2F8OA

A native to amyloidogenic transition regulated by a backbone trigger
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
TPKIQVYSRHPAENGKSNFLNCYVSGFHASDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title A native to amyloidogenic transition regulated by a backbone trigger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 17
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f8oA00
1S9WA 3GSWA 4PJ9B 5FA4B 4X6DF 4H88L 1KLUB 1JWSA 3SDCA 5C92A 4Y1AE 3GK8L 4TVPE 5F9OH 3OKOA 4Y8AA 3MV8A 5GS0L 4CDHA 2NX5E 5M7QA 4PJIA 1MCDA 1KYOJ 3F62A 4ZS6C 2IC2A 5C0GA 4LF3B 1P7KA 1TQBB 5EIVA 4IDJL 2VO5A 1FG2A 4GMSH 4F3FA 3KPLB 2H2PC 4ZS6D 1ZWIA 5HGGS 4WHTB 5E9DD 1ZHLB 4WFEE 2FLBT 4D0BA 2H2PD 4NWUH 2R1WB 1VDGA 3UBXI 1AIFB 3QG6B 4M00A 3GNML 4NNXB 4OZHB 3MBEB 4PJ7F 3SCMC 4JKPL 1CDBA 1X5KA 2P8LA 4W68A 4L3CA 1P9MA 1CG9A 4M93B 3T2QA 1VESA 3WNOA 1CGYA 3H7BA 1JCKA 1QG3A 4LLYB 5KAQF 4OB5H 4LBEA 2IFFH 3BGAA 1T0PB 4X8JB 5TQ2L 5EPMA 3T65A 2Q86B 3CXHJ 4PRIE 1H3WM 5D1ZB 5HHMB 1SHMA 2EEBA 3GSUB 2MQ0A 5DUPH 5E99L 1NCCL 5C07D 1T80A 5DD0L 5ACZB 1KUMA 5HI3C 4LAJH 3ULUC 2R0WL 1K2DA 1YYML 2GTWB 2BSSA 4D9LL 5HI3D 1N3NA 3WLWC 3MGTA 3IF1B 3ULUD 3RNQB 4PY7A 3MRMB 3IRZA 5J1TC 4Q0XL 2R8SH 3WLWD 3CVIH 1NAKL 2A6KB 3GJEA 2BVEA 3WDIA 5JR1L 4F7MB 4KAQH 1A6PA 4GKOA 3HZKB 4HIHA 2VXQH 3CJJA 3ZDYE 2DQFB 1K5NB 3QDGA 4LCUA 5EOCJ 1JK8B 3AS3A 3QI9A 2LE9A 3REVA 3P0YH 2PXYC 2VDLH 5D5MB 3TBWB 1KTDB 4GAYB 4ODVH 5F96L 4QXUL 2M8XA 3H3BC 3WJJA 3SDYH 4HKXB 2ICWB 2PXYD 3THML 3QUYC 5I1IL 4S0SD 5C86A 3FB5B 5AYUL 3S97C 4P2OC 5IQ7L 4YDVB 3MLXL 4NQED 1MPAL 3QUYD 1PAMA 3V4PL 4XC1L 4DGVL 4HLJA 1J1OH 4P2OD 4RAUB 1MCNA 3BKJL 3TN0A 3CSPA 1F42A 3RL2B 3TH2T 3KPRB 2ZOLB 4OFDA 2YEZB 1I1AC 4NCC1 4FQXB 3SGKA 3KPSB 4Q7DA 2JB6A 3E2HC 4PREB 1FHGA 4YGAB 3U36A 4QHMB 1I1AD 1B4RA 1MELA 4Z76B 3ORJA 2Q8AH 12E8L 3V5DA 2BXZA 2EDWA 1KSRA 2M2DA 3WFEL 1KG0B 3OGCB 3PWLB 1ZT7B 5FEBA 3P4LA 2WW8A 1UCTA 2DDQL 4LARH 3T04D 4JPKL 1J12A 1KCLA 1L6ZA 3QCTH 1OB1A 5EU6B 2BRRH 1XIWB 4K23H 4P48A 2OTWA 3VFGL 3CZFB 3C08L 3DV4B 4PJCE 4FZ8L 1A5FL 3QIUB 3N1MC 1YUHB 1KFAH 1S7WB 3I02A 3NN8A 4OCXH 5D1XC 3W5MA 2ZUQC 5B38A 3OAYH 1QSFA 4KTDL 3VD7A 3CFBB 3RTQC 4HWNA 5D1XD 4UV7L 1NAMB 5FGBA 3MRJA 3E1F1 3RTQD 3LMJL 3HZMB 3BZ4B 3P0VH 5HDBE 5FUOL 2PTUA 5EA0L 1MREL 4J3SA 3TVMA 4HUWB 5J11B 2VERN 1I9EA 1FGNL 2CD0A 1EIBA 4LFHG 4LRNH 2JB5H 4KK5C 1AI1H 1K9TA 3U0PB 4QRUA 4KK5D 4IBLT 3T77A 5JOEA 4KFZC 1HDMA 2FEEI 5T1DL 3KYNB 3U2SA 3FO0L 1AGCB 4MNHB 2AJYL 1F2XK 4R4FH 4DEPC 2IPTL 4PGCB 4PRAA 1DL7L 3VXTA 4HJJL 1YN7A 3L5JA 1F00I 4X5WB 4OUOA 4EI6A 4UDUB 1BBJA 1J1PL 4MCYB 4UB0L 4I48A 2E27L 4LHUB 1CD1A 1CD9B 4R2GC 3PHOB 3UBXA 2IQAA 3O4LA 4JFOA 4JZOB 3B6SA 3K0WA 4G9DA 4R2GD 4QRSB 4PBVC 1R5IB 4OD1L 3X11A 2MCPH 4MWFA 5CD3B 3CGTA 2O5ZH 4Y1AD 4H1LG 5LQBL 4WV1B 5E8PB 3GJFB 1G7QA 4TVPD 2ITDA 3MJ9L 4NGHH 2NX5D 3WIHA 1KPVA 5BXFB 2P7TA 4LNRB 3OKLA 1JZ2A 3ILPA 4G42A 2C7UA 3VFMA 3JV5A 2W65B 2F74B 1OD9A 1QFOA 3MUGB 4BSWA 3BD3A 4BQ8A 4Z5RB 3DURA 3GRWH 4WFED 4Z78B 3SDAC 4MMXC 1RZGA 3VFVA 4RAVB 2B1AL 3C5SA 4P5KB 4G5ZH 5IMKB 3SDAD 4AL8H 2VUYA 4HGMA 3QZWG 1AXSA 1VENA 3ROLA 3BQUA 1K3IA 3T2NH 3D6GA 4I3RH 2FD6L 5B8CC 5C70A 2ENYA 4M7KL 5E56A 4R4NC 3VU2A 2DL2A 4L8BB 1UZ8A 3EUUA 2HRPL 1TCRA 1ZXQA 3HE7C 1MJJA 5I30H 4R4ND 5ADOL 4PRID 4DVBB 1VHPA 4LGSB 5AAWA 5J13C 3HE7D 4XVSH 1JWUB 5FYKU 4DAGL 4AMKL 4QHUB 4MA1C 1A3LH 4PJHE 3MV8E 5C7XL 1RMFL 1S78C 1GZQB 4QHLB 4ZUTB 2VABB 4WTZA 1S78D 1DBAH 4L3EA 2ZPKL 4NIKB 4PB9L 1IEBA 1RD6A 1G6RB 2F5AH 2B1HH 3GFUA 2BRQA 3M8OH 2R2BB 2RQ8A 2YPVH 1G9NH 2BSED 2XYCA 3PL6A 1D9KB 2VWEE 5I74B 5AWNL 3MR9B 2FBJL 4ODHL 5IHUH 4MXVE 2Y1VA 3R8BB 3CUPA 1XF2B 2EYTB 1M7IB 4XNMA 3QDAA 3WO3B 2OTPA 3O11B 2G60H 1HILB 2ZSVB 2Q87A 2VDPL 3D69A 3JWDH 3OTTA 3VGFA 3PIQA 2C3HA 4JM4L 3LN5B 2AK1H 3C2AH 4H25B 3FAXA 3IDGA 4LLMB 3CCHA 5FO9A 4JDTH 2H45A 2X4PA 4CMHB 1PG7H 3CZJA 4S11A 4XB7A 5ESVB 1S7UA 1V3MA 5EZOL 4GSDH 2OLDA 3W81A 4LVEA 2QQNL 2JELL 1RQ5A 1I8MA 3PWVA 2FJHB 3NA4A 1MHEB 1ADQA 4GG8A 2ADFL 5KJRL 3BE1H 4QNPE 5I16A 1B88A 3RDTA 2D9QB 3MRFB 3B9KC 3U7YL 1A9EB 3RVXC 4JFZH 2FDBP 2R23B 3SDDA 4NYLA 2X4SB 4RIRB 3B9KD 3MUJA 5DJXA 4L8SC 3RVXD 2XZAH 2CMRH 3QDGE 5EU7E 3QRGL 1NC4D 4JG0H 1NFIA 4M03A 4R0LA 3B2UC 2CIIB 2VLKE 1IARB 1JGEA 3QDJD 1QLFA 1N59A 3B2UD 3QXAA 1ED3B 2BY2A 4OD3L 4XGZA 2ZG2A 1X7QA 1YNKL 4N8CL 4XPTL 1OAYL 1R24A 3L95A 3VGAB 5EBWB 2GFBB 2C3GA 3LKPB 5EBMB 3STLB 1C7SA 4JHWL 5DD1L 5MP6H 3AVEA 4PTTA 4FFZH 2GCYA 3V6ZB 2ZZUT 3EO0A 2HJKB 3VGBA 5GRWA 1JHKH 1WBYB 1CDUA 5BJTA 4X5XB 4XAKE 2X9XA 1EEZA 3EJZD 2VDQH 4DQOH 1X6LA 1IE5A 1FDLL 1DQDL 4K2UH 4Y7MA 1I8KB 4LEXH 2V2WB 2NY7L 4GG6A 1F90L 5DMKB 1PJ9A 4YO0A 4NT6A 5FECB 3QO0B 1GJIA 3MLRH 5E94A 2ICWJ 4L4VE 4ZDHA 2EH8H 1INDH 1FQ9C 4KVCL 3T0VA 3SKNA 4R4BA 4ZOCA 1OP3H 4PJDF 1CCZA 4NKOA 3TPUA 3ZLQC 4LSSL 3RZWA 3OJ2C 3MRPB 3HC4H 3UJIL 3G5YA 3ESVF 5DFTA 3JBG7 3HUJB 4LIQL 4Y2OA 3L7EB 5CINH 4WIQA 1T1XB 2AK4A 1A6WH 1P2CA 5DSCA 3QULA 1FLRL 2NXYC 5IJKA 2V7HA 4PJBF 5DS8A 4X4YB 4G6JL 1CDYA 5IB2B 1AQKL 2NXYD 3FONA 4MXQC 4XCFL 