2F8LA

Crystal structure of a putative class i s-adenosylmethionine-dependent methyltransferase (lmo1582) from listeria monocytogenes at 2.20 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
323
Chain Sequence
ANEATQELFQVLDNTAIILQNELEISYLEAVYETGENLFQKEVLQKEEKQLKLQASYESIELENFSNEEIRKGLQLALLKGMKHGIQVNHQMTPDSIGFIVAYLLEKVIQKKKNVSILDPACGTANLLTTVINQLELKGDVDVHASGVDVDDLLISLALVGADLQRQKMTLLHQDGLANLLVDPVDVVISDLPVGYYPDDENAKTFELCREEGHSFAHFLFIEQGMRYTKPGGYLFFLVPDAMFGTSDFAKVDKFIKKNGHIEGIIKLPETLFKSQARKSILILEKADVDVKPPKEVLLANLSSLTDPSVTAPILAEIENWFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (16411011) from Listeria monocytogenes LI2 at 2.20 A resolution
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords hypothetical protein lmo1582
total genus 113
structure length 323
sequence length 328
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.470 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f8lA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2f8lA02
5F2NA 1VLMA 1YB2A 5HZMA 1WG8A 3DTNA 4RVHA 3SGLA 2PT6A 3EPPA 3NW9A 3GRYA 3K0BA 1SUSA 2BR5A 2AOUA 5EHGA 4M37A 2PXXA 5GP1A 1T43A 4BY9E 3S68A 3EEYA 5CD1A 1WS6A 2QE6A 3HCBA 3A7DA 4PYKA 1IY9A 1RI2A 2N47A 2I6GA 3MGGA 1XJ5A 4GEKA 5HIMA 4YMGA 5LQJA 4DCGA 5DLYA 2OO3A 3MERA 3SMQA 4QTTB 3X0DA 2ZCJA 4YUXA 4HSGA 3PX3A 3E7PA 5KS2A 2HMYB 5CIYA 2PWYA 3A25A 3ME5A 3UFBA 3TPZA 3CC8A 5K01A 3QV2A 4YMHA 5ICCA 1QANA 5K09A 3A27A 3OZTA 3T7RA 4ZTBA 2R3SA 3LSTA 3FZGA 4CWAA 3G2OA 5MHTA 2G70A 3LPMA 3P97A 2PX5A 5BW4A 1XVAA 2ZBRA 2PJDA 3KQSA 3SSNA 3T7TA 5BW5A 1SG9A 2O57A 3PFHA 3BKWA 2VDUE 2PKWA 1NKVA 3LDFA 4C05A 1O9HA 2YXDA 3DP7A 3HA5A 5DM1A 1QAQA 4FZVA 3CBGA 4X41A 5HIKA 1BKYA 2QRVA 2ZWAA 3KU1A 1NW6A 3KPYA 3P2EA 3EVAA 4FS8A 4MQ4A 5DM0A 5HEKA 2AN5A 1R8XA 1ZG3A 3ELUA 2GH1A 4RVFA 5HILA 1N2XA 3NWEA 2AOXA 3G5LA 4CTJA 5K0NA 5E9JA 3RODA 4ER0A 5T64A 3LBYA 4PCLA 3GRVA 3ER9A 4OX9Y 3C3YA 3FYDA 1L9KA 3M70A 3G2QA 5HIIA 1ZQ9A 3BGIA 1P1BA 4GF5A 4BP1A 3TFWA 2O07A 2ONZA 3EVGA 3GIWA 4G56A 2BR4A 4PYJA 3PS9A 5T6BA 1VIDA 3LHDA 4ISCA 5EKUA 3DXZA 2HV9A 3BXOA 5EMKA 5ICEA 4BLVA 5GOZA 4K6MA 4E31A 2YTZA 4MWZA 5HFJA 3KPVA 1HNNA 3U81A 4R8RA 1KYWA 3FPHA 3KPWA 3LDGA 3LGAA 3M6VA 1JSZA 1SQFA 4MIKA 4PYNA 5C1IA 4C03A 2JH9A 3OFKA 1RJGA 9MHTA 1X1CA 4F84A 2IH5A 4PYLA 5LR6A 5CCXA 4R6WA 2Z6QA 2UZ4A 5EG5A 2P40A 3FPEA 2DULA 2B2CA 3QOXA 3GCZA 5JR3A 3I53A 7MHTA 4KDCA 3CJQA 3EVBA 3DMHA 4YUWA 1WXWA 10MHA 3AWIA 5K05A 1KPIA 5GINE 2QM3A 3M33A 1PRYA 3NVMB 4AZWA 4GOMD 5BP7A 3BWMA 5E1OA 5K0BA 1YFLA 3OPNA 1ZGJA 1JQDA 4GOOD 5DTRA 1EQAA 3MB5A 3O4FA 4QDJA 2P1DA 3FPFA 4QQNA 1XTPA 4RWZA 4RYLA 2UYCA 4DQ0A 3HP7A 3CGGA 1JTEA 2AOVA 4KVZA 5DM2A 3BKXA 3E8SA 4QQKA 3GO4A 5FADA 3EVDA 5EOVA 5KQRA 5DWQA 4PNEA 3KHKA 4ER6A 5DTQA 4EKIA 3G89A 4DA4A 4HC4A 4U7TB 4AZVA 3B5IA 2E5WA 1MHTA 4DKJA 2ADMA 3F4KA 4RV9A 4C08A 2BZGA 3KR9A 4FT4A 5DT2A 5GM2A 5K0FA 3FTDA 4BLWA 5E9QA 1AV6A 1I1NA 1G38A 5EGSA 2HTEA 1XCJA 2HNKA 3M4XA 5E1BA 1SQGA 2ZIFA 2KW5A 3UJCA 4YUYA 3JWGA 3THSA 5CM2Z 3MHTA 4RTMA 5KVAA 5ICFA 2ZBQA 2ZVJA 3LECA 4KRGA 4CKBA 4IWNA 4CKCA 1M0EA 2K4MA 4PYMA 3HTXA 2YXEA 3GJYA 4FT2A 4EMSA 2ZIGA 1KR5A 2H1RA 4QPPA 4XCXA 4E70A 1M6EX 3DOUA 3UJ7A 1VBFA 2B3TA 3EVFA 1BOOA 2I7CA 5D1NA 3NDJA 3TRKA 1R00A 1R74A 1WY7A 3AY0A 4FSXA 4PYIA 1JTFA 1SKMA 3DXXA 3BGVA 4LG1A 1I4WA 3AJDA 4YUZA 3BWCA 2XBMA 1AQIA 4POOA 4BP3A 4F85A 3THRA 3I9FA 3D2LA 3HCFA 2JJQA 2WA2A 3BUSA 3KQTA 3SXJA 2P7HA 4DZRA 3EVEA 5EZQA 2IPXA 3LKDA 3VC2A 4CKEA 2PXCA 2C7OA 2PV0A 1XDUA 3HCEA 3P2IA 1ZKDA 2Y1WA 1B42A 5E9WA 4KDRA 2AOWA 4XUDA 1P1CA 3FUXA 3SX0A 1JG1A 3ER8A 2I62A 2ZWVA 4L7VA 2ESRA 3EVCA 2P35A 2NNWB 5EQJB 1TW3A 5CVDA 3OU7A 5EZSA 4YUVA 4WVLA 3PB3A 1NV8A 3FPGA 4OQEA 4OBWA 4R6XA 5C9ZA 3KQWA 1EG2A 2VDWA 3CCFA 3FRHA 3R6TA 4ER7A 4RTKA 3REOA 3KKZA 1QYRA 3T0IA 2OY0A 3KQOA 3MCTA 4X60A 2GAFA 2O05A 2QRVB 3A7EA 3BWYA 1FP1D 3KR1A 1ZGAA 5CUQA 4Z2YA 3UJ6A 1Q0TA 2G71A 2FK7A 1VQ1A 3IHTA 4DCMA 2ZZKA 3GWZA 4DF3A 3OE4A 2R6ZA 1X1DA 4RTJA 2O06A 3QOWA 4A6DA 1O54A 3E23A 4QTUB 4XUCA 3G8AA 4GUAA 5F2OA 3BZBA 3C0KA 4IV0A 4HG2A 4RTNA 1RI4A 2YQZA 4Y30A 1JQEA 2NXNA 2P8JA 1QZZA 3FUTA 3KQVA 3LX6A 4PGHA 3SM3A 4PYOA 5KQSA 2P41A 4PGGA 4UOEA 5GM1A 1D2GA 2CKDA 3MTIA 2PXAA 1YF3A 1DUSA 2HWKA 3DLCA 5G02A 2IH2A 5CVEA 4FP9A 5DPMA 5LQUA 2ZTHA 5DRYA 5IH3A 2H11A 2O0LA 3OU2A 1F38A 4A6EA 1X1BA 4IKPA 2VP3A 4XUEA 1XCLA 1NV9A 4QVGA 2G8NA 3MCZA 3ELWA 2ZFUA 3UZUA 3TQSA 1AQJA 1JG2A 1RI1A 2PBFA 1VP3A 2GA9A 4C04A 5EKXA 1WXXA 3GRUA 2CL5A 2DPMA 2FPOA 4GC9A 2OXTA 1UFKA 3KPUA 1NW5A 5FA5A 5EIWA 5EMJA 4NECA 4X61A 4KW7A 5KYGA 4RTPA 5ERGB 3LCCA 1U2ZA 2GPYA 4E2YA 2ONYA 1G6Q1 2PT9A 1JG4A 2H00A 5HIJA 3P71T 1EAMA 2AVDA 2IDKA 3HVKA 1XDZA 1MJFA 3LL7A 3O31A 5EPEA 4FR0A 2IBSA 2AOTA 3SR4A 4C06A 4P7KA 4QPNA 2JH8A 2AN3A 2AVNA 4AX8A 2XYQA 5DX8A 3H2BA 5HOQA 2IFTA 2OYRA 2ZBPA 5E8JA 5EIFA 2XVAA 3K6RA 1UWVA 3DLIA 3A4TA 2PSSA 3LCUA 3KR2A 2ZULA 1QAMA 2BM8A 4V0RA 5GIOE 3A26A 5EEGA 3MAGA 3FUVA 4X63A 1BC5A 1YFJA 3AXTA 3V97A 4JXJA 1PJZA 4RTQA 2IBTA 3WSTA 1FBNA 1JSXA 2JHPA 2IP2A 3KQQA 1Z3CA 5CVUA 3HVIA 5K0EA 3M6UA 3BT7A 2AOTB 1NE2A 2FHPA 2ZZMA 4RVGA 2PGXA 3P8ZA 3B7PA 3PT9A 