A;  4YAH X;  2I4B A;  3IX1 A;  4QF9 A;  2Z8D A;  4G8M A;  4PGP A;  5L9S A;  1FPF A;  1TT1 A;  3LC8 A;  4OES A;  4KYD A;  3TPA A;  3B50 A;  4QSC A;  1LB8 A;  2RIN A;  4MEV A;  4YB5 A;  1LAH E;  1IME A;  4RPO A;  2WKY A;  1B58 A;  5AA2 A;  5AA4 A;  1PDA A;  4PF6 A;  5HM4 B;  2XXW A;  5DVJ A;  2REJ A;  4UA8 A;  4IO6 A;  4HE2 A;  5L9M A;  3QYT A;  3N6U A;  2WBB A;  2Y7K A;  3DP4 A;  1ZMG A;  1IXH A;  1NKX A;  4JSD A;  4X04 A;  4IO5 A;  2QS1 A;  3TEP A;  2O7I A;  3PUX E;  2H5Y A;  4X8R A;  4X1D A;  3SZP A;  4NF4 B;  3O6I A;  3MP8 A;  3GLB A;  2HPG A;  4ZZE A;  1INP A;  4QSD A;  1OQH A;  2DE4 A;  5DYH A;  2FA7 A;  4I3Y A;  2Q88 A;  3ECR A;  3KC1 A;  1N0T A;  4LUB A;  2XXX A;  1MY4 A;  3S4U A;  1MQI A;  2NVU B;  4QRZ A;  5I2N A;  1A8F A;  1NNK A;  3T96 B;  2AL4 A;  2V4C A;  3PPQ A;  1KWH A;  4GWY A;  3IOW A;  1PB7 A;  1XOC A;  4FIM A;  1FCK A;  4H6D A;  3PU5 A;  3GBB A;  1XVX A;  4PDH A;  3CFX A;  4NTL A;  3TOD A;  4OVJ A;  1K9Z A;  3KSX A;  1NUX A;  2VGQ A;  3OOA A;  1O63 A;  5H8F A;  4FED A;  4OVS A;  1PBP A;  1ZTY A;  2Q9T A;  4BDO A;  1NV3 A;  1XVY A;  1B7U A;  2O69 A;  2QMX A;  4FE8 A;  1US4 A;  2P3N A;  2DYX A;  4MHF A;  2O6A A;  4ESW A;  4OA4 A;  1MM7 A;  4RJZ A;  5FBP A;  4HS7 A;  2OLB A;  5CI5 A;  2DE3 A;  4OEN A;  3FVG A;  3LR1 A;  3HST A;  3ODB A;  4I62 A;  5B70 A;  2PX1 A;  5KZT A;  4OVQ A;  1BKA A;  3Q29 A;  4KI0 E;  1URS A;  3SES A;  4MJO A;  5TP9 B;  1LGB C;  4NED A;  4O7M A;  3GBA A;  2IA4 A;  4GBW A;  3ILT B;  3R26 A;  2UYF A;  4O3A A;  4MFI A;  4DXC A;  1LCF A;  2QPQ A;  2RF1 A;  4F29 A;  4ND9 A;  5JTY B;  4AS5 A;  4F19 A;  4NE4 A;  3VVD A;  4EQ7 A;  1B51 A;  4HE1 A;  3DEL B;  2I58 A;  1T0K A;  4NF8 B;  1R6Z A;  1G0I A;  2R8T A;  2VHA A;  1USY E;  3FZV A;  1LBW A;  3SEX A;  1FJ9 A;  1QKB A;  2ZYO A;  4NWC A;  4P1E A;  3IO6 A;  1ZKB A;  3TTN A;  2XXR A;  3LUY A;  2G93 A;  1A40 A;  1MQJ A;  1FTL A;  2H4I A;  3OEN A;  4RK2 A;  4LQ2 A;  5EHM A;  2OZZ A;  1I69 A;  1DTZ A;  1EYI A;  2YLN A;  2DDK A;  4MBP A;  4KHZ E;  1JEU A;  1M5F A;  3FAT A;  1AWB A;  4QSE A;  3PV0 E;  1N3W A;  1Y3N A;  3FXQ A;  4KPT A;  1EZP A;  1UTH A;  3GZG A;  4XTC Q;  1URD A;  3QXM A;  3V89 B;  1QUJ A;  1FW0 A;  1LLS A;  4Q8R A;  5DVF A;  5IGA A;  2DP8 A;  3F11 A;  5CRY A;  2GRV A;  2HFB A;  3G3I A;  3FIR A;  1YZ0 A;  3QUJ A;  1EH3 A;  1YTV A;  4DCX A;  4PFU A;  2X26 A;  3IB1 A;  1US5 A;  1IIT A;  2DOJ A;  5ELV A;  5ITO A;  1FQA A;  1MXY A;  3TKD A;  1HSL A;  3IFA A;  3CFL