2OSLB 2DIJA 5JHDB 3EOTH 4YHOH 3LQAL 2IH3A 1H15B 1ZT4A 4MXQD 4XPAL 1FVEB 3QCVL 1TNMA 3KYKL 3IAPA 2WP3T 1YEDA 2A6JB 3VD4A 4AK1A 5JOFA 3WL9B 3CVHB 3QQNA 1G7PA 2BNRA 1TZHB 3WLBA 1YZZA 1UVQB 5JORA 4PTUA 2ED8A 3LEXB 1QEWB 4ZNCD 3C9NB 3O4LE 3V8CA 1H3UA 2Y25A 4OF3A 4UNTA 3CFJA 5BZWA 2YMXL 3TJEH 2CKNA 3SDCC 3MRCB 1BLNA 5DA0B 5DHYA 4HFUH 1CXIA 4JN1L 1YEGH 2MJWA 4B0MM 3SDCD 2CDGA 1IM9A 1KB5H 3EJJX 3O0RL 4PGEB 3FOLB 1I8IB 4HGWA 2PW1A 3MV8D 3P4OA 5DMIH 1QRKA 1E6JL 3GBNL 1GIGH 1RIVL 3O3BA 2LTQB 3QHZL 5BZDB 1CLYH 5CCKL 2H3NA 4U6YB 1J11A 2QQLL 2VQUA 3K8MA 4XBPB 1T21A 4P23A 1BEYH 2HT4C 1YEKL 1MJ8L 1TJHH 4NO0A 1BFVH 3FOMB 3MNVB 4H20H 4S1RL 1C5CH 3F7PC 2HT4D 3ZTNH 3R06A 2ADGB 1VFBA 3UJJH 1G9NC 1YEJL 3LPWA 5A16A 1P9MC 4Z0BH 1R3JB 5F70A 1MH5A 4FQ1H 5HHQB 4JRYA 4ZSOA 5LKNA 4Z7WB 4FNLH 1XF1A 1N5AA 1IGIL 2NLJA 1RURH 3EZJB 4Q6YA 5JIPA 3LIZH 4Q74A 3VA2C 4DWHA 1N5YL 1VADB 4GXVH 1IM3B 1CLCA 5TDPA 2D0FA 5DEGB 5CP7B 4DGIL 4UQ3A 2VSCA 1OTSC 2N7BA 4MQTB 4PGZA 3E6FB 4QWWC 1P1ZB 5HY9B 3QXUA 4Z7VB 3RJQB 1XZ0B 1S8DB 5GGSA 4DCQB 1OTSD 4XBEH 4XP1L 4QWWD 4HKJB 2IMNA 2AJUH 3D18A 3MRKB 1LEIA 4L3EE 1GGTA 3WXVH 5EFIA 2APWA 3RQ3A 5EU7C 4TYUA 5DUBA 3QI9C 1JNJA 4DW2L 1RVFH 5DJAA 4OBSA 1G9ML 1KJ3H 3HNVH 3A0OA 3CX2A 1MRCL 3ME0A 4IRJA 3WJJC 3QI9D 3U4AA 3HE6A 2IALB 3BZFB 3GBLA 1U3JA 2B4CH 3BT2L 1J0HA 1T2XA 2D03H 3DRTB 4DUXA 3TN0C 1DP0A 4YZFE 3BGFB 1BZQK 4G6KH 4MVBC 3T3PE 5HVFB 1ADQH 4E41E 1PFCA 3TN0D 3IVKB 4KMTL 1I9RH 2APXA 2FWOB 4YGVA 3ULSB 4MVBD 5A2KH 1ZS8A 3SGKC 5CHNB 4PRBB 4WU7B 4N9GB 4YDIL 1M7DA 1G7MB 1BOYA 1T2QL 4XAKD 1MCWM 1P4LB 4LKXB 4RFEA 4MA3A 5IJVA 1B2WH 3OAUH 4XPBL 1PYWB 1UM6L 4KRNA 3MFFA 2GJ6B 1WAAF 5JO5B 3WBDA 1NCBL 1IGFL 3TIDB 3OKEB 3GMRA 5B39B 4U0QB 1FRGL 5E4EB 2P8MB 3NPZB 4NRXA 5T1MA 3FB8A 4F9PA 5I1CL 1T0NA 2H32A 2K7QA 4ODWB 1KC5L 5FGRA 5LGJB 2VDKL 3KJ6H 1MNUH 2IPUG 2M1KA 4Y0GA 4P3CH 1Q94A 1VB9A 5GSRB 4Z7QE 3DSFL 4EN3B 2PXYB 3RKDC 1MCOH 5FGBC 1AGFB 5BMFH 4M1DL 1QSFD 4WI3A 3PHQB 2YD9A 1CVSC 4H88H 3QXWA 1FZJA 2I07A 3RKDD 2ENSA 3K1DA 1OGTB 3GK8H 3QIBA 4JZNA 3L1OH 3TVMC 4L8CA 3M1BA 4LEOB 3TNNB 3B9AA 4K8RH 2A83B 5DJ2B 3NVQA 3H3PL 3HKFA 2WUBL 4IDJH 4QT5B 5GGSY 4WFGE 2I24N 4Z77B 4GG6E 1I1AB 3BSZH 4HHAA 4XMKH 4KY1L 1FVDA 4OLVH 3LHPH 3GSOB 2I60H 4WJ5B 1Q0XL 3S88L 5I8CA 4XB8A 4Z6AT 4HPOH 3RGHA 2I5YH 1G7HA 2RIKA 5J7CC 2H6PA 1LVEA 4LKCB 1D5MB 5ID1A 3GI8L 3P11H 5TQ2H 4WI8A 5AUMA 4EIGB 3BH8B 5EU5B 1K8IB 3REWB 3O4LD 1CDJA 5I1JL 5DWUH 1NGZB 3QQ3B 5DD0H 5DQ9A 5E24E 3DX8A 4ORGB 1XF5A 3RBGA 3EYUL 2AK4E 3FN0L 1S7RB 4OZIA 1G7JB 4UIKL 5D1XB 2EIDA 1U8NB 2X7LA 3MLUL 2O5YL 4QRRA 4OGXL 4DKDC 4IRZH 3GHEL 4KU1A 5DJYA 1RULH 1NAKH 4G43B 4UINL 5CEZL 1OAXL 1MY5A 1ORSA 3FO1B 1WZ1L 2VISA 5IBUB 4JFXB 1DEEB 4CMMB 2FX7L 4MX7B 3SO5A 3B8YA 2ICEB 1T1ZA 5E2VL 3DO3A 4MD4B 1SVZA 5FHAH 3CFEB 1YDPB 4TTDC 2H8PB 4XWGH 5F96H 4GS7C 4QXUH 3BQUC 4S1DC 3VWJB 2NY2C 1BJ1J 3OR6A 4TTDD 5BV7H 3MRRA 2BNUA 3KPMB 3BQUD 4S1DD 5DJDB 2NY2D 1RFDL 3GI9L 1Y0LA 4D9RE 5IQ7H 2AXGB 4JB9L 2O61A 1MJUL 1T1WB 1LO0L 3V4PH 4FQPA 1DDHB 3AM8A 2Q20A 4JQIL 2P5WE 4KTEL 3B9VA 5D72H 3LEVH 2A1WH 2WK2A 3V0WH 1CD8A 3ZKSD 5K33A 3A6OA 4R2GB 4JDVB 2YZ1A 3FFDB 1M6OA 5HVHB 1T20B 4TUKH 5F7DA 1YYLH 2F8OA 3DPBA 1VGEH 4UILL 12E8H 2ADJB 1CICA 2E9IA 5ANMA 3WFEH 4L3ED 3DVNB 2DDQH 2GSIB 4DKFH 2DLIA 4U1JB 2Z93A 3O45A 3PXHA 5K59F 1MFBL 1QKZH 2RB8A 4FZ8H 5F89B 3MRQB 3TA3B 1HHGB 4GAJL 1RZKL 1JRHL 3CNKA 1MUJA 2W59A 1WF5A 4FTVA 3SDAB 4JRYE 4M5YL 3BDYH 4OJFL 4ZSOE 4UV7H 3KPTA 1UZ6E 1QYGL 4WY7H 1UWGL 1YEIH 5JTWA 5J1AB 3JV6A 3DUUB 1PKOA 1KACB 5B8CB 3S8WA 5EA0H 1R0AL 4NBYB 4PRIB 4OSUH 4KHXL 4J8RB 4MQXC 5HHOE 3HE7B 3ZHLA 3W5NA 5GRXG 4BJLA 1HE7A 2YPLA 5C0IA 4MQXD 4ZTOH 4NOFA 3RDTC 5CBEB 1XMWA 2HFFA 3VXOB 1RV6X 1EUUA 3UPRA 1LDPL 2UY7A 3SDDC 2XIDA 3RDTD 3MODL 4JPWL 4TNVK 3UBXG 1K3ZA 4DZ8A 1SQ2N 4NM8L 3Q3GA 2C26A 1FAIH 3SDDD 1P53A 3C5ZB 1WBZA 3LZFL 4R0LC 4L8DB 3RPKA 1XR9A 2R15A 32C2A 4X6DB 1ZGLB 3DSNA 4AEHL 4UB0H 3JTTA 2YD3A 4UIMA 2UVEA 1Q8MA 3OKNA 5ESQA 3TT1L 3KLHC 3JTSA 1FIGH 4OKVB 3QEHB 1L7TL 3OJVC 3KLHD 4P5MB 1DQML 2E7HA 4QF1B 3WUZA 3D87B 3VFTA 4JFQA 1SYSA 1U8KA 3W9DB 2EO1A 3WNPA 1ZLSH 4BH8A 1RUPH 3EO9L 4FZEL 1CT8B 3NZ8B 4JFEE 1ZTXH 5EO1A 3TPKA 3MJ9H 2Z35A 2FJFB 2AEIT 4EBQH 1IFHL 3SE3A 3HPJB 2ZCKH 2VLLB 4TQEH 1CF8H 2HP4A 5SWQB 2DKUA 4K8RC 3W2DL 3BUYB 5L6YH 1V7ML 5GXBB 4OIBA 1FFRA 1H5BA 3S35X 4WFGD 4K8RD 1ES0B 3PDOA 3KPOB 1CXEA 2H32H 3T0AA 2B1AH 3RNKB 3VXQA 2GJZB 3HMXA 5HPOA 2ZNWA 2WBWB 5DD6B 1S9VA 2FCBA 5MHSD 1LD9B 5GGRY 3NABL 4HZLB 5FIEA 2FD6H 4JQXA 1EFXB 3HG1E 1NC4B 2I9LB 3D25A 5EUKB 2OCFD 5KTEL 4Q6IA 2MKLC 3JV4A 3KWWB 3QDJB 3MJ8A 1MAML 3RGVA 5FGCE 4RDQG 1SJEA 3A6CH 5FCUL 4LGRB 1JIBA 3PGDA 3OKDB 1U8MB 2DLFL 3MRHB 4AMKH 1Z0MA 2AK4D 4W81A 1F02I 2DICA 1CLOH 2VL5A 5IJKC 5FM5O 3LD8C 4LPTA 4YHIB 5C7XH 1RMFH 2MQ3A 2P8PA 4F57H 1S3KH 4R3SB 4UT6L 4RGNB 4X4MA 4N0YH 2K7PA 2MQCA 4Q9QL 1ZLVK 3ZT7A 4V2CB 5GRUH 1S7QB 5EZJB 1A6VH 3B4NA 1S7VA 3W11C 1P4BL 2BFVL 4KKCC 4PJFF 1U8PB 2GITB 4KK6C 2VZVA 1HNFA 4UU9B 4KKCD 5TH2A 5DUML 3DTXB 4KK6D 3HNSL 4KROC 1BMGA 3F7YA 