2F8LA

Crystal structure of a putative class i s-adenosylmethionine-dependent methyltransferase (lmo1582) from listeria monocytogenes at 2.20 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
323
Chain Sequence
ANEATQELFQVLDNTAIILQNELEISYLEAVYETGENLFQKEVLQKEEKQLKLQASYESIELENFSNEEIRKGLQLALLKGMKHGIQVNHQMTPDSIGFIVAYLLEKVIQKKKNVSILDPACGTANLLTTVINQLELKGDVDVHASGVDVDDLLISLALVGADLQRQKMTLLHQDGLANLLVDPVDVVISDLPVGYYPDDENAKTFELCREEGHSFAHFLFIEQGMRYTKPGGYLFFLVPDAMFGTSDFAKVDKFIKKNGHIEGIIKLPETLFKSQARKSILILEKADVDVKPPKEVLLANLSSLTDPSVTAPILAEIENWFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (16411011) from Listeria monocytogenes LI2 at 2.20 A resolution
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords hypothetical protein lmo1582
total genus 113
structure length 323
sequence length 328
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.470 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f8lA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2f8lA02
2IGTA 4X60A 3UBTA 4M38A 2PWYA 3PFGA 3EMBA 5EC8A 3P8ZA 8MHTA 3ELDA 5E2AA 5BW5A 5E8RA 2BR3A 2VDUE 2P3LA 4PONA 5T6BA 3TMAA 3X0DA 3SVZA 3KQOA 3PT9A 3TQSA 4IV8A 1IXKA 1SQGA 1VL5A 3FPHA 4X41A 3HNRA 5HOQA 2ZULA 2JHAA 1G8SA 3GDHA 2ZLBA 3MTEA 3P2EA 4F86A 5JR3A 5CVVA 1RJEA 5EEGA 5E1DA 2UYOA 3NTVA 5CVJA 5DM1A 4FZVA 1N2XA 2IDJA 3B7PA 2P35A 5KVAA 3R0QA 4R6XA 5P8WA 5E1MA 2AVNA 4MHTA 1NW7A 2B2CA 1KIAA 1P1BA 3M6VA 1G8AA 3O31A 3KR2A 2UYHA 1XJ5A 4MQ4A 2FK7A 3OU6A 3CKKA 3O7WA 3A26A 3HCAA 4DCGA 5DM2A 1SUIA 1TPYA 2IIPA 3H2BA 5GOZA 3UJ6A 4CKBA 4RTSA 5K0BA 4GUAA 2QYOA 1P91A 3ER8A 1G6Q1 2ESRA 4BY9E 5ICCA 2AOXA 3UWPA 3FPFA 2BR4A 1YB2A 1G38A 2IFTA 2QE6A 3S68A 3KQQA 1VLMA 1TW3A 4HRAA 4DA4A 4Z2YA 1R6AA 2EG5A 5MHTA 2I62A 4YMHA 3F4KA 3BT7A 5HIJA 3I58A 4PGHA 2I6GA 3EVEA 4OA8A 3NWEA 3PVCA 4PYLA 3UFBA 4E32A 3D2LA 4QPPA 3FZGA 3HEMA 2QRVB 3C3PA 3KR9A 5FHQA 3M6WA 3RODA 5DRTA 3CJRA 1AQIA 4PIMA 4E2ZA 2NXJA 5FTWA 2PY6A 3P9CA 4BLUA 2VZ9A 1FP2A 2A14A 1I9GA 2KW5A 2N47A 3HCCA 3LHDA 3MB5A 2BH2A 2ONYA 1EJ6A 5EKUA 3ERCA 3GJYA 2IBTA 1FPQA 1RI5A 3LCCA 2Z6QA 1O54A 2ZVJA 3PFHA 4OQEA 4AZWA 4DMGA 1M6YA 4E70A 3T7TA 3AXTA 2YX1A 5K0GA 2GH1A 5F2OA 2IH5A 2ZIEA 2YXLA 4PINA 3G2MA 2HTEA 3EEYA 3QV2A 5LQNA 4MIKA 3HA5A 3MGGA 3CCFA 2FRXA 1OR8A 2OXTA 2AOTA 4PGGA 1ZQ9A 4BLWA 1X1BA 4RTQA 1QAMA 3KR0A 5GIPE 3C6KA 1XDUA 3GRRA 4LWOA 3UA4A 2BR5A 3IV6A 4XUCA 3RW9A 3E7PA 3EEOA 5FUBA 1X1CA 2BM8A 4V0QA 2GLUA 4KDRA 5EG5A 5E8JA 4HG2A 4M36A 4QTTB 4YV1A 4FR0A 3ID6C 5DM4A 1EG2A 3TLJA 2O06A 1R74A 3AY0A 2G72A 1I1NA 3SMQA 3BWYA 5EZQA 1O9GA 1L9KA 2ZBPA 3EGEA 3QOXA 2PXXA 3MQ2A 3FUTA 5FWDA 3OCJA 5EMMA 2ZTHA 3ME5A 3HCEA 3G2OA 3UJ9A 3KHKA 3WSTA 5K03A 1SG9A 4RTLA 1ORIA 3NVMB 5KQRA 2YXEA 1Q0TA 4X61A 4HC4A 4PIPA 4R6WA 2GB4A 2YQZA 3MAGA 2G71A 1YUBA 4H0NA 4ZTBA 3NJRA 2O05A 3P71T 2FK8A 3P9NA 5KQSA 10MHA 5T67A 1X1DA 4PWYA 3OPNA 3R3HA 1N7JA 3HM2A 4E31A 3LBYA 3QOWA 5K05A 1XDZA 3REOA 3FYDA 3KPUA 2IH2A 3DXYA 4C04A 2HV9A 2CKDA 2ZBQA 5EMKA 5M5BA 4RTOA 4HGYA 4L7VA 1UFKA 3HCFA 1O9HA 1AQJA 1D2CA 1DCTA 3BKXA 2PGXA 2ZWVA 3NDJA 2DULA 4PYQA 2PLWA 2ZIFA 4GOND 5EHGA 2P7HA 2AR0A 2AOUB 3KQWA 4A6EA 4BP1A 1RI3A 1B42A 3LDUA 4POOA 3FUXA 5K01A 2G70A 3A25A 3BGDA 3LSTA 1QAQA 1KPIA 2YTZA 3TKAA 5LQRA 4CXMA 2XYRA 3R6TA 5GM1A 4KIGA 1M6EX 5D1HA 5GM2A 2CL5A 3G2PA 5DPMA 4CKCA 1Q0SA 3MTIA 1R8XA 2IBSA 2JHPA 3KPYA 5C1IA 4DKJA 3IHTA 3A27A 3DMFA 1SQFA 5E9JA 5EKXA 3THRA 3KQMA 2PKWA 3K0BA 3SGLA 5E9WA 2WA1A 4RTPA 5FADA 3HVJA 5EIWA 1XTPA 2AOVA 1SKMA 3EGIA 4EKGA 4IKPA 1XVAA 4C06A 5LQUA 2LD4A 3SSOA 3KKZA 4ATNA 4DCMA 5DSXA 1ZGJA 3FPGA 2PX8A 2NXEA 2CMGA 3NWBA 3AJDA 3B89A 1G60A 4HSGA 2NXNA 2BZGA 1FBNA 2V7EA 3BGVA 4RSRA 3HA3A 1X1AA 2R3SA 2JHCA 3LECA 4M37A 5DT2A 5FQNA 2HMYB 2PT9A 1L3IA 2AZTA 2IPXA 2PT6A 5EEHA 3UA3A 1BOOA 3GO4A 5B1SA 1VBFA 3LX6A 5D1NA 3UZUA 4ER3A 5G02A 1NE2A 2EJTA 3PX3A 3Q87B 2WA2A 4GQBA 4LG1A 4R05A 1PJZA 3IYLW 3KPJA 4OQDA 2R6ZA 3TFWA 2EFJA 3G2QA 2O57A 1ORHA 3UJ8A 3LGAA 5F2NA 3UJCA 4PYNA 4MTLA 3HP7A 2P41A 5C0OE 1T43A 2JH8A 3LL7A 3OZRA 3FUWA 5HFJA 5JUWA 5KYGA 3LCVB 3JWHA 1VQ1A 1UIRA 2JJQA 1JQDA 1D2GA 2YR0A 4AZSA 5IKMA 3PTAA 3I9FA 2IDKA 5U4XA 2B9EA 3O4FA 5LR6A 4PCLA 4F85A 4K6MA 1XCJA 2PV0A 3MERA 3DR5A 3T7SA 3DLCA 1ZGAA 3G89A 1JTEA 4PCAA 3MCTA 3TOSA 5EOVA 2AN4A 3BXOA 3GNLA 1XDSA 3BWMA 4PYMA 2ZWAA 2AOWA 4E2YA 4YUWA 3FYCA 1RI2A 1TW2A 1EQAA 4FT2A 3SSMA 3NMUF 1IM8A 4WXHA 2HNKA 1JG1A 2ZIGA 1PRYA 3B3FA 4OA5A 5CVUA 1VE3A 4ER6A 3ORHA 2P7IA 3I53A 4OBXA 4CKEA 1YFLA 1FJXA 2I9KA 2Y1XA 3CJQA 4FS8A 3UJAA 2I7CA 4GC5A 5HILA 4KRGA 2PWPA 5DWQA 3T0IA 3JWJA 3A7DA 3OFJA 2OYRA 4AZVA 1KP9A 4BP3A 4DF3A 3KQVA 4ISCA 4YMGA 1NV9A 3CGGA 3DMGA 5DX1A 4E2WA 2ZBRA 2NYUA 3PB3A 3C6MA 4GF5A 4GC9A 3AWIA 3KQYA 5K0LA 2PX2A 3UJ7A 4XUEA 1DUSA 2XYQA 4V0RA 1EJ0A 4C05A 3ER9A 4AZTA 4KWCA 3DP7A 1EIZA 2OPBA 3G8BA 2ZFUA 2P8JA 2ORED 3GWZA 3M33A 2CMHA 5HZMA 1BKYA 2G1PA 3VSEA 3OE5A 3L8DA 5E2BA 2NNWB 4KIFA 3MHTA 5H02A 3FTDA 3DUWA 1QYRA 4NECA 3KQTA 2WK1A 4YV0A 4OBWA 2YXDA 4C4AA 3V97A 2XBMA 4MWZA 5HEKA 2XVAA 3EVDA 1L3BA 5CCXA 3GRVA 3OU7A 3GRUA 1KXZA 1L1EA 2O0LA 4FT4A 3M6XA 4P7FA 4PYIA 4QTUB 1KR5A 5FQOA 5LQKA 