2F8LA

Crystal structure of a putative class i s-adenosylmethionine-dependent methyltransferase (lmo1582) from listeria monocytogenes at 2.20 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
323
Chain Sequence
ANEATQELFQVLDNTAIILQNELEISYLEAVYETGENLFQKEVLQKEEKQLKLQASYESIELENFSNEEIRKGLQLALLKGMKHGIQVNHQMTPDSIGFIVAYLLEKVIQKKKNVSILDPACGTANLLTTVINQLELKGDVDVHASGVDVDDLLISLALVGADLQRQKMTLLHQDGLANLLVDPVDVVISDLPVGYYPDDENAKTFELCREEGHSFAHFLFIEQGMRYTKPGGYLFFLVPDAMFGTSDFAKVDKFIKKNGHIEGIIKLPETLFKSQARKSILILEKADVDVKPPKEVLLANLSSLTDPSVTAPILAEIENWFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein lmo1582
publication title Crystal structure of (16411011) from Listeria monocytogenes LI2 at 2.20 A resolution
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 113
structure length 323
sequence length 328
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.470 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f8lA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2f8lA02
1D2GA 2Q41A 3EPPA 1YZHA 5CM2Z 5EKUA 3SX0A 4KDCA 2XYRA 4AUKA 5KQRA 5GINE 3LGAA 3NWBA 4DQ0A 3BGDA 3BZBA 3OU7A 2NP6A 5FULA 5K01A 3P9KA 2P35A 2ONYA 4HC4A 2ONZA 3KQTA 3R24A 3G8AA 4KRGA 5E1MA 1JG4A 5LQUA 4FSDA 3NDIA 4ER7A 1PJZA 3OZSA 1AQIA 3ELDA 3ANXA 2VZ9A 1MHTA 5D1HA 4HGZA 1ZGAA 3LECA 3Q7EA 5LQCA 4XCXA 4U7TB 3TLJA 2ZSUA 5DPMA 1G60A 2EJTA 3C6MA 2YXDA 3A27A 3M6VA 5F2KA 1T43A 4HTFB 5LQNA 3UA4A 2P1DA 2OB2A 4HH4A 5K0NA 3UJ6A 4YUWA 3SM3A 1JG1A 2VP3A 3A25A 3EMDA 4IV0A 1FPQA 4ZTBA 4QTUB 3I53A 4RV9A 3P8ZA 3V8VA 5H02A 5HOQA 5DWQA 3PX2A 3DLIA 3ME5A 4BP1A 2P3LA 3TRKA 1JG2A 2PJDA 2XYVA 4RSRA 1SUSA 1VL5A 4P58A 5DX1A 4OQDA 3KPJA 4M38A 9MHTA 3MTEA 5EHIA 3FTCA 1DUSA 1R8XA 4MQ4A 5CCXA 2NP7A 5K09A 2BR3A 2NXCA 1SG9A 3SR4A 2XVAA 3HEMA 3OCJA 1NBHA 1AF7A 1ORIA 2P7IA 1RJDA 4RTQA 2G71A 2GLUA 4LG1A 4BLUA 1YF3A 4GQBA 3LPMA 4GC9A 1MJFA 2FPOA 3P9NA 5E9WA 3TPZA 5FQNA 4RTKA 1UFKA 1SQFA 3JWJA 2UZ4A 4G56A 1O9HA 3DULA 3FUVA 1VBFA 1WXWA 3KR2A 5DM2A 3MHTA 5ICGA 1D2HA 4YUYA 2JG3A 1YFJA 3B7PA 1KPGA 3CBGA 2K4MA 3IYLW 4QPPA 4E2XA 1EJ6A 4RTPA 2JH9A 4FP9A 3ER8A 2JH8A 3NTVA 3E7PA 3KPUA 3FPJA 1SQGA 1YUBA 3OU6A 4YUVA 3SMQA 4GF5A 4QPNA 3SXJA 2JHCA 5EOVA 5LQRA 1XTPA 3GXOA 5HILA 1Q0TA 2AOUB 3V97A 3PX3A 3E05A 2I62A 2OO3A 2QM3A 3LDUA 5LR6A 3FTFA 2GA9A 3NWEA 3FRHA 4PCLA 5E8RA 5EEHA 3GIWA 3KPVA 3P2KA 1DCTA 2IDKA 4CTKA 2BR5A 2LD4A 3OE4A 4RTJA 1KPHA 2PVCA 2ZWVA 5K03A 1SVUA 3SVZA 2GH1A 3I64A 3O7WA 4GUAA 4OX9Y 1X1BA 2HWKA 3AY0A 5E1DA 3RW9A 2ZLBA 5KS2A 1RI2A 2KW5A 2R3SA 3A7EA 4ER3A 4B17A 1I1NA 2IDJA 3UJBA 3ORHA 5DTQA 4QQNA 5P8WA 2I9KA 3UWPA 3KPYA 1G8SA 4KW7A 2ZBRA 3K0BA 3KR9A 3P9CA 4OA8A 4V0QA 3S68A 3UJ9A 3VYWA 4M7RA 3T7TA 4RVFA 2YX1A 4GOLD 4ER5A 1JSZA 2ZZNA 1V39A 4NECA 3PB3A 4A6DA 1P91A 2P3QA 3VC1A 1XDUA 1JR4A 2AS0A 2IPXA 1X19A 2YUIA 5HIMA 2IH5A 3BWCA 4R6WA 1RI4A 3FPEA 3CJRA 3OZTA 2ORED 2PT6A 3PVCA 2FHPA 2QRVB 4GOMD 5CVEA 5FQOA 3HA3A 3LCVB 4YUZA 3REOA 2ZBPA 4QVGA 4XUCA 4ISCA 2AOVA 2G72A 2ZIEA 5CVJA 2G70A 1KYWA 2VDVE 3G7UA 5HIKA 4X61A 3LBYA 4HSGA 5EMJA 5GM2A 5K0FA 2YXEA 3EEYA 3FUXA 3HVJA 5E9QA 2YQZA 4BLWA 2G1PA 2JHAA 5ICEA 1L3CA 2AN3A 4DCGA 2Z6AA 3CKKA 4O29A 4GBED 3UJCA 3B89A 5HEKA 3UFBA 3G5LA 3KQPA 3BGVA 1EJ0A 3TM5A 2IBTA 2PT9A 3BWMA 2PWYA 3KR0A 4OBWA 3MQ2A 1YFLA 3GU3A 2AVDA 2O0LA 1XVAA 5GIOE 3EVGA 4U7PB 2PXAA 2YXLA 1ZKDA 3GWZA 3IHTA 1XXLA 3G89A 2B2CA 3NVMB 3SSMA 1QYRA 2ZVJA 5FWAA 3P97A 1TW2A 1O54A 1R74A 2OBFA 5DRTA 10MHA 3AXTA 3EVAA 5DLYA 4F84A 5DXJA 4IWNA 2GPYA 3C3PA 5DTMA 3K6RA 1JG3A 2EX4A 2OB1A 5ERGB 2ESRA 3T7SA 3X0DA 4RTLA 4DKJA 3TOSA 4FT4A 5K0EA 7MHTA 4YMHA 2CWWA 4RVHA 5DM0A 1YZ3A 3UJ8A 4PYJA 1G8AA 3HCBA 2F8LA 4AZWA 3CJQA 1G55A 4EKGA 4X63A 5IH3A 5JUWA 2QRVA 3R3HA 3KQYA 3DUWA 2OY0A 3ER9A 1KPIA 5EMKA 5EC8A 3M6WA 1SKMA 1L3BA 1XCLA 1AQJA 2BH2A 4V0RA 2UYOA 2C7PA 1BKYA 4DA4A 2ZFUA 3QOWA 5FA8A 3FTEA 5E8JA 2YTZA 3MERA 2XYQA 3BKWA 5CCBA 3L8DA 4C4AA 5CVDA 5G02A 5ICFA 4Z2YA 3DR5A 5DXAA 3E23A 1L9KA 5EPEA 1JSXA 3ELUA 2OKCA 2H00A 1UWVA 2GS9A 2AOWA 3EGIA 1IM8A 1RI3A 3KQOA 3KHKA 5ICCA 3M70A 5E2AA 3GRYA 4MTLA 2PXXA 4RTRA 4LWPA 4ER0A 5EG5A 5FHRA 1KYZA 3EEOA 2QE6A 1M6YA 3OU2A 5C1IA 1M0EA 2IBSA 3A4TA 2YR0A 4E2WA 5U4XA 3HM2A 3R0QA 5GM1A 1I9GA 3O31A 4RWZA 4KVZA 2AOTA 4LECA 3LHDA 3KR1A 4LWOA 2GAFA 3BGIA 3TM4A 4P7GA 3G2QA 2IH4A 3NVKI 3CCFA 4DM3A 4L7VA 5CVVA 4BY9E 4X60A 4C08A 1WZNA 3DTNA 4C03A 1NBIA 3E8SA 2GB4A 3Q87B 3B3GA 3FUWA 2ZIGA 4CKBA 1NW7A 3OFKA 5EVJA 2ZULA 3IV6A 3OFJA 3QOXA 2N47A 1FP1D 1NV9A 2HNKA 3HP7A 4X41A 4Y2HA 1Q0SA 4KIFA 4P7KA 1NT2A 3M4XA 2DULA 5LQKA 2ERCA 1BOOA 1ZQ9A 2NNWB 2PBFA 4PINA 1FJXA 3TFWA 3U81A 4RTSA 4GC5A 1HMYA 3HCCA 3GRZA 5EEGA 3DMFA 1VPTA 3WSTA 2A14A 3LCUA 5FA5A 2FYTA 1P1CA 2WA1A 2O07A 2AR0A 3HA7A 2CKDA 1ORHA 4E2YA 1DL5A 2Y1XA 2HV9A 5GP1A 4H0NA 2ZCJA 3BWYA 2FK7A 5E1OA 5GOZA 1P39A 4YUXA 3RIEA 5C0OE 3DXXA 5FTWA 2WA2A 4RYLA 4R6XA 5EIFA 3GRVA 5FCDA 3FUTA 2HTEA 3G8BA 4MWZA 3ERCA 2V74B 3F4KA 4PCAA 2V7EA 2ZTHA 3OZRA 3DMHA 3MGGA 3EGVA 3P71T 3DOUA 4RX1A 1IY9A 2HMYB 5HIIA 3THSA 3I5UA 3HCEA 4GOOD 5DM4A 1FBNA 1N2XA 3P2EA 2E5WA 4DF3A 2WK1A 3FPFA 4C05A 2PWPA 3M33A 1N7IA 3UBTA 3DXZA 3FTDA 