A;  2FVZ A;  2OJT A;  2Y7R A;  2F78 A;  1I6A A;  4F3P A;  3RPL B;  4F3B A;  1RDX A;  3EPE A;  4IY5 A;  3VLW A;  3T9H B;  2QVU A;  4PQJ A;  3K6W A;  3QMF A;  4PAI A;  1H76 A;  4HCW A;  2QS3 A;  3E78 A;  1FTK A;  3MP1 A;  5ET8 A;  4R75 A;  4BDR A;  4N8Y A;  5ET5 A;  3OO8 A;  1B4H A;  1LCT A;  1MPD A;  3N5L A;  1NV1 A;  4XEQ A;  4OHN A;  3C9H A;  1Y9U A;  2ZYM A;  3C36 A;  4GFR A;  5TPA B;  1D4N A;  3MC2 A;  5H8Q A;  2XWK A;  5FTH A;  1LFI A;  3LSL A;  3EF7 A;  1MY3 A;  2A5S A;  1LBZ A;  3O29 A;  4P11 A;  1HSE A;  3K6U A;  2OWZ A;  3O66 A;  3D4G A;  2XXP A;  4X48 A;  1RYO A;  3H6V A;  1LBC A;  1XC1 A;  3KBZ A;  4YKJ A;  4KFQ A;  1NUW A;  4N15 A;  1B7Z A;  1OIB A;  5I59 A;  3FD3 A;  5EQ8 A;  1MXX A;  2AL5 A;  1B1X A;  3OO9 A;  2HHM A;  4PFT A;  5CBR A;  3QK6 A;  1S9T A;  4THI A;  5K2X A;  1RKM A;  1NNF A;  4Q5T A;  3PPN A;  2F6P A;  4G8N A;  4FOR A;  4NWD A;  2XX7 A;  4AB5 A;  3K1N A;  1IEJ A;  3KN8 A;  1EU8 A;  4POX A;  3N94 A;  2F8D A;  5ET6 A;  2GFE A;  3TCG A;  3MVW A;  2YJP A;  2YPN A;  1B40 A;  4P3L A;  4P47 A;  2OCU A;  2Q74 A;  3RGY A;  5B7D A;  4PBH A;  2KLF A;  4ONY A;  1B32 A;  3ILU B;  3E9X A;  3R7X A;  3PPO A;  2X7P A;  4I40 A;  1MY1 A;  2ONK E;  3V5A A;  1B3L A;  3SEW A;  1B2H A;  5H8H B;  1B3H A;  4JBZ A;  2CZH A;  3U72 A;  4N07 A;  2Q8M A;  2I4C A;  3S9L C;  2ONR A;  3TYH A;  1MY2 A;  3CIJ A;  3CSG A;  1GR2 A;  4DDD A;  1MXU A;  4X9T A;  3K0V A;  4N17 A;  4ZEI A;  1P1O A;  3KGC A;  3FJ7 A;  5DW8 A;  3PPP A;  5AA4 B;  5AA2 B;  3QUF A;  4EXL A;  1GTK A;  2UVJ A;  5KCJ B;  2V3U A;  5ICQ A;  1M5D A;  1DTG A;  4ZEK A;  3TUS A;  5A5X B;  2FNC A;  3UP9 A;  4XKR A;  3BKI B;  1MDP 1;  3G3J A;  4RNS A;  4F39 A;  3MVZ A;  1H44 A;  1OLC A;  4GD5 A;  4H5G A;  4NF5 B;  1XT8 A;  3FGS A;  1CNQ A;  2O84 X;  3K1M A;  1B7H A;  1FPB A;  2O51 A;  5T3J A;  3SET A;  3IOU A;  4OEU A;  3IB2 A;  4EQB A;  1B6H A;  3PMW A;  3PPR A;  3DM0 A;  4GBV A;  4EF2 A;  3H6W A;  2ANJ A;  1A99 A;  1FTM A;  1AMF A;  1VE4 A;  3C34 A;  4H45 A;  5CMB A;  4NQ8 A;  2BJI A;  1R9L A;  3UOR A;  1RDY A;  1MH3 A;  5I2N B;  1JW5 A;  4PAK A;  2GHB A;  1ZLQ A;  2Z8F A;  3JZJ A;  1PBQ A;  3RPW A;  1M5C A;  4PBQ A;  1URG A;  1UTB A;  3RLF E;  1FBD A;  1NV2 A;  4LZ8 A;  4RXL A;  3WAF A;  1JNF A;  3TDJ A;  1B3F A;  5H8F B;  3KZG A;  2F5X A;  2WX9 A;  3RTW B;  4BDM A;  2PFY A;  2B4M A;  2XX9 A;  4PE5 B;  1G0H A;  3T9V A;  3H6T A;  4ZEF A;  1D3K A;  4F2O A;  1VSO A;  3GYY A;  3R6U A;  3MVX A;  1FRP A;  