4X1OA 2EX4A 1SVUA 4FSXA 4ER5A 5C9ZA 1DL5A 3IEIA 2C7QA 1JSZA 2G8NA 5ICGA 1WXXA 3A4TA 5EGSA 4GOOD 5CVDA 5HIIA 2EJUA 4ER7A 3KR1A 4GOMD 1NBHA 4HTFA 1R18A 1IY9A 3HVHA 2ZCJA 1YZHA 3FTFA 3HVIA 4GBED 4C08A 2OY0A 3C3YA 4EK9A 1SUSA 3T7RA 4EVIA 3FTEA 4HTFB 5K09A 1XXLA 3OE4A 5EHIA 3SR4A 2IH4A 2FYTA 3BGIA 3G5LA 2V74B 2VP3A 3AXSA 3ELUA 2C7RA 1RI1A 2UYQA 1YF3A 5K0FA 3ELWA 2XVMA 4FP9A 3EVFA 4QVGA 5DTRA 1Z3CA 1F3LA 1ZG3A 3GXOA 4WVLA 1WXWA 4G56A 4U7PB 3KU1A 4AUKA 2K4MA 2H1RA 3B5IA 3OZSA 2O07A 4RVFA 5EQJB 3MCZA 2ZZNA 3HTXA 2DPMA 5LQJA 2JG3A 5FA8A 2ADMA 1KYZA 2VDVE 4QVKA 4FGZA 5CIYA 1NW3A 3FPJA 3BWCA 2OBFA 3JWGA 5CD1A 3P2IA 3NDIA 3KPWA 5EPEA 3CBGA 1JTFA 4U7TB 3B3GA 3FRIA 1KPHA 3BWBA 3TRKA 4LWPA 4R8RA 1Y8CA 1R8YA 3GGDA 3R24A 4RVHA 4GOLD 5ERGB 3E05A 4DQ0A 1L3CA 4E33A 4KDCA 1NKVA 5FCDA 5CCBA 4RX1A 5HIKA 3P2KA 5DSTA 1M0EA 3RIEA 4QQNA 1ZKDA 3TPZA 2AOUA 2Y1WA 2P1DA 9MHTA 3NVKI 1MHTA 2IP2A 3BKWA 2E5WA 1JG4A 3VC1A 4EMSA 3GRZA 2PJDA 1P1CA 4FSDA 4QDKA 3OU2A 4XUDA 2ONZA 3U81A 5LQCA 3HCBA 4PYKA 3TKYA 2ZZKA 5EZSA 4PYOA 5EVJA 1NBIA 1JG2A 1VP9A 3EVBA 3P9IA 4RTMA 4F84A 2AN5A 5EMLA 3VC2A 1D2HA 1HMYA 5FA5A 5E1OA 3EVZA 3PS9A 4O29A 4PYJA 5K0JA 1MJFA 3HVKA 1AV6A 3TM4A 2ERCA 5DLYA 2YUIA 4CTJA 5DTMA 4UOEA 3GRYA 2Q41A 4M7RA 3K6RA 2ZSUA 1JG3A 1VPTA 4JXJA 5K0NA 4YUVA 1YFJA 4IWNA 4ER0A 3E8SA 3LBFA 4GEKA 2PXAA 3SM3A 1FP1D 3NW9A 5FHRA 1AF7A 3G5TA 3LKDA 2ZW9A 2AOTB 2AN3A 1F38A 2JH9A 2OO3A 3HA7A 4P7JA 5DM0A 4BLVA 2Z6AA 1RJFA 2PX5A 4EQZA 4HH4A 3V8VA 3G8AA 1VIDA 2BM9A 3SXJA 1BC5A 1NV8A 2QY6A 5BW4A 2B78A 4QPNA 5BP7A 2YVLA 7MHTA 2PSSA 5T64A 2OB1A 5EIFA 5DRYA 2H00A 3LPMA 1YZ3A 5GP1A 3DULA 3PLAE 3CVOA 1WG8A 3Q7EA 4R8SA 1ZHFA 2UYCA 4KW7A 4RTNA 3LDGA 3SSNA 5GIOE 5LQAA 2AVDA 2GAFA 5DXJA 3R9XB 4XCXA 3GU3A 1UWVA 4E30A 4YV2A 1JR4A 3E23A 2QM3A 3FRHA 4RTRA 3UJDA 1NW5A 3CJTA 4DZRA 1X19A 3I64A 4IV0A 5DX8A 1WZNA 5LSAA 3EPPA 4LECA 5ICEA 2AS0A 5DTQA 5ICFA 1H1DA 3PX2A 1WY7A 3TR6A 5K0EA 3TM5A 2OB2A 1JSXA 3CC8A 4CWAA 1NT2A 3OZTA 3KQSA 4YUZA 1P39A 4RYLA 5EMJA 5KS2A 1RJDA 1V39A 3P9KA 2P40A 4CTKA 3ELYA 2UZ4A 5GWXA 1RJGA 4RTKA 4RVDA 2C7PA 3G88A 1N7IA 3P97A 1BHJA 3M6UA 4A6DA 2HR1A 2P3QA 3HCDA 3FTCA 5DX0A 2GPYA 3JWIA 3A7EA 3EVAA 3OFKA 5DXAA 1U2ZA 4RV9A 3KQPA 5K8VA 4RTJA 1RI4A 3DH0A 2XYVA 4OX9Y 3KPVA 1EAMA 3FPEA 3ANXA 5CM2Z 3FUVA 4EKIA 3EMDA 1KPGA 3DLIA 4RWZA 5FWAA 2OKCA 4C07A 2NP6A 3DMHA 4P58A 5E1BA 4YUXA 5CUQA 3GIWA 4KVZA 2PX4A 2VDWA 3M70A 4AX8A 5HIMA 4QDJA 2PVCA 4HGZA 3I5UA 4QQKA 5E9QA 4P7GA 3THSA 3G7UA 2B25A 5CVEA 5FULA 2C7OA 1JQEA 1INLA 2OZVA 1KHHA 1QZZA 5IH3A 2ZZMA 2FHPA 2H11A 2QRVA 3DOUA 3GCZA 3LCUA 3C0KA 5F2KA 4RVGA 3DXZA 3LKZA 4B17A 1NW8A 1QAOA 1QANA 2Z6UA 4E2XA 3SX0A 3VYWA 1KYWA 2B3TA 4X63A 3UJBA 5GINE 2P3OA 4PNEA 1WS6A 2FCAA 5BXYA 1XCLA 3EVCA 2F8LA 2CWWA 5K0CA 3B3JA 3DXXA 1NW6A 3M4XA 1R00A 3FUUA 4C03A 2FPOA 2VS1A 4P7KA 1JQ3A 3EVGA 4YUYA 2HWKA 1G55A 3BUSA 4Y2HA 4DM3A 1I4WA 2GA9A 2PBFA 2PXCA 3DTNA 1HNNA 3BZBA 3LDFA 2NXCA 3EGVA 4Y30A 2NP7A 1VP3A 2GS9A
chains in the Genus database with same CATH superfamily
2NU6A 4BVLA 5TPWA 1T1RA 4TS3A 3A6DA 3ELDA 1FJ2A 5E8RA 1L4LA 1GPUA 2BMWA 2VDUE 4PONA 5K3FB 1YCFA 2HMVA 2QG4A 1MJ5A 5AHWA 1E7RA 3I2HA 3U3OA 1V8BA 1SQGA 1VL5A 1UBJS 2R1TB 4EECA 3TIFA 1CF2O 4JJ4A 1AO0A 5JPCA 2REXB 3ENNA 2K8AA 3R3SA 3JRWA 5DM1A 3HO8A 1GGHA 1ZQLA 1BDIA 4ICAA 1VHTA 3I9V6 3D54D 3PRYA 3UHFA 1KIAA 1GNRA 5AKIA 5L1KA 1TD9A 1PTJA 2MSKA 2J9XB 4FFBA 5I7UA 4IVQA 3Q8WA 4MQ4A 1NLFA 3I4CA 2RGUA 4UFNA 1SPBS 4FYYA 4WXYB 3BQTA 4E1VA 1SN7A 4WQMA 5BUSA 4RFSB 4ZQFA 1ZC3A 3QQPA 3WIUA 2ILVA 3IAFA 4ASUD 2VBFA 2JLCA 3TE7A 2WNSA 3A0HU 3CR3C 4BY9E 2YCLA 4QULA 5ILQA 3PJGA 4JU8A 1UM8A 2L42A 3IDSA 4JU9A 4RA9A 4DR4B 4X45A 5B2EA 1R37A 3LW7A 3RBEA 2Y4OA 4TZ6A 4S35A 3BT7A 3H5IA 5BV7A 4WY5A 1F6BA 4E4YA 1NBMA 2ASVA 2OD7A 4HLUA 4XDYA 4I50B 5LLDA 1SXQA 4EKEA 1SUWA 2DHCA 4JEUA 4Z4EA 1Q57A 1TUEA 4YJ3B 4BN5A 2GFIA 2IQ5A 2C2EA 4LQDA 3ZWYA 4E2ZA 1U9CA 2C2BA 3EXG1 1HRKA 1CR1A 3KL2A 1K4KA 3D6FA 4LY0A 2H5IA 4Q3DA 3T38A 5AYVA 1EESA 2V6FA 1U0EA 1T9CA 4PSVA 1GRQA 2ZG6A 2KSOB 1TZBA 3UBTA 2QW1A 1RQRA 1O54A 1O0SA 4IAOA 2VWQA 2W3RA 3R8FA 1HE4A 3M49A 3O3NB 1OZAA 3V72A 1G20B 3AMZA 3KOZA 1JLLB 2YXLA 4G2NA 4PINA 2BPGA 2JAXA 1JIHA 4WADA 3QNUA 3M6ZA 1JYEA 1SOUA 4F8JA 2ZDQA 3GGJA 2WJAA 4MVJD 2XUQA 5EXDA 5HZGA 3IG5A 1TM2A 3D2NA 1OR8A 1VIVA 2KBFA 3AIIA 3QE4A 4L6CA 1KZ1A 4PGGA 3ZIUA 1E3WB 3QFSA 1HK7A 3E58A 4JXKA 4CGYA 1X6IA 4D42A 3UMSA 4F3TA 4KN7A 1D6MA 3BB1A 4CUZA 2EDCA 5H9VA 1R0SA 3UCXA 3DVRX 2WD7A 3E7PA 5JSKA 1CJUC 1NK8A 1X1CA 2Q5LA 4L08A 1SOWA 3RB3A 4CL0A 1MX3A 2R9VA 2WFLB 1KFKB 1DOHA 1K7FB 3O8DA 4QTTB 1KETA 4G5XA 4B6OA 3B1VA 4X3OA 3IRVA 1I32A 1KR2A 1OV6A 2R8KA 1D9ZA 2G72A 3FHCB 1CDDA 3SYTA 2JZOA 1ORVA 1VMDA 1O9GA 3PFWO 1CB0A 4AP6A 3L4KA 4OHRA 4RT3A 3KZIU 5JZSA 1WNFA 3VR2D 2W43A 4UQGA 5JCOA 3LKBA 5BQ5A 4BQFA 1PJBA 1XYYA 1S3SA 3EXHA 5HBRA 3OIDA 3OF2A 2W04A 4NVRA 2YQZA 4IQWA 1XSEA 5DBOA 2O8VA 4AJ4A 3G7SA 3TTSA 1DKMA 5BQXA 4WW0A 2G6BA 1N36B 3ZI0A 1T8SA 1VL8A 5J47A 3W3AA 2CCGA 2ECKA 4AO7A 1Q46A 4Q7JB 2F1JA 1N7JA 1NY6A 4BB6A 4ECZA 4HDQB 4X20B 1R1DA 1K92A 3I9MA 1E92A 1XL1A 5J5CA 1VGQA 1GZDA 1I3NA 