5GIPE 1XDSA 4OBXA 3P9IA 5EKXA 1AV6A 3KU1A 3LBFA 4PYQA 4Y30A 4CXMA 1TPYA 3C6KA 3TKYA 4E30A 4FZVA 4ER6A 1F38A 3C0KA 3CC8A 5BW4A 5FUBA 3NDJA 3FZGA 2ZWAA 4E70A 3BT7A 5FWDA 2C7RA 3I9FA 3HCFA 1XCJA 1OR8A 2PX4A 3UZUA 4M36A 4AZTA 4AZVA 4FGZA 2XBMA 2B9EA 3EVBA 1WS6A 4R8SA 2Y1WA 3NJRA 3BXOA 4AX8A 3KQWA 5DT2A 3PS9A 8MHTA 2P40A 4RTNA 5DSXA 4EMSA 3IEIA 3MTIA 4M37A 5EMLA 2CMGA 5T6BA 2PX5A 3TR6A 2Z6QA 3CGGA 3LDFA 5K0JA 3A7DA 3HCDA 3DP7A 3KKZA 5DX0A 3KQVA 3THRA 3OE5A 4EK9A 4PYMA 1D2CA 3DXYA 3SGLA 2P7HA 2AOTB 5BW5A 4WXHA 5D1NA 3HA5A 1N7JA 2JHPA 3OPNA 4PYNA 2IH2A 2ADMA 5EMMA 2AVNA 3FRIA 3GRRA 4FS8A 3G5TA 4BLVA 1KHHA 3P2IA 4R8RA 2UYQA 5DRYA 3UJAA 5K0CA 3GJYA 4EKIA 2BZGA 1NW6A 2VS1A 1HNNA 1TW3A 5FHQA 4YV2A 5K05A 2I6GA 2P3OA 3UJ7A 3B3FA 2PKWA 3EVCA 4PONA 3AXSA 5HIJA 3MAGA 4R05A 4PIPA 5KYGA 5EGSA 4CWAA 1G6Q1 3HTXA 4QTTB 3VSEA 5CIYA 1NW5A 4GOND 4RVGA 5DM1A 1NE2A 4PWYA 3R9XB 5T64A 3FPHA 2CMHA 2FK8A 3PFGA 1JQEA 4FSXA 3I58A 5HFJA 3EMBA 4F86A 4YV0A 1ZG3A 3G2OA 1B42A 5T67A 2BM9A 4QDKA 4RVDA 5M5BA 2C7OA 3G2PA 3PT9A 3LL7A 3TQSA 5C9ZA 3FUUA 2VDUE 1U2ZA 1ZGJA 3LDGA 2O06A 2EJUA 3ELWA 3ID6C 3R6TA 2IGTA 4X1OA 1VP9A 2PV0A 3EVEA 2R6ZA 2G8NA 5CVUA 1G38A 2Z6UA 4C04A 1VE3A 2P8JA 2PLWA 3G88A 3ELYA 3C3YA 5HZMA 4C07A 4CTJA 2PY6A 2O57A 3KQSA 3LX6A 4PYLA 1O9GA 1QAQA 1VQ1A 3CVOA 5KQSA 1RJGA 1M6EX 4KDRA 1NKVA 5E9JA 1R8YA 5JR3A 3GCZA 3GRUA 5EZQA 5EIWA 1BC5A 3TKAA 4FR0A 1EQAA 2NXEA 4DMGA 4PGHA 1INLA 3H2BA 1VIDA 2H1RA 1EIZA 3BUSA 5DSTA 3KPWA 5K0GA 3EVDA 1KIAA 4PYIA 1Y8CA 3EVFA 5GWXA 1R18A 2IFTA 4XUDA 3PLAE 1EAMA 4KWCA 1R6AA 5BXYA 1QAMA 4QQKA 3PTAA 1KP9A 3FYDA 4E33A 4ATNA 1P1BA 1RI5A 2ZW9A 1XJ5A 4MHTA 3NMUF 2PX8A 5LSAA 4BP3A 1X1DA 3HNRA 1QZZA 1YB2A 2IIPA 1WY7A 2BR4A 2PX2A 3KQMA 5EZSA 2EG5A 2NXNA 3AWIA 4MIKA 1RJFA 1NW8A 3AJDA 4YMGA 4KIGA 5KVAA 1VP3A 2EFJA 5E1BA 1SUIA 1QAOA 1QANA 3D2LA 4E31A 2UYHA 4OA5A 2IP2A 4WVLA 2JJQA 4QDJA 5BP7A 4K6MA 1L1EA 3UJDA 2C7QA 2QYOA 2ZZKA 5EQJB 2ZIFA 3LKZA 2YVLA 3A26A 4E2ZA 4HTFA 2B78A 3FPGA 3VC2A 2BM8A 2PSSA 3JWIA 3FYCA 2NYUA 3BKXA 1EG2A 4IV8A 4HRAA 4GEKA 5K0BA 3GO4A 1JQDA 4HG2A 4HGYA 3LKDA 1X1AA 1NW3A 1Z3CA 3HVHA 4P7FA 1VLMA 2I7CA 4PNEA 4EVIA 2CL5A 5CUQA 3TMAA 4F85A 4RTOA 1IXKA 2AN4A 1WXXA 4PIMA 4XUEA 5FADA 4DCMA 3BWBA 3LSTA 5LQJA 1XDZA 4PYOA 5K0LA 4DZRA 2ZZMA 3T7RA 3HVKA 1ZHFA 3SSNA 3SSOA 4C06A 1FP2A 2DPMA 5EHGA 5DX8A 1F3LA 3KQQA 1JTEA 1JTFA 1R00A 5LQAA 3B3JA 3DMGA 3PFHA 3HVIA 3GDHA 3LCCA 4E32A 2AOXA 4UOEA 3GNLA 3RODA 3QV2A 4YV1A 2XVMA 1L3IA 1I4WA 3MCZA 2PGXA 5E2BA 4EQZA 3EGEA 1H1DA 4CKCA 1PRYA 1NV8A 4JXJA 4A6EA 2PXCA 3G2MA 4CKEA 2HR1A 2UYCA 2QY6A 3O4FA 4AZSA 2NXJA 2OPBA 4P7JA 5F2OA 1RI1A 2AN5A 3CJTA 5MHTA 1RJEA 3EVZA 1KXZA 4IKPA 5B1SA 3M6UA 3DLCA 4POOA 2B25A 2OXTA 5IKMA 2AZTA 3DH0A 5CD1A 4OQEA 4QVKA 3T0IA 5F2NA 2O05A 4RTMA 1WG8A 4PGGA 2OYRA 3M6XA 2B3TA 3MCTA 4FT2A 2VDWA 2AOUA 3UA3A 3HCAA 5DTRA 2FCAA 2FRXA 4PYKA 3GGDA 5K8VA 3MB5A 1KR5A 1UIRA 1X1CA 2ZBQA 3JWGA 1JQ3A 3NW9A 2P41A 3B5IA 3JWHA 1BHJA 2H11A 2OZVA
chains in the Genus database with same CATH superfamily
2IEIA 3MFIA 5ESXA 2FLLA 2AW5A 4C8NA 3P52A 3CE9A 3KQNA 3HV2A 4S1TA 4MS1A 1QQ5A 2G9QA 4YJDA 1TUIA 1MPXA 4CZ2A 3SMVA 1EM6A 1W5TA 3NDPA 1Y5LA 3ZDRA 5H4HA 2WNHA 4HX2A 4TTAA 4YRPA 1FU8A 4FCCA 7AT1A 2EZ4A 1C3XA 4AJ4A 4L5YA 1DUSA 2WYWA 2CNWA 4MR8B 1LRKA 3P0HA 4TT3D 4O3NA 3JWJA 2J0UA 4QLOA 1TQ2A 1MX5A 4RL6A 4MEYA 2CLEB 4LMBA 1BDMA 2GHQA 2QSYA 1S4MA 721PA 4A7PA 2PZBA 2ZIXB 1ZRHA 4JJAA 2VUSA 4Q1BA 5B4VA 1UFRA 1GPWB 3HT3A 3EISA 3R44A 2ZROA 2QW0X 2B0JA 1DQPA 4B4UA 1LLFA 4QQNA 1OFVA 2OENG 3RK1A 3TSOA 2PL5A 2VHXA 1AGNA 4HAZA 1Y63A 4A82A 3ROXA 2AG5A 3D7LA 3N8IA 1KKUA 2R8KA 4X71A 4RCVA 4XX1A 3FUXA 2O7NA 4F6RA 4DL6A 1SC3A 4G1VA 3EXFA 4DSUA 3RU3A 2PCJA 4WY2A 1XHLA 3JPWA 4DT1A 1GYRA 3TM5A 2GBCA 4YFYA 1HUZA 2NU6B 1NG1A 3IQZA 1K4YA 4QW9A 5KWVA 3WBFA 2P9BA 5JXGA 1H5NA 3AJ8A 4EO9A 4DUYB 5DHSA 3IOYA 2FKNA 1Z33A 1YKSA 1NMXA 2H5XA 3ZTYA 2Q2OA 3KV3O 4LWPA 3H5AA 4WLUA 3B20A 2ZDHA 4UOQA 4BDSA 2BGTA 3TFSA 3UUFA 5FAXA 1PE0A 3JAKA 1KH1A 1EDEA 5HFNA 5EVJA 1KQOA 5HP4A 4M1WA 3H11A 4C0QC 1EUDA 3HBNA 3EZGA 4S1NA 1KYXA 3K5PA 2ZYHA 1T9GS 3L7OA 2P9TA 2ZE7A 1GAWA 2J9XB 1JHXA 4CF4A 4NONA 4UE6A 3BGSA 3L4BA 2XTAA 1WXHA 1Q1NA 1N7IA 4CIAA 1Y3IA 1ODJA 4YH1A 3IQGX 1CHNA 5K0SA 4M0UA 1P3JA 3E2MA 3INYA 1H2WA 2PGIA 3HCDA 2QB0B 4XTRA 4PS0A 1SVLA 1DWQA 1RE0A 2DKOA 3E7WA 2YIVX 1TO1E 4MQ6A 1RHKA 4AW9A 3RS2A 2BZGA 5EP1A 3FIUA 5K05A 3L1IA 3OSNA 4MW5A 1XTJA 3M34A 4JOBA 1VSQA 2HHCA 2YHSA 2AZDA 4OGKA 4Z1OA 3F2DA 4Q8EA 1GG2A 2AD5A 4PXSA 2XY6A 1PZXA 3G2OA 4F92B 4PZLA 4E7OA 1A9RA 3M9OB 3OOHA 1P5HA 1CY8A 3GARA 1W0JA 4KO8A 4ZCIA 3NVWA 1D2AA 3V46A 3KE8A 1X1EA 3HBMA 4O6VA 4OKSA 3RV3A 4JJ8A 4BU1A 3PR1A 1GGHA 2HU7A 5LSAA 1IPEA 4C0WA 4BCBA 3VO2A 1QCDA 3LVRE 1EBFA 3AR9A 2HMVA 1QKIA 6Q21A 3DLBA 1EUZA 4UAYA 3EGDA 4MUHA 4CLDA 3PZPA 4B7UA 3DV9A 2IDZA 2ODEA 3UMSA 3AJRA 4L6IA 1E18A 3FMOB 2LCQA 1M5RA 2X4IA 3HVIA 1GFIA 1N3BA 1ZYUA 3Q7SA 5NLLA 2WM9B 1I0LA 2I3ZA 1JFVA 3B6KA 3ND7A 3TVYA 2O1EA 1P5RA 4A2QA 3R6GA 1IHYA 1RJEA 1TRHA 2IXDA 3NM4A 5DN6A 1YFZA 2ZSKA 1PVVA 4DQIA 1NL3A 4BO9A 3C14C 3ZIDA 1VFNA 3L0BA 1IUOA 4HDCA 4XDGA 5I8WA 