4PJGA 4N8VA 4BZ1L 3HZYA 4EDXA 1U91A 4RNRA 4ISVB 1HEZB 3I3DA 4OV6F 4HZAA 4KROD 43CAB 2BNRD 1PZ5B 2BVQA 2OTUA 4D9RD 1WZLA 3PNWB 2UY6A 3G6AB 4U1GC 5T1LB 5BV7C 3QJHA 4OCNC 4JM4H 1WBXB 3KYOB 3WNMA 1PBYA 1Z9OA 4N0RA 4WW1B 4YFLF 1BQSA 4WU5B 1U95B 5T3XL 4M6AA 1JPFA 5CEXA 4K7PX 2EC8A 4X8XA 5KN5B 3GMQB 4RA0C 4ZFGH 3L3JA 1JPST 4OZIE 5T33H 3GMPA 2HTLC 5IFAL 2ADFH 5KJRH 1YNTA 3RUGA 3MLVL 1IM9D 1JZ7A 3RWFB 3DBXB 1I85A 2QADC 3FRUB 4C4KT 4ZFFB 2XKNA 2D7MA 2HTLD 5I66B 4O2FA 1SEQL 1OAUL 3U7YH 3MXVL 1QLRB 2QADD 4P23C 5E2WH 1S9KC 1OAKL 4GW5A 4P4KB 5DJCA 3NFSH 2FRGP 3HZVA 3TCLB 3WFBH 3HLAA 4P23D 1JNNH 3VG9C 5I2IB 3AAZA 1UEMA 3HR6A 2V2XB 2EYSA 3IU3A 2I9TB 5CKAA 3QPQC 2BHZA 5DDHB 3I6GB 3ES6B 2K9UA 3NACH 3OZ9L 4LVHC 4Y2DA 2EXWC 3FZUC 3QPQD 4KI5E 5IMLA 3W39A 4JRYD 4N8CH 4XPTH 1A7QL 2EXWD 2XZQH 1DUZB 3FZUD 2NPLX 5DJZA 3UJTH 1QSEB 4U6TA 4ELMB 2X4OA 1YPZF 3INUL 2MSPA 4Y4KA 3VRIA 1QO3A 5IEKB 4PJCF 2LU7A 3OKYA 3ULVL 3BRGC 3C6LA 2X41A 4JM2A 3MA7A 3SDCB 4NSKA 1DQDH 3IFLH 1TMCB 1J7VR 5ANME 3T0BA 4PJIB 1JGLL 3HPLB 3AMLA 4LSTL 1E0OB 1I9JL 3TNMB 1AR1C 4L9LA 3D0LA 4XZUA 3VFPA 2Y7QA 1LEGB 2KZWA 1C12A 4NJAL 4F9LA 3TYFB 1TJGH 1ZKAA 3QH3B 4XWOC 1AR1D 4IRJC 1YY8B 4D8PB 1XCTA 1ZWIB 3IDJB 3PJSA 3BPOB 1NL0H 3HE6C 4OLWL 4XWOD 1NGXA 3FB6A 4D0BB 3TESA 4IRJD 3QFDB 5CJQL 4BFIA 4GBXB 3BEWA 5AYQA 3HE6D 1KNOB 3K46A 1OAZH 1VGKB 2XRAH 4FTVE 3S96A 4FG6D 4PJ5A 3R1GL 2YWYA 3DX9A 2P8LB 3B3IB 4L29B 2WBJA 2YWZA 4YWGH 4OZFA 3H9SA 4PGDA 1A7PL 5DHXB 1CG9B 4BFBD 4XRCB 3N9GH 1FLRH 4YBLC 2WP3O 3G9VA 4PG9B 2NY0C 2R0LH 2HLAA 3KPNA 4OM1H 4G6JH 1KTLA 1A6UL 5E5MB 3IDMA 1QFPA 1TVHA 3GMLB 4K3DH 2NY0D 3VXMA 1L0QA 2W91A 3D9AH 1N2RB 2YPLE 1VACA 1NH6A 4ONGL 1HNGA 5CEYB 2BSSB 5BVJB 5TE6L 3SE8H 4PY7B 5F7LB 1PQZB 4G8FB 3H3KA 3LS5L 3BDXA 1T7VA 3D0VB 1HH9A 3F7VA 2J8OA 4F9PC 5D71L 1GHFL 5L2JB 1W72A 4FABH 1TZIA 3ARZA 5DK0A 1S7SB 3ZL4L 5LWYL 4JFDA 3MLYL 3QI9B 4U1MA 4JHBA 4L1DA 5DR5L 3REVB 1U6AH 5DJ0A 4CN6A 1IGCH 1MF2L 5JW4M 2HVKB 4CU6A 2A9ML 2YMXH 2ZSWA 1HN1A 5KSUA 3QUZA 4NM4L 1QZ1A 4DKAA 3QIBC 1ACYL 5I18L 1HHIA 2VB5A 4IHOA 4TOYL 1NEZA 5FOJA 3ZDZE 3QIBD 1AXTH 1E6JH 2AJZA 3SKMA 2CXGA 3HI1A 4FFWC 3CH1A 5KSAA 5FAAA 5DT1L 4LCCA 5EOQL 4FFWD 1FE8L 2XKSA 5HGHB 3HMXH 3BP7B 4M9OA 2B7DT 5DK2A 4K55A 1D5BB 5IHBA 1OY3B 2RHEA 4GO6B 4M7LT 4M1GH 4D9QE 5D96C 3V5DB 1U58B 4WDIA 4P2YA 4PJHF 3W9EA 2EKSB 3VFOA 4ZUSA 3S5LA 1JYXA 4JO2L 2HFEB 4MD5A 2XA3A 1TITA 4RGMC 4UOW1 4EUPA 4K9EH 2YA0A 2OTWB 1LP9F 4XMLH 1Y6NR 5H35A 1N5YH 2AV7A 3I2CL 4EOWH 3BO8B 3LVEA 3Q2CA 4J3UA 5C09D 3SQOL 4WHYH 4YHPA 3SBWA 1KULA 4Z7OF 4DGIH 3MRIA 4RWHA 5B38B 3WHXA 4PIRF 2R29H 1QSFB 4MXVF 5DURD 2Q8BL 4NRZB 2J2ZA 2WBKA 4XP1H 2LV4A 4O2CA 4WI2A 1I7UA 1RIHH 2A73B 2M26A 2ZKHL 3MRJB 1Q38A 4R96B 3O41A 2AI0H 4QRRD 2Y07L 1JHLH 3QQ9C 4LVOB 4R97C 1W0WB 1T22B 1VA9A 1QFWI 5I9QB 3MLSH 5C0BA 1PX3A 3V4VL 5F9AC 4AIZA 3ALXA 3H9ZA 1ITBB 4AH2A 1E28B 4N0FA 1A4JA 4P9MH 1U3ZA 4NUGH 5IGXL 4KI5C 4OFVA 3PV6A 1MCHA 2AQ3A 2VLJA 4KJYB 4PJGE 4HWBL 3RY4A 1U8LB 5E6IA 3UZVB 5DVLA 4KI5D 3AM8C 1GGBL 3U2SB 1A21A 4GMTL 1MHPL 2EC9U 3RY5A 4PRAB 5ITBL 1QLEL 5D8JH 4UBDC 3VXTB 1YN7B 4IMLB 2J6EL 2FHCA 2FEDC 4UBDD 4KMTH 1EXUB 3KYMA 2IQAB 4JFOB 1RPQA 2FX9L 5F1IA 2OS7A 5EG6C 2FEDD 4KXZI 4MNGE 4RGOL 1EDQA 2DI7A 1EO8L 4ODXB 3HR5A 1UM4L 1T2QH 4DN3H 3HI6H 3RUGE 3X11B 4JFHE 3FQWA 4MWFB 4AM0B 1DE4B 1UKTA 1CICC 4PPTA 3NZHH 1HXMA 3TBVB 1ZLUK 1UM6H 1WC7B 5E5UB 5E8NB 1NBZA 1CICD 2BSRA 4NQDE 3ILPB 3VFMB 4OZGA 1UACH 3MRNA 1KB5B 1FRGH 1A6AA 3LB6C 1ERNA 5IT2L 1J0JA 1X5FA 3IGAA 3NOIA 5I1CH 4HCRA 4WCYL 4ORZC 3LB6D 1T66C 2VDKH 3PGCB 3HI5L 4I0PA 1FIEA 5IIEB 3E0GA 2AGJL 1RZGB 1EBPA 1NGPH 3ECBB 3RZCA 1T66D 1E4JA 2LVEA 3DSFH 5KVFL 5IF0A 5FDWB 4FTVD 3VFWA 5EBLA 2WWKT 2BVOA 5HI5C 4Z7UF 4GS7B 1U36A 3IKCA 4NN7B 2NY2B 5IB4A 4DGYH 4RAHA 1WVZA 4PRPA 1MCPH 2Z92A 2DLEA 5HI5D 1XAUA 4OIAA 1EHXA 3MUZ1 4PS4H 3VGDA 4HUMB 5I71B 1FN4B 4KDTA 4HF5L 4ALAH 4H8WH 2KL6A 1KYOK 4PJ8B 5EU4B 3H3PH 3T3MF 1I1YA 3ZT5A 4RMSA 3PQYA 4PLJC 1CZ8H 3BGMB 4M4PA 2YPLD 5DFWH 3WXWL 2B8OT 3NCBB 4MNQA 2BVPB 4NKDB 3QAZC 5DVNA 4M6OH 4M7ZB 3DYPA 4PLJD 1F4YL 4JANB 3SOBL 3QHFH 1RJYA 1DJSA 1NLBL 2J5LC 2VXVL 1Q0XH 1ZVYA 5B3JF 3S88H 4L4TE 5F71A 1N0XL 3LH2L 4L3EB 4TRPH 4BFEA 1YJDL 2ICWI 1IAKA 1F4AA 1IEBB 3BHBA 2EIEA 4HT1L 3OX8B 1QFHA 4OZFH 1QFWM 4MLIA 1ZEAL 4QY8A 2EH7H 3PP3K 4PJ5E 3CXHK 5I1JH 5FHBL 3RPIA 4XNQA 1BGXL 3OKKA 2DL9A 3V52L 3H9SE 3WSQL 3O6FB 5I1GL 4JAMA 1F45A 3K3QA 3F8UB 2O5YH 1U0QA 3SE3C 1SBSH 1C16B 2QR0A 3IDGB 5CSZA 4RQQA 2R2EB 2VH5H 3S34L 4DN4H 4M5ZL 2X4PB 3F6LA 4PFEA 3IDXL 3VXME 5CEZH 1OAXH 1O7VA 3VW3L 2RGSA 1T7XA 1HQ4A 4NC2B 1G7LA 1H5BC 3QUML 2V6HA 5BQ7A 1AC0A 1E4XH 1ND0B 4GG8B 3HMWH 1AP2A 2EYRB 2W92A 4PJAA 4QHKJ 5E2VH 2VN4A 3AB0B 4S1SH 5TQ0L 1W72H 2D7TL 5I16B 2Z31B 2QHLA 1URLA 4GW4A 4D9QD 3I6KA 3QA3B 4N1EA 1X4YA 2GT9B 2VXUL 4QLRA 5C9KA 1S9YB 4JQXC 4D94A 2DJ4A 5F7HA 3LRSA 1RFDH 3GI9H 4JFPB 5CJXC 5JQHC 1NGWA 4Q6IC 1LO0H 4JFDE 4QKXB 1S7XB 3OXSB 5F8RC 3PWNA 1NFIB 1GZPA 3RGVC 5HVWA 2CXKA 3WV0A 2GHWB 1WWCA 5IB1B 3PWJA 1JGEB 5A2IH 2CLZB 1QLFB 1N59B 