2F8OA

A native to amyloidogenic transition regulated by a backbone trigger
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
b'TPKIQVYSRHPAENGKSNFLNCYVSGFHASDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
molecule tags Immune system
source organism Homo sapiens
publication title A native to amyloidogenic transition regulated by a backbone trigger.
pubmed doi rcsb
total genus 17
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f8oA00
3HCVB 3WHE0 2P8MA 3DI3B 5KSAC 5GHWH 3RUGA 1NANI 1FYTE 3IU3B 4HJJL 4QXGL 4H5SB 5C0RL 4OV5A 3QUMH 2X05A 2VZ1A 2GAZA 3VRIB 1ERNA 1C12A 3EOTH 1A6UL 2X1QA 3QPXL 4OCSL 4GMTL 4WWID 2R2HB 5SWZA 3FL7A 12E8H 4ZO6A 4JHAH 2R0WH 4JVWA 3QDJE 4I3GA 1T0NB 3BH8B 3F58L 1KEMH 4FNLL 3L3HA 3V6BR 5I75C 3MGTB 4QRSA 2GK2A 43C9B 4RWHA 3P30H 3TVMA 5EUOE 3V7MA 4GRWH 1CG9B 5LCVH 4HPYL 4K71B 3RKDC 1OSZB 2HFGH 3JUYA 3QG6A 3LN5B 3WIFA 1KN4H 5JUEL 3V4VL 4MD5B 4M7LT 2ZKHL 4RA0C 1JMZA 4UAOB 2IGFH 1V05A 3SDDC 3G6DL 3K4DA 5TE7H 1YY8B 2YC1A 4MWFA 4QNPF 5E03A 5J13B 2GJZA 5BO1H 1HXMB 2DDQL 4LARH 4E41B 4D0CB 1FL5B 4U6HA 4JRXD 1SHMA 2R1XB 5CSZB 3IETA 3TZVA 4RNRA 1EO5A 2EH7H 5IMLA 2BXZA 4J8RB 4N68A 4F37F 4YK4C 5EU6A 1MFEH 4JDZA 3C60D 4GRLD 2ITDB 5T1LA 2FX7H 4APQD 4GRMA 1IC5L 2MPAL 1WGOA 4X7EC 1L7IH 4DQOL 4Y8DC 5C2BL 5I1KL 3QUMB 4PJDB 3MACL 2M8XA 2GITA 1OHQA 2VE6B 3WDHA 1IM9B 1TZIA 3TNNA 1JWSB 4JVUA 1GGUA 4AK1A 3LB6D 4U7MA 4HUWB 5JXEC 1I75A 4GG8A 1A7PH 4MD0A 5JQ6H 2Q86B 3INUH 3O11B 2E9BA 5C0EB 2Z0BA 4GMSH 4M5ZL 4YHOL 5E8EB 1DN2A 3R06B 1MJUL 2ZCKH 2EYTA 3EDEA 1XH3B 3BD5A 3BE1L 3CXDL 4EN3B 4WHTB 4WJ5B 4AEHH 2H6PB 4ERSH 4IRJB 4P2QA 2JB6A 1KB9J 2D7QA 1BLNA 2YZ1A 4P5KB 3RUGF 3ULUL 3GSVB 3IXTA 1DE4A 3SGJA 1ZHBA 4N8VB 5I17B 3LEXA 4KUCF 1BFVL 5JPNA 2P5EE 1S7UA 2Y6SC 5K9KB 4CGTA 4HIEA 3HE7D 4NSKB 1WEJH 3GSNA 1FZJB 5I15H 4U1LA 4NNPL 4ODTH 2ZJSH 