2AWOA 1ADFA 2VYND 5D7NA 4ZRNA 4CVNA 2I4LA 4M0PA 3D8UA 4Z9FA 4CIXA 5JCXA 4G1BA 4BU1A 2ZR0A 3WB0A 4BNLA 5KVVA 1DCTA 4RU1A 3IJEB 1GUZA 5EXPA 2RCYA 3V4VB 3ORRA 1R0YA 2DULA 2EFDB 1WB6A 1LDYA 3PUKA 4KO1S 1PK8A 1WTAA 4LJAA 4ZVPA 5TY0A 4WSOA 4RZUA 4M0EA 4YAJA 2EEPA 3ZE1B 5IK2D 4U7JA 2YFKA 3BGDA 1QCKA 1H5QA 1KPIA 2WD9A 4UOQA 2BFDB 1J2UA 4HQFA 3ZCRA 2PKQO 2FUG6 4CKCA 1E1DA 2OXFA 3A31A 4J1NA 4MKZA 2JHPA 3PFCA 4YJDA 1MU0A 2OHGA 4JR1A 3EDYA 4M3NA 1HE8B 3QW2A 4L5AA 3DC7A 5F35A 1C80A 4QRDA 4B46A 1S9HA 3CLSD 2OM2A 3I8SA 4H6PA 4XD2A 3SJAA 5HKOA 2BI7A 2F3PA 1XWWA 2ZJFA 4F3CA 4D4HA 1AD2A 5IJZA 3BWVA 2F55A 2QG9A 3ZW8A 2WF5A 3QWAA 4KP7A 2A88A 2HUPA 1CQXA 1T3QA 2XWJI 4RVCA 4F5WA 1ZAYA 2QYHA 3OY2A 2ATCA 5BMVB 2V4QA 2HK9A 4DFJA 3LRPA 4WEQA 3KBBA 3B89A 1NPTO 4YWHA 2ZJ0A 3BGVA 3DBOB 3D0OA 3DT9A 4QZGA 4KLHA 1E6UA 1T4MA 1IN4A 2H9YA 4Q6BA 2JHCA 3LECA 5KAFU 4OXQA 5CP2A 1UPCA 5GZ1A 4YRRA 2PT9A 3ZDFA 4QUEA 1P75A 4NICA 1N5KA 1B00A 2YWDA 1N2SA 2CYCA 3QVWA 5FFMA 4IQUA 2RIPA 3BWDD 5ALMA 1Y8RA 2WA2A 2YOGA 1RAAA 3JQPA 4LOKA 4Q3OA 4F3NA 4UBBA 4OJ6A 4Q03A 3T5LA 3L6RA 3OMXA 4AFNA 3V6HA 4LJ5A 5EWMB 4C7KA 1WHSB 5IAKA 2YJ5A 4IIJA 1HDEA 3VHXA 4KPUA 4BKUA 4BQOA 2I4NA 4US1R 1U2TA 1QQ7A 1Y3HA 8ICYA 2O5CA 2EFEB 3S1AA 4PCLA 5ITZB 1EU1A 2A0FA 2BHLA 3U7RA 4JQZA 5DB9A 2PV0A 1IZYA 3DR5A 5KAPA 3EYZA 1I2CA 4C0XA 1UOPA 1TLFA 3O95A 3WB1A 1ISSA 2AXQA 4B3RB 1S10A 1DRVA 4ZTUB 1NSTA 3HGTA 3I9OA 1XMXA 4OLAA 1NONA 2BJHA 3U4MA 3BDIA 1FYVA 3QJ5A 1IWBB 4B3DA 1XZHA 2YV1A 5F98A 3NMUF 1B1AA 1IM8A 2KSOA 4P4OA 3O4HA 2HPVA 4IXTA 4AZ3A 2HFKA 2Z56A 5HG0A 4DQLA 1MDBA 1NSFA 2W2QA 4HAUA 3LPDA 4GDMA 1DRWA 2BEWB 4OBXA 4U7GA 2VPIA 4W7HA 4N5NA 5JPDA 3DPIA 2OQ2A 2FFHA 3PMNA 4KPGA 5C31A 2OYRA 4Q4JB 4YMGA 3AF4A 2TMGA 3JQFC 1SURA 3PB3A 1IOLA 1F06A 5EMNA 4YCBA 1T9AA 5JTIA 1ZYUA 3IHLA 4C05A 2HT1A 5ALIA 2FN3A 2HPAA 4ZCPA 2RGAA 1MABA 5JZMA 5J0PA 2ZYAA 4S2EA 2VWGA 1C9YA 2O8FB 1BKYA 2VSFA 3ONEA 1PFQA 1ABFA 3SEIA 1QHYA 2JJYA 1W94A 4JK3A 2X23A 3H0CA 1O77A 2GRAA 2V4ZA 3Q7PA 3STUA 1SUEA 2Z95A 2QTFA 1C7JA 4P32A 5HFNA 5HEKA 2EBWA 1ZQYA 5TC4A 3FC4A 1HYHA 1X13A 4MI3A 1JHAA 4DSKA 4PR0A 1Q3UA 1IJKA 1C5KA 2CL0X 3AHFA 2H7YA 3RGWS 4HAIA 3M6XA 1UBKS 3L4PA 1TC1A 3DT8A 2O7VA 3O91A 5KCZA 3SI8A 5JNRA 5KYWB 3K9HA 2E1EA 1HO3A 5EA2A 2NU8B 3HABA 3IVCA 1V71A 2ZJAA 1LBSA 4QXRA 4FOPA 1TCAA 4JY7A 1MD9A 2I7VA 4Z53A 1A76A 5KYNA 1WXXA 1OZ0A 1R0ZA 3WK4A 1RXEA 1X87A 1Z5OA 3H5TA 3KKOA 1JLRA 2FWNA 2OCYC 2PT7A 4O3OA 2YY7A 3QSGA 4JVMA 4PZDA 4ER7A 5TLSA 2VJDA 4YP0A 3H1EA 3IDFA 1A4UA 1ZQ1A 1RZ3A 3TBFA 3BH6A 3X1YA 1O5TA 3COYA 4V2IA 3U7QB 2G09A 2WJVA 3L8MA 3LIIA 3JX9A 1PW7A 4UCFA 1OLUB 2C4MA 4MUKA 1TVKA 4ENSA 4AMZA 1DHTA 3EC1A 1NDHA 2WU1A 3E9DA 4LOIA 4G5OA 2RKWA 3GFKB 2G9UA 2JGDB 5F7OA 4E3ZA 1XJWA 4NV1A 3I05A 3DAFA 5J2DA 2JI7A 4OBBA 5FB3A 1Z3CA 3GXOA 4FHEA 4Q4CA 3K05A 4I46A 1DEHA 1DTEA 1A3CA 1K97A 3AH8A 4DFKA 2K4MA 2PMBA 4G56A 4K1XA 4B81A 4HNVA 2V5VA 5KG3A 2JG3A 3KOXA 3TF5A 2QUHA 2VDVE 3L7BA 4BO3A 3BM5A 3CZ4A 2W2LA 4LV5B 4PNZA 2ACVA 1C14A 2BDEA 4NL9C 1R12A 2BKUA 4GL4A 3P2IA 1GTRA 3RK4A 1UBCA 2VCYA 1YU9A 1UXKA 3BWBA 1EDEA 2QVZX 2QJRA 3LXMA 1DTWB 4BFTA 4WNCA 5JTUA 3RYCA 3WGQA 4K7JA 2YJZA 1D9XA 4M0AA 1S0NA 2H0RA 3BJEA 3O3OB 4BVAA 5JI2E 3CB4A 3KO8A 3E05A 3H65A 2Z0MA 2RKBA 2ZXUA 1ZRNA 1EHCA 5CT8A 4NXNB 3LC0A 4XPIB 4NMXB 3WLRA 1RLIA 1B0AA 1B0PA 1ZKDA 1YR6A 2EJWA 4FPXA 4IX9A 1JDVA 3JAKA 4YRGA 3DHYA 3KAKA 2RD2A 4O0IA 3H97A 2OSVA 2D8MA 3RG2A 5AW0A 4GI1A 2FGKA 2P2DA 2VWHA 3WWDA 2ONZA 3KZOA 3LW8A 3HCBA 4MQMA 1LLFA 5BWBA 3R23A 3KJIA 2VT7A 3ONWA 1D4OA 4HNAA 2FPIB 5IC4A 1O0BA 1FSZA 4B9SA 1DIBA 5JVDF 1AS3A 1GO2A 1J5XA 3OO1A 5JT1A 1YQXA 4C87A 1JKXA 3EVZA 3B0XA 1CZRA 4D0SA 2IYEA 1XYVA 1AV6A 3E03A 4X8OA 1JR6A 3MILA 1NJXA 1YJ8A 1FFEA 5LDDC 4XLZA 4QGGA 3D02A 4V0SA 3QBJA 4QSMA 2O5RA 4K3VA 1NAHA 1TTPB 7ICTA 3PY8A 1J21A 5HGJA 1YFJA 3EVNA 4H3HB 3JQ7A 1NOKA 1JBEA 4KACA 1OLXA 4DG9A 3L4BC 5FRDA 2D5CA 4J3FA 1X7XB 3NHKA 2ODTX 1WRBA 3MJEA 1YDHA 1QDLB 3M3HA 4MQUA 1T9DA 4WPGA 1TEZA 2Z6AA 1XYGA 4XYBA 3IP6A 3BL8A 2C5SA 2ZQ5A 4C7BA 1LEHA 1H6DA 5EJMA 4BV2A 4F2SA 3NNSA 4N8SA 3IIEA 1N3BA 4JUZA 2X14A 4QPNA 2WF6A 5AQEA 2A1TS 2ZSAA 4JN6B 4TXHA 2MR6A 3LPMA 2OVFA 4S1PA 5EIFA 4ZCQA 3V55A 3VTFA 4F06A 3SYZA 3Q7EA 5LDGA 3QWFA 3LC7O 1QXSA 2QD4A 2RI1A 3ETHA 2ZB3A 5I9IA 5EWGA 3C24A 3E0XA 4BRZA 5I7FA 3IDQA 1YASA 2FFJA 3N8GA 3NP7A 1C1XB 3E4DA 1LK7A 2C8JA 3HLTA 4R0VA 4Z6KA 1KY2A 1SVKA 1VIMA 1DFIA 3E23A 4Y6QA 2ZI9A 1JKMA 2VAMA 4C4ZA 4CQNA 1JNYA 5H1YA 2Y0DA 2XWQA 4MIYA 5FIUA 2IT1A 3U3ZA 2NO9A 1YS1X 4TT3A 3RREA 2R8PA 3QX9A 2ODQA 5HUQA 4TWZA 4OJ5A 1FMFA 4EY7A 1C1YA 5EWJB 4BFXA 1U3DA 3D4IA 5JJLA 4MWOA 4KLIA 1VG9B 3M8RA 1EK1A 5F3XB 2YRWA 3FOFC 4KLDA 2V3CC 3VH3A 3PITA 1N7GA 4DOMA 1JEEA 2HHQA 5EJ8A 3HSYA 3LFTA 1L5UA 4FNGA 1JHXA 3COVA 4ALLA 4P35A 1JEYA 3NRJA 5D6OA 4BKOA 1QKKA 4Q4HA 4MV3A 1GUBA 1KVSA 2Q3LA 1YOVB 2ADFA 5FLEX 4TL6A 2BKEA 1OH7A 2XRMA 3FOZA 3I8OA 3A2LA 3K9LA 2J6BA 4J7UA 3TR5A 2B8TA 2XH8A 3OFKA 4PFJA 5ED4A 4RV9A 3AP3A 3R6GA 4KV9A 5A5FA 1KI7A 3KHTA 3TCXB 1J2RA 2VSNA 2C88A 1KMMA 1DELA 5FAXA 3QVMA 1W9MA 5AKXA 1RIIA 1C7IA 1IY0A 1JG7A 2DCUA 2DMRA 3BQ9A 3OE7A 4LC9A 4M0MA 