1FPL A;  3Q28 A;  5IZ3 A;  5FHN A;  2O68 A;  3TZA A;  4R9G A;  4OEV A;  4OZ9 A;  1QVS A;  3OO7 A;  5ET7 A;  2DWH A;  1P1U A;  2AYS A;  4OVR A;  1GGG A;  2FHY A;  3BBR A;  1Y3Q A;  2F3D A;  4G8H A;  5EQA A;  3LV0 A;  2VD2 A;  3OO6 A;  1BLF A;  4NG7 A;  3MP6 A;  3TEL A;  3HHG A;  1QUL A;  4N81 A;  1P1N A;  5IAI A;  1SYI A;  1TWY A;  1HSJ A;  2WEF A;  5EQ7 A;  3Q25 A;  5FHO A;  4U23 A;  1NNT A;  4IO4 A;  2QFL A;  4F1V A;  4RPN A;  1P99 A;  1FJ6 A;  3FJG A;  3OSQ A;  2OWS A;  1FQF A;  2W7Y A;  5IZ1 A;  3FVK A;  3B6W A;  4OAN A;  1NUY A;  1IQ7 A;  1Y3P A;  5CMC A;  2Q89 A;  1XS5 A;  3EQ1 A;  3K02 A;  1GV8 A;  4DLD A;  4NF6 B;  4HXV A;  4DE8 A;  4DXB A;  4GL8 A;  3W15 C;  1NV6 A;  4BDL A;  2R6G E;  3HPI A;  5I2K A;  2DVC A;  3IOR A;  2RC7 A;  1EYK A;  3B6T A;  4GWU A;  2UVH A;  4PTK A;  3PGF A;  4YB6 A;  1JW1 A;  1GVC A;  3M3K A;  3Q27 A;  4R6K A;  4ZE8 A;  2L5V A;  2QS2 A;  4O7I A;  1DMB A;  2KR0 A;  1IXI A;  3K01 A;  3QAX A;  4ISU A;  4RYA A;  1POY 1;  3ROJ A;  5I56 A;  4O8M A;  1IMA A;  3U92 A;  4PFI A;  1FQE A;  2XD2 A;  4G77 A;  2VD3 A;  4U22 A;  3CSB A;  3CI8 A;  1IXG A;  2I6E A;  1N3X A;  5I57 A;  4PP0 A;  2GHA A;  3RYD A;  3FXB A;  1JVX A;  3TCH A;  2QVR A;  2ZYK A;  1LBY A;  2DXY A;  1MQG A;  1B0H A;  1FSA A;  4GL0 A;  1FBF A;  4GWO A;  3MZB A;  2VT5 A;  4OET A;  4XF5 A;  3H4Z A;  2RCA A;  2E0S A;  1P1W A;  1JVY A;  3K2D A;  4QFO A;  2GH9 A;  1SI0 A;  1WOD A;  1SBP A;  1YXI A;  4R6H A;  3VE1 B;  4MLV A;  1ZU0 A;  2RKM A;  4G4P A;  4N6P A;  2FIE A;  3HFU A;  3TCF A;  1UIV A;  1Q1K A;  3MST A;  1AL3 A;  1SW4 A;  2DWJ A;  3EKI A;  1FPE A;  1RDZ A;  2PT1 A;  2THI A;  3T22 A;  4I8C A;  1ELJ A;  4WXJ A;  3RN8 A;  1YCJ A;  2NOO A;  4M1V A;  1QUK A;  2ZZX A;  4Q30 B;  1DOT A;  4U21 A;  1XHY A;  4HE0 A;  4NN3 A;  3PUW E;  2OBG A;  4QFP A;  3MJN A;  3PTY A;  4MH5 A;  3O28 A;  1J1N A;  2I49 A;  3MPK A;  4ELO A;  4RK9 A;  4F1U A;  5DEX A;  5ITP A;  1SI1 A;  3T0J A;  3P7I A;  4YMA A;  1MM6 A;  3E79 A;  3T1B A;  3T93 B;  5I3S A;  2XHD A;  2ZNS A;  4JWO A;  3JV9 A;  4PDD A;  4JSO A;  4FAJ A;  3RUM A;  3A09 A;  1Q9D A;  3HN0 A;  1VR5 A;  1JET A;  4GX3 A;  4GIZ A;  2DS9 A;  1UQW A;  2H98 A;  3TTL A;  3A3U A;  4QFL A;  1M5E A;  1D9Y A;  2UXA A;  3O9P A;  3OSR A;  2XD3 A;  1BIY A;  3IOV A;  1Y1M A;  2VPN A;  3MWB A;  2OK2 A;  1YYZ A;  2ZXT A;  2UYE A;  3E3K A;  3C35 A;  4LON B;  1IMF A;  4KXP A;  4I9D A;  4MLQ A;  3OD7 A;  2OX3 A;  3KC0 A;  4G61 A;  4PET A;  3T9U A;  4O3B A;  2QRY A;  3TQL A;  1PB9 A;  4H67 A;  3PUV E;  3LSW A;  3TQW A;  1K9Y A;  5I84 A;  1B3E A;  3MBP A;  3ISP A;  1LFH A;  2H25 A;  2QL3 A;  4KR5 A;  1USY H;  4EXK A;  1ANF A;  2B3B A;  4XFE A;  1FPK A;  3OMB A;  1FQB A;  4R2B A;  4WKM A;  2ABH A;  1R1N A;  5H8N B;  4O94 A;  3BIG A;  4BDN A;  5I58 B;  4EQ9 A;  4P0I A;  4MNI A; 