1QF9A 2O8DA 3ON5A 3OF3A 4BU0A 2V59A 4KRGA 3G8AA 2ZRQA 3O8QA 3PFKA 1K7CA 3DYIA 4CUJA 4CM4B 3F3MA 5EERA 5AJHA 4YAGA 1UBJS 3V4ZA 3AR3A 3K6SB 2J1LA 4DG5A 4ZMBA 4RFSA 3ESRA 2VWHA 1A50B 3EC2A 2AFHB 1TM7E 5KYNA 5CTJA 5LDDC 3ICQB 4AURA 7REQB 5LLTA 4JX9A 3F5FA 4TVOA 1M34A 2C2DA 4ZCMA 4GXJA 4FEYA 2JI8A 1ZNZA 3AB7A 3V97A 1YAJA 2NIPA 4MARA 4J03A 1PSWA 2ZWVA 4BECA 1HO3A 4OX9Y 3W8RA 2X86A 2FMXA 1OXKB 2ZPAA 3VR4H 2HSGA 1P2GA 4FW9A 4L74A 4ZT5A 1K1SA 4DC9A 4MR7A 2PGAA 4COOA 2OL4A 2UU9B 3ABZA 2Z5FA 1QORA 1P7DA 1Z28A 1EK5A 1L1FA 1DOAA 3AP2A 3MYYA 1XRNA 3W5SA 3OD5A 3OECA 1WV0A 4OHZA 5KUTA 2Y1FA 5FI5A 5T8KC 1TW2A 2OHVA 1O54A 3NC1C 3A1CA 1T3TA 3TOSA 3T9BA 1JAXA 1W6UA 3CLSD 2IUYA 4F4JA 3EEQA 1V4NA 3CZRA 2MYPA 4I46A 4QXOA 2UXBB 3FTEA 1BPEA 3GQCA 4YD2A 4CNBA 2V6BA 5DBGA 5KT3A 4LIPD 1QTRA 1J2MA 3ISVA 4RHFA 3HO8A 3F9RA 1Y0BA 3R0QA 2R6DA 3INGA 3JQRA 2FMFA 2H29A 1RLTA 1P18A 4EW3A 3GLVA 4FLEA 3GRKA 1UK7A 3QH4A 2ES6A 1ZGCA 2IU0A 3VU0A 3RRBA 3K70C 4IZIA 5CFZA 1SHJA 5B58T 1X9IA 5IT0A 4NU5A 2AN9A 4H0NA 5GP1A 3C7TA 3RIEA 2L17A 5B3JA 4L9SA 2OP0A 3R3WA 4HAOA 8ICHA 1CR2A 3CKLA 4P31A 3E2IA 5G4KB 4GICA 3ZD8A 1Q3HA 4I4LA 5DHPA 4Y7DA 2QK4A 1Q7RA 2PANA 1YHYA 3U0VA 2C0CA 4P35A 2VF7A 5C4IA 5I7SA 2JHPA 3D8RA 1XMXA 2IHNA 1EUCA 3GB9A 3GXBA 1B2LA 1MEEA 2I6FA 3G3EA 3EPRA 3ECAA 1XNJA 4D9JA 1RMQA 4CL2A 1F6DA 1XTQA 3AUAA 4I4TB 4RK1A 4YROA 3JXEA 5ALYA 3T7AA 4RLHA 1NXQA 3A9SA 4D9HA 2CD7A 1TZBA 2XBUA 8ATCA 3C3WA 3CUKA 2IHUA 1N6OA 1QE0A 1FXUA 3HA2A 3E9YA 3G7NA 1H94A 2RHLA 3ZW8A 1P1BA 3TG2A 4NCXA 3ZGLA 4FFWA 3W3AA 5CLHA 1SN7A 3RS9A 5C5JA 1JXAA 2TMYA 5KFXA 1O5IA 5FTNA 5YASA 1L1EA 1SGGA 2O0MA 2V96A 5KOJB 2AG1A 1W5SA 2D2IA 4CMJA 3WGVA 1P44A 1UKEA 3LLMA 1Z22A 3TMAA 2GEJA 1XDZA 1ECWA 4DADA 1JIJA 4FGJA 5FR2A 3TXYA 1WCYA 1JT2A 4C8MA 1BWQA 5ITVA 4TLBA 3C15C 3SIPA 5AKXA 2NN3C 4MV4A 4DQPA 3WIOA 3NW9A 1IN7A 5TDHA 4L08A 3ZN2A 1WB6A 3STYA 1QCCA 2CVOA 2I8CA 1ML3A 5MGBA 5REQB 4KCGA 4J43A 1HYEA 4JVSB 4M1ZA 4RIHA 4CQLA 2F76X 4WKNA 2II6A 2O0HA 2Y93A 2OP1A 2DFTA 4P08A 1U81A 1Z2EA 3M8RA 3DD5A 3CS3A 3HXQA 5KYXB 2M6SA 3QIAA 1UM9A 4R5MA 1NXXA 1UEXC 1G6KA 1K1EA 2AC4A 3QLUA 5KQLA 1JKJA 4MYCA 3B9RA 1YTUA 3TBHA 3LFUA 1P4AA 4Y2JA 3PIRA 3PC6A 1F9EA 1QZ3A 5IN5A 2HU5A 2O2YA 4LAFA 2UYGA 5F64A 3Q3HA 4LZLA 1SVUA 1JA0A 5IK2A 2VAMA 3IXQA 5J3JA 1NQWA 4NMWA 1W30A 5KTNA 5D87A 3AQFA 3MWGA 2EJBA 2J41A 4YRQA 2X5KO 3PWKA 1E6WA 2AL7A 1XNSA 5L8VA 3EQ9A 4PLYA 4UBMA 5BSFA 1KK2A 3B85A 2YB1A 2IBTA 5K3EA 1FRQA 3KAKA 3AEKA 4OGGA 1E2HA 1UBLS 3RVDA 1DHRA 5AO9A 2P65A 2I5HA 1IY8A 2WD7A 5KYWA 1AQLA 3AXTA 2NYRA 2X8AA 3H4DA 4D7AA 1MQ2A 3N7PD 2KJ5A 4HDMA 4BTLA 3K5HA 4M6WA 4PG7A 1M67A 4FMBB 1G0NA 3F49S 5KYUB 1EHIA 1XVTA 4R8LA 4Z2AA 1RC8A 3W9SA 3A3NA 4D43A 3A4TA 2VSFA 4R98A 4RPCA 2V0GA 1YNOA 5KCMA 4C4SA 3VHQA 4HUTA 2W00A 3DVSX 3E8SA 4QYIB 5IINA 4UEJA 2NACA 2WFMA 4JJKA 4R4JA 4XVCA 3H04A 1T9CA 1V96A 4D8XA 1H38A 2E18A 4TV8A 5C8ZA 4DDHA 4HPJB 4JBHA 2BKXA 1U04A 4O4HB 1C0KA 2O2IA 4NYMR 1SHUX 1XMSA 1SC6A 1RYUA 4KDEA 2ZU0C 1P1HA 4ND8B 1Z15A 2VZLA 1AV6A 2M9NA 3FF4A 2APJA 3TAUA 2ZYDA 4WIAA 3B2NA 2O8CB 1DBRA 4GHWA 4OFZA 1WS6A 4TUPA 5DT2A 1DKPA 4FDMA 3HN2A 4QJ3A 4F9GA 1SZJG 1KVTA 2EQAA 4NV3A 5E38A 1EK6A 2MOKA 2J7PA 4NARA 1UMDB 4DNPA 1UAAA 4NPCA 5HIJA 1BXZA 2XZDA 4C76A 1PEYA 2O52A 5CIYA 2V7UA 1BVUA 2ZRKA 2ZT6A 4IF6A 1FYDA 3TO5A 1KMCA 5BYAA 3OCUA 4QWAA 1G2OA 3ZD6A 4CCYB 4I2DA 1JALA 1R5OA 1O4VA 1A7AA 1UWCA 4XJSA 1ZINA 3EH1A 3BEDA 1E2JA 4XCQA 3ZCVA 1X87A 5BXYA 1RAFA 3GJSA 4KO1S 4JT2A 4GRIA 4C21A 2ZAMA 3D6FA 1TLFA 5L7YA 5L1IA 1VZ2A 5CA0A 3ROFA 5DN9A 5DVZA 1W4BA 3A26A 5LLSA 5CFOA 2P27A 5CB4A 3C70A 2F1KA 2GLTA 2O3RA 4Q6WA 4P4SA 5DASA 8ICQA 1JBKA 3JARB 3KJQA 1WHTB 5DX8A 4D3ZA 4G5SA 2EF1A 3TLGB 3IE0A 4GMHA 3V7KA 4YG2A 1QLNA 4P7JA 5BWLA 1J49A 1JTVA 4A16A 1WMSA 1NXWA 4HX5A 3DH0A 2JGDA 4ED0A 4V0NA 1QSSA 5DTRA 1Y7TA 2ZR0A 3MS2A 3GLGA 2XGOA 4RVCA 2XSZA 1SXPA 4X54A 2AZXA 3WL4A 1X1RA 1IY0A 4CI9A 2CYBA 3IPRA 3BIWA 1G20A 1K27A 4WBXC 4HLCA 4JJ4A 3FKSD 4L5JA 3C6MA 3RB8A 4Z4HA 3CB4A 3R5XA 1M1NA 3I53A 3TQOA 3DLIA 4X91A 4IGKA 3W9BA 3O95A 1QTNA 2OC9A 4YXFA 4DLYA 4IUCS 3BXXA 1ODFA 3KT8A 1DIAA 4P0QA 4DLGA 3ZLJA 2X9QA 2D7DA 1XRMA 2ZRGA 3WRXC 4QTXA 3WYAA 1T25A 4L5AA 2BEVB 2X2EA 3A14A 5MHTA 4CF7A 1NC1A 1IQUA 1TMOA 2I62A 1EYZA 3FE2A 3H0MB 2ZETA 1Q16A 4CJXA 1X3SA 5JXJA 4WZBE 1FX0B 4JFAA 3M81A 3HDHA 2QARA 4CEIA 2W2KB 4RZUA 1XO1A 3PDJA 3M49A 3OZWA 2JEGA 5CFPA 1USIA 1KVQA 4BOYA 3SICE 1CY7A 2JEOA 1L5SA 3OM1A 3B0YA 4O33A 1O77A 3ET4A 1C9MA 2C42A 4DLPA 2V6IA 3NORA 3IBYA 2B5OA 1Q3UA 4Y0AA 1IBCA 4UTRA 4U2FA 4NICA 4TXHA 2KIVA 1KSGA 5FV4A 3NVMB 1YR1A 1ISMA 3A58B 4MF8A 3WK5A 3NHBA 2WF9A 4ZQGA 5H0IA 4DQVA 3RR8A 5I5EA 2LV8A 2RIPA 1SKMA 1VRCA 4KK4A 4X9XA 4BWJA 1NUUA 4M1MA 4L8LA 3MWDB 3ST7A 2YN0A 2YFYA 2DECA 1Y1KE 4IGIA 4ECUA 1RI3A 5I8PA 3C2LA 2B8NA 1J8QA 1HLPA 4E1BA 1SC4A 3G0GA 3ETLA 2Y1LA 3UGQA 1USUA 3OCWA 2Q6LA 2BCJQ 2GAFA 2HZ7A 4LOAA 3VHLB 3KV1A 5E4YA 3M9MB 4DSZA 3D8SA 2V7WA 3KEGA 4IDCA 4QGAA 4KMSA 5EHZA 4N65A 2AG0A 1Z0DA 2X23A 5THQA 2V0CA 3CRVA 3KSAC 1KHTA 1CUYA 2IX3A 3AINA 3BRWA 2HRBA 2RGDA 1V97A 1XLWA 2ZIVB 4G5YA 2RG7A 1KBUA 1ZJNA 5HG0A 1GPNA 2Z2IA 