4K9EC 1BIIA 3RGVD 3QXAB 2CJUL 3SPVA 1X7QB 5I73C 2DYPB 43C9A 4XXDB 2VLME 3F5WA 1PEZA 4M6MH 2FIKA 3MROA 1R24B 3X3FL 5EIIA 3MLWH 2X40A 1BQHG 4PJ9A 1KLUA 3SE4C 4TSCH 3DHJA 3G6JF 3QO1A 4G9FB 5DD5H 5BJTB 1NBVH 4LF3A 4NFCA 3L6FA 3NCYP 1ZHLA 4GG6B 4CVWA 4EUPH 3KJ4C 1EGJL 4UT7H 1Q72H 1CFVH 4GKZB 1AIFA 3QG6A 4NNXA 4PLNC 3Q5OA 4OZHA 4LU5L 2LU3A 4RDQF 4PP2B 4X7FC 3TPUB 4NKOB 1UWGH 1NMAL 2CIKA 2WUCL 4LLYA 2KH2B 2VDRH 4X8JA 5LBSL 2IF7A 2Q86A 4D3CL 1OF2B 4IOSD 3ZTJH 5D1ZA 2KZ1B 1EBAA 4O02L 3T2OA 8CGTA 1I85C 1FSKC 1QFUH 3MLZH 2H1PL 1KN4L 3P9LA 4JFHD 3WD5H 3QULB 1LDPH 2GTWA 3C60B 2UWEA 3MODH 3RFZC 5DS8B 3IF1A 5GISL 3LD8B 3RNQA 5KANI 1EHNA 3GHBL 2O26U 1KJ2L 3MRMA 5C0BE 1WFUA 2A6KA 4LOUC 4OLYL 4F7MA 4OIIL 3NIFE 5DI8A 1C08A 3HZKA 1OCWL 3OPZL 3RAJL 2YD8A 2IH3B 1QOKA 4LOUD 1ZT4B 4Y2DC 4CJ1A 2XQYK 1JNHB 2DQFA 1K5NA 3HC0A 2VLJE 3BYTA 3TT1H 1JK8A 1NBYB 4Y2DD 4OAWB 5D5MA 5JW4R 3TBWA 5JOFB 1KTDA 4GAYA 4P4RB 4U4BA 1WICA 4HKXA 2ICWA 3FMGH 2ED7A 4U1KB 2BNRB 3VDAA 1OLLA 1UH3A 3TV3H 5JORB 5C0RL 2ZUXA 4X80L 4Y4KC 2HH0H 4YEEA 4UUJB 3MOBH 3U4BL 4YFEA 4HS6A 1B3JA 3C6LC 4Y4HB 5F3HA 4Y4KD 4RAUA 2PYEB 4JM2C 1PSKH 1KTRL 1IFHH 4CGTA 3RL2A 4PY8I 1OQXA 3C6LD 4OI8A 3PGFL 4JM2D 5DHYB 1IC5H 2ZOLA 3LQZB 4H8WC 4UV4L 4XHJD 1EMTL 1V7MH 4Z7QF 4OCLC 35C8L 1IM9B 4FQXA 4HGWB 3H42H 2PW1B 3KPSA 4L9LC 4PREA 3P4OB 2EDLA 1MIEL 4MSWB 3S35L 4QHMA 4F9LC 5JW5B 3MGOB 4Z76A 1IVLA 2IBZX 1MCKA 4NQTA 5HHXH 1MIML 2H3NB 4OZGE 4PBWD 4UTBL 3WCYA 1UM5L 3QFJA 1KG0A 3OGCA 3PWLA 1ZT7A 4P23B 4YDKL 1K85A 3FKUS 4NQCB 4KRMB 5JOPD 4WUKL 2XXMB 2G2RB 4PV9B 3DROB 3H0TB 1IT9H 2HT2C 5ALBL 1J18A 3CZFA 3E3QE 3R06B 4XI5C 3DX7A 2WBJC 3EO1B 2HT2D 4PJ5D 4XI5D 1YUHA 5FCUH 2WBJD 1S7WA 4JRYB 3JWOL 2DLFH 2IG2H 5HYEA 3H9SD 3CFBA 1N5AB 5SWZB 1X5YA 5D2NE 1JMXA 4ACPA 3HZMA 3BZ4A 1Q9OB 5TDPB 4RMVA 3ZE0F 2DJSA 3DX6B 4WVRA 3VXMD 5IG7B 3PQYE 1YEFL 2B5IB 2NW2B 4HUWA 4UT9H 1DBBH 2XZZA 3PF2A 1FFOB 4AENB 5IEHA 3QDME 2DWEB 1KIRA 1BVZA 3U0PA 5DUMH 4CBPA 4PGJA 1G84A 5TGBA 6FABH 5L9DH 3BD5A 4X98A 1RY7B 2PETA 1I7ZB 4LVNC 1CE1H 4C4KO 5KVMC 3KYNA 3ARFA 3HAEB 4MNHA 4PGCA 4JFDD 2AEWA 3L9RA 5DC0A 1OT1A 5MI0C 4P9HL 5KSBA 3QUZC 2APBA 4MCZB 4X5WA 1VSCA 4UDUA 5ICZA 1D5ZA 3ULVF 3EZ8A 4NUJB 5HHVL 4WEUD 4O5LH 1DFBH 3S37L 3QUZD 4L5FL 4JZOA 4KJQC 4K7PL 5JXAH 3AU1B 2XN9B 3NBNA 5IFAH 4QRSA 3OL2A 3SJVB 1R5IA 4KJQD 3LV3B 5C2UB 1AE6H 5KSAC 1S5IH 4DVRL 1KN2H 1XH3B 4NO2B 3O6LL 4LCCC 1SEQH 1OAUH 1TJIL 2GEEA 3MXVH 1WISA 4WV1A 5E8PA 3GJFA 2MNUA 3IJHB 4JRXB 5KSAD 5KVGL 4JG1L 4YBLB 1GGCL 4RFOL 5MEOA 1ZS8B 1CGXA 4J1UB 5CZKA 5HYJA 1M7DB 1NC2B 4LNRA 5C08D 1XF3B 1QFWH 4PJAE 2W65A 4OT1H 4Q9RH 2F74A 1KJVB 5T3ZH 1LGVA 3CLEH 3MUGA 1F4WH 2HWZL 2HLFC 3OZ9H 3LOWA 4Z78A 1BBDL 1DR9A 2X4TA 4OV5A 3MFFB 3CSGA 2DTSA 4RAVA 5B4MC 2HLFD 4MHHI 4HIEB 5T3ZE 2PF6A 3IXTA 1A7QH 4M6NL 3VFUA 5CGTA 2E6JA 1ZGLP 5B4MD 3CFDB 1IEAB 2YUZA 4RMTA 3SBWC 3SHSA 3INUH 2DB8A 1CWVA 4R7DB 3Q5TA 5IWLA 5FK9B 4LSRL 3MFGB 5CS7A 1GSMA 2NQCA 4L8BA 4ODUB 1OSPL 3G04B 3ULVH 1QACA 3UYRL 4DVBA 4ESKA 2NZ9C 2Y36L 1I9IH 1FZJB 1JWUA 4QHUA 2C4XA 2NZ9D 1S5HB 1D7FA 1CR9L 2MPAL 1NCAH 4L8CB 1KCRH 4JQVA 4GRMB 4PGBB 1EUTA 1GZQA 5K93A 1QRNB 5C0BD 4ZUTA 2VABA 1FYTA 1W2KT 4OZFG 4C57C 2YN5A 1GCFA 1G6RA 1TCMA 2R69L 3CFKA 2EDDA 4HHAB 2IANB 5E6IC 1D9KA 3LQMA 3MACL 5D7SH 2J8UF 2NMSA 5DF0A 5E6ID 1J8HD 4KDVA 4FQJH 4OZHE 2VIRB 5T1KB 1XF2A 2EYTA 1JPTL 1RZIA 4R90H 1G7HB 5I8KH 1A7PH 2IBZY 4HMEA 3O11A 3HFMH 4G7YH 5ID1B 2R39A 5DRWB 1HILA 1U3HA 2ZSVA 1MY7A 4JCLA 1HIML 3U9PH 2W38A 2Z91B 2L0DA 3LS4L 4RGMB 2HKFL 3MGAA 3DVIA 5C09B 3LN5A 4FXGB 1RUAL 4X7CC 5HHME 5K9OB 3ABZA 3OR7A 5H37H 3JSSA 5CFHA 1QQDB 3DX8B 2X9YA 1XF5B 2VZUA 5DURB 5ESVA 4OZIB 1BP3B 1R5WB 1KT2B 2W60B 3BP5B 4FMKA 4OKDA 5DQDH 2FJHA 5TE6H 1MHEA 4QRRB 2IPKA 1NANH 4LSUH 2ICCA 3EOBB 5DJYB 5I1EL 3BPNC 2F53D 3P4NB 3SKJL 5D71H 1A9EA 1C5DB 2R23A 3DO7B 4I0PC 1YMMB 4OCYH 4RIRA 2DQDH 3IETB 3E3QC 4RWYL 1NEZG 1WT5A 3RZCC 4J12A 2CKBA 4I0PD 4RBPK 3VXNB 3OAZK 1X5XA 1MF2H 1EO5A 2CIIA 5D5ME 3FFCB 5EH1A 2BSTA 3RZCD 4M8QA 2ED9A 1KXVC 1ED3A 2KUTA 3MRRB 3AFLA 4XP9H 2DD8L 5I18H 2I27N 1KXTB 4R26L 1JF5A 3MXWH 4PRPD 4KDTC 4TOYH 4PJFB 4HFWA 5F7FA 3I3BA 1ETZB 1DANT 5EBWA 1PKQB 3NFPA 4HK3J 3CDGB 3FAWA 5EBMA 3LKPA 1MQKH 1AJ7L 4ODSL 3CPLB 4CN4A 3KPRE 4U2ZA 4TNVF 1FE8H 2NY6C 5HJ3B 4G7VH 5GGVY 5JQ6H 2HJKA 1CGSL 2F19L 1NMBH 4OTXL 3UZEA 4NZUL 4X5XA 1P84J 3RKPA 4MNQD 4EUPG 4NHCH 3KPSE 2R0KL 2NY6D 3V0VB 1SY6A 2JF1A 4AG4H 1A7OL 1MCCA 1B9ZA 2V2WA 2QQQA 2BCKB 2V17H 4UZGA 3PWUB 2D4FA 3QO0A 5FECA 3DI3B 1HSAB 5KS9A 1BFTA 4XNZB 2IADA 1JTOA 4YHKL 5MERB 3VE0B 2NY4C 5EU6E 2APFA 3QB7C 1PG7W 4H0IA 2NY4D 3SQOH 1T0MB 2VDNL 2C3WA 3ARBB 4CNIB 4X6CB 3WEXB 2YRZA 4F58H 2B0SL 1VFOA 1A7RL 3Q0HA 4UI2A 3HUJA 4G8GB 1T1XA 2ZKHH 4LSPL 4P2RA 4HK3N 2D7PA 3WYRA 1CFQB 3HNTL 1NSNL 2EKJA 2DLTA 3BXNB 3WNKA 4X4YA 3MRGA 3V4VH 1ODAA 2OX5A 1J05B 4HPYH 3MCG1 5IB2A 4G6AC 1HYSD 1TZGL 4F33A 2HFFB 1YPZB 3LPGA 2OSLA 5JHDA 4YHNB 4ONFL 5IGXH 3BI9X 3UPRB 1SM3L 1H15A 1WFOA 1WCQA 4JDZA 4DZ8B 4HWBH 3RHWF 1OL0A 3PDGA 1LMKA 3Q3GB 2A6JA 1FO0L 2J5LB 