#chains in the Genus database with same CATH homology
 3VDF A;  4PFW A;  3EHU A;  4H65 A;  2D3I A;  3EHT A;  2XXI A;  3UK4 A;  2I48 A;  3OEK A;  5TP9 A;  3IJX B;  3QSL A;  2X7Q A;  1OVB A;  4GLI A;  2NUV A;  1MY0 A;  4JWX A;  4LZ5 A;  1VFD A;  2HAV A;  3G3K A;  2F36 A;  2RC9 A;  4LAT A;  5BUU A;  3MW0 A;  4F3G A;  5FTI A;  3I6V A;  3CFZ A;  5JTY A;  3O97 A;  1M5B A;  4ECF A;  5KDT A;  3CG1 A;  4NF8 A;  2XX8 A;  3N26 A;  3OEM A;  3C33 A;  1B46 A;  3W9V A;  4IB2 A;  4EF1 A;  2I3V A;  4FEC A;  3HV1 A;  1WDN A;  1NFT A;  1AOV A;  3KEI A;  4H8J A;  3PD8 A;  5AA2 D;  4BLA A;  4ZS9 A;  1S7Y A;  3RT8 A;  4ELR A;  2I0B A;  3G3H A;  4KYS A;  3TFL A;  3IK6 B;  1A7L A;  3PMV A;  4YKI A;  1H3D A;  1ZIU A;  3IOT A;  1IZ1 A;  2V84 A;  4YKP A;  2OWT A;  3VFJ A;  5FHM A;  4H0W A;  4GVO A;  1OMP A;  4DIG A;  4IY6 A;  1OLA A;  4F1Y A;  4F31 B;  3ONM A;  1NNP A;  1MH4 A;  3FVO A;  2HAU A;  2Q2C A;  5K2Y A;  3BFT A;  2ZYN A;  3U94 A;  3GXA A;  5IKB A;  1LBB A;  3TTR A;  2HZK A;  4YZZ A;  1N76 A;  3CG3 A;  4R74 A;  1NMU A;  2ONS A;  4XKQ A;  2I0C A;  1FTJ A;  3VVF A;  4ZEB A;  3E4R A;  3HO7 A;  1QJM A;  3SEY A;  1BTJ A;  4F18 A;  3O6G A;  5BWJ A;  2DVZ A;  1S50 A;  1B5H A;  5CMK A;  3CR9 A;  5M2V A;  2HEU A;  3KN7 A;  3LBS A;  3UIF A;  3JYR A;  2QJE A;  4G68 C;  4XIG Q;  4G68 A;  4IGR A;  1R9Q A;  1FTO A;  4OFL A;  1Q35 A;  4ZEC A;  3S2V A;  3K4U A;  4GOT A;  2Q2A A;  2LAO A;  4GF8 A;  3V8X B;  1MQH A;  3DP8 A;  1DSN A;  4GRK A;  2G29 A;  4LZ7 A;  5J1D A;  4Q0C A;  5I56 B;  3OXN A;  1ZJL A;  3TMG A;  5DT6 A;  1CB6 A;  4F22 A;  3C31 A;  1FQD A;  1IIW A;  4XXU A;  4E0W A;  3THI A;  3FV2 A;  5CM6 A;  1POT A;  1B05 A;  4ZED A;  4YU0 A;  4AQ4 A;  3PD9 A;  1A55 A;  3T66 A;  4K3F A;  2DXR A;  2F7A A;  4TQU Q;  2QMW A;  3TTK A;  3CRB A;  3SEU A;  2O1M A;  1QKA A;  2I3W A;  1JW4 A;  1SQY A;  3USD A;  3VV5 A;  3G3F A;  5H8H A;  3KG2 A;  3HCQ A;  3H7M A;  2PMS A;  3K6V A;  3KBR A;  1B3G A;  3H03 A;  4O3C A;  4OXV A;  4F2Q A;  2A5T A;  2H99 A;  2IEE A;  1RYX A;  5F7V A;  4TOZ A;  1NH8 A;  4IO3 A;  2Z22 A;  1QW0 A;  4R9F A;  5KCJ A;  4OFJ A;  5A5X A;  1Y4C A;  