1PYOA 4D3XA 1FBNA 3K8QA 4TRMA 2K4IA 1LS6A 5BMVF 4QVIA 5A04A 3KS9A 4MVJD 2QN3A 3WXBA 2REBA 3IKVA 3LXMA 3LQ4A 4RESA 3A7DA 4ZI7A 1YDMA 3CLTD 4R2MA 1GLNA 4QUAA 3BMOB 1ADBA 1H6AA 2R1TB 2KKVA 4B9UA 5L95A 4JKYA 5HF6A 3ZH9B 4I08A 3CFYA 4PZNA 2REQA 5EGSA 4K28A 1PLLA 2DMRA 4ZV9A 5IDWA 4IIXA 3ISBA 3HUUA 4I1VA 1RQLA 1EQUA 5FH9A 5EHXA 3R6TA 1M9NA 3JWPA 5DB9A 5J0OA 4FB4A 2QXTA 4XD2A 1DEXA 5IS2A 4BV3A 4FYKA 1RI5A 1E2KA 3A1WA 2H5LA 2BDTA 3LO5A 4X97A 3V32A 1Z36A 4Q03A 1T5LA 4P54A 4ZH4A 3TI9A 2WUVA 1N48A 1VCHA 3SJ7A 2JRZA 1HE5A 3O3CA 5TGDA 5K0BA 2WSMA 2XIJA 4NPAA 2QTAA 3G1UA 2D1QA 3VMFA 2Y3IA 4XUEA 4LVOA 3OJLA 2HKIA 3TUZC 1B14A 1YRBA 2XT0A 4UOEA 1TGYA 1L4KA 5JSQA 4A92A 2PXCA 1HPLA 2CV1A 1AE1A 4LPKA 4RQNA 4O4IF 3ZCUA 1WYGA 4DFMA 3A70A 3A1FA 4PGGA 4DRYA 3M6XA 1UBHS 3BHMA 2PUVA 2ZWIA 4FMDF 5ITZA 2F43A 3CSSA 1PL0A 2WSSD 4LEIA 4Z3KA 2WJVA 2DU8A 2NP6A 4FSHA 4C80A 2K2WA 1W8IA 3QVOA 3O4HA 2R25B 4LOKA 5KOHA 1IRXA 3UXNA 1IHPA 2QQ5A 2Y4OA 1LSUA 1QKKA 3MBYA 3LSYA 2G1AA 1Q7CA 3TRKA 2I1WA 4CM8B 1R9JA 2FN7A 2W58A 5FWXB 5KU1A 3A06A 2BW0A 3LO8A 2Q3FA 2I3GA 3E22A 3DULA 2XQJA 1W0KD 4RXTA 4G97A 2G8LA 1UK8A 2YWGA 4QPNA 2JEIA 5JIBA 1JXEA 5B30A 1GQYA 4OFBA 1TYDE 4ZZ1A 1KJYA 4RTJA 1XMPA 1EI9A 4CDGA 3OZDA 1X86B 2JGKA 3R9IA 3THYB 2ZBRA 4IH1A 2VF5X 3K9CA 5DTJA 1NOJA 1ZEMA 1NZPA 5HIMA 3D3QA 1UHUA 3CRRA 1W5FA 2BFAA 4OU5A 2V54A 5KOIA 4ECVA 4WSOA 2NU9A 2Z4TA 4ZT7A 2FX3A 4GZMA 4WZ6A 1DSSG 2GI4A 1XQ6A 3GU3A 2WPDA 3D6TB 2QQ0A 2AF4C 1QDUA 4PO3X 2Z95A 3JVVA 4Z5XA 1YZ3A 2PUBA 2X7HA 4RQMA 3K0HA 4JL8A 1YJCA 1ZJYA 4BC1A 2BCUA 1ODTC 4MCJA 1FB5A 3BKWA 2IUTA 2C4TA 4UAVA 3KVVA 1WZIA 1PK9A 3Q11A 3GRYA 1M74A 3QMVA 1FL9A 3V1TC 4OHUA 2V3VA 2W5UA 4M1TA 4RFVA 1NTRA 4FOSA 4UFNA 3FUWA 4WECA 1KDZA 3D3WA 3DOEA 3WJ1A 1S7CA 4YCCA 1ZD9A 4PC1A 1BOOA 1R4ZA 1MW8X 2XVTA 1SXJE 3EZ7A 5DB6A 1P39A 4D80A 1JIHA 3ERCA 4PHAA 3RSLA 5EWMA 2KWIA 2C4KA 1PD0A 8ICFA 5IZCC 1N36B 3N7TA 2VNKA 1XKTA 1R6XA 4N0QA 3O7MA 2JJYA 3OE1A 5KT7A 1EHCA 4RGQA 1Y1RA 2JARA 1L2TA 2VKQA 3CH4B 3O03A 4RMIA 1Q12A 2HJSA 1XZFA 4OHFA 4AXBA 3GD5A 5AW2A 3R3VA 3GC6A 3AEVA 4CIWA 4NS1A 1ULSA 4ACAA 1FSPA 4M54A 4P4OA 1G6Q1 3B2QA 1FCJA 4ZD6A 2G36A 1U7OA 4F86A 2PZKA 3L05A 3L46A 3UOAB 4IDHA 2C4WA 3BD9A 1VP9A 3Q1LA 1XA3A 7ICNA 1CQIA 1GKIA 4Y98A 2FEOA 3KHHA 2ZUVA 1XN4A 4WX2B 1KIAA 1SKWA 5IXJA 1ADJA 1QAMA 3NWJA 4ATNA 5EIBC 5CM9C 1YB2A 1KH2A 3S2GA 2XKKA 2KSQA 4RA6A 3U7JA 2E87A 5IIIA 4GOJA 2UYHA 2O3SA 1RQ7A 5CRIA 4G01B 3MD0A 2X0DA 2RHBA 2F9FA 4N5NA 1WCIA 3TQHA 5AR1A 4JB8A 3U1VA 3RG2A 3PFHA 3VR5A 3H97A 4CBVA 2HREA 2I78A 3TJZA 3PW5A 3VRHA 1JIVA 1GPAA 4A6PA 2C5FA 1GCIA 4EG0A 1Y8RB 3ZGNA 3JYPA 2F9LA 3ZWBA 1SVWA 2N75A 4CIBA 2JNWA 7ICTA 4P5DA 5HR6A 4IXMA 5HF8A 5A4MS 3HL0A 4IQWA 1G5IA 1PNOA 4O3SA 4UHJA 5FFNA 4XW2A 1KARA 4I9GA 2YHBA 2W70A 5AVXA 2ONZA 3KQTA 2B20A 2WTMA 3CF4G 4PV7A 4YCNA 1T43A 2HEIA 2P1DA 4AJEA 2RDMA 1TQ4A 9ICVA 3CZ5A 1FFHA 4NQZA 4WBNB 4O3MA 1J8YF 5KG2A 3P0IA 4NOJA 4WY8A 2NZYA 2K4HA 4LQCA 1JDBB 1TCUA 4LNUA 1CIJA 4M87A 5ESRA 3LV8A 2CW5A 5COAA 4Z9FA 3E6AA 3LXXA 5JT1A 5IXSA 3PSHA 5HOEA 3B7PA 5AKEA 1ZAKA 3IE2A 2J33A 3OJEA 4KAFA 3MR3A 4WEQA 1YUMA 1IL0A 3P2KA 3MUOA 1UZNA 1RYYA 4NYJQ 4XASA 3WNBA 3A7EA 2IDJA 3MW8A 4ED3A 5J29A 1BKDR 5KWSA 1Z4JA 2KHQA 1Y82A 3FPEA 5F98A 3O1HB 3NBQA 4E5YA 1F8FA 1KYWA 3GVPA 4TKZA 2LR0A 3CR8A 2JL1A 1Z6QA 4GVLA 1BPZA 1GRQA 3E81A 2J5KA 3H0LB 1E2MA 2DXIA 5L40A 4MUEA 2VDOB 2Q1SA 1U4SA 5BRAA 1QQBA 5ALDA 5KFOA 3I4LA 3NETA 2HT6A 3T15A 3QKSB 4DUPA 2JAWA 1J8FA 3EXHA 3H4BA 4FMCF 5A4JA 4OAPA 5LYJB 5FORA 4BS9A 3FZYA 3RFXA 3DKRA 3KVNA 1XQXA 3DVAA 5FA8A 4J4HA 1EFAA 1QIGA 4Q12A 3SXPA 1JSXA 1JHUA 4DIMA 1R3UA 1R7RA 1RJ9B 1OMOA 4E21A 2PS0A 3KCQA 3R6LA 2QZZA 2ANBA 2ZYWX 4A8EA 3UXPA 1IQRA 2A78A 1XK6A 2IP4A 2XY5A 2XCUA 2QZPA 3ZGOA 2RGYA 2YDXA 1QIEA 1FMJA 4NHOA 3HN6A 5BSTA 4YXWA 1T0UA 3NGLA 4XD7A 1DKNA 4DMUB 5DYIA 1WHSB 1HDYA 1OYVA 3MMSA 5IKPA 1Y9EA 2DBQA 2XCIA 4EX6A 1E3TA 5J2JA 3WK9A 2FA9A 4OSPA 4O2RA 2FN8A 3R09A 1ZQSA 3WLSA 1FDOA 2J5RA 4DCSA 4BNUA 3NUQA 4Y6GB 4Q4AB 3VCBA 3PLRA 2AJQA 4AKEA 5DNVA 2FSGA 4LGMA 2BFCA 2PUWA 3KZXA 2I2FA 5CXQA 5DBHX 4OBXA 3LVWA 2EQBA 3AUXA 4ER6A 2Y6UA 3CC8A 2N1RA 1ZH0A 3KUDA 3BXOA 1M1YE 1G64A 3OJOA 3IEKA 4OB6A 2P2LA 1CRQA 2JJ1D 5MN5A 3OUZA 2CL0X 3A0UA 1GTRA 4AO8A 2HA2A 5GPBA 1PV4A 3I9MA 1JI3A 5DNWA 1YQQA 4AO7A 1QOQB 4WOJA 4XSVA 4H7DA 2LDBA 4GL4A 5M34A 5KFSA 3L8HA 3LC1O 4ARUA 3UJNA 3E4DA 3UEOA 1O7JA 3IEMA 4AMZA 2H4FA 1Y6FA 1P5FA 3EVFA 4ZWNA 4E33A 1FTNA 3OZCA 1KY4A 1JNYA 4L8WB 2ZRPA 1B3RA 3I28A 4ARZA 1C2TA 2FZGA 4OA5A 1TAGA 1BD3A 3DAGA 1QZXA 4UQPA 1CQZA 1AKWA 3F8SA 3ET5A 3D5EA 2FDCA 1M1ZA 5CDYA 2O2HA 1XLTC 3FPKA 2VLBA 1ZHFA 1UR5A 2Q3BA 4RELA 4YRJA 1EDOA 2Z57A 1DUIA 2J4DA 1R4MA 4MWTA 4EO4A 2QLNA 4K4HA 3HBAA 2H59A 3I4FA 2F3RA 3EA0A 4GU5A 5DYNA 2W8ZA 2R1VB 3GT0A 2RH4A 3WAKA 3FNEA 4HVAA 1SBQA 2C2GA 2LDXA 3K16A 4HKTA 2JGFA 3SBOA 1B16A 2G07A 4IRUB 1EE2A 2JZBA 1SXJB 1I6LA 4WMLA 1Q11A 4OO3A 3MCWA 1DG3A 1QIJA 2CK3D 1CU1A 5A5EA 4KQMA 1O1YA 3SIXA 3RAPR 3IXMA 4IIJB 1KKMA 3TXXA 2ZUFA 1AKTA 3WGHA 1KZHA 4RPGA 3DM5A 3VV2A 3HDYA 3T3FA 1Z4PX 5JU6A 1C3OB 4EHDA 2PUAA 2GEKA 1YE3A 4UASA 2XDQB 4F38A 3OF2A 