1UA6L 1WBZB 3S36X 5T3ZD 1MHPH 2JJVA 1XR9B 3WL9A 3CVHA 1L7IL 5TF1H 3CFCL 5I1DB 4G8EB 1TETL 1TZHA 5KSBE 1LO5A 4WFHE 2BY0A 4UIMB 1QEWA 2ZOKB 2BERA 4X9BA 3JTSB 2FX9H 5EWIH 1CI5A 2ZUWA 4YXLH 3GJFH 4ZG1A 4GRLA 3AMKA 4PJ9C 1FP5A 3RI5F 1C5BL 3V4UH 4JFQB 1U8KB 5E8OB 5HI4C 2X10A 4PJ9D 2V5TA 5EO1B 2EZ0C 3FOLA 1I8IA 5CP3H 2Z35B 5HI4D 3OB8A 2WWKO 2VTFA 1TQBC 2FX8H 2NY1B 2EZ0D 4I1NB 5BZDA 1E4WH 4Y5YB 1MJ7H 4JFFA 3BZEB 4XBPA 4BA8A 2XTLA 1H5BB 2AABL 2EE9A 3OV6A 3MNVA 4XHQA 1Q9KA 2YK1H 3RWJB 2ADGA 5KVFH 3TWCH 3VXQB 5HDLA 2NXZC 1R3JA 1MCJA 3MJ7B 2DLHA 3KDMB 4M93C 1G1CA 5HHQA 3MA9L 2NXZD 2PR4L 1F3DH 4XAWL 4Z7WA 1OM3L 1QP1A 1UB5B 4KGJA 1XGQB 2XY1A 4WGWB 5GGVH 5DRNB 1ZT1B 4XP4H 2NTFB 2WIIB 1VADA 2OJZL 4P46B 4JY5H 1IM3A 2UV3A 3GMMB 4XCYB 4Q2ZB 1SJEB 4XPHL 5HHMD 3X3GL 2P48B 5CJ8A 4RX4A 5DEGA 1LO2H 4AZ8A 2XZCH 1NKRA 3E6FA 5HY9A 1P1ZA 1UYWL 4NP4L 4HMDA 1CVRA 4Z7VA 1ZLVH 1F4YH 1XZ0A 1S8DA 4Y8DC 2BJML 4DCQA 3SOBH 2P8PB 1G6RH 3QEUA 2DWDA 1HCVA 3VXUB 2VUOA 3NIDE 1ZA3B 2AP2A 5L8KB 4K3EH 5KG9B 2APVA 4QO1A 3MRKA 5LXGH 1FYTE 1S7VB 4G3YL 2L4OA 4FFVC 1T3FA 2CK0H 4BZ2H 5L7XL 1AGEA 4OCWH 1ZEAH 4ZUUB 2XQBL 4FFVD 4M7LH 5K9KB 5TH2B 1QVOB 2IALA 5E1HB 4R8WL 1BGXH 4N8VB 2OMBA 3BZFA 1U91B 3V52H 3WSQH 5F93C 5I1GH 1BM3H 3DYMA 1UWEL 4UAOB 2BVQB 5BVPH 4OGYL 4PUBL 3WKNA 1MRDL 2AEPL 3DRTA 1SEBB 3FT2B 1F4XH 4FP8H 4WEBL 1W0VB 1OAQL 3IVKA 3IDXH 2WLZA 4NJ9H 5CEXB 3FJTA 3VW3H 3ULSA 1HKLL 3C09B 4FQXC 3JV0A 4WU7A 5A2LH 3GMPB 5KBNC 3VXPB 1LP9B 5TQ0H 2YRLA 5DYOB 4FQXD 1FSKB 1P4LA 2D7TH 3KPSD 1SYVB 4MZ2A 5I17B 5EB9A 2ZUTA 1UC6A 3VXSD 4QXWA 2CKBH 1F3JB 4JO3H 1PYWA 4YK4B 4MS8C 3QFJD 1INEH 1U8QB 1UCBH 5DQJB 2GJ6A 1CGVA 1KB9K 3DNKA 3P9WB 4OCSL 4YC2C 3TIDA 5JO5A 3AAZB 3OKEA 4KV5F 5GRVK 5B39A 3P77A 1TVDA 4MS8D 3IU3B 2P8MA 3LSOB 3N85L 4HBCH 3TCXA 2YSSA 3WS3B 3LPFA 3L3GB 4ODWA 1JV5B 4PYGA 5D6CB 4Y2DB 1QBLL 1J86A 3GIZL 3NMEA 3L5HA 4ZUWB 1J10A 2BX5A 3EFFB 4YE4H 5DZLA 3W39B 2XTJB 4EN3A 5IW6B 5I1AB 5D7LA 1AGFA 3PHSA 4N1CA 3PHQA 1Z3GL 1PEWA 1OGTA 4K3JH 1SY6H 3CMOH 4KKBC 1FNFA 4Y4KB 5FYKH 4OBRA 4LEOA 5J11C 4Q9BA 4X7SH 3TNNA 4LLWB 3VH8B 3C6LB 2A83A 4KKBD 3OBAA 4NO5B 5DJ2A 4U3HA 4QT5A 5BW7A 1DN0A 5HYSB 5C3TA 4B5EA 5HDQH 2IWGA 2GAZA 5FYKE 5E1AB 1MFEH 1I1AA 1IL1B 3WUWA 2F58H 4L9LB 3GSOA 4WJ5A 1QBML 5KS9E 3ARFC 4ZPTB 4JPVL 1FFNB 4I3GA 5AZEH 1JN6B 1XCTB 4FXLA 4MJ4A 3MYJA 3PJSB 3TEUA 1N4XL 5HYQB 1HHHB 3ARFD 2ZUYA 4U6VL 4MAUL 2PNDA 1D5MA 2R0ZL 2WUCH 5BRZA 4BFIB 4E0RB 4WFHD 4WO4B 5I1KL 1CK0L 3BH8A 4WI6A 5LBSH 1IGTA 1I7TB 2CK2A 5FKPA 4CADA 4J6RH 1K8IA 2EE3A 4W6WB 5AZ2L 2VXSL 1RJCA 2WBJB 1BIHA 1DSFH 1XCQA 3QQ3A 3HUJE 3H9SB 2A9NL 4ORGA 1OGAD 15C8L 4KUCD 1S7RA 1R3IH 4WV1C 3PP4H 4X6FB 1G7JA 5D1XA 1JGVL 1U8NA 1WTGT 4DFIA 5I1HH 2DQUH 5GISH 3KPNB 1KTLB 1KJ2H 1MWAL 3ETBF 2OR9L 5HYJD 4G43A 4OCRL 4URTB 3FO1A 4OIIH 2DM4A 1RUMH 3VI4E 4JFXA 3KLAB 5JHDE 4CMMA 3RAJH 4MX7A 5GHWL 2V9TA 3RL1A 4MD4A 1WSST 3RUGF 1BD2B 2PW2B 5F9JA 1YDPA 2C1OB 1RK1B 1KEMH 5EZLB 3F7VB 3VWJA 3ZE2E 1P5UA 1NAML 4G8IB 3RIFK 4HGKC 2FB4L 1FGVL 1ZLWK 1W72B 4B7LA 5DJDA 5IWLC 1JI1A 4X80H 1JFQH 1T1WA 3MCLL 1DDHA 2CGRH 2AJXH 5IR1B 1B90A 5LGHL 1OP9A 5KSUB 3GSVB 5F6IB 5FM4A 3PGFH 3JUYA 4UV4H 4JN2B 1HHIB 1A22B 3FFDA 4TSAL 4JQVC 1T20A 4KDWA 4BM7A 2RBLA 5ENWB 4M61B 2AJZB 1XGRB 4JR9L 1MSPA 3SKMB 3TIEB 2ADJA 4O58L 3VGGA 1VEOA 3QBTB 1GC1L 3B2VH 1FYTD 4WI4A 3CK0H 5IW1B 4HS8L 1NBQA 2GSIA 5C08B 5EIIB 3HRPA 1D9KC 4WW2F 4OUUA 2OYPA 5I74C 5CLWA 2DTML 4OQTL 1D6VL 4ZTPL 3ARGD 1D9KD 3T1FB 1IQWH 2VYRE 5F89A 2EC9T 4WDIB 1HWHB 3MRQA 3TA3A 3MNWB 2Z8VC 3W9EB 3PXJA 3S5LB 1U3HC 5M95B 1KELH 4Z7WE 1OTTC 5F6HJ 2BOCB 1CBVL 1U3HD 1A0QH 2WSKA 5E6ZA 3K4DA 5DK3A 5F7KC 5H35B 2OK0L 1OTTD 1FPTH 4CMHC 5I76B 5J1AA 3A67L 5DLML 4YDJB 3H8NA 4U05A 3O6KL 1UH4A 4J8RA 1IKNA 5EU3A 4OFYA 1TDQA 2YKLL 4U3XA 4Z7VE 1EVTC 4FN0A 3UTSD 1I7UB 5CBEA 3M17B 2VDMH 4C83A 4Z8FL 2IMMA 5ADPL 3MV01 4HIXH 3F58H 4LHUG 5E7FA 1J0ZA 3WFZA 3KGRA 5BO1H 2QSCL 5IFHL 2FJGB 5FUZL 5IMOB 3DOSA 4AIZB 1KLFA 1WT5C 2Y5TB 3WIIH 4UTAH 1I8LA 1GAFH 1TPXB 3C5ZA 2OL3L 5JW3L 1A4JB 2MMXA 4JO1L 4L8DA 3LY6A 5T5NG 5JPNA 4NC0B 3CLFH 4X6DA 1ZGLA 2HRLA 3PV6B 1NCUA 2OQJB 1MCRA 3S37H 5E6IB 1J8HB 3G6JB 3MUY1 1N6UA 3MMEB 1WK0A 2BOBB 3QEHA 4OKVA 3O6ML 1QSZA 4O51B 3SGEH 4QF1A 4EDWH 2XG4A 2C1PB 3W9DA 1TJIH 1LILA 4WFFE 4HW6A 3LN4A 3NZ8A 5F1IB 2FJFA 5KANG 1DBKH 4PJ7A 4YNYA 1UADC 3HPJA 1ZLUH 2VLLA 3FQWB 1R3HB 5SWQA 2DQGL 4XNUL 3BUYA 1MRFL 4AQ1B 3D48R 5FYKD 1EAPA 3V7MA 4K94L 1ES0A 3KPOA 3VMPA 2F53B 4TSBH 5B3NA 4M48L 2GJ6E 1DCLA 3RNKA 4M6NH 4GT7A 1Q0YL 1LD9A 2XICA 3MCKB 1LNUB 5IVOA 5K9JL 1LO4H 1RJZB 1EFXA 1HWGB 2I9LA 4YJZL 2BNQB 1BFOB 2EIZB 2DIAA 1OSPH 3KVQA 5EBLB 3QP3A 1HCFX 5D7LE 4IOIA 2HT3C 3IKCB 1F8TL 1IC7L 1DEDA 1JNLL 4PRPB 1E6OH 2VKWA 3UC0H 3OKDA 5L88H 1U8MA 3MRHA 2HT3D 3JUZA 4P2RD 3G6DL 4QGYA 3WFDH 1CR9H 2X4RB 4W4NA 3GEWB 2CDFB 3LEYH 4YHIA 5GGQH 1YEEL 3K1KC 4NN6B 4R3SA 25C8L 1I1YB 2W0FA 2YPKB 5A3IC 4J3WA 1DBJH 3CMGA 1S7QA 5EZJA 3NCMA 4MNQB 3QNYA 5A3ID 3S3PA 1CTNA 1RI8A 2NNAB 5JHDD 4KPHL 1H3PL 1RJYB 1U8PA 3MACH 2GITA 3EIFA 3WJLA 4NNPL 1HZHL 