1HIMH 2EXWC 2V7NB 3SKOB 5J1TC 4H26A 5DMKA 3SDYH 5CMAB 1ZHLB 3D39B 5IQ9B 4M1CD 4CU8A 2HFGL 1CGXA 4E5XA 5LWYL 4UDTA 3DRTA 4JN2B 3LVEA 3EGSB 4LSPL 4O00A 5D7KD 3B6SB 4PJEA 4LFHG 5EZLA 4CBPA 3OX8B 2IAND 3O6KH 4U1GC 4JQIL 1E4XI 1YMME 3QFDA 5JIKA 3ILQD 4L9DA 1H0DB 3HNVH 1WBYA 3I6LD 2D9CA 4M6NH 1ZGLB 3ZE1F 3T2PA 1TNMA 2BVYA 5F7FA 4QLRA 4N0UB 3LIZL 2PR4L 2WBJB 3QNZB 3VFVB 2X4SB 4P48A 3H2WA 2RFXB 2W9DL 5B8CC 2GTZB 3ZHDA 2ZUUA 2VDLL 3O2DL 2QSQA 5EFIB 2PYED 4AEHL 3VG9C 5MEOA 4QRPA 2NZ9D 5DRXB 3DX8A 1HKLL 1F6AB 3TBTA 3MODL 4DKEH 3WSQL 2EYRA 4UV7L 2FJHB 5ADPH 4JJ5B 4KGJA 1RHHB 5JOEA 1R3KA 4P0DA 4JRYB 3BVNA 4HC1L 2D4DA 4LEOB 3ILPA 3VXUD 1I7UA 1EHAA 4JB9H 2MMXA 5HD8D 5DD0H 4NYLA 2HFFB 1ADQL 2M26A 1KTRL 4P2RB 5I9QB 4RDQF 5KSBE 4XCCL 3IAQA 3QEHA 4AEFA 5LGKA 4TVSa 4W6YB 3ARVA 1QD0A 4NJ9L 4EI5D 4B53A 5C08A 3EUUA 3FZUD 2WMPA 1BOYA 2D9QB 4LBEB 3VXSD 3QI9D 4YXLL 1AXSA 2FO1A 2KUTA 5EC1A 5IHLB 4K3DL 1RZIB 5FK9A 3OKOB 4AH2B 1CI5A 3UDWC 1FNLA 2Q8AH 1O0VA 1OAQL 1JP5A 1LWRA 2WIMA 3FCTA 3UPRA 2COQA 1JV5A 4XBPB 4WNQA 3O81A 4Y5XA 1YEDB 1CFNB 5FFLA 5GGSB 1I8KB 4M62L 3C60A 3E6FA 3RVWC 4XNZC 2IQAA 1KC5L 4FFVC 4KVCL 4NQEA 1MFAH 5EO0A 2R0ZL 4IMKA 3HB3C 5TDNB 5ETUA 5EU4B 3EOYG 2V9RA 4WUUD 2G5RA 1KJVA 3ARUA 1WVZA 1D6VL 3KPNA 1NDMA 5C0RH 5JXEA 1YMHA 4PRIA 5GGUA 4RAHA 1TLKA 3KLHC 3BYYA 4WO4C 4F7PB 3P30L 4DKFH 3MXVH 1IAOB 3SEPA 1RULL 2WBJD 2ZP0T 4XNMB 2FL5A 3ZDXE 3I6LE 4G5ZL 5FGBC 2HRLA 3QYCA 1VB9A 4Z95L 2HT2D 3WFEH 3ESVF 3ZKQD 1Z3GH 3ARGA 2H2SC 2FX7L 3MBEB 2AAVA 4L3AA 5IT2L 1HINL 3WN5A 1U95A 4WHYG 2HFEA 3O4OB 4QHUB 5DJ0A 2VZTA 3TZVC 5GHWL 3VXUB 2YHGA 5I8OH 1F4HA 3NPSC 4GW4B 4H20H 4H8WL 3SO3B 3KJ6L 3BKMH 1D9KC 4QRTB 1CDHA 3TO4D 5C2BH 2BNUB 4L29A 5I6XB 5ILTH 3UTPE 3SQBA 1I8IA 5ID0B 1AO7D 4EIGB 5ITBH 2NCMA 3RUGB 1PEWA 2WWKO 4GSDL 4P23D 5JPMA 4M9PA 1N4XL 1JZ6A 1TTFA 5EU3B 4LLDA 4Y4KA 