1JU9A 1CNEA 3S27A 1MQ3A 1YDGA 3LWNA 4J4HA 1G2PA 2DL0A 2JAWA 1LPOA 3ZQJA 3TFQA 5DH9A 1LF5A 3I0NA 4QRHA 4TSFA 3Q10A 4P5DA 5CVEA 3K72B 5LMNB 4ZAWA 5K6RA 3CNQS 4LUCA 3S1SA 1BE6A 1I1HA 2G40A 1AY0A 3D59A 4EB3A 4YH1A 1RPZA 1KHHA 3RVKA 5CFOA 1P62B 4DLVA 4QBGB 1HEUA 3H4IA 3ZTYA 1NW8A 1K7SN 1X14A 1C4OA 1QAOA 3TB6A 3N3BC 1L9XA 2VO1A 5GINE 3ZOZA 4L0DA 4ZV7A 1MUUA 1NXXA 1VM6A 4HCJA 1BS9A 5J2EA 1KMQA 3EIUA 3L84A 4WFJA 3ZY6A 1JIIA 4XGKA 4YA6A 4PNEA 1MN6A 1IN7A 3FCAA 4H35A 1NXSA 3EVCA 1EP1B 1B7GO 3B3JA 3DXXA 2PDAA 1R00A 3W6PA 4YIHA 2APJA 5IYZF 4C6TA 5C34B 3KZ1E 2JFPA 1YA6A 2AQIA 5SICE 5I4IA 2IZOA 5F21A 4CL3A 2FB9A 1FFYA 1YR7A 1AA9A 2JEZA 5CTAA 4LZGA 3QLUC 3L7AA 4L4UA 3ZCVA 3H5VA 3G9XA 4JBNA 4P4GA 1FLVA 3BZWA 2FJ6A 4J94A 4Z4HA 2RHGB 4MJ7A 3MPUA 4P81A 1P2VA 5T14A 5ELLA 1KE2A 4CEIA 2J9ZB 5T6BA 1AK2A 4FVTA 4P3OA 2DERA 3BIJA 3IV9A 4MSUA 1LA2A 1VHWA 1I6MA 3CZRA 1N63A 1Q12A 3DCNA 3JYOA 2MYNA 5BWOA 4OB7A 3RRFA 1JB1A 2G4LA 1TCUA 2NG1A 4KPYA 3S2EA 1W36C 3SJUA 2QTGA 3TL6A 3B36A 2R8YA 1OWPA 4X7MA 1W4ZA 4K8RB 3U19A 1ADCA 3F9RA 2NZYA 4I1VA 4BV9A 4QW9A 2WQ7A 3LP6A 2YYSA 3UWOA 2PL5A 4NFSA 4RQ3A 3VA7A 2BGIA 1NUSA 3KR2A 3WBKA 3A14A 3ABQB 4UAWA 2NYRA 1IOZA 4FLEA 4LK3A 5A3VA 3COJA 1XRNA 2XGPA 4RY8A 4HXEB 4J9PA 1JJIA 4FQ7A 1GNQA 2LM4A 2QVXX 4XOUA 3ZUGA 5K0BA 5KMGB 4IIHA 2XO7A 3GP5A 5A6VA 5F78A 5FL3A 4NS1A 3MAJA 2N75A 2WRZA 3C1TA 4QJIA 3EHDA 4Z2AA 3KQQA 3ZXXA 3QHPA 5K0SA 1RBMA 3H9CA 1OREA 3GLFE 1GO3F 2G0AA 5JNVA 1TTQB 3OJCA 4QHTA 5I7AA 1UIMA 1YU6A 4ED0A 1ZVMA 2R751 4YK7A 2ZRQA 5G4LA 4WA7A 1WOMA 2WWRA 4UUMA 4KSYA 4AS3A 4OX9B 3R3JA 3UFBA 2VOEA 1QNLA 2FEPA 3FGZA 3EZ5A 3C3PA 2UXDB 1F6DA 3TLMA 1NP6A 1ZL2A 5L9AA 2XE7A 2XV1A 4OGGA 4QO7A 1AQIA 2CVQA 4RXMA 3QU7A 3MMZA 3QPAA 3OQHA 3I5MA 4XQGA 3WQQA 4YALA 3P9CA 4UU8A 1ZQAA 1VA5A 3U61B 4LRTB 3FVWA 3SHOA 1AKVA 3H5WA 4MVYA 4E5DA 2YKGA 2IBTA 3EDQA 4WH0A 4Z9XA 3TK1A 3QYFA 4I1PA 1J2YA 1CY2A 1WCWA 1E58A 4Q44A 3DAGA 3GROA 5CRXA 3ETCA 3M1LA 4OD0A 1JHRA 1FB5A 4S12A 3QTTA 2ZUBA 1NXQA 1D1SA 1P1KA 1U9IC 3PDUA 2I1VB 1XK7A 1YBVA 2NZ8A 3GMDA 2Z3ZA 4IIEA 2BEJA 2NN3C 3AF1A 8ICUA 5GTIU 2X4IA 3RAJA 4IHJA 3F2VA 1ZI8A 2DPLA 1I2MA 3CPEA 3ILVA 1T5HX 2C4VA 4I2IA 4HY3A 2YN0A 3BA6A 2XCIA 4L8LA 2UZ0A 1J23A 3GVIA 1IQPA 3HCNA 3GAZA 1BMFD 3K0FA 4Y2VA 2WKPA 1UUFA 5BSKA 1NYRA 1Y9ZA 2FMHA 2Q2WA 3HADA 1BVRA 1GRNA 3MJVA 4U3JA 4U5XA 3SIWA 4AG6A 3ZCTA 4BASA 4JFAA 3DBVO 4RCYA 3SZ3A 3GGGA 2JS7A 1FY2A 4R84A 4R71A 3A36A 1DGSA 3OHAA 3G9ZA 4OHWA 4R3UC 5B7PA 5EZQA 3Q8SB 1CNMA 1L9KA 4HNQA 1M7GA 4JI0B 1Y6QA 3A6HA 4CCHA 1E0AA 1YJ5A 4BVEA 5KQRA 1X2EA 2P5TB 1Q0TA 2C28A 1SG9A 2Q46A 2DKXA 1BMFA 3CINA 3F1LA 4V02A 4BNJA 3LP8A 5J0QA 3ILHA 2PRJA 3CHYA 4MV7A 4QJ4A 3P4YA 2QX4A 3RJEA 1PDOA 2F62A 4C29A 2X9NA 2QNIA 3W5CA 1PNVA 1KF0A 2H3EA 1HUOA 3IAUA 2AIRA 3NPAA 3UG7A 3FR7A 3GJSA 1XPRA 3RBDA 2H4WA 3K16A 3CLRC 2VAXA 4R2IA 5K05A 5JFGA 1VL6A 3PO4A 4ZHQF 4D6PA 4DPLA 2JMGA 1N9ZA 3NWPA 2ERXA 3GT7A 4GD3Q 1KJJA 4KFCA 4MW5A 1D03A 2GAJA 3RS5A 3X44A 1ZIPA 1N34B 3BKXA 3D6TB 3S6JA 1WBBA 1E2NA 4O4HF 4NI5A 3LUPA 5ENDA 5G3ZA 2WJJA 2XTJA 5EHGA 5K8LA 5KFFA 1IZZA 4LFAB 1PBTA 2W2XA 4L8GA 5BMOA 2GBIA 3FN4A 3RV4A 3S55A 2FRVA 3HYLA 1XAJA 2OILA 4WFQA 3S4YA 4DVGA 2VP9A 4AT1A 5JXWA 3VBEA 3MPOA 1KQOA 1OYOA 1XE3A 4ZDJA 3DE1X 2ZAMA 2FSFA 5GM2A 2ZE5A 1EI9A 4P31A 1Y7TA 2VVTA 4NQRA 5A6SA 1ECPA 1FNNA 2P4SA 3CRRA 3NQ41 3EBPA 1L7EA 4QQ8A 4ENPA 5KCMA 5JCZA 5DNDA 4Z0TA 5C1IA 5A4KA 1Z4JA 4Z54A 1GA4A 3KEQA 4MGKR 4WRRA 4D6XA 3U4QB 1XCOA 2ZUVA 2VKTA 3OBBA 5HR7A 4D80A 1RZRA 1LDNA 1EK2A 5KJ1A 4AQDA 1KGSA 4K26A 5AJHA 3R0VA 1UOOA 2W48A 1YZKA 1ZGJA 3P2JA 4PC2A 4AIIA 1IN6A 2P2SA 1FO4A 3IKMB 1PUIA 1CRLA 2AI1A 1YK1A 1ML4A 2VLBA 1FTSA 2H7XA 3DONA 3GLHB 2V7EA 3W9UA 1GD1O 3WP1B 1Z17A 3PXXA 3O83A 1QPGA 2R3SA 2J0SA 1M75A 2MIIA 4EY3A 2HMYB 5BT8A 2ODAA 3CW9A 1ZQCA 2R8OA 3IP4B 1ZQPA 1DC3A 2QPLA 2R44A 3E61A 4GP9A 3OE1A 4M0UA 4YV7A 3L6UA 2Q5HA 2YZ7A 2HRDA 5G02A 3ZWKA 5JH7B 3C3MA 2WHRA 3MJTA 3SS9X 4DHEA 3EZFA 2GILA 4HYYA 2H2IA 1PFYA 2O57A 3CTPA 5F52A 3RSOA 3UY4A 1U1FA 721PA 5F2NA 1M34E 3V32A 1TAMA 3OJXA 4NPAA 1OI4A 1GCUA 2BSAA 1T43A 3CM0A 1V8DA 3LT1A 1RMYA 4J9UE 1C7ZA 3EIEA 4PLHA 3TEMA 1SHUX 3CH7A 3H75A 2P1RA 3SK0A 1XRLA 4JI7B 3VNUA 1UFVA 3IXMA 2ATEA 1BPZA 2VNKA 4CV2A 1T0IA 4WBXC 2PMZF 4LPKA 5J0OA 1MDFA 1EAYA 4JIGA 4B87A 1QIDA 1RYZA 2IW3A 4MVJF 4P9NA 2EKZA 2RHJA 4A6PA 4RJTA 4CKCB 1RJ9B 2OCEA 3DDOA 2GAAA 3JTMA 2XZLA 1ZGAA 1QHXA 2H3QA 1TT7A 2OQRA 3G89A 3UPTA 1BROA 4NZYA 2ZWIA 4JEIA 1T25A 3GNLA 4QIHA 4PV7A 1XDSA 2DBQA 2VCHA 5ALVA 4X8LA 4DABA 4N9WA 1ULAA 1QTQA 1ETHA 1VHLA 1Z4KA 5TQ0A 3OTHA 1G4UR 4F91B 3B8HA 2Z8ZA 3F3SA 4G3XA 1LDBA 3B3FA 4PG5A 4ER6A 1XFAA 1DE0A 4FBUA 3SLKA 2P7IA 2H8GA 4Q4AB 3K4HA 1MNAA 4HN2A 2XT9A 4EM6A 4ZQBA 4CLHA 4GRAA 3CKLA 5CBPB 4M53A 5IJ0B 3FOEC 4AECA 3LQ4A 4GRDA 1QGED 2FMKA 4EI7A 1H4SA 4J9LA 3LFHA 4EENA 2ZBRA 1PTJC 3LVQE 4HZUA 5JAOA 3B9RA 4REMA 2DEUA 1JI0A 2QB5A 3CX6A 4Y0NA 3W5SA 1Q3KA 5F12A 2AK3A 4G24A 1G8HA 4LE1A 4MPTA 3M2TA 4NL9A 1K8QA 3FCCA 1UP4A 4GPD1 1JG6A 3AU8A 1G0OA 2VYVA 5HUJA 4KREA 1K27A 2D1QA 5KX5F 1S7CA 1WSAA 2SBTA 3ZQ6A 5BMVA 2LV8A 2IBMA 1IZ7A 3AB7A 4MKXA 2JGIA 5LNK1 