4OWD A;  4H8I A;  2B3F A;  2F35 A;  2PYY A;  4NF5 A;  1TXF A;  4M4G A;  4GXS B;  5DEX B;  3U1O A;  4L17 A;  5HBC A;  3TTM A;  2P1S A;  1UTH B;  3H06 B;  2H9B A;  4YMB A;  5ICT A;  1MDQ A;  3PUZ E;  3VVE A;  2HCA A;  2VP1 A;  4C0R A;  2Y7I A;  1SD3 A;  3MVY A;  2E1S A;  1B9J A;  4OFO A;  4KD5 A;  1MQD A;  2CMO A;  3C32 A;  3PMX A;  1MPB A;  4IO7 A;  4HCY A;  1L5T A;  1IUD A;  2HXW A;  1Z7N E;  5DTB A;  2Y7W A;  1PB8 A;  4U1Z A;  2P2A A;  5CC2 A;  1A54 A;  3FXU A;  1N7X A;  1OVT A;  3KFM A;  3FUZ A;  3KN3 A;  3RNN A;  5EHS A;  2B65 A;  2V93 A;  3SDF A;  5AE4 A;  5L9O A;  4Z0I A;  2F7B A;  1A8E A;  4PFY A;  4U1O A;  5H8S A;  4KQP A;  3M3F A;  1NH7 A;  1D9V A;  5CBS A;  4GXA A;  4POW A;  3IB0 A;  4NMY A;  3BFU A;  5H8Q B;  4OQO A;  2V25 A;  2V3Q A;  2HQ0 A;  2RC8 A;  3IR1 A;  4IGT A;  1MRP A;  4H1X A;  4ZZA A;  3ZSF A;  4FAT A;  2F7C A;  5I59 B;  4ESX A;  2DSF A;  3KJT A;  4HW8 A;  3U93 A;  1Y4T A;  3K1P A;  3LSF B;  4ZE9 A;  5KDT B;  2QSX A;  5EYF A;  1JEV A;  1Z7M E;  3B7D A;  1I6Q A;  4NF4 A;  1N04 A;  3FAS A;  1H45 A;  1YPN A;  1LST A;  4FEB A;  3I5O A;  2XXY A;  2Y84 A;  1SDX A;  2DQV A;  3KOS A;  3IAZ A;  3TAJ A;  4NF6 A;  4XKN A;  3W9W A;  3ZKK A;  4H5F A;  2XXH A;  1EZ9 A;  2HZL A;  1ZBM A;  5CMM A;  3IL1 B;  4F3S A;  2DWI A;  4R6Y A;  3IO4 A;  1SW5 A;  4R72 A;  2XXU A;  2XXV A;  5LOM A;  5ISU A;  3SER A;  2QS4 A;  1WVJ A;  3H6U A;  2Y7P A;  3RT6 B;  2D5W A;  4ELQ A;  2R71 A;  4XKP A;  1N7W A;  1UIU A;  4FJP A;  3G3G A;  4GQO A;  4JDF A;  4OER A;  3SKP A;  1DPE A;  2V3T A;  1MG1 A;  1FQC A;  1YAE A;  3FV1 A;  3EHS A;  4OTE A;  1QUI A;  4WEP A;  3WAE A;  4YB7 A;  1DPP A;  3MZ9 A;  4WED A;  4LVQ A;  3O2A A;  1LAX A;  3L6H A;  1MPC A;  2M8C A;  4JWY A;  2ZMB A;  1IXC A;  3K6X A;  3VLV A;  3D4C A;  2PBW A;  3U8Q A;  1MXV A;  1MS7 A;  4EUO A;  1II5 A;  1B4Z A;  5F1Q A;  4G68 B;  5TU0 A;  4KCC A;  3UA8 A;  4QFK A;  4JXI A;  1O64 A;  4DXU A;  3L6G A;  2VOZ A;  5JEI A;  3DLN A;  4ZDM A;  4ELP A;  2CZL A;  3N6T A;  2FYI A;  4RA1 A;  2REG A;  1UTB B;  1H43 A;  3T9X B;  3DP6 A;  2F6G A;  1BP5 A;  1SYH A;  4JB7 A;  3UN6 A;  2NXO A;  4TLL B;  4U2R A;  3S9N C;  3K00 A;  1PEB A;  1SW1 A;  4IO2 A;  4DCY A;  2DWA A;  1LB9 A;  2O1L A;  2XXQ A;  2PT2 A;  4UAC A;  1SVX B;  1EZO A;  5DVI A;  1Y20 A;  1MXZ A;  1VFE A;  3KSJ A;  2F34 A;  4BDQ A;  3VXB A;  4R73 A;  3S9M C;  4KYE A;  2F97 A;  2NWJ A;  5AA3 A;  5JK4 A;  2Z23 A;  3C4M A;  4QFN A;  3AXF A;  3RTF B;  2D21 A;  