4UVDA 4BAZA 4QWMA 2R1UA 2NUTA 3GLFB 4ON9A 3R0VA 1AN0A 2F1OA 3PTZA 2UZ1A 4QDTA 1QRAA 1OBFO 5IAJA 3OE4A 1PGJA 3AY0A 3NRWA 1MB2A 5L3QA 4EBCA 4ERXA 1J42A 3NCHA 5JH7F 3THXB 1J33A 2G72A 4RHCA 4YLGA 1Y3HA 3M8KA 1HG0A 4MX8A 2IZ6A 1FO4A 1GADO 3JQAD 5CT9A 1UKBA 3DNMA 1NKSA 5FDFA 3KYCB 2ZYAA 3F5EA 3MQ2A 2R66A 3ODPA 4DOMA 1RYEA 2O4UX 4Z7OB 5J47A 4DV0B 1BE1A 3HNPA 3QXGA 5K0EA 4OP2A 4FX2A 3A0RB 3K6JA 3OKPA 4JJZA 4O2BF 2O9JA 1Q14A 1T6YA 3E0XA 5EC8A 5AOAA 5HF5A 2KLBA 1P9WA 1EWQA 5AICA 3EBOA 1V7ZA 3CRQA 1KFDA 3HH8A 2DWOA 2EATA 1AQUA 1TT5A 1VC2A 4BO4A 3OJSA 2W55A 4U1RA 3A6EA 3UW3A 4B6PA 2PKCA 2Z1NA 1T0BA 2C59A 2QMUA 4WFJA 1PGOA 4K03A 3ZY4A 2JFUA 3B1XA 3ONVA 4K2HA 3O38A 4K3VA 2NG1A 1PS8A 1OWPA 1AHIA 5J40A 4EHBA 1NF9A 4MS4B 1BHO1 3HW8A 1DEAA 2B7CA 4L5BA 1J2JA 1GKKA 2WLSA 4C30A 1Z6YA 1SZDA 3JVEA 3H9UA 3QXHA 2B69A 1OYOA 1H2BA 2F48A 1RQRA 3FJOA 4HWOA 3AIKA 1KAGA 3T4EA 1TVMA 2IEAA 4WHMA 4LDAA 3LHSA 4GBJA 2WU1A 2OKGA 2JF0A 3L0OA 2QVBA 2CZGA 3LPDA 4DFPA 4NK4A 3RFAA 3K0FB 3ROMA 2X0JA 3AQ4A 3O8OB 3TD2A 1ZH8A 1JMYA 3LG2A 1JFFB 3NUGA 4WDRA 4AJKA 2UV8A 3HXOA 1HA3A 1KI3A 5DLEA 2NV2B 5AUNB 3G8YA 4FFLA 2Q2QA 3NFRA 4PC3A 3MQ4A 1N0VC 1ZY2A 1VKJA 1PTJC 1J70A 4PFJA 3U5ZB 1QU2A 4KAAA 4TMZA 3NYWA 3AP1A 5E6UA 5B4UA 1Q1ZA 3ICEA 1F0KA 2C0PA 4ZU6X 1FDRA 4F96A 5J58A 3NH6A 4QKQA 2BFDB 3H5NA 1NOMA 1YT5A 5A2QA 4JA2A 3PYLA 1RDFA 1JQ5A 2VQ6A 1DLJA 3C3MA 3GQBB 1EVIA 3J7TA 1FMTA 3B78A 1P73A 2VHQA 1WXXA 5TZVA 3U3JA 4ALJA 1F2TA 2GFIA 1GGVA 1M73E 3RUDA 2QMOA 2WUWE 5EIEA 4IEFB 1CUWA 5MF6A 5BRJA 2IPOA 2AZTA 1ZLYA 4I50B 4AY2A 2VLIA 5BT9A 3M5CA 4JL5A 1B0XA 4GI1A 3GUCA 1XMOB 2WUGA 1WOYA 5FJJA 3BGDA 3V80A 3CISA 1P4JA 1JR6A 1YT3A 3KOOA 4P53A 1D1QA 5LQUA 3HNOA 4LZPA 2R1ZA 1GVHA 3L6BA 3PGJA 1QGUA 4JLKA 4J16C 1Z0SA 4RU1A 3R7WB 2HHSA 3BJYA 1UJNA 2PJDA 3K4HA 8GPBA 3AU9A 4ZVSA 3V3TA 5TY0A 1ETUA 1NQ5A 5IYZB 2P7IA 4Z4GA 5DYYA 1XSPA 1KJJA 4LBWA 2VJQA 3GLUA 4CDMA 5BVHB 1LLUA 4YT8A 1M1YB 3RYTC 4BBZA 2BKAA 4YYZA 5GJBA 2GTIA 3W4KA 4TV9A 1IG6A 3IJPA 2BGUA 3ZPXA 2OGTA 5SYAA 2KD1A 3LF1A 5J1TB 3BAZA 4FCTA 3RC8A 4TXNA 4F4WA 1GTSA 3T61A 1WA5A 2HQRA 5K3DA 1LKYA 3U7EB 4M21A 4IILA 2OEHA 3RBVA 5LKAA 1UUFA 3CVYA 9ICXA 3MR5A 2OZLB 3PQ6A 5KTRA 2AXTU 2K7ZA 3CLUC 4UTNA 2DFPA 4ECTA 5J4VA 4RPKA 4YCBA 4YRKA 2DFLA 3HR4A 2Y1IA 2YXBA 2YXLA 3I62A 5CTAA 1GUDA 2RGUA 2PR2A 2A67A 4S24A 3H2SA 2CSUA 5JI2E 1P8AA 3I2YX 1G4UR 1QFMA 4PZEA 4TL8A 4LKOA 2RCYA 5JO9A 2R6AA 1VI5A 1ZQXA 2QRVA 3HDJA 2JH1A 1S10A 2C03A 4AC9A 4EL5A 1A9TA 2F1HA 1FW8A 2NO5A 5L3SA 1UMBB 4ECRA 4HWRA 1Z4KA 3Q8RB 5FP0A 3PYXA 1W76A 1YR6A 1ZM7A 3LUJA 2ZJ7A 3VU9B 4EPTA 2IY9A 2QL6A 3QMMA 1E1RA 2FZEA 2NO1A 5AM5A 4RA9A 2RDIA 3G0IA 3RE1A 3PRJA 2BQUA 4YAWA 3RF6A 1A9SA 3MUNA 3C7DB 1Z3EB 2FNAA 4GC5A 1Z1VA 4AZ3A 4JT4A 4YS6A 3FYUB 3NEJA 2RCNA 1HE2A 4ALIA 2JBHA 4XEHA 4OM7A 2WJ6A 4MUBA 3DB2A 3RT7A 1MXHA 2H4ZA 4EPRA 3UJPA 2Q5IA 3NP7A 4PCUA 1OAKA 3KU4A 1UWKA 3QHPA 1U31A 5DCWA 4P98A 1W4ZA 3WKCA 4OM8A 4B9NA 4BVFA 1FPMA 4PLTA 3TPCA 3SEAA 2P79A 5K0JA 5KT4A 2ZS7A 5FUVA 1NW9B 3OE5A 5H4GA 1S9HA 1TVCA 2JLRA 5ETJA 1O96A 1X7WA 2O8NA 1S96A 1G5PA 4K6FA 2XITA 3CZPA 1SUBA 2Q5OA 4RMJA 1I3KA 3ZTTA 2IC5A 3DCIA 1XRQA 3G82C 1NDQA 1Z73A 2C9CA 2RK6A 1JDJA 2I7VA 2OZKA 5CH8A 1O9GA 4I2JA 2FQWA 1FS6A 2Y1DA 3GRUA 2NXEA 4CUZA 3AM1A 3GA7A 5ARCA 1UJ2A 2O19A 1P2DA 4JMPA 4R16A 1M2VA 1O0BA 4YAEA 3NO4A 4EEKA 2W6ID 2DQKA 2C78A 3G9ZA 4I5GA 2R7KA 2W6MA 3TNYA 4DL5A 2XNCA 3DGEC 4QHYA 1YQUA 5DHTA 5TVKA 1WWUA 5E95A 1RPLA 3ADBA 2JGMA 3NB0A 3CVVA 2D8AA 2VTKA 2UVVA 1EH5A 3SM9A 1K7EB 3VYVA 4FVTA 2RHTA 1KTQA 4AJOA 3DVLA 1NU8A 2P6OA 3IHWA 5BQ5A 4V2IA 4QVKA 2Q29A 3O3OB 2JVKA 4DUGA 3EQZA 4HYKA 1XZQA 1VLZA 3ML1A 5ESDA 2DG2A 3G2JA 2IYLD 1D2EA 4KDCA 2FG5A 2XYRA 5JRTA 2XUFA 2DF4B 2OYCA 1YB5A 2OSVA 3IDFA 3RAGA 4JYBA 1CDEA 2EYQA 4U7CA 1YB7A 3GGGA 3RB6A 4PVDA 3GGPA 1TMGE 2GRUA 4UTOA 3C3CA 2VYCA 3W6OA 3PVSA 4EBBA 3WV4A 4R7GA 2PSHA 5BVGA 4MQ4A 3K4PA 3P9RA 1JYFA 4G8CA 4IOKA 4KMOA 1GRVA 1P60A 4F56A 5BOVA 4IG9A 3RJ5A 4DEVA 3ZGXA 5IUJC 3D1JA 4B83A 2GILA 4FYWA 1F8YA 5L1JA 5DLQC 1IHOA 5EXTA 2ZXUA 3QG5A 3TYXA 3BMCA 2O7QA 5EP4A 5CM8B 3FCXA 3TZLA 4N76A 4R9NA 2C77A 1OLOA 4A6DA 2JFBA 3O82A 3OLWA 2NSJA 3AVQA 4AYTA 1MTZA 5L4LA 5BSVA 4OHMA 3FOEC 4C6RA 1YCGA 3AM3A 5JJCA 1TU3A 4IRXA 5CX1B 2BCVA 5AQEA 4QXPA 2GEDA 1E5DA 4N0PA 1J09A 1PJLA 5HJEA 2AEMA 1JDBC 5BNIA 1SOAA 1E1CB 4QWWA 1EPUA 4KQ1A 2XJ9A 4P38A 3D7KA 3L0DA 3U6KA 2NSYA 4TTTS 3LK7A 4IWNA 2C1EA 2HIMA 2GPYA 5IJ0A 4TQUS 2EX0A 3OQ1A 4BLRA 3OQOA 2ZEJA 2A94A 3PC8C 4ARBA 5JAUA 4MYSA 2JGRA 4EO7A 3QU2A 2XCTB 4N0DA 3JD4A 4JI8B 2G5PA 3CZAA 3RRZA 1QHYA 3VYRB 3E4CA 1ZMOA 3D0OA 4OFXA 3DZHA 3FH0A 4OQFA 4DSNA 2ZB8A 4QEKA 3IVXA 1R0CA 4QGGA 1VI2A 2EWWA 3ZCXA 4BWFB 2Q50A 4E46A 2MSNA 4MVJF 1NJGA 3RC9A 3M8SA 1ODLA 2GAJA 3AEUB 1ZEJA 2QA5A 2NNWB 2PBFA 3DE2X 1JEQA 3G7SA 4LFAB 2H3VA 5SZHB 5C5CA 4YJ3A 2OR3A 2ZCJA 3BREA 3RSFA 4A91A 3U56A 4XFJA 5DB7A 2E37A 3G8BA 4NK5A 4URWR 1ZK0A 4GPIB 3P71T 4DIOA 1MH9A 3WLJA 4KJXA 2DPYA 2VK8A 4I3FA 3MGBA 4S0XA 2X4LA 3A6KA 2WUEA 2Z0MA 3IAUA 3CMMA 2EFGA 2VF8A 2VP5A 3VR4A 5J0QA 1TX4B 4NZMA 1J4AA 4XM2A 1CRPA 4PL2A 2R8PA 3IN5A 2R68A 2IXBA 3I83A 3LBHA 