3BAEH 1BVKB 1T1WB 3ALXA 2R2BA 1MOEA 4UNUA 5SWZB 5HDLA 2OYPA 4FP8H 4UT7L 5EN2B 5L7XL 3GRWA 2R56L 2OZ4A 2ZKHH 2NW2B 4OLVH 2F8XC 5TDOB 3DHMA 3MRCA 1I3UA 5AD0B 3UTOA 3I75B 5KW9L 1F6LL 3QJHA 2D31A 2V9QA 1DVFC 5F70A 1UB6A 1JGDA 2O5ZL 2A77L 3TZVD 1OW0A 5HY9B 2BNRE 3HI1A 2MKWA 4X5LA 2IPUK 3T77A 2GSGA 1OP5H 3OGCA 4NOFA 3PIQA 3GSUB 4LVEA 2E9JA 1KJ2L 1EHLL 1EEYA 3BDXA 4TUKL 3KS0J 4HIJB 4DZ8B 2BVOA 2P24A 5D96B 5DQ9A 4FA8A 3AU1B 2EYSA 3MV01 4IRZL 3I02B 4K8RD 5IEKB 3FHAA 4XCFL 4Q6IC 4S10A 3VXNA 5CSZA 5H37G 5EO9B 3ZDYF 5IGXL 3CVHH 3EW3B 1AR2A 1CK0L 1JFQL 3CPLB 1G9NC 1NGWA 1ITCA 5CP7A 5EU6B 5J1AB 3UPCA 3V6FA 1PJ9A 4HPOH 3TJEL 2OR8A 2ED7A 1NC2D 1CDGA 4D8PB 2WZPD 4DKEL 1K5NA 2N7AA 3HMXH 3QPQD 3IXAB 4X6CE 4OV6F 4UOW1 4EDWH 2E6QA 4KQ3H 5C0AE 15C8H 1NFDA 2AEPH 4F7MB 4MCZB 4HUWA 1QEWA 2MCPH 4TUKH 1N8ZA 1I4FB 1OTSC 3DXAE 2GI7A 3DSNA 3O9WC 4KROC 2X40A 4F15C 1YNTB 4M6AA 2AV7B 3F7QA 4Y2DB 2DQHL 1XH3A 1U8PB 1JL8A 1MCPL 2BMKB 2LAAA 4WHTA 5AYUH 1BQLL 3LN4B 4NUJA 2MHAB 1KIPB 4FFVD 4IRJD 1BLNB 2XG4A 3WXWL 3SDAD 2V9TA 1ZHBB 4N8VA 4BUHA 4KJYB 2OI9B 2DQGL 5JPNB 5T1DH 3IJSB 3T4AA 1CDCA 1OTTC 4R8WH 2V2TA 4DVRL 4NSKA 4P2QE 4M8VA 3H3KA 2DQTL 2NQCA 4OFYA 3HAEH 4WCYH 2V7NA 4WHDA 4H26B 5DMKB 3AB0B 1RUKH 1LQSR 4QHLB 2CXGA 5HPMA 2AI0L 2ZSWA 1UYWL 4FXGB 4K2UL 4XBEL 4BH7B 4X6BA 4YPGB 4OUUB 3AY4C 2WWKT 4UDTB 1NC4A 4JY4A 1SQ2N 3AGVA 2VXQH 4LASH 4HQQL 4JFXA 2OLDA 2LTQC 4OLUH 2OQJA 5ISZD 4GUPA 3OX8A 1J88A 3RVXC 3IRZA 3WN5C 1OGAA 3U6RB 3CFIC 4U0QB 4HWZB 4XP9H 1Z3GL 4WFEE 5HDQH 3RJQB 4LKCA 5JW4M 5IFHL 2G9HB 1WBYB 5C0JB 3F12B 4HWBH 3VD7A 5AAWA 5FYJH 1CK0H 5I8CA 3JWOL 1KXQE 4QTHA 3RTQA 5C9JB 1JPFB 1QO3B 1IC7L 3VWJD 4OAWA 5EOTA 4MAYB 4OZIB 1I7ZA 2W60A 2GTZA 1VFBB 3DGGB 1RZGB 3RVUC 4DAGH 1WCBB 2AXGA 3C08L 3F7VA 5GGRA 2DQEH 1G1CA 1PQZB 1N64L 3SDCB 4EXPX 3DX8B 1VADB 5IHUH 1X6LA 2QLVB 3QDAA 4JJ5A 