2EG5A 4HTFA 2CMGA 3SSOA 2P7IA 1NBIA 3RW9A 3B3JA 4PINA 2FK8A 1EJ6A 2CWWA 4GOLD 4PIPA 4HGZA 2YXLA 1SVUA 2BR3A 3NDIA 3JWHA 3NJRA 3C6KA 5M5BA 3AXSA 2CMHA 1P39A 2B9EA 4RX1A 4X1OA 2Z6AA 4CTKA 1N7IA 5DM4A 1RJFA 2C7PA 3OU6A 1IM8A 5FTWA 4M38A 2OB2A 2G1PA 1YUBA 1KHHA 3MQ2A 3SVZA 5JUWA 2IGTA 3TMAA 5LQNA 3EVZA 2JG3A 1FPQA 3R24A 4H0NA 5P8WA 3FTFA 3PFGA 4MTLA 3NMUF 1D2CA 3UBTA 2ORED 2V7EA 2NP7A 2AS0A 2FYTA 3DMFA 2ZZNA 5FWDA 4PIMA 5K0GA 1OR8A 4AUKA 4C4AA 3C3PA 5E1DA 4RTSA 2AN4A 1YZ3A 3OFJA 4E2WA 4RTLA 3UJBA 1V39A 3P9KA 3DMGA 1AF7A 1M6YA 1UIRA 3FUUA 4EKGA 3JWJA 2WA1A 2WK1A 1DL5A 4OA8A 3HNRA 3NTVA 4HH4A 3UJDA 3G2PA 4CXMA 1FP2A 3EMDA 2GLUA 2OBFA 3I64A 3IV6A 4P7JA 4PCAA 2FCAA 3OCJA 5FWAA 1O9GA 3CKKA 3TKYA 3M6WA 4E33A 1NT2A 4QVKA 3CVOA 2AOUB 5E1MA 3CJTA 2UYQA 3LBFA 4GBED 1G8SA 4IV8A 3TM5A 3TOSA 1NBHA 4DMGA 3PLAE 3DH0A 2I9KA 4GOND 1RJDA 2IDJA 4OBXA 4YV2A 3EGEA 3NVKI 3C6MA 4RSRA 3R9XB 3B3GA 5FQNA 1ORIA 3TR6A 1JQ3A 1NW8A 2ZIEA 2Q41A 5FQOA 4R8SA 5DXJA 2C7RA 4F86A 5CVJA 3LDUA 2IH4A 5C0OE 3OZRA 4OQDA 1RJEA 4P7FA 1BHJA 2XVMA 2QYOA 3G5TA 3GU3A 5EC8A 1JG3A 2UYHA 1X1AA 4HGYA 1G8AA 2OPBA 5T67A 4FSDA 5GWXA 1X19A 2JHAA 3B89A 1VP9A 4M7RA 2AZTA 2BM9A 2EJUA 2F8LA 3ELDA 2G72A 3G2MA 3UA4A 5K03A 2NXEA 5DRTA 2PX8A 4OA5A 4GQBA 3IYLW 4RVDA 5K8VA 1R6AA 5LQKA 3KR0A 3HEMA 1KPHA 2EJTA 4YV0A 4KIGA 3EMBA 1INLA 2QY6A 1DCTA 4E32A 3DUWA 4PONA 2YR0A 3G7UA 1NW3A 4AZTA 3HVHA 3R0QA 3R3HA 3PVCA 3KPJA 1FJXA 3PX2A 2EFJA 3UJ9A 1HMYA 1G60A 3P2KA 5FHQA 1I9GA 4DM3A 5DTMA 1KYZA 3JWIA 3DR5A 4E2XA 1N7JA 1IXKA 3HVJA 1Q0SA 2OKCA 1RI5A 3HA7A 4ER5A 2PX2A 3MTEA 3BWBA 3FTCA 5EMLA 3VC1A 1L3IA 5EVJA 3GXOA 5BXYA 3ANXA 3FUWA 4LWOA 4P58A 3O7WA 3DULA 3HCCA 1NW7A 2JHCA 5E2BA 4E30A 2BH2A 4PYQA 5FHRA 3P9NA 2FRXA 3M6XA 2HR1A 5D1HA 2B78A 2OB1A 1G55A 2UYOA 5LSAA 3DXYA 2GS9A 3HCDA 3KQYA 2V74B 4RTRA 1VL5A 2P3LA 2Y1XA 2ZW9A 3I58A 1ORHA 4FGZA 5K0JA 2NP6A 1L3CA 5E2AA 5FUBA 2YUIA 3FPJA 3TKAA 1F3LA 1L1EA 2YX1A 1WZNA 4KWCA 2ZSUA 3RIEA 4C07A 5F2KA 2YVLA 3P9IA 5FULA 2VS1A 3IEIA 3VYWA 5IKMA 4KIFA 3KQMA 5DXAA 5LQCA 1EIZA 4YV1A 5CVVA 2IIPA 3L8DA 3OE5A 1XDSA 1YZHA 4LWPA 1VPTA 3KQPA 3B3FA 1QAOA 1SUIA 3HCAA 1VE3A 3Q7EA 5B1SA 2VDVE 4HTFB 1Y8CA 4BLUA 1KIAA 3HM2A 2AR0A 3NWBA 1D2HA 3GRRA 3GGDA 2PY6A 2LD4A 4Y2HA 3EGVA 2XYRA 3GDHA 3I5UA 3TLJA 4M36A 3TM4A 5EEHA 3UJAA 5K0LA 5FCDA 4ER3A 5DSTA 4EK9A 3GNLA 2VZ9A 3LCVB 4AZSA 3EGIA 2ERCA 3T7SA 4B17A 2PWPA 2OZVA 1RI3A 3ID6C 2NYUA 4E2ZA 3SSMA 5ICGA 3PTAA 1L3BA 2ZLBA 4QDKA 1TPYA 4V0QA 4R05A 8MHTA 3E05A 2C7QA 2P3OA 3UA3A 2NXCA 1XXLA 3HA3A 4GC5A 5EMMA 3FRIA 3V8VA 4EVIA 3ELYA 3LKZA 4MHTA 4PWYA 5LQRA 3EEOA 1KXZA 2EX4A 4O29A 4U7PB 4WXHA 4RTOA 4P7GA 5DX0A 3FTEA 2PLWA 2P3QA 3G8BA 1KP9A 4LECA 2NXJA 5DSXA 3VSEA 2B25A 3BGDA 4HRAA 5K0CA 1JR4A 5DX1A 5EHIA 4ATNA 3ORHA 3ERCA 3G88A 5FA8A 3FYCA 5E8RA 1ZHFA 1EJ0A 2A14A 1KPGA 3OZSA 2PX4A 3UWPA 1R8YA 1TW2A 4EQZA 1H1DA 5GIPE 3Q87B 5LQAA 5U4XA 3P9CA 1P91A 5H02A 2PVCA 1R18A 3UJ8A 2XYVA 3GRZA 3CJRA 5CCBA 2Z6UA 2GB4A
chains in the Genus database with same CATH superfamily
3BF8A 1CP2A 2FEPA 3AHIA 5K6AA 4GWKA 4MRSA 5DHAA 2G6BA 3PRJA 4UC0A 5I6DA 5LYJB 1LKYA 5EJFA 3VRHA 3PDJA 1RT9A 4OUKX 1P8JA 4G4JA 3KV3O 3VZRA 3W2EA 2HOQA 1J4AA 4BFYA 2XMPA 5CDTA 1O0CA 4OHBA 3B9BA 1SZPA 4RY9A 4M0DA 5J2UB 2PFNA 3AFGA 2WQZA 3EA4A 5F4ZA 1HE4A 5TQVA 4FWTA 4LF9B 2IY9A 1B14A 3CC8A 2JF0A 4GI1A 3T1VA 4C14A 1KMHA 2O1SA 2PWZA 3DL4A 4HPWA 3DFKA 4OAQA 3BJMA 3EULA 2KOBA 3G9UA 1F2TA 4K6HA 5JOQA 2XGJA 1YONA 1DKPA 1Y89A 4A15A 3T1NA 2Z2JA 3QF7A 4G07A 4AZ3A 3CLTD 2Y1IA 1CUBA 2PVSA 3KQSA 3KLNA 4LS3A 2BKXA 2DAPA 4N3AA 4DCOA 1IY2A 4O2AF 1X9HA 1U63A 4J9PA 2ZKIA 1NI4A 4TV8A 3BKWA 5K99A 4ZXPA 3L5OA 3IVXA 3CBGA 2IYYA 5L3QB 2XMGA 3VV3A 2ZWAA 4QYIB 1SIUA 3MF4A 4BNIA 1VSUA 4MQ4A 2QP4A 1JG6A 2RBKA 3JYNA 4IICA 4ARAA 2B1IA 4C2TA 1ATZA 1LB2B 1N2XA 1TI7A 1NRWA 4DQQA 4MVCA 4IQTA 2D5LA 2GD2A 3BA1A 1PHPA 1M73E 1XVTA 3L7YA 3IH5A 2XRYA 3NFYA 2AMJA 3N3BC 2CDNA 3PXBA 1NHWA 1P74A 1TYDE 3TIXB 4YT8A 1JHPA 3DTVD 4MUKA 2QSUA 3R3YA 1XMPA 2AUTA 4HVAA 4QUHA 4D8UA 4F9GA 5A4AA 1BCSA 2AGOA 3U4HA 4ECWA 1TJ5A 1B00A 1SXJE 1NOJA 2I2BA 4KXLA 1WKCA 4P5DA 1KNQA 2NACA 2LXNA 2QUAA 4ZIRB 2NTJA 1MHPA 3UT0A 1HF3A 1P4GA 3S40A 2C7GA 2P9YA 4C2UA 1OYOA 4J76A 4LEIA 1NI4B 4I5GA 3FPHA 4JB3A 3LDGA 3LGAA 4MWOA 1SQFA 3GZNA 5B7GA 1NYTA 3OFKA 1B1AA 1DAGA 3PSPA 2FG5A 2QX9A 2VAMA 1RYSA 1DWPA 2P9FA 3CH4B 3HP4A 2ORVA 4JLBA 1MA3A 3C24A 4NOLA 3T9AA 3WOHA 6ADHA 2NV6A 4KFSA 2QYHA 1R6UA 5AOAA 7MHTA 3DHVA 3D8NA 3NOOA 1RZVA 1UJMA 2CVZA 5CW2A 3TCKA 1J39A 1L7BA 2AHRA 3GYBA 4ETNA 5IW8A 1PRYA 4F92B 1IYZA 1VDMA 1YU6A 2VF4X 2A1UA 5IKOA 3D4NA 3CV3A 7REQA 3RR7A 1R4NA 1W75A 1YZLA 5E1OA 4NLCA 2G63A 3GEBA 3GD5A 5EP3A 2JARA 3I8SA 4YY3B 2VK4A 1XWWA 5EY5B 1PJ4A 1J7KA 2RHFA 4TMYA 2M6LA 5CITA 1KYQA 3ED1A 1HO3A 2GPWA 5JNVA 4F4FA 2RGNA 3ISJA 4YMOA 3IMKA 4GPD1 2OKGA 3QPAA 1XRPA 5JJ5A 4PLWA 5IXYA 4XGIA 1B2LA 2M32A 2ZVDA 3WWPA 2X23A 5DTQA 1DJQA 3S44A 5BSHA 5LP6B 4WESA 5EJ5A 2FPIA 2O6KA 2PUVA 1JMYA 2QTLA 4D4KA 4IIYA 1QIIA 5FOWA 4FS1A 4RV9A 4BB9A 5G3YA 4YXFA 1ZONA 2YJZA 1O8BA 2QAGC 4OVKA 3G1WA 2GVZC 4FQ5A 3FZQA 4ZI3A 2NT4A 2R4TA 1NM5A 1QDEA 