4UU9A 3TH3T 4Y88A 3TBSB 4N68A 5I6XC 2R56L 4R6UA 1B0RA 3UP1A 3DTXA 5FO7A 1JPTH 4K3GA 3PP3H 5L0QB 1HEZA 1INQB 1EEYB 4HX1A 43CAA 3QPXH 3H6JA 1PZ5A 1N0LA 5C0DB 3PNWA 3BAEH 3G6AA 5T1LA 4Y4FB 4ODTH 2HKFH 1WBXA 3KYOA 3NIFF 4GRLC 4LLUB 4WW1A 1II4E 1RUAH 1B4JH 3RPIB 4BQCA 1U95A 2VR9A 3MTRA 4JZJB 3VRJB 4GRLD 5D7KD 3GMQA 3E8UL 3UZQA 2YBRB 1IAOA 4XH2A 1JGDB 1PY9A 5I15L 1DQJA 4GW1B 4NZRL 3RWFA 3FRUA 4ZFFA 4GRWF 5INCB 3U30C 5I1EH 3DGGA 4YHLL 3DECA 3MRLB 4LPCA 1QLRA 1AD9B 1HQ4B 3SKJH 5CBAB 3LDBB 4XP6H 3SN6N 4GKNA 4I3SL 4P4KA 4JFFD 3L3DB 3QCUH 3WHE0 4U6HB 3TCLA 3Q1SL 2VITB 4PJAB 3NIGF 5ICXB 4RWYH 1AFVH 2V2XA 4FQCL 1CYGA 3GMOB 2I9TA 1IGJB 3DXAB 4GJTB 3I6GA 5GRVL 1EHLL 3FHQA 1VEMA 3LRSB 1MVUB 3P73B 4WWKB 5GJTL 1OWWA 1M05A 1DUZA 1XFPA 1BQLH 1GZPB 1RK0B 1I3UA 1QSEA 2QKIB 3GO1L 3NH7L 2QTEA 3PWJB 4PRHB 3WFCL 1JTTA 2OR7A 3DETC 4N5ED 2X4UB 4M7JL 3B9EA 43C9B 4NZTL 3QUXB 4RX4D 3UTTB 5IEKA 5LAXB 3DETD 1CGSH 4OTXH 1PG7X 1DBML 4K3HA 2VQ1A 4NZUH 1RHFA 5J9PB 2IH1B 5SV3A 1KCUL 5J89A 1EAJA 4HIIB 4HS3B 1MOEA 4IRSB 1A1NA 3MBXL 4N0UB 5BOPA 4NQSB 1GGYA 2O5XL 1H0DA 3HPLA 4GRWH 4BFGA 3QO1B 3TNMA 1LEGA 1RU9H 5KVEH 3TYFA 3D39A 3QH3A 1T5WB 4D8PA 1YY8A 5DVOA 5FCSH 3IDJA 5IROA 3L6FB 4HDIA 2HG5B 4YXHL 3QFDA 3U82B 4GBXA 4XPGH 1X5GA 2VDNH 1KNOA 3QJFB 4CVUA 1YMHB 3HTLX 3QR2A 1VGKA 2B0SH 2NY5L 1F3RB 4KZEL 3B3IA 1J87A 3BGFC 4L29A 1ZANH 2NXZB 2LAGB 4QEGA 4HIJB 4M43L 2FR4B 4LSPH 2CIKB 1NMCB 4HWUA 4ZQKB 4XRCA 4PG9A 4NWTL 4WFFD 2H9GA 5DRZB 5E5MA 1NJ9A 2E6QA 5ESAA 3GMLA 3ROOB 1KBGL 2Z8SA 1NCTA 1TZGH 3DIFB 4LPWA 1GPOL 1N2RA 3P9LB 5DC9B 4JY6A 4GAGL 4ONFH 5CEYA 4DUWA 2UWEB 5BVJA 3VFRB 1PQZA 3IDIB 2HFGH 4G8FA 5KZCD 1FO0H 1CU4L 1ZAGA 4KZDH 5C6WH 3D0VA 2RCSL 3H2WA 2GJ6D 5E4EC 5DI8B 3UXFA 1C08B 3IFOA 4X6DE 3S36L 1TETH 5L2JA 2J4WH 2LAAA 1S7SA 1JMZA 3HC0B 3U1SH 5IKCA 1RUKL 1EZVY 4JVUA 1AC6A 5SX5K 4EN3C 2HVKA 5ISZB 4EN3D 3BUTA 3MV7A 3DUHA 4GXUM 4PR5B 5D7LD 1RZ8B 4ZO6A 4HUVA 1M71A 2N56A 2ZP0T 5CUSL 4HS6B 2R4RH 5F3HB 2J8UB 1VPOH 5BW7C 1UGNA 3K74B 2PUQT 4DTGH 5CILH 2BMKB 3KS0H 4POZC 5HGHA 1KXQE 1SJVA 1MCEA 3BP7A 2AABH 1D5BA 5CJOH 4YX2H 1IAII 4POZD 4PB0L 3VXSB 1IGMH 1BX2B 3QXVA 3IDUA 4FFYH 2V2TA 5I8OH 1U58A 2D2OA 3QFJB 3TM6A 1Z9LA 2EKSA 2P44B 4ZFOL 2XWJA 3MA9H 4YQXH 2HKHH 2PR4H 5JW4N 2HFEA 1OM3H 1UEYA 4YC2B 5EO0A 1BJ8A 5BRZD 3OKMB 3VXRA 3K2UL 3DX7B 3QDJE 5ERWB 3Q5YA 3BO8A 1ZMYA 2WZPD 4XPHH 5C0NC 2DOCA 1JL8A 3F65A 5IK3B 4XCCL 1FFPB 1UYWH 4I0CC 3ULUL 5C0ND 4EZMA 2E7CA 3I84A 3I50H 4U3CA 4NRZA 2BJMH 3FHAA 5HVGB 1OP5K 2A73A 1A2YB 4R96A 4RGNE 5GGTA 3UTPE 1BAFH 1J0YA 4LSQH 3KLDA 3O4OB 1W0WA 1T22A 4X7DC 2XV6B 3RWGA 5ILTH 1UENA 1LE9B 1ZHNB 4MJ6A 2GSGB 5IEHB 1FORL 5EOTB 2UZIH 1HH6A 4AEIH 2A74B 1U92B 1Y18B 2CO6B 2XXCB 1E28A 3A6BL 3IJYB 3U7WH 2XQBH 1HHJB 5FV2A 3VWJC 1KIRB 1I1FB 5TGBB 1UXWB 4R8WH 4KJYA 3VWJD 4X98B 1U8LA 3KPQB 3LKRB 1CLZL 4OGYH 1U2HA 4PUBH 3ARFB 1LE5B 2FSEB 3L9RB 5KSBB 4KKNA 4IMLA 3MSPA 3D3VD 1NCNA 1D5ZB 1NDGB 2IPUK 5ICZB 3SGJA 1EXUA 4F2MB 1HKLH 2HA1A 5HVHC 4NKMA 4M62L 4IMKA 5B39G 4ODXA 1OGAB 2AJVH 2WANA 1UB6B 1J1XL 3IFNL 4PJDA 4AM0A 1DE4A 2UZYB 4RISH 3QQ4B 5IMMA 1I3VA 3TBVA 4F15B 1MHCA 2JCCF 5E8DL 4LHJB 1WC7A 5MEOB 5E8NA 2YXMA 4KVNL 4RFNB 3T8XA 3VWKB 5GRJH 3BWAB 5HYJB 5C6TL 4OCSH 5I0ZA 3N1QC 3P40A 3KR3H 1KB5A 4POYA 1K4CB 3GSNL 3VI3F 3TA3C 3O2DA 3DMMB 5FF6B 2KBGA 1R3LA 4M3JA 3L7FB 3PGCA 5IIEA 2X4TB 4M9PA 1QBLH 4PJBA 4OV5B 2R4SH 3GIZH 3TA3D 1HINL 1R3KA 1UXSB 3ECBA 5J6GB 1OOAA 1FNHA 3CDFA 5FDWA 3IXTB 4A6YA 3U0WH 4DZBA 1IAIM 3VFUB 1N6QL 2OI9C 1HHKB 5ALCH 1QSEE 4ELME 5J3HC 2APTA 1XGYL 2Q76B 4OI7A 1FN4A 1IKNC 4ZNEE 5J3HD 2X89A 2DQCL 4PJ8A 5EU4A 4GAFB 1KJMB 2ATPB 4OFYD 4ZMAT 2EXYC 1UKSA 4MA8L 4KTYA 3BGMA 3VGEA 1IBGL 2ZCHH 2BVPA 4NKDA 5CZVL 5MEPA 2EXYD 5HXMA 4O9HL 4KRLB 3CU1A 2R1XA 4JANA 4PJIE 4X99B 3ARTA 1FZMB 2OZ4L 3E6HA 1I8LC 3CC5A 3C5ZC 3HCVB 4YHYB 2R1YB 1OPGL 1FYTB 1MFCL 3D39E 1T6VN 3ZSTA 4LSVH 3C5ZD 1N4XH 2Y06L 4BUGA 3CFKB 4NN5B 4U6VH 3NTCH 2XA8L 4JCMA 3OX8A 3ARGB 3AUVA 1RIUL 4AYFA 5D6DC 1GL4B 2DQIH 1CK0H 3EJYC 3TT3L 5HPMB 3UO1L 5AZ2H 3SEPA 3EJYD 1RZIB 1SJHB 1CN4A 3G5ZA 1A9BB 5IBUG 4K07A 15C8H 3N1FC 3O6FA 3EDKA 5ETUB 1U3HB 1MCIA 4TVPL 1A14L 1RZJH 4S1QL 4UMGA 5F3BA 1DLFH 1V3LA 2IEPA 1C16A 3UPAA 4X5LA 3QUKB 1MWAH 2CRZA 2R2EA 2OR9H 3OR7B 4GLRI 5IVXF 5F9OL 1A7NL 3L3KA 1YQVH 1JHTA 4J7RA 5TDOB 3UTSB 2IAMB 4BQ9A 3CX5K 1ND0A 5GHWH 5MENA 2EYRA 2H2SC 4HC1L 2IPKB 2P43B 5IESH 3KPPB 2Z31A 3L3HB 1RUQL 4HLZG 1MHHA 2H2SD 3L3OA 3QA3A 4X83A 2GT9A 3I85A 2WLYA 4NWUL 1S9YA 2GYSA 4RBPH 4QRQB 3OAZH 1FGVH 1ORQB 4MDIA 4JFPA 3BKMH 4B53A 3MCLH 1AD0A 2CKBB 1EFXD 1S7XA 3OXSA 2DAVA 3RA7H 2HAZA 5IB1A 2BSTB 4M8QB 2CLZA 4LCYA 4OB5L 1BWMA 2DYPA 4XXDA 4I18B 3UAJC 2A6DB 4HFWB 4KI1A 3OMZA 5DUPL 5HTSA 4MQSB 2W1NA 2O93L 4HAGA 4NCC2 4RGNC 1H3GA 3UAJD 1QD0A 3NFPB 1A6TA 1FYHB 2V9RA 3RWCA 3TLRA 2XFXB 4X7TB 4O58H 2Z4QA 4RGND 4MXWH 3UTPD 5BOZG 3T0WA 1GC1H 2YR3A 3EJZC 4D2NA 4HS8H 3H9HB 2DTMH 4G9FA 3WJLC 2R8SL 4NRYB 3CVIL 1D6VH 4ZTPH 1WIUA 1VKXA 4GQ9H 2VLRB 2AVGA 5EUOF 2VXQL 1KEGH 1FAKT 4LRIA 2ZCLL 4GKZA 2E8ZA 4JPIB 