5I30H 1AGEA 1KGCD 4JHZA 4DVBA 5ELIA 4JPIA 3PQYA 3VJ6A 4MJIE 4ZUSA 5D71L 2ATPB 3MNVA 3C5ZB 1U3HD 2FIKA 2NR6D 3HNTH 3MGAA 4HHAB 2AJYH 4PGDB 4M93C 1TIUA 1F3JB 1ZKAA 4L4VA 1NCNA 2J4WH 3HC0B 3CSBA 4B7IA 3GMPA 1OAYL 2AV1B 1TPXC 4PP2B 1CT8B 3KS0H 4OCYL 2XXMB 5TFSL 3GMRB 3UJJL 1MRCH 2NYYC 4XB8A 4OF3A 4KROB 3MRKA 3W9DA 1S9KC 1I1AA 2IBGA 2LU7A 3L6FA 1AXSB 2PKDA 5FUCC 3FT2A 1UZ8B 1S9WA 4KXZI 5E9DE 5HGDB 5GSVA 2XKNA 3VGEA 1F4AA 3SDDB 3QDGE 2PXYC 4OQ1A 2ICWB 3UPRB 2Y5TB 4PJIF 3PWLA 1KCKA 5BS0A 4U1NB 1EGJL 3DRQA 1ED3B 5ANMB 3S6CA 4MDJB 4QF1B 3IS0X 4XI5C 5CSBA 2DYPD 2GJ6E 5IBLD 1EO8L 2EEAA 1GRWA 5C0BB 1T22B 3O2DH 1A9EA 1PG7W 2NY7L 5J7CC 1QYGH 3PP4L 4PBXA 5TF1L 5L2KA 3WFDH 5C0CA 4OD2B 1A3QA 3KPMA 2XA8H 3FB6B 3RAJL 1XT5A 4IRZH 5DJZA 2YR3A 1YYLL 2ZUWA 3G9AB 5T5NF 4X7CC 2UY7A 1J8HE 5DDHA 5GRXG 2GEEA 2GW5A 3H9ZA 1KEGL 1TCRA 2YD2A 4E9LA 3MBEA 1Q9OB 1J18A 3CXHK 3MXWL 2ICES 1MCCA 1U95B 2BY3A 3C08H 4OGAC 1ES0B 2C1OB 5E7FA 5GS3A 4NZUH 2HTKD 3OAUH 1U42A 3C2AL 5I74B 1S9XA 1WC7B 1YDPB 3UMTA 2IPTL 1VPOL 3GJEA 1YNKH 1FRGL 4IRJC 4HT1H 5SX4H 2RHEA 3U83A 4AM0B 1MCRA 3TO4C 2GFBA 3WFBL 1OD9A 1WF5A 3O4LA 1CGSH 1LNUB 2D03H 4BZ2H 5AZ2H 1ZOXA 5FYKE 1F5WA 3NZHL 4JPKH 4G7VL 3LEYH 3G5VB 5K33A 3QEQB 1WT5A 2DM3A 4Z7UF 4LHQB 3QIUB 4HGKC 1IGIH 1UWXH 3BPLC 4X4YA 4OZFA 3PHQA 2YRZA 3EYUH 1W8NA 1BMGA 4PTUA 5D70H 2VIRB 5GGVL 1CXEA 5SWZD 3TH3T 4LPYA 5EN2A 3F65A 4HS6A 4K55A 3BZ4B 2YEZA 3SGDH 3MRCB 2VXVL 2AJ3A 2DYPB 1NAML 4TN9A 4LSUL 5GISL 3EO1B 1JNLH 2D31B 3QUYC 1DBMH 3M8OH 4WW2A 4XNQB 2H9GB 1D9KA 3L7EA 1DFBL 1GIGL 3HI1B 1YECH 5IVNA 3NCBB 1C7SA 5GIRA 3EFDL 3ZSSA 5ICYA 2JKXA 2YXMA 1J0ZA 1F58H 3SHSA 4K2UH 2BSRA 7CGTA 3L5HA 4FQ2L 3TJHC 4XMKL 3SE4C 3VXMB 3MCKB 2EYSB 5IEKA 2J8HA 5D72L 4OTXL 2OJZH 3EHBD 3KXFD 2W65B 1U3HA 1REIA 2Z35A 2Z92A 4HUXA 4YBLC 3VFGL 3QIBC 4GO6B 4LVNB 4NQUA 4P3DA 3IDIB 3DECA 