2BKAA 1RHMA 1D07A 2VCEA 3AR7A 1KORA 4CCAA 3AI2A 4KWTA 4MWZA 4RK1A 2GARA 1DADA 5KTNA 5CCXA 4NMLA 3S1LA 1Q5PA 3QIAA 3NATA 2WBLC 2FWRA 2XD9A 1EXNA 8ICQA 2HXYA 2O3TA 2RC6A 4MQLA 1E9CA 5TF4A 5EJEA 3PEFA 2CXPA 4BNGA 2AGOA 3ZGVA 1HE5A 5ICGA 4GI2A 5HM8A 4A16A 4ZPJA 2DUWA 4MTCA 3WLTA 2CHFA 1V25A 1I24A 3TR0A 3VJRA 1KZGB 4CU2A 3H7AA 4PG8A 1I3CA 3SVLA 4Z4FA 1YZHA 2R79A 1N1DA 4NJMA 3B12A 4YQEA 1P3DA 3TSCA 4E13A 1LLQA 3IMEA 2D00A 4TROA 5HK8A 4UDXX 2CN1A 2JNWA 2K4PA 1T5OA 3OE4A 1FXWF 2R8GA 2ZJOA 4NJEA 2GO7A 4Q7KA 5LMCA 4ZJYA 4CUKA 1W75A 4BGEA 1KIFA 1RI1A 3RJMA 3HZHA 1E7WA 2CUTA 2O7QA 2BLNA 1N5IA 1BWRA 1ZNYA 2EL7A 3BDVA 3OCXA 5DTRA 3TTXA 2A9QA 2MDTA 2X4GA 3LXXA 3LLUA 4F9EA 3VHRA 1ZH4A 1O96B 4BBAA 1X2IA 2HRZA 4ZO6A 8ICOA 3HTXA 3LZCA 2P65A 1F6WA 1FVXA 1QP4A 1T94A 1V47A 4JUDX 1L7NA 3DMPA 5L1LA 1DU4A 1DKOA 4HHEA 1GU1A 1NNI1 3C1ZA 1L5SA 2ZYSA 3MCVA 5EPEA 1GXSB 1OGYA 2HAEA 1YS4A 3BS4A 4DIDA 2JXJA 4KLJA 1OTHA 3BMQA 3DEIA 3PHGA 3ONVA 5BV2P 4BN4A 2OZEA 3CURA 2O2YA 3K9CA 4ZT3A 3G6YA 3ZU3A 4ACAA 1YSCA 4D81A 1CIPA 1IEQA 4FQ5A 4EA9A 1HT2E 4B2IA 4Z51A 4JMLA 1ZGCA 4X93A 5TT1A 2HW8A 3KSBC 2PLFA 2OG2A 4ACBA 1P1IA 1PNOA 2MINA 3EEIA 3CG0A 3FKQA 1DAMA 2IXFA 4AYBF 2BP7A 2HHVA 2I67A 3SBDA 2AUTA 2GZDA 3TYXA 1PG2A 1QPZA 4DE5A 1J00A 1GFZA 3V2UA 5A06A 2V45A 4B9AA 1GL7A 3LF2A 5GV8A 1P1CA 1ECLA 1Y3DE 3WGUA 5EJFA 4RD2A 1H1LB 1NTOA 1CZHA 4JB8A 3WGMA 1EFTA 3VKVA 1E9RA 4O2AA 5LQSA 2QYTA 3DDNA 2AN5A 4F46A 3PG5A 4L4ZA 3DZDA 2ZYWX 1T6NA 5ARCA 2QQGA 1KEKA 4E07A 4K6GA 2ID9A 1L7AA 1GFSA 3WTCA 4TYPA 2D6FC 4GMXA 1ILEA 3WYNA 1UEIA 1VL1A 4JLJA 2O7RA 4NE2A 9ICJA 3N76A 4AU1A 1NXTA 1YO6A 1FRVA 1AVTA 1E4EB 5A7HA 5PGMA 3IMCA 5KYTA 2E49A 3GLIA 1CHNA 1UMDA 2J4FA 1K5GA 1X8JA 3E8SA 4NS4A 4RPJA 3ZNPA 1WUYA 1Z9BA 2MSWA 3EWNA 2P5UA 3G5TA 1FFUA 1USUA 1RZUA 3GNQA 3QE9Y 1H65A 1R9NA 1YZQA 2W4QA 3FX2A 4Z7JA 3OOWA 2B8WA 2IZ5A 1D0VA 2WYIA 1YVDA 2BQRA 5ALKA 3K1YA 5EP3A 1EFLA 2X0RA 2OHJA 3ZKWB 7MHTA 3GMSA 1T0HB 1JHPA 2BZFA 3DVAB 1X86B 1R8SA 2H00A 3CX3A 4LDNA 4WESB 4JLBA 5DRYA 5KC8A 1XBTA 3H2JA 3FAHA 2PUCA 3SQOA 2IUSA 2DLCX 1REQA 1JHOA 1Z73A 1S9DA 3TSWA 1T3ZA 3BRWD 3SE7A 4U2EA 1QTRA 4M47A 2O8BB 4HAVA 4E2FA 3ZYCA 2DB3A 3R9XB 1JLSA 5KG2A 1UWVA 3D7LA 4C4RA 3SV3A 2GSWA 3HBNA 5A05A 3VTZA 3H40A 2HCBA 1RXYA 2GKGA 1F2VA 5KFWA 3OM0A 3AL2A 3VDNB 4G0UA 1T5SA 3VTAA 3PWZA 2W8BA 5DTQA 3GT0A 3RFVA 3U16A 4BUJA 2P90A 2YUTA 3TZBA 4QBFA 2F7SA 1HC7A 4LTDA 4ZZ3A 9ICTA 4MA0A 3AERB 1M2VA 4OB8A 3ZZUA 5IN5A 4ZODA 2G36A 5TRTA 3G17A 2WP8J 3IP9A 3LK6A 4BJ6A 4BBPA 1ZJNA 2JLXA 4CTMA 5KT6A 3G6KA 1EVJA 1V7CA 5G1NA 4W7SA 4B6PA 4D4IA 3C6QA 2FJ0A 1M6HA 5KFRA 4IJQA 2QRJA 2ZYUX 3BMOA 3RU7A 3ZW9A 4EAQA 2PANA 1XF1A 5CIWA 1K6MA 1N6IA 3LUGA 4C22A 1BEUB 4HNRA 3EF3A 4J9MA 1CETA 1Q44A 1TGVA 5KAIU 4OQYA 3NWJA 1PQWA 4WECA 5CNMA 3D31A 1NRWA 1RQ7A 4I8XA 2Q5EA 5FI5A 3N7TA 3E2PA 4NFLA 1N2IA 2YWGA 1GU0A 5DK4A 1DG3A 2GVDC 4AJJA 1S2MA 1V9PA 2Q9AA 2QN2A 1T8EA 1ULTA 4Q3KA 1USGA 4FE3A 1X7ZB 2Y9UA 2CVPA 4GPAA 2ENUA 1A8PA 2VQFB 1MV8A 5FULA 2WWXA 5B3LA 2F9LA 5FBKA 2CD7A 4EPRA 2QRKA 1LKYA 1N6KA 2I6XA 1RMQA 2H92A 2IKSA 5J9FA 3THWA 3ZJUA 2QRVA 3N2EA 3BVPA 2C98A 5CD9A 2GWRA 2E4ZA 2Z6UA 1U9ZA 4Q43A 4Y1RB 2W6PA 2JGJA 1GN8A 1KAEA 1UBGA 2C84A 2J45A 2R66A 3RNLA 4C88A 3WJ7A 2EBUA 4UAYA 4AY2A 3TLGB 4DQUA 4EF5A 2B5VA 3O8LA 1DIAA 3QXXA 4P0QB 2VS1A 2KG5A 1Q16A 3QI2A 1PWZA 4MV5A 4PY2A 5BR1A 1MRZA 2Q4BA 1JIQA 4AYXA 5KIAA 4QATA 3MC1A 1ZJ4A 3EG9B 4S2UA 5EZ6B 5LD2B 2M32A 4S04A 3FCSB 4Z6EA 2VP5A 2JF0A 4NZZA 4LSGA 4CLXA 3H11A 2UYYA 2X1VA 2PWYA 4M38A 1P5ZB 3IOCA 4O4JF 3MGBA 1E3WA 1JR3E 2EW1A 5E2AA 4I2JA 1X8KA 2R8XA 1PFGA 4OLJA 3IP7A 2E89A 3A2KA 3MJRA 3TQFA 4IV8A 5FUVA 2ZIVA 1IXKA 1GP2A 1ZP6A 3FPHA 3TBHA 2FDRA 3ZI7A 1YQ9A 1NWHA 4RF5A 3DZ8A 4XGQA 3H17A 3IUBA 5F7JA 4F86A 3SDSA 5JR3A 4CEIB 3T6KA 2X6QA 3L4JA 1X7YA 2Y4NA 2QXUA 3IUYA 3DE2X 2BMEA 3AI7A 3RANA 4JMUA 4KLOA 3U7FB 1NUTA 2BBTA 2LKCA 4D02A 5IZ4A 1SQ0A 7ICVA 1ZQNA 4TQ9A 5E1MA 2MCFA 3W5VA 3U4HA 2P3SA 1D5CA 2PZAA 3F98A 4C4XA 5FL7A 1G8AA 2JD1A 3IA7A 5JO0A 1M5UA 4PICA 3TNDA 4CODB 4YCCA 3BMCB 3HH8A 4DREA 2KZMA 5BVGB 4P80A 1P2UA 4WOBA 4UM9B 2PO5A 1TPYA 1FP4B 2Z1NA 4AKEA 4UBIA 1A5TA 4RTSA 4P5PA 1IBSA 3TDNA 1WF3A 1NW9B 221PA 3PHIA 3IODA 2R2AA 4BDSA 4DQDA 3UOWA 1XLTC 3MOSA 4Z3KA 3PIDA 1P1FA 4OV6B 4LDPA 4LW8A 4OA8A 4PLGA 2WJ4A 3JPQA 1IJBA 1H3FA 2HEIA 4D3FA 4DGSA 2Q3JA 2V6GA 1MX5A 3HC7A 4QPPA 5DIFA 2A5GA 1KS9A 3C1AA 3OA0A 1VJCA 1TM5E 1F0NA 3ETLA 4Y2QA 4RPZA 3QX7A 2CXXA 3SDZA 2BH2A 4MI1A 4XWYA 3ZGLA 4V1CA 1JAZA 3RC2A 2GPWA 2FJUA 1GXSA 1GAJA 3B38A 3G0BA 4PHHA 4CM9D 1LWNA 5J2TA 1TK0A 5CB6A 1N4DA 1NKSA 5IAGA 2G04A 5BN5B 3GLGE 4DMGA 4EKDA 3GARA 1FQKA 3MDAA 5LKAA 2XC9A 4KMUA 1N9KA 2VYQA 3AUFA 4E70A 1K68A 1YONA 3R9XA 4UB1A 3HU3A 3I04A 5JOQA 2I9PA 4IEIA 2CYAA 2GCEA 3H6KA 4L15A 2IS6A 2PL1A 2IUYA 3HG7A 3N75A 3ZV4A 3EZ6A 1OFHA 5EUCA 4W7IA 2QAJA 4FWTA 2FX2A 1R6VA 3I9JA 4OP1A 3UGKA 2V7QA 4BYGA 1M1YE 2OFXA 3H1FA 1KHTA 1A82A 1N0UA 1YC2A 3UA4A 4MQBA 1HORA 3KLOA 5BT9A 5TISU 1JEAA 1UWKA 1YS7A 3DLPX 3HUDA 1EUZA 2X41A 4QOFA 2HRBA 3E70C 3FXAA 3IIIA 4NK5A 4MDHA 5DMXA 3VR2A 4BCCA 1P4HA 4O2RA 4B4DA 1QCCA 4HDKA 3NVYA 5DM4A 