3THSA 1O0BA 3HY3A 5KVAA 1V3UA 2CNKA 3VR0A 2DPJA 1OGYA 2HBKA 1GU7A 4YN4A 2OLEA 4R0NA 3ZZ1A 2EAPA 1NBWB 2POCA 4RK5A 4GE3A 3TXYA 4RNDB 1CF4A 5LXTA 1JU4A 1NIJA 1QNLA 4PYMA 5EL0A 3HTXA 2VP4A 1AZWA 1JA9A 2HJ9A 3GK3A 4L6AA 1N2JA 2JGLA 3NYIA 4DQXA 4C21A 3AQIA 4DTIA 3OQIB 2JPDA 2OOKA 1Z9BA 2QTVB 3WGJA 2I7CA 1L7PA 4AJKA 1R74A 4RPKA 4JMPA 1PJQA 5K0TA 4M1SA 5B1YA 1DOQA 1KY5A 5JAPA 4V02A 2NO0A 3X1XA 1UWKA 4AYXA 1L7NA 2C2EA 4BGDA 4F4XA 4W7IA 3U7JA 1H8HD 2A5GA 2VNAA 2GEDA 4IILA 4V0MA 3SLRA 4OOFA 5AR1A 3TB4A 3WYDA 3HN7A 2CUKA 3B8HA 3LT5A 4TL8A 1JG1A 3UMVA 3NLLA 2B82A 4HDQB 4YR3A 2JA2A 2QRKA 5EQJB 5C34B 2Q1UA 2HCBA 3N7UA 4WZBA 1D6NA 1XNQB 3HMQA 2VH5R 1QK4A 1T6YA 6REQA 1M75A 1EFRA 1PJSA 2EERA 2KS6A 2YJGA 4O3FA 4EYIB 5MN4A 1UFVA 4RHUA 2YJ3A 3NB0A 2QZSA 3M34A 2WVHA 2VTKA 4MYDA 3GQBA 3CW2A 3HDHA 2ZUVA 1HXHA 4LGYA 1T5HX 4D42A 4F8JA 1B2RA 3WYFA 4ND1A 4MI6A 2P90A 3VHXB 3DL0A 4X60A 1MU0A 3FYHA 2UU9B 3AHHA 2W37A 2PGIA 3BWYA 4HNTA 1R9NA 2SECE 3VPXA 2COUA 5KYYB 1ULUA 3GWZA 2G1UA 4TSKA 1SD1A 1OI3A 4BRZA 4E15A 2D2EA 5KG0A 1JHZA 1IRIA 2E1PA 2RCNA 3TOXA 4XWKA 3TNDA 3DE2X 1CFZA 4LKRA 4TWJA 3ZDYB 2M9NA 1XWIA 1ZZEA 1Z6PA 3M81A 2JH1A 2R8EA 1K3UB 2VYFA 4G97A 1ODIA 2JFUA 2MTBA 3GFVA 4KIWA 1FP4B 2JGNA 3AJAA 1GADO 4Q02A 1OXJA 4F5PA 9GPBA 3O8LA 2GCIA 1U7XA 4TM8A 2PKRA 4ZO4A 3ED5A 1F60A 1UZUA 4GT1A 2V97A 4PZEA 5DMXA 3RFXA 1YJCA 1UJ4A 3I23A 2XCQA 3NBZC 4Q7KA 2BKUA 2C4UA 3I8OA 1DBWA 3IP4B 2NV3A 1J6UA 5C1PA 4JYAB 1SU6A 1I6WA 2XITA 2HUPA 5JWHA 1IQUA 1IOVA 1C0KA 3U37A 4YR9A 3D9QX 1OPRA 2MRLA 5KNDH 5HF6A 1OAOC 3NTQA 5CMLA 2P5UA 3FJYA 4OHRA 3RRJA 1MH9A 1VE9A 3GVHA 3KEGA 2AE1A 4X44A 1C30A 4NYMR 4UCWA 2P2GA 2IOFK 3P1JA 1UBUS 4EEXA 3ZDBA 1PGOA 4UTNA 1DJPA 1CDOA 1R4NB 2GVDC 2BGIA 1FUYB 2BQ3A 5GVRA 1G6Q1 2ORWA 2D2FA 4RHTA 4XPIB 1EAMA 2AVDA 2ZVQX 4DBLE 3WGMA 4DTCA 4FR0A 1N5LA 3SR4A 2QG6A 4CEJA 2AHOB 4QVIA 3NOQA 1VJ5A 4DV4B 1I30A 1RU3A 5FOSA 4EG1A 4XQGA 4KQCA 3E2PA 5K4AA 2X5OA 1PFYA 3ND6A 3M8SA 4RXTA 3ASUA 4IGIA 2ZBPA 4ND3A 4XX1A 3K6RA 1L7QA 2BYTA 2WV7A 1YS4A 1KOFA 1ENOA 2GD1O 3HI6A 4I46A 5KFRA 3UFXB 4ERXA 5KFNA 1L8LA 4BBPA 3QUSA 1KE2A 1T9CA 1PKXA 2QYSA 2XUGA 2LW7A 3Q41A 4OQMA 4TL9A 3RUAA 2GKSA 2QX4A 3T6KA 3SZGA 5JI3E 5H7XA 5J2JA 1T0UA 1C9NA 1CR2A 2OXCA 3ILVA 2AOTB 3CLHA 4DF4A 1TVKB 4ASUD 3KUUA 2YINC 3OY2A 4HNAB 1PZEA 2HIAA 1WSWA 5M04A 3NGLA 1BCSB 9ICSA 3A9RA 5H81A 4V0NA 1QHEA 3BIJA 4G5RA 2Q0SA 3WNDA 3TFOA 3DPIA 4B3MB 4L08A 3DOJA 4ND4A 1H94A 4G36A 1E1RD 2D13A 4H7PA 5CDGA 1ILEA 3FVTA 3H5TA 4RJLA 1ZYQA 3F4BA 4CTKA 2I87A 3WYCA 1U6IA 3FPAA 3T5DA 3RO7A 5HHHA 1R8JA 4P9NA 2WICA 4GVPA 4OHXA 3CXRA 4I1IA 4G1VA 5TMBA 1F17A 1ADYA 3WDLA 2VUSA 3ZDQA 3TMAA 2Z5LA 3ISDA 2LUOA 2QTGA 1CUYA 4EUFA 5L3QA 4OHUA 5IKXA 5FBLB 2EJWA 4Q7JB 4RS3A 5EMHA 3VGPA 1ZQGA 1NVKA 1Q14A 3IO5A 3R7BA 1HE3A 2AFIA 2V7EA 5H8WA 2WJZB 3W4KA 4PHHA 1DKMA 2AYZA 4R2MA 5EJMA 5LLSA 4DBZA 2G9QA 4Y7CA 1IHPA 4ZOQI 4YAUA 1CY4A 2YQ4A 2A9QA 1SCDA 5HRUA 4GYJA 5DP2A 4KH0A 4HH3C 1U9JA 5AK5A 2RHOA 3W8DA 1PQWA 2QR3A 1PG0A 2VPIA 1Q3VA 3MWEA 1JE1A 4WXRA 2D1YA 4NNPA 4EJFA 3L4KA 3ZI7A 2IUFA 4ZYVA 1HDCA 2C5HA 3C7AA 3U44B 1EFPB 1EINA 4OFXA 4W5HA 2JGAA 1RHQA 1SVMA 5I7AA 3ZE0B 4KMOA 3A1NA 4O4JB 4O59O 2EIXA 1V16A 4P7JA 2HXSA 1DADA 2IVFA 2R97A 1LSUA 1LS1A 3OG9A 4GM1A 1N92A 3CTPA 4TUYA 1EXWA 3LJKA 4HSEA 3T7JA 3U7GA 5JD3A 5JNTA 1XEFA 1TLTA 5J0WA 2PUTA 1AS3A 4FDVA 4U1RA 4JI6B 4ETWA 1C0IA 3I1YA 3A6JA 1F2DA 3MRXA 3J81k 3KWMA 4DG5A 4P93A 1S2MA 1U0GA 8ICSA 3MMPA 2YVKA 1Z0JA 4INPA 1K9VF 2X5XA 3FSJX 4ON9A 2WINI 1OASA 2P67A 2LPMA 3UXPA 4RQ1A 4IKOA 2EWWA 1SBNE 4CL8A 1CE8B 3I1JA 4G5SA 4BNTA 4FZRA 2RHGB 2VTEA 4GC6A 4KFUA 3HO6A 4XVHA 3VU0A 1UJ6A 3JAWB 5L7YA 1GRNA 3Q9LA 3G6XA 2LCQA 4QXAA 4TV9F 2WFMA 4BNLA 4RKYA 4PSUA 2XV1A 1G8JA 1XJCA 2JHAA 2WABA 3DVSX 521PA 1T3HA 3B1KA 1N36B 2Q5IA 2FMIA 2G72A 1XJ0A 1XV5A 2XR1A 3PC2A 2VSYA 5ER6A 5JTIA 1WBJB 3WDSA 4AY4A 4F4JA 4J9OA 1GPYA 4QAJA 2WJGA 2R65A 1LV7A 3EQ9A 4WXMA 1FA9A 1OI7A 3L8HA 3U31A 4QOJA 5KWSA 2QBYB 1P45A 4ZOLA 4K9DA 1L3VA 4C8NA 4XLLA 3KKMA 3HU2A 4KLCA 4EI9A 2X3YA 3H7IA 4WMLA 3PCRB 4HO1X 5IBPA 3T0GA 1QYIA 2IYTA 3E1SA 1RRMA 4FYWA 1WUDA 3TTVA 4DQLA 4M9NA 1A9XA 2Y1FA 4MK4A 1DWOA 4Z6FA 3LYAA 4JL8A 4MB6A 1V11B 2YVUA 1B8PA 3GBPA 4OB6A 5JBQA 4GL2A 2JKVA 1MQSA 4FHCA 2DFPA 1FRQA 4AJLA 1TKAA 3GXOA 1TQ4A 4YWJA 5BXYA 4YMLA 3WLFA 4RE5A 2LTAA 3WIEA 1STOA 3LHKA 2BHSA 2HR1A 1G17A 2KZZA 2AL7A 2JANA 3LW7A 2J6UA 5CJJA 4BFLA 5SY4A 3SZOA 5EIEA 1KJYA 1BAPA 2CB0A 3SHWA 3WQHA 1FLDA 1ZU5A 5C1BA 1UBLS 2CXSA 3BCHA 1QF6A 3U3DA 4DSJA 1JFRA 1MCZA 2V9CA 5KDLA 2AGQA 3CUSA 4RKQA 1LKZA 3CZ5A 2RC5A 5FUBA 1S2DA 4DLRA 3QPBA 1PR5A 5C51B 3AI7A 3RT9A 2V65A 4DIFA 1MJGM 2IXFA 5EUBA 8ICOA 1MORA 3GDOA 3L6RA 1ODKA 4G81A 1O6GA 1TYBE 4WJZA 4B3RB 3V8MA 4I4NA 1WW2A 2V1UA 3UAWA 2GAJA 2OK8A 2ZB4A 3F4LA 3IX7A 3UJHA 2DHEA 2IZOA 4QWEA 4LWPA 1XVUA 1ZL0A 3KQPA 2ZPAA 4C5AA 1JHQA 3DLBA 4RUKA 2P0YA 3ETCA 4PAWA 4MV3A 3OPYA 4C4TA 1B4DA 4LRQA 5BQ3A 3G0HA 1XZIA 3SC2B 3QKRA 1A2OA 2TRSB 3TLJA 1XNHA 3RS8A 4GFJA 1G16A 4OHCA 1QRRA 3SBOA 4NDZA 4MPTA 2FKAA 2NYUA 4RXUA 2EATA 3PQFA 1UFOA 2X40A 1A98A 2J59A 2ZLBA 5AHXA 3KOWA 4V0QA 4KQIA 5TX7A 2XEDA 2P3OA 