4RANA 4ZKEA 3SVTA 2NU8B 3LZCA 1PUZA 2W7PA 1ISRA 2AHOA 5I9IA 4ZOAA 1NW5A 3KZMA 2EHDA 1CJBA 1DC7A 1MHPA 5E7JA 1K0FA 1S2DA 7ICKA 5AM2A 1ES9A 2FK8A 1Z4OA 1DU4A 1JDSA 3LL4A 2P5SA 1TF2A 1LTQA 4TRJA 4MKRA 3X2FA 1O95A 4EF6A 4PGHA 2WV9A 4QHSA 4NFHA 1FS5A 1EAMA 2FLVA 3B5EA 3NHPA 4MW0A 4G8JA 2DFKB 1AO0A 2PX2A 7ICRA 3K4GA 3GMDA 1T2FA 1V5IA 3OAAD 4D9FA 1KI6A 1KQFA 4J91A 1ZD1A 2PVPA 5JU5A 3UENA 4UB4A 2XGMA 3N9IA 2OV3A 2B6HA 4Z4EA 1LA2A 2WU4A 1VKOA 2PS3A 2RGNC 2OCXA 1NHGA 2NVUA 5BSHA 4BDPA 2J5XA 3NI2A 1TTTA 2PNFA 5KTKA 3Q85A 1OCEA 3V6JA 2FSIA 3WHKA 5ISMA 1GUYA 4JI4B 4KN7A 2AB0A 2L69A 4LYDA 4WNYA 1TUEA 4XQ0A 4MVJP 4K1LA 2BI4A 4GXQA 1IBKB 3GV0A 3TOXA 4XFKA 3WLAA 3DEJA 1SQSA 2QXUA 4HTFB 4HH4A 1BJTA 3BXHA 3TNLA 1S77D 1QPZA 5KWIA 2EYUA 3P4UA 3ZCRA 3UBMA 3I9JA 3Q98A 3AC0A 5HUJA 2BFWA 1A4RA 2G71A 5AWFC 4EL0A 4V1CA 5LMNB 4DPLA 4F4HA 2HWYA 2J6CA 3K9HA 4NM2A 1N60A 2MR6A 2FR8C 4L4YA 7ADHA 5L1KA 3LQRA 1YZKA 3VDNB 3FXAA 2VT2A 1QH1A 5BWNA 2VJMB 4CIDA 4IQUA 4KMUA 3FWYA 2FPWA 1JSZA 2GM3A 5F52A 2KX7A 1WW3A 4B6JA 1C1YA 1U4OA 2ZIEA 1SXJC 1IJFA 1JXQA 5LXTB 4D8TA 2PUFA 2QTMA 5EJ5A 4OQXA 4JP2A 1YCDA 4ZYVA 1QLJA 4IUBS 1N2GA 2XB2A 3TVDA 1NUPA 3SSMA 1CUAA 3EARA 1UQTA 1XSLA 4KXQA 4R9UC 4RKEA 3OPXA 4K6KA 3KXLA 1CVRA 2OECA 3H8MA 2FW1A 5KOYA 2HNAA 2WWYA 4BJHB 2GO1A 1ATIA 1T5BA 2X3YA 4AX4A 3QFHA 1PR2A 4FHGA 4HO1X 2QTRA 1WUIS 3B1VA 3TR0A 1TJ3A 4GC6A 8ICXA 1AHPA 2QD5A 5GM1A 1HE3A 3SZRA 1ZXIA 3PR5B 2J30A 4FBGA 4EB3A 1P0FA 1JEYA 2JD1A 3LRXA 1U2DA 2UVWA 3SS7X 2YNMA 1NW7A 3JQ8B 3UT5B 3FB1A 8OHMA 3OEHD 2Y0DA 2GO7A 4MYRA 1UBMS 1MC5A 2COEA 4Z54A 2FYTA 4U7HA 2AI1A 1E4EA 1PL6A 3F4KA 1Q1EA 4FILA 4TVSA 3SF8A 3UMBA 5HIIA 2NUAB 4E5MA 1N2XA 1MAAA 4FKMA 1C4WA 4FS3A 3LU1A 2J3JA 3ZTWA 4KPUA 4RPIA 5CXSA 2D5IA 4QZGA 3HI4A 1NP6A 3OUTA 3RYCA 1MABB 3K31A 1UMCB 1UXKA 1FE8A 5IDQA 1UKYA 3U3DA 2QKYA 1P29A 3WLEA 2WFAA 2JDIA 1FUIA 5JZVA 5EXDA 1VKNA 4AN1A 1GUBA 3RFUA 1AB5A 4DDWA 1SKUA 1XF9A 3GEIA 3H0KA 4HJXA 3I73A 1P6QA 4PYLA 5KNDH 5E4FA 1P2TA 2ZYGA 4NWIA 1INLA 4L4SA 1JF8A 2I2CA 1Q1GA 4Y67A 3PLAE 5BNFA 5EUQB 1TCBA 2PZGA 5J2FA 1T5IA 8ICCA 4K9SA 3CZ9A 5CDFA 5EZSA 1VP3A 1V6SA 1VM6A 4FU0A 3EXG2 4LTMA 4D4IA 1VJCA 3NTRA 1SWVA 3F7NA 1UANA 4ENPA 1H8ED 5G0TA 4ARCA 3WMWA 1K5OA 4ARIA 2AE1A 1KY2A 2OBBA 1OI3A 2C83A 1E7RA 2ILTA 3BTUA 3WGMA 2WZCA 4Q9AA 1HX7A 1X1SA 4EUEA 1MQAA 1DB3A 3HVKA 1QHHB 3UK6A 1AS2A 1Z19A 2I54A 4AMBA 3NYRA 5HWSA 3WBBA 2ZWOA 3HZZA 3MINA 2ZRBA 3RB3A 2VYFA 4K6GA 4R0NA 2X4DA 4UZSA 4FO6A 4TKLA 5F2OA 2OMKA 3HKEB 4BTVA 3ZHVA 1UOQA 2ISSD 1TJPB 1NK8A 1IEWA 3H9BA 1GRCA 4OHOA 1OW3B 2B3TA 1KFJB 4DMRA 4BATA 3EZXA 1YONA 1V71A 1BVYF 1J0DA 3PJDA 1Q0LA 2PMWB 2Q0SA 2C84A 2TYSB 5HKKD 1TQ6A 5CAEB 1BU8A 1CC1S 1L7NA 4Q02A 4TURA 5HZKA 4YRIA 4GXNA 5K8CA 3VC8A 3GGJA 3PDWA 1JR3E 3TIXB 3E5HA 2XWPA 1QONA 2CCGA 3KPJA 1C3LA 3SR4A 4IIYA 1H9AA 3BH7A 1UDXA 4KZKA 1ST3A 1H1LB 4U7FA 3ZVLA 3QFTA 3K70D 4C4OA 2Q1UA 4QZ8A 3VA7A 1YR2A 3BIOA 4UHBA 3O47A 3FNFA 4EJFA 1M2EA 3RKUA 3L04A 1Z13A 5ILOA 4I4NA 1ZQUA 3N2KB 1CUGA 3U7QA 3T3GA 4KQIA 1RI2A 3I34X 3N70A 4E08A 3Q10A 3U3RA 1I1NA 4G25A 4NNOA 3KR9A 2BBSA 2CDCA 2FWAA 4H18A 1NSTA 1GGJA 1W85A 1WABA 4KAXA 2GUWA 5D5PA 5CLFA 3H16A 4O0LA 1DV2A 5J4LA 4M88A 3PFWO 2ZI5A 1PJSA 3UV3A 2PQ0A 4MUXA 4D9KA 4JBWA 2Z6AA 4GBED 2CL6X 3BN3A 3MOIA 4FGSA 4Z51A 3ZZ1A 3AYZB 2GSWA 3DL7A 2P75A 3AF2A 3G89A 4N3CA 2QIOA 5KMGA 1R6DA 4CKWB 2Z8ZA 3D43A 2P4HX 2XBLA 3HJEA 1WEKA 5CBKA 4BLQA 1E3LA 4G85A 2AG6A 4ZOQI 5JCJA 3RADC 3HWSA 5KT2A 4GPZA 1X9SA 1T4CB 2HPAA 2GS9A 4RTRA 2XA9A 2XVZA 2ODWA 4TWBA 1D0VA 4RQ3A 5EJFA 2FJUA 1OB2A 1XVLA 3EG5A 3WHLA 3DR3A 4DZTA 3RPEA 5ECYA 2X22A 1SCBA 4BB6A 1ADGA 4AWXA 4X1IB 3EBPA 5JNWA 2JLUA 5K3FA 4UPEA 3GYBA 2O3TA 4Q19A 3BWYA 4HPXB 2R7AA 4MGKR 3HB4X 5EZYF 5EIFA 1O58A 3P4XA 3HGTA 4YGXB 4GP9A 3V1LA 2HA7A 1AXEA 1TC1A 2WKSA 1LNZA 4INZA 1JR2A 5BYJA 3FIJA 1XAJA 2ZWPA 4YAKA 2ZWAA 2XE4A 4E4YA 3DFMA 2AMVA 4G1CA 1OR8A 3GPDG 3AN1A 2PFPA 3UAGA 4AX8A 3KSBC 3PFNA 1VCOA 1YL5A 2Y9MB 4QHTA 3THRA 4N7RA 2I7XA 1BCRB 1KQNA 3CTPA 4MCHA 4ZV7A 1H5QA 4CG2A 5FJIA 1VZ3A 1F48A 3JQ7B 2HGZA 1TU0A 1ZQKA 3ACCA 5G1OA 5H70A 2GYVA 3I58A 4IIFA 2QRUA 1FVFA 2EJWA 1F0MA 2Q9UA 3V34A 1ORDA 4BNWA 1VDZA 2NU7A 3FYUC 1E9FA 3IDOA 4ZI3A 2C96A 1U0TA 4NAVA 4TVBA 4GO1A 5IJ9A 1HNWB 4IPTA 2W8BB 3UK7A 2JAXA 1VLHA 4RQTA 3X1XA 5AK0A 3VVMA 2WWFA 1CUVA 2FI1A 2XRMA 2VC2B 1JJ7A 3T94A 2O8EB 4D81A 2CC2A 2NAPA 4IQ4A 1AHNA 5KJEA 2HK7A 3SHWA 2W2LA 3QOFA 3I39X 3EGXA 3RYHA 5LQJA 4LDZA 1PK3A 1LLDA 4BRZA 1PEAA 4NJMA 1R00A 1K89A 3PU6A 1A5BB 3KBOA 2VG8A 3UV6A 4WASA 1NXOA 4G0WA 5G53C 4ZVMA 3WIDA 2FR1A 5FBLB 1KRHA 3Q8KA 1TPZA 4ZANA 1C50A 5TS3A 1IIRA 2FG7C 3UT0A 3T5DA 1CE8A 1UEIA 1QWOA 5IRCD 4BQFA 5AHXA 2Q6TA 4FXPA 4KRYA 2ZSUA 1G60A 1NX9A 3NKLA 4M9LA 4QBKA 5BSEA 2JRLA 4I1PA 3TECE 2X5XA 5MGNA 4ENWA 4BWVA 5D5QA 4Z0NA 1U0NA 5JS1A 1C0IA 2E5SA 2G80A 3V8QA 2Z4SA 3OZUA 1IU9A 4KLJA 5ICGA 3DKVA 1X9XA 5HNKA 3WA7A 1XDBA 3LYHA 4X84A 2D3TA 1X7YB 3C6ZA 1N0WA 4HL6A 2HSZA 5F9MA 3R2JA 4NBRA 2EBWA 3RW9A 1KI9A 4ER3A 1M2OA 3VQTA 3ISDA 2QD3A 3SR6A 3CM0A 3TLEA 1U8AA 2D5BA 2I7TA 4M1OA 1KBZA 5IIJA 4UXHA 5AVJA 4CG0A 4D45A 1PBNA 2YWEA 3MBIA 1QHIA 