1AH1A 3AMLA 3HNVL 5ITBL 5T3ZE 4JG0L 4FQQB 4MNHB 5CJXC 1BD2E 3MGOB 1KJ3H 2ZUQC 3UTTE 4P5MB 5BQ7A 1JPGB 1AD0B 5C0NC 2Z91A 3RFZC 4WDIA 5F89B 4NZDA 3D3VE 1YECL 1N59B 3S37L 1PSKH 3NABH 5C8JB 3WFHA 2FJGA 3HA0A 2XTJE 4PRPE 1H3TA 3OF6A 3S98A 5IBUB 3C09C 3KVQA 4JKMA 1IC7H 1MWAL 4FFWC 5BS0D 4OCYH 1MH5A 4EUPB 1KJMB 4AL8L 4Y2DA 5MEQA 4RMUA 4YGVB 4Y16A 2KKQA 4OGXH 1KTKE 2ZSVA 1AIFA 1ODAA 4OIIL 4O9HL 1T5XB 2E9IA 3LN4A 5DC4B 4BFBD 3C87A 1F2XK 4ZDHB 4JFEA 5D71H 3P0VH 2FR4B 1NLBL 4C4KO 5I2IA 4PJ5E 4ZNEE 1T2XA 1L0XA 4S1QH 2A6DA 3K2UL 4LCWB 4XP4L 1EUTA 4KGLA 2XZAL 4O5LH 3RZCB 5F1OB 4CVXB 5F7UA 1OGAD 2A83A 3PWPE 5DJXA 5I8EB 3QXTA 3SKMA 3BPLB 1EZVY 4DGIH 4KPHL 3RY4A 3SE3C 1LDSA 4U3XA 1EVTC 3CK0L 1AC0A 1LEGB 1OLLA 2XWJB 1CFTB 2Y4SA 3PP4H 4WI2A 4JFXB 1IQDB 2G2RB 4GUPB 2YPLA 2ZCHL 2DTML 2HFTA 3U6RA 2ESVE 3B9KA 3NA9H 4QRUA 2VDPH 4CN1A 2GJ6A 1A6VH 2DN7A 2HN7B 4UBDC 2QEJA 1KEGH 2XWBB 1MUJB 2B0SH 3F12A 1BM3H 3OXSB 3LKSB 3A6BL 3UJIH 1RK1B 4MQ7B 4OFPA 1JHTA 4M61B 4QTHB 3RTQB 3RAJH 3DX7B 1W8OA 4UT9L 2XQYK 4NO5A 5KTEH 3GUTA 2ADJB 1A8JH 3HUJF 4MGXA 5GSRB 3LQZB 4ONFH 3BMWA 5DRZB 4NFBA 3V5KB 1V3LA 2YUXA 2CH8A 4MMZC 1YN7A 1C08A 4OLXH 2PO6B 4HUNB 3KHOA 3VXRE 1AXIB 1BOGB 3SDCD 3Q5YA 2CGRH 4R2GD 1T21A 3NACL 5KVEH 5I15L 2B39A 1BGXL 1AGEB 2YA0A 1GZPB 35C8H 4U6YA 1CD1A 4G7VH 4JO3H 4QOKA 1MRFL 4LSRH 2K7PA 3ULUH 3MNVB 4PJIB 4RA3A 1ZT4A 1VEMA 1A9BB 2L0DA 2FHBA 3DBXB 4QY8A 1MCPH 4X9BA 1B4JL 1HXYA 5JDSB 1AI1H 5AEAA 4B50A 1FE8L 3UBXI 4LGRB 5D70L 3FQTB 5F44A 3FOLB 2VXTH 4TNWK 3GMRA 2EIBA 1U8IA 1BIHA 3FFCA 1N6VA 3FT2B 3RWJB 4OLYL 3MMEA 3BDYL 2XKNB 1GOFA 5E56A 2IALB 1EXUA 5KOVC 3RVTC 2ICWA 4QHNA 1H8OA 2HP4A 5HI3D 1QLEL 2QQQA 2Y5TA 3HZYB 3U9UB 5D9SB 1W0VA 3S36H 3LKQB 3MREB 4X6FB 5FYJL 1QSFD 2WP3O 5CBAA 5E9DA 4WTZA 1G1YA 5E94B 5I18H 3A67H 5ID1A 3GEWB 3ZYOA 1UM6L 1P5VA 3DV6A 3PL6D 3IAPA 4W4NA 