2QEQA 3PJFA 4QT4A 3AY0A 2Q4DA 1T6XA 3R3VA 3AY3A 4B4OA 2ZBPA 4IIUA 1DFGA 4XVRA 1B22A 5B3AA 2R8HA 3AOEC 3L0IB 4OXIA 4P3PA 4RPKA 3OEWA 1WKVA 3W3AD 4JR0A 1DKQA 1W30A 3G2OA 1T5TA 4ZVLA 3UJ9A 1SUAA 5DN9A 3WSTA 5CITA 3GVPA 4X61A 4D97A 1GPWB 2E4YA 5IIOA 1RYRA 1I3LA 3T5JA 1IE3A 2C2GA 2IHVA 3BL6A 2G71A 4QGBA 2PMCA 1WNTA 3CUKA 3QUBA 1I5EA 2ZWOA 3ORSA 2NO4A 4QZ9A 1LB2B 4DLXA 1FA9A 3P9NA 8ICBA 2IUTA 1CJSA 1R4MA 3FYTA 1PK9A 3Q8XB 3OD5A 4ZOLA 1MIHA 2C95A 4BWMA 4YQFA 1BGWA 3J81A 1JRLA 3C3AA 4NEQA 4CIVA 4AUEA 4O2BF 4UB6U 2IH2A 3EZ7A 4IHJB 4NBRA 3FFTA 1DDIA 4EB6A 5M5BA 5DBIA 4RXUA 3G9TA 3GL9A 1ICIA 3FDZA 4JX9A 3SQMA 1GQRA 4P3NA 1X0VA 4OAPA 4I2DA 1YB7A 1Y9JA 2JJ2A 2V9ZA 1FU8A 3CO5A 3CNEA 4GXKA 1JPUA 1UP7A 2ECOA 1QJCA 2FSVA 2NT4A 1EUDB 2QQEA 2ZBVA 4FK8A 4ZKDA 3MCWA 6LDHA 3UK6A 3OIFA 1U2SA 4JLWA 1HOXA 3BA1A 1THMA 4Y0AA 3AM9A 3IAXA 4NDNE 1TDJA 4KN5A 1SCUA 2LM1A 2E1RA 2JIQA 3IAAA 4I8IA 1WYGA 2XIDA 1OJ7A 1BDJA 1C8KA 2NUTA 2DFVA 3BXGA 5BR4A 4UVDA 3O0FA 3SF8A 1Q0RA 3RAFC 1DI0A 4LRQA 1U2DA 3PZRA 2JIBA 2LHTA 1SKSA 2XQGA 5IKOA 3KETA 1W76A 1DJQA 3RR7A 3THRA 4YRBA 5INTA 3QU5A 5AUPB 1RDFA 4D9BA 1QS0B 2AOVA 2YH2A 4IKPA 1Y98A 4KCGA 4XTCS 1RFLA 2LD4A 2N46A 1EVZA 1R2QA 3ZHTA 2HSDA 3VDQA 5JAMA 3ZV7A 3OOSA 3EOZA 1ZU5A 4RF3A 3DDHA 3ZDDA 1Z0ZA 3F7MA 4JC0A 3T3HA 5ALOA 5J2GA 3B7GA 3KBOA 4UCQA 2HMWA 3FBWA 1L7BA 3HA3A 4AI6A 4YAGA 1X94A 2FPGB 2WKRA 2HIAA 4F8RA 1JNXX 2WNIA 1OX4B 4LNUB 2JV3A 3KYBA 4IEEA 4W9NA 4I6EA 3QKRB 5EEHA 2PT6A 3FHOA 2PX3A 2YRXA 1OD6A 2ZAGA 4UBNA 4XSVA 5H0IA 1MPTA 5D1NA 3BRQA 1BYUA 2ZI4A 1D1TA 2P9ZA 3K1AA 3EIWA 3C15C 1ACMA 3DWIA 3ZVRA 4CCWA 1PJZA 4OQDA 4WNIA 4F5QA 2EFJA 3RVRA 2BF4A 3TFWA 3VNQA 4ZJPA 4ZYVA 5CB4B 4XWWA 2E1PA 3OOJA 3U4GA 1M2OA 2OZPA 2XHEA 1KK0A 3PIIA 2FHSA 1WUKS 1KYQA 3G79A 3KVVA 3ZDQA 2D3WA 3BIOA 2FA9A 1HYQA 4DLEA 1DEAA 1E9DA 2ZAIA 1I2AA 2R6DA 1P1HA 3MR3A 4GO1A 4MQ5A 5CNIA 3UENA 4ADSG 2X13A 3B1WA 1A9XA 4BNYA 2YW2A 3BB3A 4ND1A 3RQIA 3N2KB 4OG2A 2H6EA 1SCJA 3E0QA 3EQ2A 3HN6A 1T3NA 3KT3A 5C1PA 3ZE2B 1PFKA 3FTQA 5JARA 4HLDA 4YP9A 2NO5A 1LDGA 2NZXA 4F6CA 4MLDA 4PCAA 1HTTA 5HE8A 5A5VA 1XMPA 3GPDG 2BEWA 1Z4OA 4UFPA 3UV6A 1LC3A 4K6HA 1C9MA 5FBHA 4W6ZA 3QMPA 3B6MA 4LRXA 1DKRA 3A4VA 4Y18A 3S29A 3SSMA 3VFDA 4EZIA 3O3MB 1JKFA 4WZZA 3PW2A 2JGKA 1TLLA 3D3JA 3LJKA 3WBBA 2LVBA 2I9KA 1JJBA 1AGPA 2A9OA 1Z1VA 1LX7A 2FPGA 2G88A 3RB4A 2C1EA 1GZ4A 2Y76A 3DEHA 1B1CA 3G2KA 4IDFA 4IH4A 4DF3A 1XZCA 2QMYA 4D96A 1IB6A 1DDGA 8ICWA 4KVGA 4K6CA 1BEZA 2IYRA 5KWJA 3GQBA 5CYOA 4JP5A 5HF8A 3WHPA 1DUSA 1C41A 1MMFB 3HU2A 3JXEA 4FC6A 1SXJD 1M8KA 1X7WB 1HY3A 2WIFA 2XB8A 3A70A 3BXEA 3D3WA 1O03A 4KWCA 5DCYA 3TD2A 3B2NA 1ZPDA 4HBZA 4FHFA 3TIGA 4BAGA 4I14A 1H9AA 5B1DA 3VAZA 1E1RA 4JDUA 3UQZA 3VO9A 2G1PA 3BORA 5DNUA 3MHTA 2X42A 1EFRD 4GFJA 4KMOB 4DL2A 4TTJA 5J3JA 2NTYC 3PQ5A 1A97A 3BJRA 4L78A 1D7OA 2W2OA 3RB0A 5HF6A 4YMUA 5L3QA 6ABPA 2YJGA 4NU8X 1PS0A 3UPQA 1U5CA 3L0PA 2C42A 4RDCA 2IMWP 2Q5OA 3ZDBA 1RYFA 5HCUA 3I23A 4R8KA 3BCUA 1D1QA 3HSKA 4QYXA 3GPBA 3VC8A 2OA0A 2O0LA 4RQ7A 4PR3A 1BQ3A 1AUQA 2ORWA 1M8JA 4RMHA 3LX4A 4KLLA 2JDIA 4U6NA 4X1OA 5G4KB 3TE6A 4EPYA 3UCEA 3NIBA 5EPOA 5ARBA 2E55A 5KFHA 4EB8A 4OXNA 5F77A 4DCPA 4TL8A 1P44A 2EJVA 1NIPA 1KS2A 3W2EA 1ECBA 3M8KA 2GLXA 4KEAA 3EEBA 4LMPA 3ETNA 2AH5A 4D4KA 3AB8A 1IYZA 3ITKA 1KKLA 4EPVA 2Y0EA 4C08A 3Q7TA 4H9GA 1RSZA 2J3KA 1AV7A 5G0SA 1YDFA 2E7ZA 2OY0A 2Q5CA 3GG9A 3R0IA 4I4TB 4DBLC 3RM3A 4EK9A 2ZYTX 1EFPA 4FZ3A 3BD8A 2COUA 3IXLA 3CNBA 3KVYA 4EBCA 1SPXA 2D5BA 3CUEF 3BGIA 3IQWA 5EIHA 4H1VA 4QX6A 5KYXB 1Q0ZA 1L5YA 2YMLA 3KZMA 4ONEA 3M1AA 5K0FA 2EFHB 4CCSA 2E6UX 2RHTA 1JQJC 1ZH6A 2UUBB 3PGKA 2KFNA 4JUCA 4QVGA 1FZTA 2AFIB 1XT6A 5T6MA 4WVLA 1QFXA 3ISTA 4RHUA 5IPFA 1DV1A 1H42A 2NU9A 2NRXA 3WBFA 4BLRA 4E94A 1ECGA 3ROMA 2D5AA 4J9KA 4PZ9A 3W2FA 1QQAA 2XXAB 2J0UB 3GJTA 1RJ9A 4N6GA 2CJPA 2GJKA 3ZYZA 2H07A 3DEFA 1GTL1 4G09A 4BDTA 4DUPA 5FH9A 1NKBA 2Y0CA 3G02A 1YHZA 4HDSA 5K8TA 2YZKA 1JTFA 4L4XA 1G42A 1AQ6A 4RQ4A 2QSYA 9ICLA 2HK6A 4PBTA 4XFJA 5T4HA 1XWLA 4M9QA 4TWJA 3W06A 4PRZA 3ZWWA 2AL7A 1Y8CA 3F5FA 4PNHA 3RIYA 4DF8A 2OENG 4QFDA 2KHVA 1SL2A 1W0CA 8ICXA 3Q8MA 1GGNA 1TYAE 3BBPA 1AG9A 3F6PA 1T13A 3Q72A 4QXQA 1XGKA 3CX8A 5CLGA 4E33A 4UTOA 3H4MA 2VRCA 2ES6A 3NBMA 5CCBA 5GV7A 3GFQA 1EK0A 3C7KA 3IR6A 1FFXB 4HWSA 2NT3A 3DCJA 3PNPA 1A5AB 3HB7A 3P9XA 4O4IF 2R85A 1E3JA 3KHGA 3TRIA 4AAYA 4H4CA 2QARB 4CLRB 3HSSA 1DXYA 1V1MB 3L7KA 3T5GA 1OX4A 5DCUA 1F8UA 2B6NA 3O4JA 4IJ6A 4COOA 3TKYA 2UUOA 2OWOA 3KFUF 1F9EA 1Y3IA 1PG5A 1MAAA 2PZEA 3P32A 4FHZA 3HWTA 1FL9A 1IU9A 2EZTA 4IMIB 5L45A 3E2MA 3M9NB 1BOFA 4IINA 1SC1A 5CHEA 4R2XA 3A32A 3OUZA 3PS9A 4O29A 5E1OA 5F7XA 5CIQA 3O9MA 4PPXA 4HVAA 3ABZA 3L0ZA 4O4IA 7ICPA 2X8AA 2CMKA 2XMRA 4W8HA 3ZVNA 4JDPA 1Q0PA 3HCRA 1VPTA 2NAPA 3I09A 1R8JA 4DSUA 3N4MB 1V95A 2X3UA 3U1BA 4X6XA 4E5MA 4GKKB 1T29A 2HT6A 3D3NA 1F4VA 3GEGA 3GHHA 1IPFA 3UAVA 1TUIA 2E87A 5IG2A 2AGPA 1O6ZA 2X40A 2GI4A 1TLTA 3QENA 3MGHA 4I9GA 1PT6A 1T36A 4TMTA 1E3LA 1XVVA 3GJ8A 3KB8A 1Z8DA 3HA7A 3JVVA 3L7CA 4GP6A 3C3KA 4E88A 5LOVA 2YYZA 5MN6A 3T3FA 1KI1A 1BC5A 2QY6A 4PZYA 2DBYA 4O1MA 1ULHA 1YQEA 2PSSA 4U3JB 2JGLA 5DBCA 3NB0A 