1OVGA 1LU9A 5EWJA 4BHTA 1Q5PA 4B31A 2PMDA 3PPWA 4H6VA 2JH3A 1U7ZA 3F8TA 2PUHA 3GLFE 3TQQA 4MKHA 3ZY2A 2P5YA 1QYXA 5KFKA 3O73A 5KFYA 2KMLA 3WU2U 4DKJA 1ZQMA 2HXYA 2F8LA 1B7GO 4BWYA 3CINA 1KKXA 1DQSA 1IB6A 1NJ8A 1WXGA 2G3YA 3GJTA 2XYQA 5FXMA 3AI1A 4W82A 1OREA 3VX4A 5SICE 1Y7IA 2C4VA 5T4HA 3SZ3A 4UB3A 3F73A 3BTVA 1L8AA 4H1WA 2P91A 1I4LD 3UWOA 3EDMA 1GWNA 1GIAA 3HE3A 4TMKA 2YZGA 2XTNA 1AHHA 3TJMA 3SEZA 3M4XA 3KOYA 1SXDA 4TYNA 5J2DA 5I45A 3OPYA 1X14A 2VBIA 2JJ2D 5KG0A 4TQAA 4KN6A 5HE9A 2ZRNA 1MRZA 1B6RA 2C95A 4TLDA 5FO1A 3I5AA 2JIZA 5AHOA 4BE4A 4AJNA 4I9HA 1BEZA 1QG0A 4X3OA 1RABA 3T5LA 3JQGB 1N4DA 2YVUA 4B79A 1Q3TA 2B9EA 4R8SA 1Z07A 3C1OA 1MAWA 4NP6A 4Q7QA 1EZ1A 4MP6A 2CE7A 1S8OA 4LDPA 4D42A 5EUCA 3ED1A 3ZH2A 5K0CA 1NJYA 1NSFA 3BIFA 5FLEX 2OUKA 4LX0A 1J22A 1NMYA 2BM1A 1KAOA 3ZCQA 3PHBE 1KTVA 2FGJA 3QP9A 4CMEA 1N33B 3V8MA 2H2GA 4OIMA 2WAQF 1P1FA 1B42A 3GH1A 1IDOA 1RRPA 1TFRA 1WX1A 3PV0A 3FYTA 3DDUA 1B4DA 4UHCA 4XGIA 2IA6A 5TC4A 2QSJA 5AVOA 1VIDA 1KOFA 3KPWA 4UB6U 1KDOA 1P19A 2W4IA 2HA3A 4A0QA 3KKQA 2JGLA 1KAEA 1SUIA 4KACA 5GTHU 2YZMA 5KVQA 3U7IA 3I12A 4R3UC 1Y3FE 2IXFA 4RTOA 6REQB 5FADA 4EBFA 1I36A 5KTQA 4QZVA 4M0AA 3BEOA 2R7MA 2AX4A 1C3VA 3NGDA 4DF8A 3ZE7A 2MDTA 5DGTA 3FNQA 1D1SA 1ZFNA 2HR1A 2WWTA 2QTBA 3BHIA 3UUGA 3T3HA 5I7WA 2OXTA 3H65A 3SF0A 1E20A 1R9MA 2AJCA 4IWXA 2P5UA 1JVBA 2VDWA 1ESDA 2V8BA 3NKVA 4XQCA 5IIKA 2VRWA 4DREA 1YE8A 2BY4A 3DTYA 4P1ZA 1ZI6A 4M3NA 3X2SA 1AQIA 1FNSA 2DTEA 4M1YA 4LSMA 2RSLA 3ZGYA 2JV3A 5CITA 2HFJA 3AQEA 4B3SB 1IOLA 2EANA 3B1FA 4XYMA 4IHQA 5JCOA 2BBWA 3TG8A 3RJJA 2FW9A 3RBZA 5L6LB 4Y6PA 4ZICA 1V9SA 1ZIXA 3CUUA 1ZVJA 3RYIA 1VBFA 1OD6A 2IQ5A 4N8SA 1LK0A 3D3EA 3KPUA 2JAUA 2QX8A 2E4AA 2Q4RA 5EE1A 1QLHA 1CNMA 5EKTA 2K8BB 4LXYA 4IEEA 2BELA 1NONA 3REQB 4OYYA 3HUDA 4XYGA 4MIEA 1U0RA 1E5QA 1PO7A 4YRFA 1Z2PX 4JUIA 4OAOA 9ICQA 4GOMD 3Q8PB 4X20A 5F4ZA 1L4LA 3WWCA 2KZZA 2FMTA 3WRYA 2DPJA 4F8JA 3GFGA 4F4KA 1YFLA 1IPFA 2I9PA 4J0HA 2KM1A 3RTAA 4FR2A 5FL7D 4GEGA 2OBFA 3S44A 3TNFA 3GOHA 3ZDDA 1WCLA 2NLOA 3X0DA 1FSSA 2QMHA 1IXZA 4C01A 1OOEA 5BSWA 3A6ZA 2YZKA 2KEYA 3FX2A 5CYOA 5JXWA 4R0MA 3ZIAA 3WC4A 2C7PA 1NYRA 1X3LA 421PA 1UFVA 1YTLA 2OILA 2YTZA 3CH5A 2D4HA 2QQGA 3DEYX 4HLDA 1VMAA 3OFND 4GSKA 1R0KA 4KYUA 3PW2A 3OMXA 4RV4A 2GARA 1QQAA 4QBFA 2G5CA 4JL6A 2ADOA 4PYRA 4DMLA 4JBIA 5KB3A 4ZVTA 3KR1A 4C20A 3GEDA 4O4LF 3R5FA 4EZEA 2VFAA 3QOXA 2A5YB 3FCCA 3FMGA 3FHCB 3ORRA 1R64A 1L3SA 2ZRIA 4UCXA 4I1YA 4W5NA 1PZEA 4QG3A 2X0FA 3N0TA 2BJHA 3BSWA 4WCDA 2X8JB 4M9SA 3DDNA 2A5GA 1TMYA 1GCAA 4PHHA 4X95A 4DQDA 3F6YA 3AERA 4MQFB 1KDYA 1O94A 1H2HA 4TTPA 2ZP1A 3SX2A 5JPCA 2XXJA 1GARA 5G1NA 1LEHA 4C4XA 3WKAA 4EECA 1B6GA 4O63O 1JQLB 2VUUA 5EUBA 4RIIA 2YIDA 3ADDA 4IQVA 5KWJA 2NTEA 2P1ZA 2F64A 4KLLA 1YVDA 4O4IA 1PLKA 1AKEA 5J0YA 2A1UB 5F2EA 1H2EA 1N6LA 4DV7B 1YRQA 4KGZA 1T9AA 4WT7A 3ZE2B 4OB8A 4RDCA 4MS3A 3MHPA 2ID4A 2CDNA 5KVVA 1XD8A 1U2ZA 4BNDA 2G8NA 2OXOA 2G6TA 5IKEA 4H7EA 4ECYA 1VDMA 1H8HD 2EKDA 1FU4A 5JR3A 4WCVA 1YOVB 2QTTA 2X6TA 1OH5A 3NASA 1E2GA 4BQSA 3A11A 1ZBQA 1J21A 4ZRDA 4B7AA 1PN3A 2JLSA 5DTIA 1PKXA 4KXWA 2K89A 3OIFA 2W9MA 2IU4A 4XM1A 4MV0A 5KBYA 3ZCPA 4DRZA 5L3ZA 1QO9A 3QUTA 3HVHA 2W9BB 3SS8A 1DAGA 4K9RA 5B1YA 3VMMA 3OI7A 4L7QA 4RXMA 1PAUA 1SOMA 2V45A 2B83A 2VAVA 4OF4A 3G2MA 1WKVA 1NY5A 3F6PA 2F77X 4AYBF 4LHWA 3RHZA 2WOJA 2EV9A 2FCAA 3F71A 1LS1A 2EGGA 1X1CA 3NBMA 2H11A 1U7UA 4J3FA 1PX2A 1YZHA 4B4WA 1VJRA 4UZEA 2OOSA 3V3KA 1J1ZA 4PTYA 4XE5A 1YL7A 1C7EA 5F51A 3PZRA 3V1YA 1Q8KA 4B7CA 4RKYA 4L5CA 4KFSA 3W8FA 4MUFA 4BNVA 2B8JA 2HCFA 1RC1A 4QAQA 4KQWA 2WDZA 2XYVA 2G0AA 1R8XA 9ICSA 5JJKA 2VANA 1N57A 3QEMA 1YK1A 1OLXA 2A9FA 4EHLA 5FRDA 3DAFA 4J9UE 3N2GB 3COYA 3UHAA 4OJ6A 1T4DA 3NHRA 1TLTA 3TAXA 3ZHZA 2FEWB 5FOTA 2Y0SF 4DARA 1FYFA 3MUEA 3GLIB 3LHIA 1UZMA 3NTXA 1MO6A 1DC3A 4KI7A 2RGXA 2A86A 5JCXA 3ORHA 2KYRA 4GOLD 2ZYTX 4D26A 3VC1A 3HYNA 4U6SA 3HA3A 1FNBA 4FPXA 5CPBA 3GVXA 3RSCA 4YCXA 4AU1A 2JKZA 1BFKA 2PMZC 1NJ1A 1GNQA 3K20A 3V8NA 2CL7X 3RROA 4YQFA 3T06B 1QHGA 2JMGA 2Z8YM 3KYDA 1RU3A 1AUXA 3NANA 4M0LA 4B3XA 3QEOA 4OHRA 4Z1MD 2W0SA 3NFYA 2VZ8A 5DLYA 4RJKA 4XQ9A 1ZSNA 4YJFB 4LRSB 3OJCA 1QGAA 2H1OA 3LWMA 1WUTA 3N86A 3DUWA 3PL1A 2QTGA 3UYLA 5C8YB 3MQFA 1JWLA 5HQ3B 1SG6A 3MMZA 2B8WA 2B4TO 5EIBD 4E5PA 1UJ6A 2JB9A 1II8B 1PUXA 2CFIA 2HQOA 4N40A 5IVHA 4RSGA 1KI2A 5F1KA 4TXMA 2GVDC 3Q3CA 2I2WA 4YRGA 4QIWF 8ADHA 1EFKA 3IL2A 3P0EA 4W5JA 2DHEA 2VQDA 1COWD 2DEUA 1BXGA 3R40A 4CPDA 4FFBA 3RSQA 2WJAA 2CXPA 1YRWA 4I2IA 2E49A 1E77A 4O5EA 1ZJJA 1J2UA 3BK7A 1NNSA 2HRQA 1P75A 3EG9A 3MT9A 2RHGB 2WU8A 4ZEVA 1PT8A 1HWYA 1EP9A 1LXCA 3U26A 3DFUA 5KAPA 3SK0A 1ZUNA 1JJFA 5LWHA 4QLBA 2D59A 3BB4A 1KAQA 3GT7A 1ACLA 2CXTA 2HMTA 4FZJA 4YN3A 4ZVRA 4OJYA 3PD0A 3P9XA 2VEOA 4NV1A 3L77A 4R9SA 1QPGA 3LNTA 3KHRA 4XGNA 5DGBA 2WFLA 4D5EA 3QUCA 4ENQA 4EA7A 1C30A 5DM60 2TECE 3ILXA 4B9LA 1YQXA 4B9EA 4PHPA 5GJWC 3VDQA 4MYTA 2H3QA 4PQEA 2XUZA 2IHJA 2EJUA 3C74A 3AVUA 3KAPA 5A03A 3CWCA 1ADFA 3LOPA 1DO2A 1POWA 4OJNA 4J9VA 1EZZA 4PN7A 4XIJA 1TK8A 1Q6ZA 1XS9D 1QVRA 3VH3A 4DLEA 3AI7A 1K2WA 5AW8A 3C3KA 2FV8A 1MO3A 4GMKA 3CF2A 4EYHB 1QG4A 2D2VA 1G5HA 4E31A 