3MZ1 A;  1AH5 A;  3S9E A;  3QIM A;  4MF3 A;  4LA9 A;  1ATG A;  4C1U A;  2UVI A;  4C1T A;  4E0X A;  1P1Q A;  3HHF A;  2ESN A;  3MPL A;  2DE2 A;  3SEV A;  4Z7E A;  4U4S A;  3KOT A;  1JQF A;  4LP2 B;  3VXC A;  3OEL A;  3G7W A;  2A5T B;  5AA1 A;  2AIX A;  2Z8E A;  3E13 X;  4TLM B;  4R2F A;  3B6Q A;  3PUY E;  3ZS6 A;  3M3L A;  1TFA A;  1OQG A;  1B5J A;  5L8D A;  3KJ7 A;  4YIC A;  3ZKL A;  4P0G A;  1B0L A;  4OYV A;  4KCD A;  2RCB A;  3IJO B;  5H8N A;  5I2K B;  4N13 A;  5TPA A;  3Q26 A;  3FXR A;  4G2Z A;  2Q8J A;  2BJJ X;  3MUQ A;  5I58 A;  3LSX A;  3FVN A;  1O7T A;  3UGW A;  1F9B A;  3I3V A;  1LFG A;  1TFD A;  3RQT A;  2XXT A;  1I6B A;  4I1D A;  2O7U A;  4RY1 A;  1MXW A;  3V83 A;  1AIV A;  3CVG A;  2UVG A;  1PC3 A;  1LAF E;  1N84 A;  3MQ9 A;  4OMB A;  2R9J A;  3A3C A;  5HPQ A;  1Y1Z A;  3H3G A;  1SW2 A;  4EDP A;  1B1H A;  4DZ1 A;  2ZNT A;  4LQ5 A;  4YKK A;  4X1B A;  4HTG A;  3FJM A;  5I57 B;  1B5I A;  4U4X A;  1NL5 A;  2ALU A;  3RY3 A;  2PVU A;  3M8U A;  1B52 A;  3O6H A;  3VLU A;  3EN3 A;  1LAG E;  1CE2 A;  4AB6 A;  2ZNU A;  3MAM A;  2P0S A;  4QHQ A;  4YAH X;  2I4B A;  3IX1 A;  4QF9 A;  2Z8D A;  4G8M A;  5L9S A;  1TT1 A;  3LC8 A;  4OES A;  4KYD A;  3TPA A;  4QSC A;  1LB8 A;  2RIN A;  4YB5 A;  1LAH E;  4RPO A;  2WKY A;  1B58 A;  5AA2 A;  5AA4 A;  1PDA A;  5HM4 B;  2XXW A;  5DVJ A;  2REJ A;  4UA8 A;  4IO6 A;  5L9M A;  3QYT A;  3N6U A;  2Y7K A;  3DP4 A;  1ZMG A;  1IXH A;  1NKX A;  4JSD A;  4IO5 A;  2QS1 A;  3TEP A;  2O7I A;  3PUX E;  2H5Y A;  4X1D A;  4NF4 B;  3O6I A;  3MP8 A;  3GLB A;  4ZZE A;  4QSD A;  1OQH A;  2DE4 A;  5DYH A;  2FA7 A;  2Q88 A;  3ECR A;  1N0T A;  4LUB A;  2XXX A;  1MY4 A;  3S4U A;  1MQI A;  2NVU B;  4QRZ A;  5I2N A;  1A8F A;  1NNK A;  3T96 B;  2AL4 A;  3PPQ A;  1KWH A;  3IOW A;  1PB7 A;  1XOC A;  4FIM A;  1FCK A;  4H6D A;  3PU5 A;  3GBB A;  1XVX A;  3CFX A;  4NTL A;  3TOD A;  4OVJ A;  3KSX A;  2VGQ A;  3OOA A;  1O63 A;  5H8F A;  4FED A;  1PBP A;  1ZTY A;  2Q9T A;  4BDO A;  1XVY A;  1B7U A;  2O69 A;  2QMX A;  4FE8 A;  1US4 A;  2DYX A;  2O6A A;  4ESW A;  1MM7 A;  4RJZ A;  4HS7 A;  2OLB A;  5CI5 A;  2DE3 A;  4OEN A;  3FVG A;  3LR1 A;  3HST A;  3ODB A;  4I62 A;  5B70 A;  2PX1 A;  5KZT A;  1BKA A;  3Q29 A;  4KI0 E;  1URS A;  3SES A;  5TP9 B;  1LGB C;  4NED A;  3GBA A;  2IA4 A;  3ILT B;  3R26 A;  2UYF A;  4O3A A;  4MFI A;  4DXC A;  1LCF A;  2QPQ A;  2RF1 A;  4F29 A;  4ND9 A;  5JTY B;  4F19 A;  4NE4 A;  3VVD A;  4EQ7 A;  1B51 A;  3DEL B;  2I58 A;  