3AYZB 3PXDA 4A0QA 4XX0A 1H2AS 4W1QA 1XEXB 2JATA 3JQ7A 3RKSA 3SG0A 5ENZA 4L4RA 3MTJA 4HX5A 1BX1A 2NT3A 2V7WA 5IINA 3WC4A 2BISA 13PKA 3KCQA 1VKNA 3QKSA 4HXYA 1YR3A 4P7GA 1BPBA 1KQNA 4AJ2A 4AWAA 2FV8A 1JHMA 3FCAA 4JVLA 3S8YA 4MV1A 5JASA 4LE2A 3SHFA 2WEKA 3BGDA 3AWDA 4DLUA 3U80A 1SCNE 3N2IA 4KNVA 3G88A 4US8A 2QD4A 3H1EA 1ZI6A 3ZU4A 1KPGA 1OZAA 4ZAWA 3UAYA 1VMDA 3X43A 2ZIVB 4PXYA 1H1DA 1R4AA 1HNXB 4ED8A 2PGAA 4IIHA 4U4AA 3HY4A 4AMZA 2X22A 1CHDA 3NM5A 3QBJA 3I9V6 2WTEA 4HPJB 4KYUA 4LOIA 2XIDA 5AJZA 3MIIA 4YJ2A 6PFKA 2W9BA 5ALEA 3E53A 2B36A 1LBHA 2YN4A 2C54A 3GRYA 5AOCA 4I1UA 2A7QA 5GOTA 4DR5B 4IIDA 3RYCB 4NCHA 2ZOSA 3H5RA 2PXXA 4II2A 3S68A 2QTZA 2QE6A 1K89A 2DG2A 3E5NA 4FQ7A 1RI2A 4EW6A 4I50B 4B3BA 2VH2A 3IPYA 4GRDA 5TLSA 3QWBA 1XQ6A 3ZU2A 5H4GA 3DKVA 2BGTA 5JC8A 5J0XA 4MUBA 1HDZA 1U0BB 4DEZA 5DYWA 3DWEX 2DPIA 1CERA 1DDIA 1ZM9A 2Q21A 4ZAVA 1XCBA 4I4IA 5BORA 2R4QA 1DPGA 3W90A 2V59A 3CWCA 1G8MA 2KKVA 3OZTA 4MXDA 2EFEB 1ZH8A 3WK8A 3KYDA 5JAHA 3I04M 2C8VA 3OP4A 2ZTSA 4GUDA 4W1RA 3LQKA 5AW7A 3QHQA 1JFFA 4XM2A 4ANFA 4C7YA 4EMBA 3BMQA 3H1BA 4WE3A 3FMGA 1U4OA 3H16A 1W0JD 1R1DA 4UARA 1S4MA 1J8QA 2GTPA 2R79A 3C43A 1SG6A 3T1TA 8ICPA 4D79A 2HHQA 1RC8A 2O2HA 4D9CA 3VR3A 1UAAA 3NRWA 3C5VA 5DVZA 3U3JA 1NXSA 2E0IA 2QP3A 4M46A 1BS1A 1D7OA 1DAFA 4MUAA 1QAQA 3ZCVA 4AJPA 2AA3A 4I66A 4ZI7B 3LWLA 3W3AD 1IMOA 1KSHA 2EH9A 1NW6A 2XAUA 6GPBA 1JPJA 5A3VA 1KR2A 1H65A 2GH1A 1MQAA 1M76A 4WNAA 1ZXXA 4KC0A 4OU4A 4RHEA 5CR9A 5E9JA 1NN0A 2IH5A 1NXQA 2O3UA 1LK7A 2MU1A 2V55B 2QLMA 3GRVA 2HMSA 2R11A 4M8LA 1XQWA 4QZBA 3R9XA 4DLEA 3DOOA 1JH8A 3DAOA 2PZGA 2WU3A 4BX9A 4CCYA 5JXHA 1OILA 1Q2XA 1IUNA 1SO8A 4HGRA 4FFSA 5B37A 2XA2A 4B4UA 1ULBA 1HUOA 1XTQA 3FI9A 1A6SA 3RR2A 2UVPA 3OLCX 2Y1LA 5EKUA 1OB2A 1HYEA 4KLNA 4PC6A 1DK3A 1WCLA 1M2VA 4JR1A 2O14A 3RIXA 1JDUA 3ZCTA 1GITA 5B12A 5AW1A 3LD9A 4M1EA 1D0VA 2EAOA 2ZRDA 1GPJA 1UOPA 2NU7B 2QP9X 4DG8A 9ICJA 5M2QA 1KZYC 4BJ1A 4XWWA 4EHNA 5JSZB 3R6GA 1CZOA 4LYJA 4NE9A 1P2GA 3M6VA 4GXQA 4YP6A 5C1IA 5TPWB 1QIJA 2IW1A 4M4SA 4JODA 2GN2A 4OHMA 3TW8B 3O4IA 1TZ2A 1GZHB 1X1CA 3EGCA 3IUYA 1T1RA 4PYLA 5DYYA 3PQ2A 3VZSA 3DNPA 2IEZA 1JLKA 5AUNB 5K8CA 4NS4A 3HBLA 4NG5A 1ZJMA 4I4TA 5EZYB 1EEXB 2KIWA 2CD9A 2X4LA 2O2GA 3DMHA 3NBMA 1IEXA 3LWNA 4H31A 5TEVA 1IC6A 3NHKA 4PBRA 4UXJA 3L7CA 1TT5B 5CK5A 3S2FA 5GINE 1D09A 2X8JA 1BE8A 1X9MA 1V8BA 4R2HA 5KG1A 4CETA 4FHZA 3TG8A 3CNNA 1BHQ1 3UW1A 1KK1A 1XMIA 4AK9A 1ZAKA 2GHQA 1MQ2A 1WTAA 2GYVA 4JT9A 4DQ0A 1RWMA 4BFUA 2O7VA 3U5ZB 2C2GA 4LRTB 4OP3A 1JQBA 1PSWA 1VRVA 2FZEA 2I0FA 2Y92A 3L02A 3M9LA 3UT6A 4C01A 5JQWA 3KHSA 2J8ZA 1Y1SA 1MA0A 3ON5A 1Y6GA 4LISA 3HJBA 3BJRA 2W6ZA 5BNIA 4I2JA 2NVBA 2XH8A 3EAQA 3NBXX 3G59A 1W581 2BCVA 5BOSB 1MHTA 4RQ3A 2JGFA 4DSIA 1F7VA 3DLTA 4K9LA 1Z1BA 1NJXA 4OHWA 1XTVA 1P6QA 2CBGA 1GARA 1XCJA 2J3EA 2RAFA 4OKNA 3WGTA 4KITB 1QLJA 1PWZA 1ZYUA 3RHFA 1YHNA 2BP7B 3IUJA 4GD3Q 4JP5A 5HM8A 2PFKA 3QWFA 4YA6A 4LF7B 1T5OA 1DV1A 4DS4A 3NXKA 3U17A 1E9FA 1KO5A 3AGQA 4WUTA 1CCWA 3KUKA 1D0IA 2NPOA 5GZ6A 4TZ0A 3PYLA 2R0QC 3C3JA 3EG5A 3GGCA 3L6CA 1BEZA 1L7AA 3AVYA 2W3SA 8ICUA 1WHSA 1UH5A 4GLXA 2OT3B 2Z83A 4RQ2A 3PSHA 4Q16A 4DL9A 3SQXA 3HILA 1I1OA 3M6ZA 1WXEA 4XSVA 4GZ6A 2R44A 3ANSA 1IM2A 1VBFA 3JZAA 1Q7GA 2IKSA 3I9KA 3TJMA 5D1NA 1Z0FA 3N8KA 3IQEA 1HJPA 3DDHA 3QXGA 8ICLA 2ZBFA 2FWRA 3NEJA 3AU9A 4ROSA 4K9KA 2XTNA 5KFUA 4DOMA 2WWRA 4UFPA 2XBMA 2YYZA 4FHFA 4PPNA 4ED2A 4TRNA 1JR3D 2C78A 4E7OA 2I5HA 2JIRA 4HRVA 1EK1A 1QFSA 2HNBA 3OQ1A 3PX0A 4B4WA 3FUCA 3QX3A 1FZTA 1V7PC 3GAMA 4KO1S 3GP5A 3VC3A 1XDUA 2WWHA 4K4GA 1W93A 3GDXA 1D8YA 3P2IA 3R8XA 4ZEMA 2BMVA 4P34A 2XOEA 1P80A 1UEJA 4LJXA 3RB3A 4MYRA 4DA0A 3LYLA 2WF6A 2W55A 2HJHA 2R85A 3R1IA 1RC0A 4G1BA 4HBZA 5EZSA 4FEGA 4GC7A 3GP3A 4WVLA 4XLZA 5EXXA 3ZX5A 4EJMA 5IJZA 4ME6A 2IHJA 3QMVA 1KBUA 1COWA 4CQMD 4KUHA 1N5DA 2Q46A 2PMEA 3ABRB 4BZQA 1O1YA 1CHNA 1EG2A 1UAGA 4URHA 4L1KA 1NK8A 4FXOA 4INAA 3ZBUA 3A10A 2IYNA 2YIDA 2XVTA 3KAQA 1SXJC 3VKFA 5D6OA 3SYRA 3UF0A 1GKUB 1T8PA 4MVJD 4KQXA 5CLLA 3FFXA 3KQOA 3UWKA 5DBOA 1ENPA 1QVWA 4V1CI 7ICSA 5HA5A 3BHJA 1FP1D 5M3BA 4DCPA 4I2EA 1L3TA 4K1XA 3A4YA 2NTYC 3OUUA 4O3PA 2BMAA 4OP2A 4XTCS 3R7WB 3RFVA 3V42A 3EY9A 3LK6A 4YYZA 3SDSA 3QVMA 1N5XA 4I4TF 3WGLA 4EUNA 2CLMB 2C2KA 3ICEA 4L3WA 5CLQA 4BTVA 1EIWA 4WOKA 1B3RA 5TQ2B 5EFZA 3S7TA 3G8AA 1N77A 7ICJA 2IOQA 5J2UF 5DF1A 1TVEA 3A1CA 1X7YA 4QM6A 2E8NA 4B0PA 1ZQTA 4Y30A 3FUTA 3FCOA 3BB4A 4L9WA 5GM1A 1P7VA 1NZJA 3FFAA 3QJYA 2HOIA 1S9HA 3E9CA 1P5HA 1FIQA 3MQFA 5ALWA 1M2KA 1XALA 1E5TA 3D7KA 1BS9A 1TM3E 4AKTA 3R0XA 1JAYA 2Z30A 4QBGB 1W85B 2ZJ1A 5JW6A 5H5JA 1QKIA 2OWDA 1GQOA 2CPRA 4FJ0A 2G5CA 4ED6A 2C2ZA 3T9BA 4B85A 5HVNA 4ZQEA 4NAHA 1NMYA 5HE8A 2Q2OA 1I3CA 3D6AA 4QFMA 1JYFA 5H4HA 2R68A 5EJEA 1CV2A 2G09A 1T2AA 3A4VA 9ICOA 2Y77A 1U2PA 1TADA 1Q83A 2OCLA 2REQA 3UPDA 2CUNA 1A2KC 1DJOA 2G25A 3PXAA 3C4JA 3L8YA 5IDQA 5JY6A 3WZMA 2OBMA 2C28A 5KYUB 2Q6VA 2F55A 2PFSA 2J3KA 3BMNB 1CR6A 2WM9B 3IVRA 2A2ZA 3QTTA 1P9RA 3L1JA 3UENA 2FWPA 4KPGA 4ZVPA 1SVNA 2QNBA 3VR5H 1ZUIA 1NHGA 4F1JA 3D4PA 5KG4A 4QDUA 4ZI7F 2UAGA 4RT3A 4KQMA 1SEVA 5ECYA 1MVOA 3WGQA 4G1MB 4J9SA 1TA0A 2MUTB 