4JVNA 3HBJA 3QZUA 4DBLE 2QRJA 4QDJA 5BP7A 1XZEA 4UC0A 3RSOA 4RVOA 4TMYA 5KQPA 1RWKA 1QGOA 4RD4A 2BMJA 3W2HA 4TUSA 4IRKA 1ZO8A 4KO2S 1G21A 1WMBA 2Y99A 4BIIA 1ZK2A 2BKUA 4ZOLA 4RU9A 2BEKA 4BKQA 1QS0B 1U3VA 1JTFA 3TQCA 3OZVA 1OZGA 2WHRA 5ELMA 1C9KA 3V5NA 2AGPA 4HDKB 3BXEA 4RETA 3W5BA 1PRYA 2IYRA 4Q3NA 1RI1A 3UG6A 4U6QA 4R8VA 2ZTUA 3UG7A 3TRDA 4EFLA 3DA8A 1DXOA 4QZCA 3BQ7A 5ALQA 3SI8A 5JJLA 3AEQA 2VHZA 4MZDA 3NOOA 4O4JB 5EWFA 4QWCA 4Y2RA 3WLPA 2GF0A 3DUFB 1Z06A 5AI8A 3CSUA 2HWWA 4KXNA 3LUBA 3SHOA 4IQTA 1XO0A 5DPMA 3PITA 4I4IA 4RK4A 2JCYA 1ZCAA 2QZSA 4YUWA 4M2LA 1VLBA 3NRZA 1V35A 4D0NA 4ZTBA 1RAHA 1FEZA 1XBTA 4V0MA 1OLUA 3U13A 4FFDA 4OKNA 3IPLA 1GNRA 3KE9A 3CG4A 1D7OA 3MCVA 3OQVA 5J2TF 1KQ3A 3IV9A 2AQ4A 3GY0A 3FKQA 4TLCA 3G23A 1LF5A 2WB4A 1LC3A 3ENKA 4GF5A 1E3SA 1VHLA 2XA2A 4JOQA 5FLYA 2X0IA 3CW9A 5TQ2A 2BEWA 2KBFA 1ORWA 1RM3A 3DYBA 3V9PA 2WU3A 1G8GA 1C8BA 3VTZA 4BVBA 1AKYA 3QUBA 5I7RA 1NBMA 3U0BA 1SIBE 3WHPA 1N0UA 3FROA 1ULBA 3PC2A 4ZI5A 1H0KA 4JJGA 5J2BA 1V1RA 5E9QA 1S0UA 4AY4A 1JHVA 3A32A 2VK2A 4AMVA 5JAMA 3PJGA 5LDGA 1OC2A 2E9SA 5E6RA 3UJHA 1PWHA 3SBDA 1OA1A 5HDBB 1Z7BA 1PCXA 4G1UC 10MHA 1VSTA 3K1JA 5JDIC 1L5MA 2DCMA 5KYKA 1VOTA 3ER9A 1E66A 4YJ2B 4KHPB 4KQEA 2XYHA 1EVKA 1C1DA 4AWBA 3PNLA 3MERA 5A0FA 4D4JA 1DT3A 4DV4B 1O87A 3MJDA 2GM5A 2I4IA 4Y0NA 1UWVA 3ORFA 4QAJA 4YAOA 3IR7A 1E2QA 3BSFA 1B23P 4C03A 5ALFA 1PS9A 2DQ4A 2ZULA 1TD1A 2YYAA 3SP1A 4RKFA 4F3YA 2BSXA 1Y6QA 1BXKA 2GHIA 3VTFA 3SYTA 4OJQA 3D2AA 1CG6A 5KDDA 2DUYA 5HVNA 4RK6A 3U9TA 4O3OA 1D9XA 3KK0A 1F4VA 2J6TA 1XNRB 3PA6A 5G0UA 4YHBA 4Q9LA 1F0PA 3CZ4A 2HN9A 2XB9A 4D44A 5CDUA 1RVDA 1TK5A 5CJPA 2PO5A 2L19A 1ZQDA 4FZVA 4WLVA 4YP1A 3DE6X 3H5IA 4KE9A 2EZ8A 1J0EA 2PX4A 3FJ1A 4O59O 8ICIA 3IPAA 3WGYA 4OLJA 2W71A 2IYEA 5ADWA 4R9RA 1C9EA 2AOTB 3RB4A 5J0TA 1N34B 2LKYA 3UJ7A 3ROQA 1KFBB 1JAZA 1E6LA 4IAOA 1SMKA 3I9V1 4WZAA 2EP5A 4DL7A 5KTYA 1IJEA 3U4AA 1IAQA 2EL7A 1ED1A 2Y1EA 2P6MA 2QP3A 4TS9A 5A9SA 4KN4A 1O0SA 3L6DA 3W2GA 4LHSA 4M4SA 3PWZA 4YRRA 4J1TA 5LOVF 2YW9A 4JFRA 4L73A 1EIZA 4MXDA 2C2MA 4KWCA 1NK6A 4HQ6A 4CQMD 1Z9BA 3LQ1A 4BNIA 1CRXA 4M86A 3QENA 4F5QA 1R4NB 4HXEB 3X1DA 2IP2A 2NO7A 1QQ6A 4PE5B 1GSHA 3IPYA 4EHKA 3MTDA 4R69A 3KDPA 5E7QA 2BM8A 1EQ2A 1ZGGA 3GO4A 1JQDA 1J20A 4PNEA 3DBHA 2BZ1A 3BWBA 9ICJA 4IR1A 4JLJA 1FP2A 2C5AA 2REXB 4D9GA 1UKZA 4GPD1 1XU7A 4MRMA 3V48A 1HDXA 1UQRA 1IH8A 5EQFA 4PN3A 4ND4A 1IUKA 1Y5IA 3G17A 2OAGA 2F17A 4ELUA 3EGWA 4E4TA 4MP8A 4EI7A 3UB3A 3O3MB 3V4RA 4N5IX 4FNAA 5F3DA 1EA7A 1D6NA 2C92A 4UMFA 2FP4A 3OZXA 4HQKA 3HZOA 1Z25A 5BQPA 2X14A 2IOFK 2B4YA 3Q7EA 2FOIA 5F2KA 3CLKA 2HHQA 3ROGA 2XZLA 4XWGA 4JU9A 1QF6A 4OQDA 2FMKA 4O2BA 2MRLA 2W3RA 3L84A 1MKYA 4WADA 4MMZB 3TE7A 2FWIA 1IATA 3OUUA 8ICBA 3EW7A 1EXVA 2QUKA 1OXVA 3Q8WA 1X8JA 2X77A 3MG9A 2VDMB 2Q4DA 4AS2A 1ESNA 1XU4A 4FFSA 1KPHA 5K03A 1REQA 1L5FA 1NK7A 3F1KA 3PUZA 1DXYA 2V3WA 2AUTA 3MUFA 1QHSA 3KVRA 3E27A 4GWKA 2FB9A 3VZPA 4RD1A 4GMGA 3NM6B 4IX9A 2LXNA 4YCMA 1KOGA 4ZC1A 2A9JA 2ZBPA 1KJNA 4Q9KA 4BZWA 5IKOA 2J32A 3QW4B 4PX9A 1PJAA 1FFXB 3C97A 3EVGA 2VTDA 4JWNA 1XXLA 3LWNA 4P93A 3CCCA 3IODA 3U4MA 3H40A 1E2BA 1L5VA 3X1ZA 2DFVA 3X1WA 1VPWA 3BXFA 2BGIA 5AQ1A 4BNTA 4GFJA 3M5PA 3ZBPA 4NV0A 4F71A 4KLDA 4LXTA 3HPRA 1XJ0A 5JALA 1GY8A 1YQTA 3D3JA 3FVWA 4PQFA 1IZ9A 1GG5A 3CW8X 1BNCA 4QPCA 3U19A 2CXUA 1Q6YA 3E1SA 1A8IA 3MJSA 4O2AB 4LSWA 5EINA 1YQ9A 3D0QA 3BD7A 3JAWA 3EPKA 5EZ5A 3R9XA 1VPTA 3QBEA 4NL9A 2ZBVA 3MF4A 5GOZA 5DBIA 3HJBA 3COPA 2BRUA 3JQCA 5AJWA 2G09A 2PRZA 5EXPA 3GZNA 2FWPA 3KT3A 5IVIA 4NS4A 3GIJA 4L02A 1BXRB 1I30A 1NLYA 1N9ZA 1YBMA 3TKYA 4FYJA 4PU0A 4OI4A 3LBAA 4JDPA 4ILEA 3IUJA 3EPIA 3QITA 3KZNA 4GYYA 1SG0A 1AQ6A 2NAFA 5COQA 4B73A 4OEHA 2BBTA 4B35A 1BCSA 3G6KA 5JC1A 1OVMA 2XF2A 3T99A 3FTPA 2WT8A 4LVNA 3KJNA 5KKNB 3QTLA 4QU0A 2CLLB 3WTBA 4YV0A 5F21A 3KFXA 2PLRA 2GF2A 5JZ9A 4JUFA 1GKLA 3PEFA 1NIPA 1MLDA 1GYPA 2ORYA 1JKFA 5EE3A 2PD6A 4F4ZA 1M6EX 1WVIA 4EI8A 2FWNA 1G3IA 3EVDA 4HUQA 1MV5A 4H3SA 2IYOA 4ZVVA 5FB3A 3JQFA 3HO1A 4XAQA 2BMVA 3VJMA 4L76A 2YWHA 2XWSA 4C7YA 4CL8A 4ITRC 1N78A 3PNOA 4UCQA 4I9FA 4PL1A 1SR8A 2PG3A 2VP2A 1FP6A 3LW8A 2ST1A 3MJFA 3LBIA 3IEVA 3ETGA 3ZWAA 4RQ7A 2C4NA 2PRIA 3CLUD 2A3RA 3JD0A 4RE5A 3UKJA 2R86A 4YD1A 1ST2A 5F7OA 2A9PA 4XGRA 4DA6A 4YLYA 2BL4A 1N63A 4I8XA 4C0SA 2BMDA 3FDXA 3ZU2A 1LW6E 1F14A 1SB9A 4C29A 2FVXA 4HEA6 4JEMA 8ICWA 1UBNA 2ZBEA 2FRXA 2BKVA 3SV3A 2V7TA 3KL4A 4XWAA 2GN6A 4LJ8A 4EPXA 2OZVA 2A33A 3VR3D 3X3HA 2GVZC 1WE2A 3HXLA 2IBMA 4I55B 4LE1A 3G9UA 1U0HC 1I2CA 2GRAA 2B21A 1RM5A 3S2ZA 4K9DA 2QUBA 3ZNNA 1AG9A 3IAXA 1NVEA 2K5UA 4WKOA 5K0TA 4OOEA 4M7OA 5EA2A 1R2QA 2Q1XA 1WSAA 1CB0A 4CQJA 1GXSB 1X2BA 1J2NA 3ZHSA 2KB0A 2A1JA 1GILA 1K8QA 1P0IA 3HCOA 2NRZA 4S35A 1KOJA 3EFOA 4IJ5A 2UZ4A 4WOKA 3C8HA 5DM2A 3C28A 3IIEA 1YFJA 3I6YA 4AJ1A 4FS2A 4W6ZA 4HNGA 1IN8A 4JP3A 4CFZA 1NA5A 3IDQA 5B6PA 2XODA 8ABPA 4D4HA 5H9WA 2DGZA 1V7QA 1EESA 2JLVA 1S8AA 5AIAA 1JR4A 1X19A 1QV6A 4A1OA 3M5WA 1EZ4A 2WB1F 1XWLA 4EM6A 3PQDA 2YQZA 4FFMA 5BR4A 1UBGA 4GI3A 3TADA 1FTYA 2GEFA 3I23A 1QG6A 3N5CA 1VBKA 4HSEA 4BB0A 3H6GA 4B75A 1NZDA 2WJWA 2SKCA 2J4FA 4FM9A 4UHFA 2FX2A 2O2EA