1T0K A;  4NF8 B;  1R6Z A;  2VHA A;  1USY E;  3FZV A;  3SEX A;  1QKB A;  2ZYO A;  4NWC A;  3IO6 A;  1ZKB A;  3TTN A;  2XXR A;  3LUY A;  2G93 A;  1A40 A;  1MQJ A;  1FTL A;  2H4I A;  3OEN A;  4RK2 A;  4LQ2 A;  5EHM A;  2OZZ A;  1I69 A;  1DTZ A;  2YLN A;  4MBP A;  4KHZ E;  1JEU A;  1M5F A;  3FAT A;  4QSE A;  3PV0 E;  1N3W A;  1Y3N A;  3FXQ A;  4KPT A;  1EZP A;  1UTH A;  3GZG A;  4XTC Q;  1URD A;  3QXM A;  3V89 B;  1QUJ A;  1FW0 A;  1LLS A;  4Q8R A;  5DVF A;  2DP8 A;  3F11 A;  5CRY A;  2GRV A;  2HFB A;  3G3I A;  3FIR A;  3QUJ A;  1EH3 A;  1YTV A;  4DCX A;  4PFU A;  2X26 A;  3IB1 A;  1US5 A;  1IIT A;  2DOJ A;  5ELV A;  5ITO A;  1FQA A;  1MXY A;  3TKD A;  1HSL A;  3CFL A;  2OJT A;  2Y7R A;  2F78 A;  1I6A A;  4F3P A;  4F3B A;  3EPE A;  4IY5 A;  3VLW A;  3T9H B;  4PQJ A;  3K6W A;  1H76 A;  4HCW A;  2QS3 A;  1FTK A;  3MP1 A;  4R75 A;  4BDR A;  3OO8 A;  1B4H A;  1LCT A;  1MPD A;  3N5L A;  4OHN A;  3C9H A;  1Y9U A;  2ZYM A;  3C36 A;  4GFR A;  5TPA B;  1D4N A;  3MC2 A;  5H8Q A;  5FTH A;  1LFI A;  3LSL A;  3EF7 A;  1MY3 A;  2A5S A;  3O29 A;  4P11 A;  1HSE A;  3K6U A;  3O66 A;  3D4G A;  2XXP A;  4X48 A;  1RYO A;  3H6V A;  1LBC A;  1XC1 A;  4YKJ A;  4KFQ A;  1B7Z A;  1OIB A;  5I59 A;  3FD3 A;  1MXX A;  2AL5 A;  1B1X A;  3OO9 A;  4PFT A;  5CBR A;  3QK6 A;  5K2X A;  1S9T A;  4THI A;  1RKM A;  1NNF A;  4Q5T A;  3PPN A;  2F6P A;  4G8N A;  4FOR A;  4NWD A;  2XX7 A;  4AB5 A;  3K1N A;  1IEJ A;  3KN8 A;  1EU8 A;  4POX A;  3N94 A;  2F8D A;  2GFE A;  3TCG A;  3MVW A;  2YJP A;  2YPN A;  1B40 A;  2OCU A;  3RGY A;  5B7D A;  2KLF A;  4ONY A;  1B32 A;  3ILU B;  3E9X A;  3R7X A;  3PPO A;  2X7P A;  1MY1 A;  2ONK E;  3V5A A;  1B3L A;  3SEW A;  1B2H A;  5H8H B;  1B3H A;  4JBZ A;  3U72 A;  4N07 A;  2I4C A;  3S9L C;  2ONR A;  3TYH A;  1MY2 A;  3CIJ A;  3CSG A;  1GR2 A;  4DDD A;  1MXU A;  4X9T A;  3K0V A;  4ZEI A;  1P1O A;  3KGC A;  3FJ7 A;  3PPP A;  5AA4 B;  5AA2 B;  3QUF A;  4EXL A;  1GTK A;  2UVJ A;  5KCJ B;  2V3U A;  5ICQ A;  1M5D A;  1DTG A;  4ZEK A;  3TUS A;  5A5X B;  2FNC A;  3UP9 A;  4XKR A;  3BKI B;  1MDP 1;  3G3J A;  4RNS A;  4F39 A;  3MVZ A;  1H44 A;  1OLC A;  4GD5 A;  4H5G A;  4NF5 B;  1XT8 A;  3FGS A;  2O84 X;  3K1M A;  1B7H A;  2O51 A;  3SET A;  3IOU A;  4OEU A;  3IB2 A;  4EQB A;  1B6H A;  3PMW A;  3PPR A;  3DM0 A;  4EF2 A;  3H6W A;  2ANJ A;  1A99 A;  1FTM A;  1AMF A;  1VE4 A;  3C34 A;  5CMB A;  1R9L A;  3UOR A;  1MH3 A;  5I2N B;  1JW5 A;  2GHB A;  1ZLQ A;  2Z8F A;  3JZJ A;  1PBQ A;  3RPW A;  1M5C A;  1URG A;  1UTB A;  3RLF E;  4LZ8 A;  4RXL A;  3WAF A;  1JNF A;  3TDJ A;  1B3F A;  5H8F B;  3KZG A;  2F5X A;  3RTW B;  4BDM A;  2XX9 A;  4PE5 B;  3T9V A;  3H6T A;  4ZEF A;  1D3K A;  4F2O A;  1VSO A;  3R6U A;  3MVX A;  3Q28 A;  5FHN A;  2O68 A;  3TZA A;  4R9G A;  4OEV A;  4OZ9 A;  1QVS A;  3OO7 A;  2DWH A;  1P1U A;  2AYS A;  1GGG A;  3BBR A;  1Y3Q A;  4G8H A;  2VD2 A;  3OO6 A;  1BLF A;  3MP6 A;  3TEL A;  3HHG A;  1QUL A;  1P1N A;  5IAI A;  1SYI A;  1TWY A;  1HSJ A;  3Q25 A;  5FHO A;  4U23 A;  1NNT A;  4IO4 A;  4F1V A;  4RPN A;  1P99 A;  3FJG A;  3OSQ A;  2OWS A;  1FQF A;  2W7Y A;  3FVK A;  3B6W A;  1IQ7 A;  1Y3P A;  5CMC A;  2Q89 A;  1XS5 A;  3EQ1 A;  3K02 A;  1GV8 A;  4DLD A;  4NF6 B;  4DE8 A;  4DXB A;  4GL8 A;  3W15 C;  4BDL A;  2R6G E;  3HPI A;  5I2K A;  2DVC A;  3IOR A;  2RC7 A;  3B6T A;  2UVH A;  3PGF A;  4YB6 A;  1JW1 A;  1GVC A;  3M3K A;  3Q27 A;  4R6K A;  4ZE8 A;  2QS2 A;  1DMB A;  1IXI A;  3K01 A;  3QAX A;  4ISU A;  4RYA A;  1POY 1;  5I56 A;  3U92 A;  1FQE A;  2XD2 A;  4G77 A;  2VD3 A;  4U22 A;  3CSB A;  3CI8 A;  1IXG A;  2I6E A;  1N3X A;  5I57 A;  4PP0 A;  2GHA A;  1JVX A;  3TCH A;  2ZYK A;  2DXY A;  1MQG A;  1B0H A;  4GL0 A;  4GWO A;  3MZB A;  4OET A;  3H4Z A;  2RCA A;  2E0S A;  1P1W A;  1JVY A;  3K2D A;  4QFO A;  2GH9 A;  1SI0 A;  1WOD A;  1SBP A;  4R6H A;  3VE1 B;  4MLV A;  1ZU0 A;  2RKM A;  4G4P A;  4N6P A;  3TCF A;  1UIV A;  1Q1K A;  1AL3 A;  1SW4 A;  2DWJ A;  2PT1 A;  2THI A;  3T22 A;  4I8C A;  1ELJ A;  4WXJ A;  3RN8 A;  1YCJ A;  2NOO A;  4M1V A;  1QUK A;  4Q30 B;  1DOT A;  4U21 A;  1XHY A;  3PUW E;  2OBG A;  4QFP A;  3MJN A;  4MH5 A;  3O28 A;  1J1N A;  2I49 A;  3MPK A;  4ELO A;  4RK9 A;  4F1U A;  5DEX A;  5ITP A;  1SI1 A;  3P7I A;  4YMA A;  1MM6 A;  3T93 B;  2XHD A;  2ZNS A;  4JWO A;  3JV9 A;  4JSO A;  4FAJ A;  3RUM A;  3A09 A;  3HN0 A;  1VR5 A;  1JET A;  4GIZ A;  2DS9 A;  1UQW A;  2H98 A;  3TTL A;  3A3U A;  4QFL A;  1M5E A;  1D9Y A;  2UXA A;  3O9P A;  3OSR A;  2XD3 A;  1BIY A;  3IOV A;  1Y1M A;  3MWB A;  2OK2 A;  2ZXT A;  2UYE A;  3E3K A;  3C35 A;  4LON B;  4I9D A;  4MLQ A;  3OD7 A;  4PET A;  3T9U A;  4O3B A;  2QRY A;  3TQL A;  1PB9 A;  4H67 A;  3PUV E;  3LSW A;  3TQW A;  5I84 A;  1B3E A;  3MBP A;  1LFH A;  2H25 A;  2QL3 A;  4KR5 A;  1USY H;  4EXK A;  1ANF A;  2B3B A;  3OMB A;  1FQB A;  4R2B A;  4WKM A;  2ABH A;  1R1N A;  5H8N B;  4BDN A;  5I58 B;  4EQ9 A;  4P0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...