1M66A 4QNMA 2O1XA 1UQTA 2QMEA 3A28A 2ZULA 1YS9A 1UBJS 3CW2C 1MH1A 4PFQA 2IW3A 3DEJA 4X97A 2HAEA 3U0BA 2RKBA 1HYHA 4DMFA 3H2ZA 2I8AA 3ANYB 3LVQE 5HFAA 3KT0A 2IP2A 1U8TA 2Q9AA 3DTTA 4IJMA 3PNPA 1IN5A 5CHEA 3RJ9A 5I3CA 3H99A 4RVGA 3MGIA 3T95A 1OFUA 1PNQA 4A8JB 3TUZC 1ZWLA 2ESEA 1HTTA 4IVQA 3MCVA 4CM1A 2J7PA 2OEHA 1DOZA 5JJIA 4GMHA 4GWLA 3B3JA 2P6MA 5LDHA 4B4OA 1OAKA 3S2GA 2R6JA 2BR3A 3B48A 1M34E 1OLSB 4BN0A 4GXJA 3WADA 2BVNA 2KHVA 2JAHA 2W98A 3NV9A 4X1OA 3TUIC 3IRUA 4L8YA 2ZEJA 4YJFB 1CF2O 1PQUA 4KLHA 3NIBA 1E0KA 2EFDB 1RWOA 1PT8A 4B4VA 5CLIA 2UV8A 5MF6A 1W5TA 3TADA 3HWSA 3K35A 4Q0MA 1F20A 1ODCA 3W3AH 2NU8A 4KAJA 3QWAA 1IV8A 4RJ2A 1IN6A 1N0WA 2EJBA 3C16C 1EH5A 4ISBA 3C2KA 3WWDA 1JEYB 4BRSA 1X0XA 5JT1A 3FTFA 3H8SA 5AM3A 4G1EB 4HDKB 5JD5A 3VNRA 4GLBA 3UXYA 2Z9DA 1SXJD 1II0A 2GA8A 2GBPA 2GEJA 1PS8A 3L0DA 1DT5A 4BV3A 3HFJA 5B3JC 5IHPA 1ISPA 1DBSA 1U94A 3IGFA 1ZGHA 4P4TA 3ZWNA 3U5TA 3TIFA 3CNHA 3ILXA 1MPTA 3RUFA 2YV2A 4J0GA 4PGAA 2VJ5A 1CEYA 2JZNA 3Q5DA 4RFSA 2W2KA 3TTXA 1H2HA 2IXDA 5G4LA 2ENWA 3VDMA 3MMZA 3T5GA 4QZAA 4IMIB 1F5SA 3L6OO 3RJEA 3MJFA 5DNUA 1TEVA 1N2GA 4EZ6A 1L8AA 2WRZA 3P94A 4Z0NA 1S7CA 4JV5B 4HH4A 4YHBA 1DFIA 1O89A 5HDBB 5KG7A 1PR0A 1Z6ZA 3FB4A 2E4WA 2PL1A 4GL4A 4XCQA 2QPOA 3I64A 2NW6A 4BLPA 4F93B 1M1NB 4LY9A 2DFVA 2PGNA 2QS9A 3R2JA 4V3CA 3GD7A 4Q3KA 4E03A 1NT2A 3OCVA 4IOLA 4JDUA 3RFFA 4B40A 3NUQA 4FYYA 4XIJA 1KF0A 1FUIA 1A8HA 2QEQA 3A6PC 1ZK0A 4GBED 4OI1A 3UAXA 3FPSA 4CQLB 4OJ6A 3DDNA 1E6UA 2VHXA 2VRBA 3DE1X 3JPOA 1F0MA 1H42A 3IUNA 4JLKA 4OBXA 4UU0A 3ZLBA 2DCUA 3RWMB 2QZJA 4RSRA 4E21A 4EPVA 3B3GA 5FQNA 3QEJA 1CY1A 1TM5E 2MYNA 3VMFA 1DMSA 2GPBA 4K87A 1Z6TA 3TI9A 5C18A 1ZUD1 5KQMA 1JDVA 4C7ZA 1A96A 2VDRB 3WGZA 2KHZA 2OV6A 3WISA 4QJIA 4Q9HA 2C31A 3PUKA 4GGOA 1GUYA 1WPRA 3RBVA 8ICNA 3EHDA 3HN2A 3F6BX 5J2FA 1DQZA 2G5HB 1CLUA 3GFRA 4UHKA 3IELA 1GTMA 2E2WA 2ETVA 3COYA 4TQAA 3LHFA 1M6WA 2V4QA 4FSDA 5DB7A 1U4SA 1TTHA 2X0KA 3B89A 3WKAA 4FYHA 4MYSA 5BN5B 5L3RA 4D3YA 5KT5A 5BVHB 5EIAA 4J94A 4EG3A 4LF5B 3HJGA 1KZ1A 3F73A 3KYJB 4DEXA 4P4NA 3J81A 2OBXA 3HEMA 2PRIA 2TYSB 1H3EA 3U44A 2O8VA 1U9ZA 1YAHA 3TSYA 3UKDA 1KIFA 2LV8A 2ZTUA 1B0PA 2C4NA 2OK7A 3ORFA 3PFNA 4EZEA 4Y6GB 3R0QA 4KZPA 5BOVA 1KTIA 4ED7A 1I8TA 1UJ2A 4NLBA 2AXNA 3BK7A 3I32A 1PUZA 3JQAA 4CLRB 3A1UA 1FJXA 5DHQA 5F3WB 5H9VA 1I9GA 3L4BA 4TMKA 2ZB8A 2FW8A 4FDUA 2XTAA 4JQCA 5JS1A 1N7JA 2NO9A 3X2SA 5B66U 3HNOA 3MA0A 1VE6A 1RXYA 2VOJA 4LY0A 4XA5A 1HTWA 2OGZA 2R62A 4PXAA 4EG8A 1QGAA 1RPAA 3O4JA 4LSMA 5G3ZA 3X2EA 1AQYA 2F67A 4AKEA 5CEJA 5MGNA 3K9NA 2IS1A 2BH2A 1TA9A 2W9XA 3VKUA 5A7HA 4F9TA 4I8XA 4FIZA 4E1BA 4ZOBA 5LSAA 4WKOA 4FTWA 3OQVA 2PSDA 4R84A 5EYPA 2BKEA 4MKFA 2OV4A 3DBRB 1SZHA 4O4HB 4YRRA 5A9TA 4LXHA 1SV4A 5CYGA 2PX3A 5C7OO 3ZGLA 1BA3A 1YV9A 4EVRA 2X9LA 4DDTA 1U7DA 1L3CA 2GXAA 3C3KA 1JMVA 2I76A 2JEJA 4WKPA 4Z9FA 2BGGA 1G9SA 3I3OA 8ICQA 5F7ZA 4ZCQA 3IEIA 2LPEA 5AUQA 4B44A 4BMXA 5IN5A 1IAQA 5DXAA 4NZ9A 4IQFA 4QWWA 3LC7O 3NZEA 5J2CA 1G5QA 1C3XA 1VPTA 1XMVA 2BGKA 3GLUA 4GX2A 3HCAA 1CYDA 2W42A 1TE2A 1BH2A 4BCBA 4LJ6A 5IKPA 1TF5A 3ZHVA 2Y05A 2ZBDA 4RF2A 2AZXA 4DRXA 3ZWMA 1TO2E 5JNRA 3A2KA 8ICMA 2HWWA 1TUIA 5K0LA 1DEHA 1Z29A 3NDPA 2OZEA 3UJPA 1GNTA 4CHTA 4CIAA 3LCVB 2H1SA 3HS3A 3HWX1 1D0SA 2L42A 3LUFA 4L5IA 4O25A 4U0JA 5TVKA 1RI3A 4M0MA 3ADCA 1EVEA 3E18A 1X38A 1MABA 3GGPA 4J9MA 1KFSA 2FZVA 3QFTA 4JY7A 2BLLA 4QDKA 5BYBA 3WO1A 5JI2E 4FBTA 4MWGA 1FMCA 1N6HA 4F04A 1WETA 2WG1A 4IH1A 4PYRA 3SZRA 2EU8A 1HEIA 4ODIA 4JT2A 2G7MC 2IYUA 3BJYA 2G80A 2F77X 4CF4A 3DBOB 4TVBA 4I5FA 1TQ8A 1N0UA 3JASA 4ECZA 2A1AA 4AMYA 3KSAC 2GN4A 5CW1A 4FWIB 3MCWA 4E11A 5KTKA 1NPDA 4H0CA 4LYEA 2E8PA 1PYDA 1UPFA 2WVAA 2YMQA 2VP2A 3NONA 1DV2A 4DRXB 1KI8A 4DJFC 2Z3WA 4TXNA 5LYYA 5FA8A 1OT3A 1VBKA 3NALA 4UPVA 3TFRA 5HGJA 4HY3A 1QTQA 4ZQFA 2PX4A 2CBXA 2O1WA 2C94A 2YV5A 1SVKA 2ZP1A 3VAYA 1A7AA 3RAGA 1Q57A 2FLVA 2FPWA 5LDGA 2BHRA 4S1PA 4BXOA 4WJKB 1JHYA 4ZPXA 1R16A 3AFHA 4OHFA 5FBVB 5JAIA 4BV2A 1LTHR 2VJ4A 4MWCA 2FUG1 3LO5A 4GMKA 3R20A 2FTKE 2PKQO 2BQUA 3IIEA 1KQFA 4JJ4A 3JVIA 3IG8A 1TCAA 5GP1A 3CSUA 5HUJA 1RM6C 5J8YA 5DLGA 1NVEA 3D6NB 4WT7A 1VSQA 2I6GA 1C14A 2N47A 2XE6A 5BN4A 2KV2A 5JANA 5LQJA 4KLUA 4P4PA 5DBBA 1Y82A 3W6PA 2KP7A 4YXJA 2AYYA 3C8DA 2OLKA 2OO5C 3GLVA 2C5SA 3LWBA 2QX7A 3LO8A 3VR5D 1DOAA 3EFEA 3P9YA 2WUEA 4YMSA 4F4UA 3IB3A 4M1ZA 1BJTA 3AUJB 3M6IA 1DQYA 2Y0SC 1PVPA 1X7DA 1XQ1A 3P97A 4JBWA 4X3PA 5CM9C 3HWTA 4Y3UA 5BW4A 1OD6A 1NQAO 1AVTA 1RE0A 3F9CA 3UC9A 4MUJA 4QWDA 3KBOA 2AKAB 1UC4B 2NYVA 3FMPB 2C92A 3LDFA 4WADA 1OIVA 1I6MA 1A72A 3ALRA 2HQ1A 2QYTA 3O84A 2WP0A 1Y33E 5KNCD 3RUEA 1V41E 3EVAA 2E4YA 1BOFA 1KK0A 4Q4AB 4BQRA 2HW8A 1SH7A 4EPWA 5LBTA 3O5AA 3B70A 3BA6A 4HRXA 1SMKA 3LU1A 4LXQA 3CLTC 2P0EA 4EFDA 2G88A 1BPYA 1ZVKA 2Q1YA 3DDZX 4GF5A 4URUR 4J7XA 4BP1A 4MICA 3DEHA 4KODA 3HPOA 1J49A 4EO4A 3EVGA 1J90A 1JIUA 2HQOA 4NNJA 1V35A 4RDIA 2RE8A 1DVRA 1IQ0A 1CU1A 1ZI8A 3IESA 3FROA 3KVOA 2CFRA 1KTQA 4N5IX 4HADA 2FPKA 1MQ3A 3ROMA 2XT6A 4CLXA 2JRLA 1UKBA 1G59A 2B7LA 5JH7A 4DR6B 1SK9A 3C8MA 5ALFA 1NN5A 4OLFA 2HI0A 1PE0A 2ZUEA 2WW8A 1Q1EA 1UPBA 1WTCA 4PU0A 4YC7A 5DNAA 1CUVA 1NBOA 3KLBA 1RTTA 3CX4A 4ND2A 5BSWA 4DADA 4FMBB 1VSTA 4P54A 4B5KA 4EOGA 1XDBA 3GCGA 3GCZA 3I53A 3HP6A 4DYVA 3G1TA 2WUDA 2JASA 3QFFA 1N9KA 3AEYA 2X8WA 4GOMD 1S0MA 1ZGBA 4DNFA 3ZVMA 4KLAA 2H54A 4EG4A 4NM1A 2B4AA 4RANA 5JVDB 2V1XA 4D9FA 2WIAA 4RVCA 5BMVF 1GR0A 2P65A 4CN8A 2RBGA 2WZDA 7ICOA 2RH5A 1LJLA 1SA0A 1LNQA 2EEPA 1EFKA 4RWZA 5C8VA 3KKNA 1VLJA 4I1YA 1OQAA 2HHUA 3Q12A 4U2BA 2XDQA 2LM1A 4GOJA 5FA6A 3ZI0A 5I48A 3CIOA 1SHKA 4X6YA 2I67A 4V3BA 5EOVA 1ZK1A 1UM8A 2PD6A 2IKQA 5EWFA 4ITVA 1T29A 2F3SA 2J31A 5BT9A 4OL0A 1SXEA 3MGCA 4PX2A 1QBGA 3SPXA 1MR3F 2BLNA 3BOSA 1XTIA 4JBGA 1E79A 2HREA 4KIJA 2LYBA 1CLEA 3W78A 3I2FA 3ZZUA 4GGMX 2J6IA 4Q47A 2W93A 1FS5A 5E1BA 2A0XA 4X92A 2CGEA 2IJGX 1U0OC 1VCOA 4A16A 3JWGA 1SKQA 4RQ4A 4CG0A 2JFXA 1V5GA 4NFLA 3NWPA 4Z1OA 4MW2A 2YV1A 1N6NA 3QVVA 1EWVA 1YK1A 1Z2AA 1SKYB 4GKKB 4C78A 3JWEA 2BDUA 1ZQKA 3TOVA 3DZJA 2H7CA 3LF2A 2OAP1 2ZIGA 4EMSA 1E0SA 2H1RA 4RNCA 2IZ1A 2EX0A 5SZJA 2Q5EA 2Y6VA 3F74A 2JLZA 2WM8A 2HJSA 2EJVA 4B87A 2ATIA 3NKVA 5I9TA 2AX3A 1L6IA 4WLFA 2ALZA 4I9HA 2XI4A 3UWDA 1T8SA 1Z5UA 3NNDA 5D01A 3W5DA 4L0MA 4B80A 4NOMA 1PR9A 1ABFA 1UADA 3BERA 4K40A 1P29A 2Z43A 4MDEA 4NYMQ 3U9TA 3THRA 3E2EA 2PZ8A 9ICKA 4HS9A 4NY1A 4R1UA 1W36C 1BVHA 3LXUX 5AHKA 1NXXA 2IPAB 4HNQA 1D7AA 4CKBB 1JLHA 2DPXA 3T9FA 2RB5A 4BWYA 2PXCA 3EPLA 4XLTA 4I2HA 3NHMA 4D9GA 5KOJA 3DVAB 2XQVA 1XA4A 2KZMA 5E9WA 4D57A 4HUQB 3CZ4A 4FCTA 4B8YA 5LQMA 2PI5A 3F78A 1CQPA 1PEYA 5DIFA 5KYUA 2WBLC 3QYJA 3OCXA 2EQYA 3D3KA 3E1GA 1IM5A 3LH5A 1OW3B 3QHAA 5ERYA 1NV8A 4NLNA 1TCCA 3PUIA 4LSWA 1ID8A 1Q21A 4PVCA 1XZQA 3FRHA 2OXOA 1B8UA 4TQGA 3T3PB 4ZV4A 1VXOA 4FZNA 2Y0PA 2WP8J 2K6GA 3GAZA 1DAOA 1E7MA 4BQOA 3LTNC 2FSVA 1F0NA 2BELA 2IV3A 4C43A 2CXQA 3ZKWB 4ARZB 5J0QA 1MO4A 2WAMA 1E9EA 4X94A 1HFWA 3DGEC 1VQ1A 4K7JA 1UJCA 2R25B 3PNSA 5IX8A 4UTPA 1C9DB 3E8MA 2AD5A 1LPNA 4A8TA 4UBLA 1ONNA 4TXHA 4GECA 1UP4A 4QTUB 4I2GA 3JX9A 4ZJUA 1F6DA 1QX3A 4G9EA 2I2XB 3IQFA 3P7MA 1N3LA 3IKTA 3IPXA 4H4DA 4AL4A 5AUPB 4EBEA 5B1IA 1RI4A 4GI5A 3UW3A 5ALUA 3PW4A 2P8JA 4KSCA 5AXDA 2JIPA 3A6FA 2IF2A 3HWRA 2P41A 3MT0A 3AEUB 4PYOA 4FILA 4HNSA 3K1RB 2OV2A 1RZRD 1UJNA 1W8DA 4F5NA 4UASA 8GPBA 2RG1A 3R7WA 1IWPB 1E60A 3H1GA 5DPMA 3RQSA 5LQUA 4ZMSA 4R1OA 1TAUA 4HLDA 2LKCA 4CL3A 2W6JA 4KOAA 1IJEA 4D41A 4OQQA 2YY7A 2G8NA 4N4AA 1Z7GA 2BFDB 1KMNA 1RWKA 2ZJZA 3IAS1 4LQLA 4D1YA 5JIBA 5B1HA 1RI1A 4O5EA 3RS5A 3FDZA 2KBFA 1RMTA 2JHGA 2OXIA 2FDRA 3D2NA 3PPYA 2K87A 4NY8A 4RDXA 1NNI1 3GA0A 5THQA 3BDIA 4NX2A 3JQBA 2HC9A 4U5QA 3RT1A 3S0JA 3ZIDA 4Z49A 1ITZA 4KKXB 3THYA 1FSSA 4IZ6A 3H5VA 3P9XA 2O2EA 2Q3HA 3HWWA 2HT6A 3CCCA 4IYRA 2C1EA 1T9BA 1ILWA 1U0LA 2RAUA 2GPYA 3ZV5A 4BBJA 1I32A 4EEYA 2B35A 3PSTA 2BEWB 4Q37A 4HX2A 3SZLA 1T10A 4M54A 1O5TA 3U49A 4CT5A 5GY7A 3DFUA 5K8IA 5KSZA 3SYZA 1P6XA 2GX6A 2ZJ8A 4NU5A 3RIMA 2Z8ZA 2C9DA 2GI4A 2EF1A 4XYMA 4AF7A 4HYYA 1N2IA 4ZD6A 4EG0A 2OR3A 2VWPA 2R7MA 3MGBA 2CNLA 3MJVA 3UPQA 1U7WA 4LC0A 3STHA 5KI6A 3PR5B 1FS6A 3T3EA 4UAYA 2E4AA 5GIOE 1ZR2A 4DQIA 1YFJA 5KCMA 1FFWA 3D5EA 2RKWA 4JXJA 2AH5A 1VKJA 2WMYA 3QMMA 3RJKA 3DCIA 3EPRA 3WOVA 5KSWB 1XRSB 3VVBA 3LP6A 1YZ6A 2WU0A 3GFOA 1WYGA 3ZY3A 2O8BB 1UBSB 2EG5A 4EPRA 1AUXA 1JR2A 3HM9A 1TKBA 5K4HA 4CL0A 1E2DA 3SWWA 1CUEA 2A84A 2PZJA 5EXTA 2D8CA 3L5KA 3ZCRA 2DBZA 5IYZA 3SD7A 2H7XA 2PNFA 1NP6A 3C6KA 2DUMA 5F5XA 3KTAA 2JBWA 2YHSA 4W8HA 1JGTA 3VPBA 4B6JA 1P7DA 2ZU6A 2ZT6A 4Y2QA 3RSHA 4ZYZA 4L75A 2JW5A 1V1RA 4O4HF 5FTWA 1GTSA 1S5PA 5KT6A 2PS0A 2VYCA 3EBLA 5JUWA 4NJ8A 3Q8WA 3GDFA 4I55B 4CLEA 1OBVA 3K1YA 1IK4A 4AMGA 4C1NA 1EK2A 3EQ6A 4S2UA 3WJ1A 1QGZA 4B9LA 1U8AA 5LB4A 4DIOA 8ICVA 1SGWA 4HH1A 4J3JA 5JTTA 4I55F 2IELA 1JMSA 1D2CA 5EXEA 4BMSA 4BB5A 2NO1A 4M1MA 4C7XA 1NONA 4LF6B 3G0IA 4F46A 3HFSA 1VL2A 3HV2A 2QUIA 1F8UA 4RL6A 2OCEA 5TC4A 2QUHA 1QYDA 3KXDA 3STXA 2DKNA 4WNIA 1T3GA 4PCVA 2K8CB 2IYOA 3ZE7A 5TGDA 3OFJA 4OFBA 2IZ6A 5IAEA 2YXNA 3ZE2B 4BQPA 4JLUA 3HJAA 1VDVA 5BV2P 5TISU 1PAUA 4I3GA 5HGXA 3CF4A 2CWDA 4MWEA 5EA2A 1SEPA 5DH9A 3INTA 3ZLVA 5HZHA 1DL5A 4U8HA 2XY7A 5ILGA 1JSCA 9ICTA 2YIVX 3U3ZA 2QV7A 5JZMA 5LKAA 1WEHA 2W6PA 1I7QB 2H5XA 4ZCSA 1QZTA 1RCTE 1W87A 1C4WA 3KHLA 3OCJA 4HDMB 3L8GA 4LHXA 4MMXB 4D8YA 2HLNA 1QFJA 2COKA 2D2IA 3JALA 2G36A 4I6EA 3T9EA 3VO2A 2RDMA 3CJTA 3VNAA 1LVHA 1G8SA 4HDNA 3TM5A 2WJVA 1TU4A 3L41A 3PLAE 1TGYA 5I47A 4BGUA 1W4AA 1J9GA 1K1EA 4NABA 5J0SA 1MT3A 3NV7A 3VU8A 2H4WA 2RAVA 3IVAA 3LNCA 4TXMA 5IP5A 1ZJJA 1DRVA 1T5LA 3QX7A 3HBNA 1YR9A 1C41A 2C7RA 4OUDB 5JMOA 2F4VB 4AWBA 4JUZA 4AJHA 5JDIA 1K8XB 1RAEA 1SNYA 2CXHA 1Z22A 2OVBA 3G5TA 3V32A 4G0VA 1ZMOA 2J48A 4O8CA 1JG3A 4IJ5A 4LVCA 5EC8A 1KOGA 1X87A 2FMKA 5DB8A 2C2DA 3E7FA 2VYNA 5CFZA 3TPCA 4AF6A 1QP4A 9ICIA 2WYWA 1TMKA 1M6VB 4G8BA 1BDJA 1KFEB 2HCTA 3AERB 1YT5A 3EVNA 1U0EA 3MJRA 1V38A 4IHKA 2OYYA 1NVFA 1YOBA 4L16A 3C48A 4RCYA 1I1QB 1IG0A 1F4PA 3WGHA 1ECGA 1KI1A 3LX5A 2PZKA 4O3SA 4FDAA 4DJAA 2O3SA 1WXFA 2WSYB 2VK2A 3ETRA 1DRGA 1KU6A 1N5JA 5JRTA 2WNHA 3AB7A 3EXG1 3K1AA 3GBSA 4CLHA 4HEHA 4IOMA 4LZNA 4XJTA 5ARCA 2EYUA 2PMWB 4QBTA 3QQPA 4EO7A 4YDSA 5CFOA 2GK3A 3W5VA 1OV6A 4M9XA 1CZKA 1CZUA 1GEEA 1JFFB 2B7CA 2GZMA 4L8FA 2FLLA 3R5HA 2JCSA 