5KS9B 2DQTH 2IADB 2VDLL 1FJ1A 4ODVL 3G5XB 2JK5B 4E42B 3SDYL 1EV2E 3BIBX 4PP2A 1A3RL 5T1LD 5FYJH 1XF4B 4NO3B 4PYHA 2XNAA 3T0DA 1AR2A 3O6KH 5GGTH 1AHWA 1OF2A 1WAAA 4YXKH 5E2UH 4RMQA 1QSFE 3BRFA 1NFDF 2A2QT 4NFBA 5FYJE 1I1CA 4BSVB 2C4FT 4PLOB 5JNYB 4P2RB 1RHHB 1DQQB 4Z8FH 5ADPH 2MTPA 3S9DB 3C60A 4P4KC 1R5VB 5C8JB 3VG0H 2GY7B 3MRGB 5FUZH 1KPRB 4HQQH 3EDJA 4NZJA 3FRPA 4P4KD 4H26B 2Q8AL 4F33B 2OL3H 4MB4A 5JW3H 4JO1H 1CFSB 1MCLA 2JJWA 5D9SB 2FLRT 1KJ2B 2Q7NA 4LARL 1MFDH 3WDHA 1CXHA 1JNHA 4P5TA 4JDZB 1EPFA 3T0EB 1CXKA 1NBYA 4UNVA 4OAWA 5KVDH 3O6MH 4LPXA 4P4RA 4CJ0A 2J12B 5I6XB 1CIUA 5DA4A 4FXKB 4U1KA 1KFAL 4WI9A 4OCXL 1LO5B 1QSED 3EYFB 1QNZH 1L0XA 4LL9A 3IS1X 2ITCA 2WAHA 4UUJA 5GS2H 6CGTA 4LP5A 4Y4HA 5C9JB 2PYEA 3EW3B 4Z7NE 3LKSB 4GRLB 3U7AA 3J7HA 4XNYL 1T5XB 5D2LF 4XNUH 1N7MH 3LQZA 1KENH 1I3GH 3MOAH 4PJDE 1MRFH 2F8VA 4ZOBA 3ISWA 5INDB 2QQKL 1HI6B 2WQ8A 4XMPH 3O2DH 4F7EB 4MSWA 4P0DA 5DVMA 4LRNL 5JW5A 1FNSH 2JB5L 3MGOA 1WV7T 3K80A 1AI1L 5IROC 3RBSA 3U30B 1H8OA 3BPOC 4W4OA 3DLQR 1G9EA 4JFFB 3W82A 1Q0YH 2P4AB 3D39D 5C0EB 4NQCA 5FYLH 4A6YH 4GBXC 1NGYB 1KCVL 4APQA 2DMCA 1WQVT 4N90E 3T4YA 2G2RA 4PV9A 1Q9KB 3DROA 3H0TA 4R4FL 2AXJA 1GGUA 1KCSH 3N1PC 4GBXD 3NCYS 3EO1A 4U1LB 3O2VH 5FYLE 5AG9A 2JJSC 2OMNA 1IC7H 1JNLH 3I75B 4PJXF 4JEGB 1JYVA 5JA8B 3K81A 4QXTA 1PVHA 1T03H 5SWZA 2Q3AA 1GGIL 1ZSDB 4R7NB 2VC2H 1RZJC 3CH8A 25C8H 2MCPL 5ABDE 2O5ZL 3JWDC 1Q9OA 1I1RA 5E7BA 2Y5EA 3DX6A 5IG7A 4KK9C 4NGHL 2NW2A 4AT6B 2GQHA 1FFOA 4AENA 2FH6A 4O4YH 4KPHH 1H3PH 3QEUB 2DWDB 2DWEA 3HUJF 4KK9D 4OLZL 1HZHH 2DMBA 4V1DB 3V5HB 1YQ2A 3JVGA 1FBIH 3S6CA 4PP1C 2R56H 4P59H 4ZODA 3GRWL 1IAIH 3GMNB 2L7JA 4QTIH 4PP1D 3T4AA 1T3FB 4M4RA 4D0DB 1I7ZA 4G5ZL 1AGEB 4AL8L 5ICYB 3HAEA 2FATH 5SWSB 3T2NL 3VI4F 3N06B 4UDTB 4I3RL 4MCZA 5E08L 1IZJA 5A40E 4YHMH 4NUJA 3MV7D 2H26B 3E8UH 5EZIH 5EN2B 1F3DJ 4F7CA 4HBQA 5I30L 3IDNB 3AU1A 2XN9A 1A1MB 5DD3H 3SJVA 5I15H 4Y19D 3ZE2F 5DTFA 1FNGB 2D7OA 4ZXBD 4NZRH 1KIQA 4PRDB 1UWXH 3LV3A 2P5ED 5JUEL 4YIQA 3HHRB 3G08B 2V9QA 1XH3A 4NO2A 1A3LL 4JRXA 3IJHA 4FQLH 4HXBL 2X4NA 1UKQA 1OQOA 4J1UA 1MEXH 4PY8J 3Q1SH 4MJIB 5HYIA 1NC2A 1LWRA 4RMUA 1XF3A 3QIWB 1DBAL 2D7NA 1KJVA 3MJ9A 3B5HA 2F5AL 1ACZA 2PTTB 3QEQD 5C0JA 2YPVL 4PJEF 2JKXA 1G9NL 2CRMA 5KZCB 4XVTL 4ZO8A 5IHUL 3WKML 3S3SA 4HIEA 4OCMC 3NCEB 3P77B 1YY9C 3P9MB 4HWEL 1S9XB 3U83A 1FNAA 2YSSB 3CFDA 3VXRD 3ZO0A 1IEAA 2ICES 2DQEL 2FL5A 1YY9D 4J3OC 4YUEH 4XP5H 1MFNA 1I4FB 4R7DA 3V7AE 5FK9A 4MJ5B 3NCJL 4NZTH 3EDDA 5CIPH 1JWMA 2AK1L 3C2AL 5F9WB 4ODUA 1JVKA 3G04A 5D7LB 2VAAA 2PCPB 1KCUH 5FYJD 5FB8B 1P84K 4X6EB 3NFNB 4ZS7L 1QPPA 4LVOC 2HJFB 1RZ7L 4ONHB 4W70A 1S5HA 5GS0H 5I9QC 4GRMA 4PGBA 3NCFB 3LKNB 1QRNA 4G9FE 1DN0B 1FZOA 3PWPB 2D4DA 4MA7L 3QXTA 5D7IB 2GAZB 1ZA6A 4JFZL 3RIFF 3V8OA 2DMKA 5F7EL 3R0MA 5F1NB 4F8QA 3RJDA 3ARQA 4HWZB 2IANA 2XZAL 2CMRL 3WUWB 5J12B 5BS0A 3GNMH 4JKLA 3BPLB 2NY5H 4JKPH 1CFNB 4KZEH 2VIRA 5T1KA 5MHSE 3MYJB 5F6HI 5E0QA 1XEDA 4M43H 4LNVA 4JGJA 5DRWA 3SGJC 5BRZB 1IGTB 4IMKC 1FZKB 5FKPB 4CADB 1JYNA 5ITFA 2Z91A 5TDNB 3ZZ1A 3KG5A 5C09A 4KWUA 1WAAE 4FXGA 2X05A 5E99H 5K9OA 4FMFA 1NCCH 1XCQB 1QQDA 5MP6L 1MCQA 5IM7A 3DARA 4FFZL 1FL6B 1JPGA 5ECJE 2R0WH 3C2SA 1EO7A 1UG9A 1R5WA 5GS2D 3U79A 1KT2A 1YYMH 2LFGA 3BP5A 2W60A 1JHKL 4D9LH 2EDOA 4CAGA 3MQIA 1CFBA 1KIUA 2VDQL 2Y72A 4DQOL 4EVNA 4GUPA 1CU4H 4K2UL 4Q0XH 3EOBA 1O7SA 4L9DA 4F37F 3P4NA 5JR1H 2ERJC 1NCDL 1EH9A 1D5XB 1IQDB 1C5DA 2QJDA 3DO7A 5J56B 1YMMA 3MLRL 4KKAC 3QNXB 3RL1B 3IETA 3P2TA 4N90D 4I77L 3IAQA 5E4IA 1INDL 2ZWLT 3VXNA 5F9JB 1ZLWH 3AC0A 4KKAD 1L9NA 3MC0A 3TO4B 3FFCA 1I3RB 4NN7C 3ULUF 4MD0A 3DYOA 5FYLD 3THMH 5I1IH 3NCCB 2BNRE 5AYUH 3L5WA 5I71C 3MLXH 2DM2A 1MPAH 1MLCB 4PJFA 1V7NL 5CUSH 1CS6A 4XC1H 4DGVH 1ETZA 3D3VB 5CINL 4RA3A 3IDYC 3BKJH 4PJ8C 1PKQA 2MHAA 2OR8A 2F15A 3CDGA 2PYEE 3S4SB 1A6WL 5FFLA 3CPLA 2X89D 4NBZB 1CL7L 1S7TA 4PJ8D 5F44A 1UJ3B 2FO4B 4JKKA 5HJ3A 4GLRH 4M7ZC 1WTLA 5GIRB 3D2UA 4JO4L 4PB0H 4K71B 3V0VA 3EOAA 3NPSC 2H41A 5E70A 3ZYIA 3EOTL 5SX4H 2E5EA 2Q3ZA 4YHOL 5M94B 2BCKA 3EYOB 3VJ6A 3PWUA 4DKEL 4NQCE 5B38G 1CXLA 4OUUB 4JPKH 1HSAA 2X09A 1WEJL 4E5XB 3VE0A 5MERA 3BFOA 4RZCA 3VFGH 2IGFL 3C08H 1ZK9A 4JJ5A 4GRWB 1I7RA 1A5FH 3CSYB 3ZE1F 1P69B 3O6FC 1PZUB 1T0MA 3ARBA 4CNIA 4X6CA 2PTVA 3WEXA 4OF8A 4KTDH 3O6FD 2WM0A 4N0CD 3L3IA 1T1YB 2B4CC 5SWZE 3TJEL 3WIHL 4G8GA 5IB3A 3FT4B 2OI9B 3LMJH 1YEGL 3CIQA 1NUFA 3SDXF 5FUOH 2OM5A 1CDGA 1U93A 1CFQA 4LLQB 3BXNA 5I8EB 1MREH 5FM5M 3BP4B 5DMIL 5EU3B 2DBLL 4EEEA 1FORH 1J05A 3AB0C 1FGNH 1CLYL 3ELAT 1V3JA 5MEND 2Z31C 5HHNA 4WI7A 1YPZA 1BEYL 2PYFA 3S7GA 4C83B 5MEQB 4YHNA 1RZFL 3HAEH 1BFVL 2Z31D 3RWHA 1LDSA 4H20L 1C5CL 2DQHL 2UZXB 1CDHA 3ZTNL 4LDOB 2CLVB 4YBHA 4PJCA 1C8PA 1O0VA 2IJ0C 1CLZH 3UJJL 1AKJA 5T1DH 1MI5B 3FO0H 2AJYH 2IPTH 4ZO9A 1QTYT 5JPNB 1DL7H 4HJJH 5I1DA 4G8EA 1HQRB 1J1PH 1FO0B 2E27H 5DGQA 2VXTL 4FNLL 2ZOKA 1BVKB 2MWCA 2W9LA 2A6IB 1ZVSB 3ZKXB 3FQUA 2DYPD 2EEDA 2XN9E 3SJVE 4OD1H 2QSTA 3PE9A 2SEBA 2EDJA 4DUVA 5K59E 3SO3B 4OD2A 5E8OA 1BFSA 3LKQA 5LQBH 5ID0A 3LN4B 1F11B 4JRXE 1BVLA 