3S96B 3HI5H 3ZMRA 1IGFL 4ZPTA 5EORL 1T22A 1A9EB 3B9AA 3KXFB 1DZBA 2LTQB 1MCIA 1ZT1B 5L2KB 5C0CB 4UQ2B 1Q0XH 4JFPB 2X4OA 4K3EL 2NX5A 5FHBH 4ONHA 3VD3A 4BA8A 2X10A 2B1HL 4MA3A 2HLAA 3DYOA 3UTSB 4NNXA 3BP6A 3MLWH 3ZTJH 1Z6JT 5EIIA 4KMQA 3EFDH 2HMID 2C7UB 4J2XA 1JHLH 4X6EA 3MNZB 1IM3B 3D85B 2O5ZH 2WINA 3UYRH 3V5HB 1WTLA 5F72S 3CX5K 5F1KC 1XCTA 2YPVL 3U2SA 5AG9A 1R24A 1VFUA 3W39B 3HUJA 5BMFL 2QHRL 2ZZUT 2V5RA 5L7XH 4FQIH 2B5IB 3CSPA 1XGYL 1LNUA 4HS8L 3ZYIA 3ARED 3MRFB 1EERB 1GYAA 3PABA 2QJDA 2V7HB 3GSRA 3KPOA 1ZLVK 2F53E 3QG7H 3NOIA 3F7YA 5HVWA 5FIEA 4UOW0 3LDBB 4YEEA 4C56E 3RNQB 1LO3L 4U49A 4BFIB 2R23B 5L2JA 3IF1B 2DQUH 4G8FA 1DFBH 1GIGH 2PO6D 3E2HC 3G5YA 2LAGB 1H5BC 4NCDA 3X14A 2DMBA 4MS8D 5FO7B 1INQB 1VSCA 2WLZA 4FTVE 4HS6B 1JYXA 4ODXB 3HAEB 5EOCL 4APQB 3MOAH 3BZEA 1QVOA 4KVCH 4GRLC 4NFDA 1NGPH 3EO1A 4KQ4H 1HWHB 3ULVC 2J88H 2I26N 2VITA 1A7QH 1MIEL 1JTOA 3P40A 1HINH 3V8OA 4WIQA 1FGNH 2LE9A 4G42B 4ZUUA 4X7FC 4G8IA 1J1XH 2KQNA 3VGDA 5ICYB 4ZS7L 1IZJA 3ZZ1A 4TYUA 2DTMH 3UC0L 3PHSA 4GQ9H 4LPXA 2HJLB 3HFMH 1JF5A 1ONQB 4XTRC 4YIQB 1KCLA 3VFMB 3QXAA 1U41A 3OXRA 3QQ4A 4QT5B 4R0LA 3U1SH 4O9HH 1SBBA 4P23C 1SEBA 1G84A 4I0PD 3WFBH 4HKXB 1JGEB 1RUQH 2Z35B 2Z92B 5DFVC 2VLRD 1XGYH 2GK0A 2HJFA 2X1PA 3GJFK 4LNRB 5GJTH 2IF7A 2Y5EA 4XPFL 4P9ML 5T5FL 3RWEB 4D3CH 4PRHA 2CSPA 4PB0L 5BQ7B 4OD3L 4RBPH 1UVQA 1U8MB 1MREH 4LASL 1DQDH 2YOCA 1HDMA 4NZJA 4F9PA 4XB7A 4IOFC 5C8JA 2W9EH 35C8L 3JV4A 1NGQL 1P2CA 1RUPH 2EC9U 3MRHB 2Z4QA 3U7YL 2MFNA 4U6XA 2VDML 3CFEA 3WHE1 4Z7QF 4EUPA 3KPRE 5E2WH 5FECA 1GAFL 1GHFL 2C26A 1RMFL 5BO1L 2PXYB 1RZKC 5HGAA 3MLRH 4OLWL 4UTBH 3QI9B 5EU5A 5HVGB 1KCRH 4NRYA 3MRMA 5C6TL 1TMCB 2AJYL 4KJQD 4NKMA 3KLHD 4OGYH 5E6IB 5FA3A 3JUZA 1T04B 3FQWA 2F8OA 5I2IB 1CGTA 3UZEA 4XP6H 5T1KB 4Z0BH 3PDOB 1DQML 1G9MH 1YEJH 2UUDH 5D1ZA 2A6DB 1I7TB 4LCWA 5ERWA 4LRNH 