5AW4A 1Z0KA 1C1DA 5EUQB 3RVPA 2Z56A 3S5UA 4ER5A 5HBGA 1Z13A 2BMWA 4H2DA 4KSYA 3AKDA 3KUCA 3VC1A 4JC4A 5C8XA 1WB9A 1CEQA 4RMJA 3I73A 4YMWA 3RDPA 3RYFB 1NZPA 4LWOA 4RZUA 3SEQA 3WV5A 5GJCA 5FT9A 1DRUA 2Q6LA 4OATA 3TQFA 4YAOA 4Q12A 4IDNA 1P2SA 2BRUA 5I3ZA 4PYQA 1TVMA 2PJZA 2W2LA 2UUBB 1C4KA 1A8UA 1ZU4A 2F3NA 2RHBA 4GX0A 3G85A 1IUKA 5AM2A 1BRMA 1UPXA 3CS3A 3NT2A 3NFRA 4MGEA 4Q7MB 3L2OB 3PQDA 4AUMA 3O95A 3V7LA 3NORA 3PENA 3H11A 3WV4A 4M8IA 3BREA 5I4BA 1G3UA 2YMLA 3GT4A 2RMKA 1V25A 2B1RA 1QE0A 4RLFA 1GNLA 1RKBA 1U0HC 3EGXA 2HU8A 5EWMB 4GFDA 3TECE 5F2KA 3CSSA 1I24A 1IB6A 1Z19A 1TM4E 1WHTB 2XKBA 1M3SA 2R8ZA 2YZ2A 4AY5A 1HRKA 1N57A 1XDSA 2PK3A 3CZQA 1DKNA 3OKAA 1OBHA 4DXDA 5BR4A 2G1KA 4BOYA 1L7EA 1GQFA 3HBFA 3ZXUB 2Y1OA 2V4UA 1JILA 1RAAA 5LUBA 3MWJA 2MSDB 2WUVA 4IQ0A 3CVWA 2DU8A 1LX7A 3FDIA 3O9VA 4ER3A 5KIAA 2OG1A 4HWPA 2XO7A 4XR4A 2QLBA 5LP6C 4LCEA 4E4RA 4BP9A 2FN8A 3R7NA 3B85A 2R1ZA 2XZLA 2RB4A 3T3MB 2YS6A 2GJAA 3M2PA 2ZB2A 5DNVA 2ZBVA 1A0PA 2PGOA 4DUPA 3HZOA 3BE4A 1IPEA 1K7SN 4J9KA 1ZGCA 3AJEA 3PFFA 4IIFA 3UA3A 4BNYA 4EVIA 4Q1DA 1X7XA 3MGHA 3M3PA 4MULA 4J1SA 4UBOA 1UKYA 3GUHA 4MHTA 4Y0NA 2VJYA 1T3LA 2VZ0A 2B8JA 1RLOA 3GUUA 3WLLA 3HZRA 3IR7A 4F5YA 9ICCA 4OK3A 4JWMA 5IBRA 3C3DA 1TDJA 2PQ2A 1W96A 4HFMA 4V03A 5LOVB 2DXIA 2I1QA 2ATXA 5BNTA 3EN0A 4KRXA 2P9TA 4KVGA 1FDTA 1JEEA 2J7KA 1LTQA 3KKQA 4KAXA 1IPHA 3VSEA 4LZAA 2KN7A 4GXIA 3EWSA 4XYBA 5GTHU 3EC2A 4YIKA 5DX1A 1JEJA 1UEIA 3IBCA 4FCCA 5GONF 3W2HA 3WJ2A 3CO0S 1FX0A 5FP0A 1ZHFA 1ZIXA 2Z2ZA 3EGXB 1GV1A 4S0XA 2JGKA 3I05A 2LM4A 3GFKB 3I62A 1P5FA 2PQMA 3PQEA 4EQZA 1HOTA 3Q87B 5U4XA 4BUJA 1JQJC 4RC9A 3R9KA 2FFQA 4LYHA 2BM0A 1IHOA 2PIDA 4PL2A 4YRGA 3TIIA 2P4SA 1RVV1 5J40A 1JECA 4ED3A 1T9HA 2VDKB 2X1MA 3DTNA 2W48A 4JAVC 1NVVR 4C0SA 4BX8A 2VCHA 3O74A 1F6WA 2IXGA 1KDTA 1DFHA 1YZTA 3INYA 2A92A 1WVIA 1IY8A 1RZTA 1PTJC 1WF3A 2LVBA 1E20A 1CPYA 2EV9A 2WSIA 2XUDA 1I3KA 3AL3A 1UXHA 1PZNA 3FTNA 3I4CA 1Z07A 3PA8A 4PZ9A 5B4VA 2G9VA 3RYIA 5KO2A 3HRDD 2PVPA 3ABIA 1I33A 2P2YA 4GEKA 1WABA 1W19A 4JD5A 2OO3A 4Z6EA 3FDXA 3N75A 4ZKEA 4DCGA 4ZCMA 4INJA 1ISSA 1J99A 2HRQA 1HM5A 4IIJF 3PE3A 1SHTX 3QXHA 2JJMA 4MQEA 5DTJA 5JQGB 4HAVA 2Z5FA 2QY9A 1UEXC 1FNCA 1SHZA 3QV2A 3K73O 5ICCA 4RIGA 5K09A 5DSZA 2J0EA 3FKJA 1HC7A 1UPCA 4EARA 2PSEA 1AKRA 2HJVA 5C8DA 3UATA 5CFRA 4ZGWA 4UAZA 3IB6A 4KYIB 2XQKA 4PG8A 1NWCA 5KNCH 1XPJA 4WN9B 3TNYA 3WLNA 1EGVB 4I14A 2FF5A 1BZYA 2QBYA 3PO4A 5D49A 2YV3A 1KZHA 1NKVA 5I9BA 3V4PB 1NNUA 3DP7A 3C1UA 4B73A 1L3SA 4TTRA 2Q3MA 4P8RA 1LSSA 4XWTA 3RUIA 4BVHA 1E89A 1P4RA 2BV3A 1I3OA 4MCIA 5HEKA 3AUYA 3SS9X 2ZJ2A 3DCYA 4XYLA 4A23A 3AR4A 5A62A 4UU8A 1Q3KA 1R0BA 3G5LA 4L50A 1TQDA 2CZGA 3DE4X 5IM5A 3JZMA 4J4HA 2VXOA 1NVDA 3ESYA 4N9QA 5KDDA 4BIMA 4JU8A 4L9RA 4MVJG 4DCJA 3TL2A 2DECA 3WLEA 1KTVA 5EPOA 4Z2AA 1MG0A 3Q2IA 4QWAA 4YCMA 1QSYA 1F12A 3GIWA 1JQLB 1ZKMA 1AXGA 1VIDA 3A05A 3DB2A 3PGA1 1URJA 2G06A 4YP3A 1RKQA 4NL9A 3HCWA 1VPLA 2RHRA 3OIVA 1MZVA 3GIIA 1GZ3A 1K8ZB 1Z68A 2EQ5A 3DZIA 4ECTA 4GLJA 1H2RS 2CW5A 4LJ9A 2IC5A 1CZRA 3GJSA 3JYLA 1JS1X 2PKQP 4QRIA 4PYNA 3B1FA 1BD4A 5I9LA 3GLIE 4U2GA 2CXOA 2JH9A 5CEHA 1YB5A 4LYAA 2Y71A 1CRZA 3I5MA 4RK4A 3R7FA 5IZCC 3A6LA 1V16B 2GUGA 1GKIA 2XUQA 4IAOA 4J0HA 2ZRGA 4MIYA 2WJ3A 5F1YA 2P40A 3AV3A 3VR4H 1N1MA 1Y80A 1ONPA 1AHHA 5HJ7A 1CIJA 3Q3VA 4Y9SA 2V7QA 4ZICA 5JR3A 1BIFA 1GGHA 4P0PA 3BMOA 4JT8A 4P08A 2VA8A 4R2WA 1D9FA 1P4JA 5JQGF 2G04A 4DSLA 1QXSA 4U9IS 5L7TA 5ECDA 4WK4B 1LUAA 3TDKA 1AMOA 2A59A 4I1VA 5JZ9A 1SXIA 2ZQYA 5AJYA 2IUTA 2AQHA 3N5CA 3KKAC 2IZ5A 5KTTA 4Y6QA 2RQ5A 2IHNA 2GZ3A 2QMHA 3IV9A 3ZWXA 1XK6A 2NQ2C 4NOKA 2HMXA 1K7YA 2GF2A 4WGFA 5HYVA 4MIOA 5H2FU 3OC0A 2BGNA 3A3YA 4C80A 3CIFA 3NHSA 3V1YA 5J4LA 5FADA 2YOHA 4BLSA 3N7SC 1U3DA 3ZW8A 3SXUB 3PQ3A 4UB8U 5CB1A 1T0PA 2IYZA 2EHJA 3LCRA 4MAAA 5CB8A 4B7XA 3M89A 1S8FA 4LZPA 5TDHA 3ZH2A 3T3GA 1DELA 5EWJA 3KR9A 3Q6NA 5GM2A 4WXPA 3PFCA 1NVUQ 3R7AA 2XY5A 1Z4LA 2B0CA 2F7SA 2HTEA 4IIJA 4XD7A 4JV1A 2WWWA 1L3UA 3BD7A 3VNUA 2ODAA 1UBGA 2VHWA 4B3CA 1PLJA 1H2YA 2ACVA 3AUXA 5CM2Z 3CE9A 4RD6A 2ZBQA 4FSHA 4JP2A 4QO7A 1SL0A 1KMMA 5H70A 2XAAA 3JQGB 4XYEA 1PL7A 4ZHQA 5J43A 4CCWA 1MEEA 2WFLB 2HHJA 3LTEA 4FT2A 1ZNXA 3IQWA 1J0AA 3TZHA 3WYNA 3IDAA 3ZBTA 5KFXA 2XZPA 4ZEOA 1JLLB 4QOSA 3KJHA 4WOJA 3VDNB 3G9QA 5J2TA 4PH5A 2RLTA 1AK2A 5CA1B 3V4ZA 3AY0A 4PYIA 1WSAA 5EE5B 4PPGA 1NK7A 3VC8A 1ZD9A 2HBLA 1JNYA 2W8BB 3KEOA 4PZYA 4RY2A 4XB1A 1O96A 1QDUA 3T5LA 4UAVA 3N7TA 1YL5A 3PP8A 5A7FA 2O19A 5B58T 1XZAA 2WB1F 1KK2A 2QMZA 4P5EA 2FETA 4Y2UA 3N2KB 4E0BA 3N28A 1T5TA 3HCOA 2VTBA 2HOFA 2C7OA 3A4NA 5A4IS 4BQFA 2ONCA 2W7PA 3D81A 1OXVA 2M6RA 2WSSD 4B71A 1ZN9A 5ADUS 3FUXA 4IXWA 3PNVA 3R74A 2H1WA 2HMUA 1OWMA 1HBJA 3E7DA 3OEEA 1U3WA 5ETJA 1K86A 2W6JD 2LYAA 3ABOB 4B35A 4Q7QA 1R5NA 2BFDA 2OVFA 1RYFA 4QGAA 4LCBA 1ADJA 2CVFA 1JFVA 3RFTA 4RTKA 1L4HA 1NXTA 2I6SA 4HFNA 2X9GA 3BZCA 5DQGA 1BVUA 2OY0A 2OWEA 3G9ZA 3OUZA 2RK6A 4Q3NA 3DJYA 3A1DA 1KJQA 2O05A 2D1RA 4H7JA 3AEUA 1W2GA 2OCDA 3AHJA 3WWZA 1ZGAA 2IHVA 4N54A 1TK2A 2I22A 4Q00A 1VYHA 3H9BA 1WZ2A 3D8TA 4MRMA 3AM1A 4DF3A 1SXJB 1K7CA 1UM9B 3X1DA 2R9VA 3DZFA 3ANTA 3QVUA 1BVRA 2Y0BA 