2P24A 1CQYA 4XBEL 5EC2B 3SQBA 5AD0A 3UX9B 4C55A 4OFPA 3OHXA 4PJ7B 1IKFL 2AJUL 4YNYB 5GS0C 5KSVB 5HD8C 4Y5YA 4G9FD 3WE6B 3WXVL 2C9AA 3BZEA 3GSNH 5GS0D 5HD8D 1J8KA 1BREA 4LRIC 1EAPB 4WWID 5HGBB 1CQKA 1RVFL 4JHAL 1HINH 1KJ3L 2Z0BA 3RWJA 4QRPB 5CJ5A 5I1LB 4ZPVB 3MJ7A 3KDMA 3T09A 4OLUL 4M7KH 3TO2B 1AO7A 1XGYH 1UB5A 3RHWK 5CJXA 1XGQA 5CGMA 2D03L 1AHWC 3BD4A 3I6LD 4QOKD 1ZT1A 5DRNA 2NTFA 2E7BA 2HRPH 5LCVL 1BECA 4G6KL 2CDEB 2WIIA 5ADOH 1DTUA 4P46A 2ESVB 1ADQL 2DQCH 4PD4K 3O81A 4IOIB 4WTZG 4XCYA 4U1SB 2VDOL 3GMMA 4Q2ZA 1I9RL 3RWDB 2F9BT 4L3AA 2Z8RA 4DAGH 3C60C 1IBGH 1OD7A 3VCLB 3ZDXE 2QSQA 4LDLB 5CWSB 4XCNB 3IJSB 2AJ3A 4Y5VB 3C60D 3VXUA 2IBBA 1ZA3A 3CAFA 2W0FB 1MCWW 1QRNE 1MLBA 1OPGH 3R8QA 3OJDA 1E4XI 2X2YA 3RI5K 1VFAA 3SE4A 5KG9A 2ZPKH 4PB9H 3WIFA 2Y06H 3FQRB 2VR4A 3QNYB 4P5TC 2XA8H 2D31B 1DZBA 2IANE 5ACMA 3CDYA 5AWNH 4PV8B 5DMYA 4ZUUA 5DEZA 4P5TD 5BS0E 2FBJH 4ODHH 3UO1H 5K9KA 2FEEL 1GH7A 1QVOA 3B9DA 1B0RB 4MQ7B 5FO7B 3Q6FB 3KJ6L 1MNUL 2VE6A 4P3CL 5CJBA 7FABL 5DRXA 4IS6B 4HX1B 4E9LA 3U46A 2VDPH 4S1QH 3FQTB 1MCOL 2IBGA 5HBBA 4Y4HC 1SEBA 3FT2A 1U8HB 3OGOE 5C09E 3ZDYF 1W0VA 4Y4HD 4QYOA 2PYED 1A7NH 4FQHB 2B2XL 4PJHA 4Q58C 4XX1E 3L1OL 3MREB 4NNYB 5EZOH 5EO9A 1FL3B 4K8RL 2QQNH 2A77L 2JELH 1IAOB 4XH2B 3VXPA 4HC1H 1DQJB 1LP9A 4Y5XA 4DOHB 5DYOA 4HXAL 4QRRE 2JIXB 4I4WA 1SYVA 2BC4B 5I17A 3DGGB 1RUQH 4W4OC 3GSQB 3KAAA 4G6FD 1F3JA 3BSZL 4XMKL 3V7AG 1GRWA 4OLVL 3LHPL 1FH5L 4GKNB 4APQC 2W0PA 2I60L 1U8QA 5DQJA 1YMME 4NQCD 3QRGH 4APQD 4HPOL 1JRHI 2I5YL 3LSOA 3DHMA 4JJHA 5JPMB 3WS3A 3SCMD 4LFHD 3L3GA 3ZYJA 3FFCE 2DF3A 1JV5A 5FO8A 1KF9B 3KXFD 5D6CA 3P11L 5E2JA 4YAQA 4U1IB 1CDCA 4OD3H 2G75B 1P5VA 4ZUWA 4P2CG 1YNKH 3EFFA 5IW6A 3DGCR 4JY4A 1M05B 5DWUL 5I1AA 1OAYH 4PJFE 3BISA 3BJ91 4XCEB 5SWZD 5FOBB 1K4DB 1NDMA 3WFHB 1BJMA 1PKQE 4F7TB 1K8DA 3EDEA 4JHWH 5DD1H 4CVZB 4HUKB 2B5IC 2EECA 3CSBA 4IM8A 4NHUB 5L2KB 4LLWA 3P4MA 3VH8A 4IRZL 2V5SA 2VQ1B 2XPGB 4NO5A 1RULL 3JVGC 3O3DB 5HYSA 3AREB 3EFDL 1FDLH 4LQ1A 1QR1A 1A3QA 5E1AA 1A1NB 2NY7H 1CIDA 1FL5B 1F90H 3FB7B 1H0DB 3VD5A 2ZCLH 5FHAL 1IL1A 4LCWB 4OLXL 1X6NA 2VLKA 4ZPTA 2X1QA 3D39B 4XWGL 5HDBF 1FFNA 4BKLB 3TYGL 1JN6A 4KVCH 4HV8A 5C1MB 1A3RH 5BV7L 5HYQA 1HHHA 4HDIB 2VN7A 4LSSH 1VCAA 3K2MC 4L1HA 3VGHA 4FG6C 2JCCB 4KQ3L 4E0RA 3MLTB 4WO4A 5H8DA 3UJIH 4QCIB 1I7TA 4X6CE 2BHUA 5D1QB 3VFNB 1JZ3A 4HAFA 5D72L 3LEVL 3FRPG 2A1WL 2X6MA 4LIQH 1FG9C 3V0WL 1DLHB 2XN9D 1TTUA 4G8GE 3SJVD 1FC1A 4X6FA 1HXYA 2X42A 4TUKL 2H9GB 1YYLL 4LIQE 1A1OB 1NJ9B 1VGEL 4JRXD 1E27B 5F72S 5ESAB 5DMJB 1AQKH 1QHPA 4Z7UA 1OARL 1NC2D 1WWBX 4RMWA 3IFPB 4XCFH 2YD6A 3FQNB 4JY6B 4QHNB 4U2YA 3KLAA 1YPZE 4DK3A 3LQAH 1EERB 4FRWA 2PO6C 4XPAH 4L4VA 4DKFL 1MWAB 3QCVH 5F97E 4ETQB 8FABB 2FGWL 3KYKH 1BD2A 3NGBB 2PW2A 2PO6D 3X14B 1QKZL 2C1OA 1RK1A 5EZLA 3CXDL 4G8IA 1ZE3C 4HKZB 3IFOB 5SX5H 4HEPG 3W0WD 3BDYL 3RRQA 2NR6C 3D85A 2YD1A 5IKCB 4LGPB 2GTZA 4WY7L 2NR6D 5IR1A 1YEIL 3F12B 3MV7B 5IBTL 3GSVA 2VZ1A 4NQUA 4XNYH 3MV9D 4NC1E 4JN1H 5HSFA 4JN2A 4OSUL 4Y19B 4HUVB 1M71B 4ZXBB 3O0RH 2P5EB 2QQKH 4BZYA 5ENWA 4M61A 1RJLB 4X0KB 3Q6GL 3GBNH 4ZTOL 1IJ9A 1XGRA 1RIVH 2NY3C 3QHZH 3TIEA 4ELMF 3TGXA 5C0CD 5CCKH 1F6AA 3O8XA 1QRND 2QQLH 2NY3D 4JKMA 1YEKH 5IW1A 1J0IA 5C08A 1MJ8H 3WMSA 1KCVH 1FAIL 4S1RH 5IFJB 1X9QA 1QA9B 2AV1A 2IAND 1N8ZB 3QEQB 3T1FA 3BH9B 2V2TB 5BS0D 4U7KA 4XT1C 3FT3B 5IVXB 1YEJH 1P6FA 3MNWA 5T1KD 2XWJB 2X1WL 4PJIF 3DUSB 1TQCB 1FIGL 5GS1B 1AO7E 5IB5B 5EO0B 4W6YB 2BOCA 1IGIH 3VXRB 1Y6KR 5GZNC 1GGIH 4ZFZB 5GZND 5I76A 1ZLSL 1RUPL 4XVJL 1OP5H 1ZTXL 4YDJA 4CN1A 3MNZB 3TC9A 3ARVA 4J3VA 4EBQL 4P2QB 2ZCKL 3AY4A 1CF8L 3HAEG 4TQEL 1N26A 4OLZH 3VD9A 3VXUE 3M17A 1EK3A 5L6YL 4X4ME 3M45A 3RWGB 3IXAA 3KS0J 3T1WA 2FJGA 4LSDA 5IMOA 4MJ6B 1JJUA 1H8SA 2Y5TA 1HH6B 1YMMD 4DW2H 7CGTA 1G9MH 1FNEA 2V5YA 3V6OA 1MRCH 3DV6A 3AXLA 5E08H 5C0AB 3FFCD 1AQDB 2OQJA 1JE6A 2OL3B 4QNPF 1J8HA 3G6JA 5DVKA 1OT2A 3QYCA 3BT2H 3MMEA 2BOBA 2IQ9L 4O51A 2E3VA 4FQQB 3A6CL 5JUEH 4GQPH 5EUOB 4AIOA 3FL7A 2C1PA 1CLOL 2KDGA 4HXBH 4NKMB 2QBWA 3X13B 4F57L 1S3KL 3T08A 4YDIH 4N0YL 1IGYB 1LP9E 4PJDB 1R3HA 3D2UD 3TZVB 5GRUL 1A6VL 5IMMB 1MHCB 4XPBH 3BEVB 5IOPA 3BP6B 5J8OA 4Z7OE 1W8NA 5C2BL 3T8XB 3AS2A 4XNZC 4XVTH 5JA9A 2F53A 3WKMH 1NCBH 1IGFH 1NFDB 4EI5A 3EAKA 3CDCA 3BPCB 4HWEH 3CFIC 2ERJB 1Q9WB 1PW3A 3MCKA 3IU4L 2DQEH 1LNUA 1KC5H 1R3LB 1J0KA 2DN7A 2NCMA 3ARBC 1RJZA 4PJBB 4N1HB 3NCJH 4WNQB 1R3KB 2BNQA 1BFOA 2EIZA 3ARBD 4A6YB 2XTJE 4E41A 4DZBB 3BIAX 4M1DH 2MCG1 1KCKA 1XGUA 2DKMA 4ZS7H 4G8GD 4ZFGL 1HKFA 1RZ7H 4HJ0C 5T33L 2X4RA 4U6XA 2CDFA 3VMNA 4P99A 2HFTA 4HJ0D 3TBYA 3IDYB 2L7UA 3ILQC 2WUBH 3V5KA 2YPKA 4X9IA 5EDXA 4MA7H 4GKSB 4BQ6A 4C56B 5E2WL 1NANI 3ILQD 5F7EH 3NFSL 2AXFB 3WFBL 1BOGB 1Z6JT 5MEPB 2C5DC 4NPYB 2G9HB 1JNNL 2NNAA 4MAYA 3EGSB 3N1GC 4KY1H 1B0GA 2R1XB 3LCYA 1VERA 3E6HB 1T4KB 2E7MA 1JZ6A 3CC5B 4MLSA 3BX7C 3LQAC 4ZD3L 5IW3A 5E8EB 3NPSB 3TBSA 2D3VA 2ZJSL 3NACL 4XX1G 1AKJD 2YUVA 5D2LB 5A2JH 1FNLA 2RFXB 3SE9L 3EBAA 5JOPE 4RMRA 1U2CA 4HUUB 1M7XA 1DVFB 3MUHL 1OSZB 3GI8H 1INQA 2HVJB 1EEYA 3UTZB 5C0DA 2XZQL </