1NRXA 5D3ZA 3DULA 4FFOA 2Y66A 3CVOA 3GF4A 1CR0A 5EZYF 3FZEA 1G9SA 4IRXA 1JAHA 4DJDC 3D1LA 2JFZA 4ZO9A 3Q0IA 3ND5A 2C8VA 3EGXA 1ISJA 1QO0D 1OTXA 1Y5RA 3LDGA 4MKHA 1VYVA 5DXJA 4EABA 2M6LA 1W88A 2WB2A 3UPUA 1MH1A 1NFQA 1W73A 1TRKA 3GD7A 3WYGA 5IBCA 3DB1A 3TS1A 2BMFA 2ASDA 1ORTA 3KTFA 3N3AC 3RV3A 2X8BA 3ZBUA 1Q77A 2ZK7A 4J1QA 3EZ2A 4DUZB 2OZLA 1I14A 2AN9A 1LTKA 3PDIB 3JSXA 4PFQA 5AVRA 3HM9A 1OOEA 4OI0A 4ZAGA 5WRFA 3E22B 4DSNA 1BO6A 2DPYA 4TXMA 3EZNA 2E8MA 3NBKA 1U99A 4OMDA 3KQNA 4NG4A 4OTZA 3TSZA 3ASUA 3AUSA 3GMTA 3E9ZA 4CIDA 1U0NA 2A7XA 3GUCA 4CTKA 4F97A 3L5OA 5BW8A 1T2VA 3Q8RB 2AUMA 3PC7A 4N18A 1C30B 1SU8A 4FFWA 4Z9YA 2FVYA 4IGKA 4Y6GB 5HDQA 1QRTA 1RP1A 1WUDA 4TLBA 1P7CA 4PHGA 1YI1A 2IUFA 3VU0A 2UU9B 3Q6NA 5DBAA 2GM3A 4OAQA 4RDHA 3BQMB 2HBJA 4C0BA 5ICMA 3C7AA 3FZYA 3HP4A 3K9QO 4DIBA 4RKRA 3WFIA 1Y6GA 1N2BA 2O3QA 2OBXA 4TUSA 2D2EA 3DZGA 2CF5A 4TYMA 5KDDA 4MPRA 2B7CA 1ZUHA 3N58A 2QTBA 3DZHA 3DYBA 4WXMA 2AJ8A 4KJXA 3CLUC 3L6CA 1JR3D 3M4JA 3NH9A 4O4HA 2PVCA 1Q1EA 1U4NA 3MJFA 4IVRA 4FBLA 2RGNC 2Y1IA 2XNSA 4OQ4A 5EOZA 4N3AA 5CA7A 4ZYTA 1EFAA 3GEIA 3V1NA 3FOBA 4LBVA 1CK4A 1JQEA 4F4UA 1INLA 4AX4A 5DE3A 1R50A 4C0ZA 1B2RA 2YICA 1ZM2A 3SOPA 2Z3VA 4B17A 4CMIB 4DQIA 3F2CA 4YPOA 4IJKA 1HYBA 4UJ5A 3EARA 5I3ZA 2PS9A 3VKUA 1FOEB 1N8KA 1LY1A 2DBVO 4OVKA 3F5DA 3ZXYA 4B48A 2VHXA 3THXB 3NDBB 1EK5A 2JKVA 3WJ2A 3NJ4A 1MTZA 3U6KA 5IMBA 3X1XA 1G8KA 2GEFA 1ZXLA 4NTZA 3X43A 1D9DA 4CKZA 3O2QB 1BWQA 1N5RA 1E77A 2AJLI 2F2TA 3FSEA 1COOA 5JCOC 4XM1A 1YMQA 2C97A 1ABEA 1HNNA 1VTKA 3BZBA 2NXCA 4K9MA 4Y30A 4YVFA 3ANSA 4N7MA 4JJGA 2KKPA 1Y7PA 2XKBA 3BE6A 5CFLA 2E37A 4HZGA 1ND6A 4IC9A 4DAEA 1EX9A 3NJ8A 1GITA 5LA6B 3ZWPA 4ZT7A 2F59A 1Y0BA 2A5LA 2AJDA 4DV2B 3TLEA 1B73A 3F9IA 4KPUB 1KI9A 1UT6A 4KNWA 5HOQA 3AEKA 4F2WA 5C8ZA 4TKUA 5CFRA 4FN5A 3IP5A 1E5XA 1RU3A 1LSJA 4MAFA 3BYZA 3FGPA 2KMLA 4EHDA 2PMZC 1OIWA 2YMMA 1E7YA 4LXUA 1U28A 3INYA 1Z6AA 2G5HB 1AZTA 2HADA 2QZPA 3EGCA 3HKBA 5A4IS 1CG6A 4LJLA 4DDWA 5LJLA 4AQ7A 2DAPA 1EQUA 1X7YB 1XEAA 2R2GA 4ND7A 3P2OA 2XOKD 2P5SA 4XB6B 3UWSA 5CVTA 1KZ6A 1MA3A 2O2XA 4UNQA 2JIZA 4IJWA 5IEBA 4BKRA 2LGJA 3HCAA 4UUQA 3FI0A 4ZIRA 2UXBB 1UZUA 4ZFNA 5LB4A 3PC8A 1LSSA 1G6Q1 3HKCB 2CHVA 4QZDA 4Q1CA 2AQHA 3QKUA 4KIWA 3WA7A 1G4AE 2X9LA 1MTOA 4Q3NA 4RPIA 2OV3A 2OHFA 2CVOA 4UE3S 2GEKA 1YOVA 3OQJA 4PGFA 1H2FA 5KJ6A 2AJQA 2VHWA 1X1SA 3AOEA 2FCRA 4MCHA 5JG7A 3K1AB 3RVMA 3FJ1A 4ALKA 4MDFA 4ECUA 4Q9LA 2J31A 1Z7BA 3GFSA 4HMPA 1ZHHA 3ISCA 3L18A 3MOGA 3PGMA 2C4WA 4TTAA 5KG7A 1ZXXA 4R41A 2P69A 3FR8A 2VYCA 3GFRA 4LMAA 3PEWA 1S2IA 3U7GA 3MYYA 5DRTA 4UTPA 1SRRA 2BCSA 2XTZA 4FFDA 2ZIVB 1IDOA 1U6IA 1NUAA 1WP4A 1Z6PA 4DSZA 1A2QA 1ATIA 1T9ZA 1IAQA 3ZS8A 2HJHA 2PSFA 1O5IA 4PLVA 5JWHA 1UADA 1A04A 1J7KA 3ADKA 4H16A 4N3GA 2MWMA 1SUCA 4OQEA 2R8IA 2R00A 4EBFA 2EH9A 3ADCA 2XW6A 4Q3LA 3T7TA 5JBIA 3PU6A 4Q9HA 3GD5A 4KQEA 4DILA 3VJMA 1QG2A 1JAIA 1QORA 2IYFA 2ZIEA 2DGZA 5HCNA 1MC1A 3AVQA 1RKXA 2FPPB 2HTEA 3AV0B 3EEYA 4HYQA 4QXOA 4E09A 1T9BA 4MWTA 3WIEA 5C8DA 1ESMA 3HA5A 5LQNA 2Q3CA 2C5EA 5IJAA 1NURA 2AQ8A 3RABA 2PCLA 2Z04A 1NNEA 3HMQA 2DJ5A 4EWLA 1TYBE 1LUAA 1I6WA 2G63A 3DBLA 3C6KA 4B3IA 3MK31 8ICIA 2SHKA 1MHPA 1YB5A 2P91A 4H3SA 4HMQA 1XLWA 2AKAB 2XOXA 3L3FX 4Z1OA 3H7IA 4IFBA 2VA3A 4EYIB 1Q0LA 2H4HA 3AI1A 4ECQA 2PMDA 1QHNA 5CLJA 4XUGB 3TTVA 3C74A 3SI7A 5J2UA 2CJWA 1K3TA 5JZVA 4FYWA 3LHKA 3AR5A 4IG4A 2R8RA 1PVPA 4QHYA 1E9AA 4LQCA 4CM7A 2Q0ZX 5D6NA 4ZEOA 8ICPA 1T4CA 2YN2A 3QUTA 4XWGA 3BWYA 3I32A 4C0LA 1YAHA 4DLAA 5KC9A 2Z5LA 3EGEA 3IE2A 2PXXA 1GNVA 4DCCA 2R4UA 1G16A 5EMMA 1II8B 1U7DA 4DL5A 1T34A 3KD2A 4DLRA 2EX1A 3ME5A 2NU8A 1IJEA 1KK2A 1L4BA 2VK2A 3IEMA 1J0BA 5DBGA 5BURA 1UKZA 4KL8S 3UW3A 1IUNA 2BBSA 1YZGA 3IV7A 1CQPA 4NY1A 4RQTA 5BN5A 2RG1A 3UQ2A 4R7GA 1FUEA 1QX4A 3EAGA 4JP2A 1XQ6A 3NJRA 4RACA 2O05A 1LPSA 4AN1A 5JFOA 4LVCA 1ZQWA 2VRWA 3N2YA 5T67A 2PNFA 5HYVA 1ENYA 2HWWA 2Z2JA 2ZIWB 1ZOOA 3BJIC 1V4BA 5MFPA 4ARVA 4C8KA 3EK2A 3KFXA 1XDZA 2NTVA 2W71A 2FRDA 5FYDA 1RLTA 2I03A 3RTVA 1GSAA 3NBXX 1XNHA 4XEUA 4ASUA 4C04A 2Y99A 1HE2A 1OV4A 3G6VA 3N7UA 2XGOA 2RK4A 3A1TA 1Z19A 1O9HA 2N1MA 2C4NA 3RUHA 4JAVC 2C83A 4F92B 5IYZA 4FYJA 2AR0A 4BP1A 1BFKA 3BDPA 3ZNNA 5ALZA 5KFYA 1CRZA 1M34B 3FUXA 4YVZA 5EL0A 5JVDB 2IZ6A 4RXTA 3UGQA 2V7GA 3DXFA 4RJ2A 5FKJA 1NMEA 2DKFA 4O3RA 2QX9A 2YTZA 2FPXA 1DQPA 3V1UA 4DMHA 1PX0A 2XCLA 4DNQA 1RM3A 2ZJ5A 3A1VA 2ZQYA 2GPTA 3RVDA 4DUGD 2MR5A 5KTSA 5E4FA 4DOBA 3VNVA 2Q1YA 2V98A 1U80A 5TPWB 1KJ8A 1ODKA 1RZTA 2CVHA 3QXSA 4RL4A 1N2HA 1NVFA 2JJ8A 2PGLA 2RGRA 4LV6A 3N97B 3SX2A 2FUNB 3RARA 4PVDA 3L79A 3UT6A 1G3RA 3MM4A 3OWOA 4ZVUA 4A2QA 4H2DA 4B3HA 4BKQA 1PVOA 1QTIA 1W6RA 3P4UA 4JNCA 1MZPA 3N8NA 2V7WA 2XMBA 2W6ID 1MA7A 2DFNA 2FG5A 3CKMA 1XSLA 5C1BA 4RSRA 2KP7A 4NH0A 3RVPA 5CBPA 1HDIA 1P2GA 5HHIA 3IG8A 3LI2A 4M8NE 5T3UA 4I99A 5CW2A 2E3TA 2QI9F 1C20A 3LRTA 1BOOA 1CVLA 4OH7A 3SBXA 5KUTA 4YCMA 4NULA 1UXJA 5KWSA 4BVBA 1ZSNA 2OESA 3AUXA 4O3PA 2EKLA 3MRSA 1QHGA 2GJAA 3L8GA 3RTBA 2J7KA 2WUWE 5G0UA 1MSWD 1JB9A 3OSZA 3LLVA 3H05A 3OQMA 3U56A 1T1IA 2ANCA 2O2HA 3AIKA 2XRZA 2IZ0A 5JYDA 3UFXA 3BK7A 2R1TA 3I3OA 2GA8A 2JJQA 1RS0A 5KQPA 4G0QA 