3I3SR 4NLZA 3OZAA 1HZJA 4HI0E 2Q62A 3G2LA 2P6UA 3MT9A 1RRCA 3H2SA 4W4TA 3KHGA 1DXSA 2VHQA 3RS0A 2OLJA 3ZWPA 4BJHB 1VL1A 3WU2U 1L2TA 4IXMA 3EASA 4MF2A 8ICAA 3O90A 4IJWA 3EAGA 5CRXA 1KO4A 1QNFA 1WZEA 3KQVA 1H5NA 1M7GA 4EGCB 2VRNA 4PGHA 4HWRA 4QQFA 2L0XA 4X20B 5E4TA 4ARZA 6LDHA 2JD1A 3CEPB 2V6GA 5EGNA 1DC8A 1ABBA 1QH8A 3DLCA 1J1IA 2F48A 4WEQA 5G02A 2LBPA 1W1WA 4HHEA 5TS2A 5JC1A 1TPZA 2O0LA 1FLNA 3E9NA 4HB0A 1DKLA 3CPJB 4MPPA 4M99A 5K3BA 1ZQ1A 2QSJA 2QN3A 1C8KA 2FFRA 5FB3A 3RK4A 3BJZA 4A6PA 4BKUA 5A5FA 4KQKA 3KJNA 1U0JA 3HXLA 3FCXA 2A0KA 2E18A 2CXNA 3K5PA 1VMAA 3M7DA 4LE0A 3NBKA 4RBNA 3RBZA 4ARCA 1PKEA 2YNMA 4WK0B 4NAVA 1NN3A 1XZ8A 4NCNA 4UCXA 3F9IA 1OXKB 2ZSBA 3BWVA 2GJ4A 3Q8KA 3WGNA 1ODJA 3EBOA 1S89A 4QKQA 3WQRA 3OY7A 4LWQA 5EMJA 2X8LA 3PIRA 2C2RA 5IUJC 1H5UA 2QNRA 1JNXX 5F1KA 4A8JC 3OBIA 1W5SA 2CZCA 1VLZA 3LQFA 4KMRA 1DXQA 2I7DA 4LDZA 2PT9A 1N3IA 2G1AA 2VZLA 3BD9A 3BXFA 3FE2A 4Y9UA 2IA5A 1MAHA 5EIHA 1UK8A 2B8WA 2MYUA 1GL9B 1CNEA 2FW6A 3WB0A 2D0PB 3HYCA 5K6TA 3THWA 2AN3A 4AX8A 2P4EA 4GDFA 1WXIA 2HA6A 3FOWA 4RQMA 1E2LA 3DA8A 3TZLA 4X3CA 2P66A 4O4LF 3TLAA 2FFHA 4TKVA 2YB4A 4DL2A 1PFQA 3GZ4A 3MB8A 2PS9A 1EGHA 1V6SA 4ZTUB 3KR2A 1UDWA 1SKYE 1PJ8A 1S10A 1VIYA 1DX9A 2XA9A 3DMDA 3HKEA 4NZZA 4YQYA 4AJJA 3KNZA 2VT7A 4X63A 2PT7A 1XWFA 1H4QA 4NNOA 1Y5IA 5JNUA 3L49A 2FA9A 3OQIA 1VKOA 3R76A 2Q3EA 3RSGA 3KQQA 4FZ3A 3L93A 4HN2A 5C52B 3BT7A 1VXRA 1KOLA 5IIJA 2YZMA 2ZI6A 4B9UA 3HXQA 1HDRA 2RP5A 3ITKA 3FOZA 3T7CA 4EP1A 1G41A 1B6TA 5COQA 4B7CA 1U2QA 4ZEWA 3K31A 4MS4B 3ROFA 4CEHA 1VG9B 3CX8A 4DVJA 1JFTA 3LUJA 4GZ5A 4U6NA 5KPJA 1DG1G 1CS4C 3V1NA 1DBRA 2FI1A 4IO1A 4J7UA 1NQOA 2HSJA 3K0AA 1EM8A 5L1IA 2A1TR 2B6HA 8ICFA 1C2TA 1EWKA 1KHTA 2BEKA 1RRPA 3K96A 1KJ9A 3NATA 3SVZA 2A1JB 3EYWA 1EUCA 3GIMA 5JS2A 5E7IA 1R12A 2KJ5A 1SA0B 1ODSA 3EA5A 3KTOA 2GXSA 2OYCA 2XF8A 1PDOA 2ZUDA 1YQDA 2JH7A 2UXDB 3W3ZB 1KMCA 3LK9A 4R9SA 2IXTA 5D3KA 2C4VA 3GLRA 1NG9A 1UZMA 1QFZA 3DMFA 3IOEA 1ND5A 1MO3A 2FN7A 1X86B 2H1IA 4G0YA 3RJZA 1C1YA 1OXMA 2A5FA 2D1SA 1D3AA 1USWA 2W2VA 1H23A 1I5EA 2PG3A 1JZTA 2V6BA 3FHJA 1K66A 2R8RA 4XKJA 3V2UA 3VH1A 4LW8A 1XX6A 2DHRA 3DZCA 4M1KA 5DLPA 3A11A 1FNMA 4YLGA 2VNJA 4Y2TA 5IK2A 3U26A 2IUUA 4OA8A 3NTVA 4WZAE 3WYEA 5KAFU 2HRDA 4R1SA 1WRBA 2BN4A 3JQAD 1RP7A 3K94A 1BNOA 2OQ2A 2VWHA 4L2IB 1MIOA 1SC3A 3W5SA 2QN7A 1CXZA 3OZ7A 2NO6A 2XLCA 4H1HA 2PQ0A 2P2SA 3JRXA 2GWSA 3GZNB 4Z8XA 3JATB 3B0YA 5BOMA 4AMUA 1OF1A 2FSFA 3ZYCA 4OGWA 3ZLTA 1I5RA 2H92A 3FR7A 1TZBA 4G0PA 3W9BA 4HWGA 4G84A 5KDOA 1N9GB 4UM7A 4MUIA 4JJKA 3CQ9A 3LOUA 3C6MA 3M7IA 1SB8A 5CA7A 1U11A 1C3VA 2CCJA 1GYPA 4QARA 3RSCA 2BF4A 4QJFB 1JV2B 4X6LA 4POOA 4EB6A 5B7PA 4N82A 2Z4SA 3K6KA 2I4RA 2DVMA 3AFNA 1E58A 1Q92A 5D3ZA 4L6CA 3I0MA 3KB2A 1R37A 4R9UC 1WXHA 2Q5JA 1SAYA 2Y93A 3KVYA 3QWHA 3I39X 4N18A 2IPNA 4DSTA 1PWYE 2A7XA 5CXXA 1JHVA 1JPUA 3OESA 4EYEA 2QLTA 3ECCA 2F1RA 2D3WA 2WTUA 5EHNA 4D8XA 1WD7A 1THZA 3ELDA 3URMA 1JL3A 2HA5A 5LPNA 1VZ3A 3B2EA 4RVDA 4BMDA 5K8VA 1KPHA 5DJ5A 1R6DA 1ZX1A 1K5DA 1E2NA 3JAMA 5KNBA 1WW8A 4BJ3A 4EY6A 3G0GA 1LK5A 1E3SA 3BRQA 2Q49A 5TR9A 4OBEA 3R40A 1IZYA 1M8PA 4EG5A 5KWIA 5KFIA 5BV7A 2I7XA 3R3HA 3KUXA 4S04A 3WLKX 3NAMA 4L2IA 1HMYA 4O0MA 621PA 1IXYA 5BN3B 4OXIA 4LI3X 4RPIA 1Z0DA 2PDAA 3K0FA 1E61A 2GSDA 3N2EA 3S5JA 1IXKA 2UZ1A 1GPUA 4JOQA 4C8MA 1JG7A 1EWRA 1XRNA 3ISVA 1OZGA 4G26A 2QGNA 2X5NA 9ICEA 4OXQA 4S24A 2KFZA 3A9TA 2X1HA 3GILA 1FNSA 3LVFO 4I5DA 4UW9A 1RWQA 3I28A 2JVJA 2O6LA 5FWXA 3VVLA 4BTLA 1FMFA 5LLTA 4OL9A 4PHAA 3X1YA 1XRMA 3KU4A 2W7TA 3EUFA 2VUUA 4F71A 1N25A 4M49A 4H3VA 3V2GA 4BL5A 4ZJYA 5IT0A 1I7DA 1H0HA 3ABQB 2B78A 3P19A 2ZE8A 1VL5A 1JU3A 3C5GA 3EF0A 3L7OA 3AUAA 4L4SA 4ZP1A 4B31A 5JS7A 3TZ6A 2H7VA 4RT2A 1E5LA 3EDRA 4D9NA 1J25A 1GNRA 2LBOA 1DTSA 3RS4A 4G0UA 1W34A 4JEIA 2C5AA 4NCXA 4LTMA 3SIPA 3KL2A 1IJKA 4XE5A 2NWQA 3OJCA 4DQRA 3BE5A 1RWXA 1GGJA 3C5FA 3GEHA 2R8BA 3N0XA 3ZNNA 1CQIA 2NZ8A 4IDCA 3ROKA 2WF9A 4U2KA 3F5EA 5AK6A 1GQ2A 4M9HA 1TK9A 3W5HA 1M1YB 2X5JO 3T7RA 3B3FA 5MDHA 4FFLA 1P1KA 1VE3A 3AU6A 4KKVA 1S3SA 5CB4F 1YE3A 4BLUA 3AEZA 1KOJA 1GGFA 4BE9A 3GVXA 3L0BA 4NEGA 1U0SY 1M8KA 3ZDAA 1MKYA 2PGLA 5JCXA 2RH4A 2Y0SF 3EDQA 3IAS6 4C6RA 3OLYA 1P44A 1SVLA 4KUGA 1J1UA 5SYAA 1XIVA 3EUWA 3GLKA 3ZDEA 3JCZA 4XJXA 4DL4A 4HFJA 1II8B 2XNCA 3PHBE 1THGA 1ST3A 4R1QA 4UCQA 3T5PA 1L3BA 2HMVA 2FGKA 5D5HA 3NGMA 3TRKA 3JSAA 4UBCA 1JBQA 1XYGA 3EIQA 1K5GA 3DT6A 5DLDA 3ZWVA 4BMZA 5K3DA 2QRUA 4DHWA 3IQXA 3UUWA 3CM0A 3PUHA 2ZETA 2PGDA 4QJ5A 5A4JA 1T8WA 3RB0A 1Q77A 2ZXUA 2JZBB 2BCEA 1KXZA 3ILHA 5COAA 3WL8A 1N33B 1CFJA 4B2IA 1KJZA 1S01A 1UP6A 3KT8A 4PQRA 2WWIA 4H6XA 1YASA 3UQ0A 4RNNA 4EHHA 3G8BA 5IDWA 5AI8A 5AKIA 4DJDC 2BDEA 4DLYA 3FNEA 3TGPA 2F1JA 4ATNA 1KI9A 3NBUA 5B36A 1I2DA 3EIWA 3GLGE 3QX8A 3M9OB 2IE8A 4FU0A 3V8BA 4BO3A 1ZJ5A 4I2AA 3R5TA 3S3TA 1UCFA 4ECVA 1U7PA 2BEUB 3EQZA 3EY4A 4X8HA 2J85A 2E82A 1PYOA 3UK0A 1W4LA 3FSRA 1MRSA 3FZNA 1AQLA 4O4HA 1KGSA 2BFMA 2FW7A 1R6XA 3OJWA 5IU6A 3AR5A 3RAEC 3OUTA 1VA4A 4ZGBA 4ND5A 4CU5A 1ZXLA 3LG2A 1PR3A 4IS7A 2Z98A 2BPCA 1KEZA 4BO5A 5CBPB 3C7DB 2H08A 3NW9A 1C1HA 4JLMA 3ML1A 1QH0A 2BR5A 4FN5A 1N34B 5TGTA 1RP1A