3HRIA 2JFWA 3I9FA 4EVSA 1S5LU 4TZ0A 4GQAA 3C2LA 1P9RA 3ROEA 5L9XA 1KQFA 4FYIA 1QG0A 1U8FO 4FJ0A 4RGYA 3IBGA 1Y1SA 3M7IA 4AWXA 3E4CA 3K70D 3TL2A 4KNVA 1WZ2A 1CERA 2GEUA 3WRVA 3W5BA 4I7EA 1R27A 2KLHA 4UVGA 1M7BA 1YB6A 3WL3A 4ZI5A 3TVDA 1GLGA 5ESRA 2DFPA 4K03A 1SK8A 2J0VA 4JJZA 2VSOA 3ZE6A 1K1QA 1ZQOA 1PFVA 4JGGA 4XTRA 1N4AA 4BJ1A 1FK8A 4YUWA 4G41A 1BWSA 1WR8A 1PRYA 1XP8A 3OT1A 4UZEA 5BN4A 1NF9A 2VH5R 3T0IA 4G26A 1I5RA 5I4BA 3EPKA 1NG9A 2ZIZA 4ZT2A 1SV0C 3R5FA 1DBPA 1SC3A 4MCIA 3ZCUA 3A2MA 3IDWA 5FOQA 1QHIA 3KUUA 2NYUA 4KODA 1AJEA 1KDHA 2Q7XA 4GVXA 4ZOEA 1ZIDA 9ICBA 2A19A 1Z4IA 4YG2A 2ASJA 2XYQA 3B1XA 1HT0A 3ER9A 4CBVA 2HWXA 4D8XA 4DNPA 3BXPA 4HAWA 4IVNA 3T79A 4L2IA 1YQGA 4PHTA 2HX1A 1JDTA 3KWFA 3KOYA 2V7XA 3JQDA 3OQOA 4WCFC 4K2AA 1TIBA 5E2BA 5LOVF 1Q1NA 4PHDA 4Q4LA 4ZQEA 2B8JA 3WB9A 1IFXA 4G0ZA 5A6SB 1X9SA 4BRUA 5GTHU 2ISOA 2F1KA 2JEYA 2ZUTA 1AH2A 5F3WB 4YECA 3TBKA 1PFUA 4DIUA 4AYBC 1AS2A 1F20A 2JASA 2R7KA 2EARA 3N7RC 1AKRA 1H66A 1EJ2A 1OXBB 2QVGA 4JA2A 4QTUB 3NONA 3IPLA 3QJYA 4HRXA 4ECVA 2QW8A 4HXYA 2YQ5A 1U8YA 3CX4A 1IG3A 5JLJA 4JELA 4NJMB 5I47A 2DHQA 1DL5A 5LXTA 5DHFA 4EZEA 4B8ZA 5IT5A 5DBFA 2X3FA 2F76X 3FVTA 1WA5A 1RRCA 5CT9A 1DCFA 4X94A 2RBKA 2IPLA 1ARZA 4EHJA 8ICHA 1BXRB 4TRRA 1L5GB 5BQPA 4B82A 4BBZA 3ESAA 3NASA 2Y8EA 3KAPA 5BMVF 4N6NA 3QSYA 1EPUA 1A8IA 1SL0A 1ZQQA 2HGZA 4US9A 4FBGA 4KUHA 4K9LA 3B8EA 3H11B 1WDTA 2R60A 3MMSA 4Y98A 2OUIA 3C45A 3LV8A 3R3YA 1W85B 2FSHA 1RRVA 3G5LA 2CXYA 4RQUA 4CDMA 3SYKA 4J91A 4DF4A 3C39A 1CNFA 1SZDA 1A5BB 3EVFA 4W1PA 4D9IA 2OC4A 4KHZA 4TWRA 2DBRA 2VHYA 4MWCA 3SEZA 1OW5A 3L7LA 4NCXA 1SBZA 4KU4A 3ETRA 1VBMA 2X8JA 4W1QA 1Z36A 3T7DA 3WQRA 4DIOA 1KMNA 4Y2RA 3M2PA 4OJQA 5D3MB 3AUYA 4GLFA 4QVKA 4FGZA 4Z0NA 5K3AA 3TAHA 2GPNA 1NW3A 3PUJA 2DZDA 3LOQA 1TADA 1W47A 1ISPA 1B6SA 4MVJH 3NCHA 5IXSA 2Y93A 2B6GA 1V6CA 2J9RA 5KFTA 1XR3A 1ONOA 3GJQA 1KI4A 4TT3D 4U7TB 4F2PA 4MAMA 3ES9A 4K8OA 5KQGA 4LYAA 5AOCA 2ZSEA 3W1VA 3Q4GA 3ICOA 4BMVA 2WY2D 2Y71A 4GOLD 2BFPA 2HCRA 2JGNA 4RKEA 3JZIA 5ERGB 4HJRA 1NKVA 2WTAA 3D6VA 3ORQA 1D2NA 4F2GA 3P2KA 4JT2A 2FEKA 2DWCA 3R4VA 2WKWA 4Z9BA 3T5CA 1GWNA 1KY3A 2C0PA 2FZCA 3PE4A 4JSYA 4WESA 2H65A 1LBIA 4ZMBA 2RGEA 5IWCA 1XO0A 2INGX 3C3XA 3TXAA 4FR2A 3NKLA 5LQCA 2GTHA 1Q3HA 1QVZA 2VQDA 1P2TA 2XVZA 4UD6A 3EVBA 1Q50A 3N0VA 4I1UA 3NEJA 3OIUA 4TV8B 4ECWA 1E2LA 5EPUA 2QARA 4AF6A 1K5OA 5BO5A 3EISA 1U7TA 2JDID 3PUIA 4CCYB 1OWLA 1I51A 2J08A 3JZDA 2VTKA 5K0JA 2EF1A 3HUUA 3IB6A 1ZQVA 3ZWBA 4UTRA 3ISVA 2HMTA 3FYSA 4MWEA 5DGTA 1CZUA 5H4HA 4DMCA 2Q41A 3K6RA 3CYFA 3KAQA 5G53C 1PEYA 2XWBF 3AI3A 4NSNA 1XVIA 1DC7A 3EXHB 4GPIB 2V0GA 1RAIA 3DOEA 2WM8A 2YNMD 4TMFA 1DIHA 2CFOA 2X2FA 3LBFA 5TT0A 2DY1A 4FXOA 4YXJA 1E7MA 4KGXA 1USIA 4K9OA 4BFVA 4DUYB 1T8TA 2ZW9A 4QARA 3HJNA 4BLVA 2IYTA 3GUHA 3CRZA 5L3VA 1TD1A 3R7WB 2XB2A 1Z4QA 3IKLA 4OJPA 1FDUA 3CVWA 4YRAA 5BP7A 3GOHA 2PS3A 4JVOA 5AESA 5AKYA 1G1AA 3OZWA 4QEKA 3COWA 3ACBA 1ZLXA 4N47A 3KKKA 5K0ZA 1V6SA 1XNJA 1YQDA 3FE2A 3NIWA 4DBVO 1WMSA 4BNTA 3SFZA 2DQSA 2HD4A 3KTAA 4LGCA 3SSNA 2GETA 4JV1A 4TUYB 1RWOA 2HXSA 4YFVA 3NEPX 3VDRA 4V24A 4MV1A 2R1UA 3NHBA 1R9MA 1V16A 2MT9A 2QM3A 2X9GA 1Y1RA 3CNLA 4J0IA 2OV8A 4RMNA 1DLIA 4R8LA 5B3JA 3S28A 2QRGA 4PH5A 4W5TA 1WZNA 2RB4A 5CU7A 3RRBA 4XFDA 4B7ZA 3QFRA 4IIVA 4IP0A 2K4IA 1PEDA 3WIVA 3O75A 5EE3A 3PX2A 2IYOA 4Y9UA 3PPWA 2ZRDA 4YB8A 1HG0A 2B94A 3SXUA 1JSXA 4AKTA 2PUTA 3E2EA 3GDGA 3JQ9C 3I2JA 1ZM4A 4YUZA 1G9TA 4ME6A 4CM4B 1RJDA 4AP5A 3VR4H 1OJLA 3MQ4A 1NX6A 2HO5A 1ZOIA 1GVNB 1N7IA 2DRIA 2FV8A 1HQKA 1E59A 5CM9C 4EB6B 3DB2A 1W4LA 5IX8A 5F4BA 1E5QA 4JI5B 3WKBA 2YWRA 4U02A 3V3KA 1N57A 4EHNA 3O8RA 2ZUSA 3V5NA 3A7EA 3OEYA 1WUHS 3TNYA 2AZMA 3JD4A 1KNXA 4NLLA 2CCJA 2XB9A 4DRXA 1TGYA 5JSYA 2PJZA 3TG8A 1KPGA 4FZJA 2ZTCA 3UWKA 2O2JA 1XZDA 4Z3DA 2NP6A 1Q14A 1CSEE 2LP4Y 1HOTA 4G9BA 4MR8B 2X7HA 2PUHA 2VDKB 3GBVA 1CUWA 4Q21A 2ZB7A 2YB1A 1N48A 2AMVA 2EXXA 2VP2A 3LF1A 1GRVA 4P7GA 3A6PC 2GD6A 5JRTA 1BHO1 2G25A 3PF9A 2Z5GA 5LFAA 3U39A 1W85A 1ZXBA 2WR8A 2VHZA 1OFGA 2FQ1A 3B9PA 4UEKA 2H11A 3G2NA 1I80A 3SQLA 4BQRA 1E0JA 1TQ8A 2GXQA 4EJMA 1QH9A 1E9FA 1EKXA 2WVJA 5AIAA 4EG0A 5DN6A 1KO7A 3SJBA 2YQ4A 2BN4A 2AHOB 5ALFA 3RYFA 3MABA 1G7CA 2X0JA 1W4RA 3O5AA 2W9CA 2QKYA 1ZQJA 2XZPA 3JRXA 5AVSA 3OX4A 1RRPA 1B4DA 4GX0A 2CWWA 2JLWA 2GMWA 1YA8A 2VT3A 3A1DA 1MF7A 1QRRA 4M9CA 4V3BA 3V2IA 1FC0A 2AFVA 3JPNA 1NK9A 3EVGA 4ND3A 4YRDA 3NDPA 2QUAA 4EEKA 1QQ5A 2CF6A 3DTNA 1BPEA 1UM9B 1L6RA 1VSUA 1Z06A 2VA9A 1KI2A 5TX7A 1I5OA 1Z0KA 3N86A 4Q7LA 1OQAA 1XZEA 1SHJA 1PGQA 1XAHA 5FTNA 3TOCA 3ZKWA 2NPIA 2PR7A 4X60A 2BUAA 5DI3B 5AO9A 5J0WA 3DGFC 4R0NA 4Z0HO 1ZA1A 3REQA 4IOLA 4DDMA 4EB0A 2ZBGA 4C4YA 1SGWA 2P3LA 1Q8KA 1LBQA 3PHJA 3JYNA 4QEZA 4ZTZB 4DJFC 3TQSA 3NHYA 4KVAA 1SVSA 3RH5A 4R5MA 1WV1A 3UG6A 2OXOA 2ZPUA 4FOTA 2WYHA 3NG1A 1ODSA 5CVVA 2O23A 1F8GA 5E1DA 3MTJA 2EKDA 1QC5B 1JHDA 1G8PA 3AEXA 2JIRA 4F7WA 1Q22A 2FSIA 4QC2A 4RA6A 1P0MA 2QTLA 1OYWA 3K32A 3VV3A 1VGRA 3MRTA 1PZXA 5KT4A 4Q82A 2P6UA 4WJKB 5JXGA 4AO6A 2VPTA 4IH9A 5JAUA 4C8NA 2C2XA 3ANTA 4G07A 1L8LA 4PL1A 1ZGHA 1IY8A 2DSNA 4B71A 4J9QA 1JILA 3AR9A 2QNBA 3R20A 4I2BA 2FR8A 1NJFA