3MRPA 2MNUA 3NAAH 1CLZL 2P43B 4N9GA 4KHXH 1V3MA 3FO0L 1BQSA 3SKMB 1OAZL 1FFQA 3TP4A 3C2SA 1DQTA 2EZ0C 5I1LA 1AGBA 1IEAA 5KVDL 4W6XB 3SGKC 3PNWA 1Q0XL 5CHNB 2ZOKA 3U9PL 3UCRA 1E6OL 1TETL 5FUOL 2X4RB 5ALCH 2W9LA 2AJXL 2IAMD 3MV8A 1IILE 1QRNA 3FB7A 1HOCB 1MCEA 4CU7A 4LKXA 5DJ6A 3G6JB 3G04A 3MO1A 1TNNA 2EIZA 3DUUB 4AQ1B 4I18C 1MUJA 4PV9A 4Y5YA 3I3DA 4Y4FB 1M7IA 3QHZH 2YPLE 3H9SD 5C0GA 1I3GH 4LSQH 1V5JA 3TCLB 2IPTH 3KYKH 1O7VA 1MJJA 3BDYH 1IGTB 5IW1A 3TPUB 1U58A 3QAZC 4OIIH 3LQZA 1S8DA 2UVEA 1UJTA 3FONB 5D7JA 4PS4L 3E3QE 1JNHA 1YN7B 2R0LH 4UMGA 5BV7L 1BOGA 1D5ZB 3C9NA 3RL2B 3HPLA 2IH1B 1RFDH 4XCEB 4MXQD 2KPNA 3NCEB 1IAIM 3MBXH 4XNYH 4YR6A 1UG9A 1E4WH 3C09B 4URTB 3NCJL 5IVXB 4L4VE 3HS0A 4UDUA 5CBEB 2FZ3A 3ABZA 3KPSE 4FQPA 1HXYB 5JDSA 4X6DF 4WI9A 2FSEB 5BRZB 3GBMH 5D1QD 4XWGL 1QA9A 3FQTA 5E9DD 3MRDB 4YDKH 1BAFH 2J7LA 3DX9B 3HRZB 3LY6A 4QO1A 1Y6MR 1FFNB 3MRJA 4NHUA 4NZTL 1YEEH 3P2TA 1BPVA 4PV8B 5ESAB 2AEWA 5CKGA 5GRWA 3MQIA 3DNKA 3CD4A 5E6YA 5GRYA 4ZUVB 3GHEH 1AGDA 3WNLA 1XIWC 4JZOB 3SE4A 3BGFC 5FYKU 4DGVH 3MREA 1QSEE 5E94A 4PB9H 3QHFL 2WUBH 2IMMA 3ZT5A 4HF5L 2DQGH 2E7HA 4ZS6D 2QKIB 3GMNB 2DM4A 4NRXA 4DEPC 1K6QL 2AABH 1DUYA 3ARXA 1NMBL 4HUMB 3OAYK 4V1DA 1TJHH 4KK8D 4X8JA 1DDHA 3MFGB 2X4OB 5C0CD 3HNTL 1GGIH 2RB8A 4NZTH 4A6YL 1CE1H 3P73B 4JO2L 1UEYA 2KDGA 3SJVB 4NNXB 4GXUN 3S97C 1J0YA 3LQAC 3I84A 5H35A 2CR3A 4M1GH 1XZ0B 1MVUB 2WQRA 3AAZA 1ACYH 5FYLE 5I16B 1P1ZA 4PGCA 1GC1H 1UXSA 2E7MA 2HRPH 1JPST 5KJRH 1WITA 4LSVH 2Y7QB 4LLVB 1PX4A 5F7LB 1KV3A 4Q0XL 3NN8A 1U8QB 2AJSH 1PKQA 2CIKA 3K7UA 3RGVD 5B3NA 5C71A 4Y2OA 2J6EA 2F58H 4OGXL 3K8LA 5C09A 4ISVA 1S78D 4EJ1C 4DK6A 1C5BH 4MMXC 2NY6B 1KCUH 1P4BH 2FYYA 3KDMA 3O3DA 3WIIH 2AJZA 2C3WA 1T3FA 3QUXD 4XP1H 5FGCE 5L88H 4RCAA 5DK2A 2Q8AL 4A6YB 3WJLC 5IWLA 3X13B 4HWEL 3HZMB 4EVNB 4HKJB 1MVFA 2P5WB 2F5BL 3KPOB 5DJ8B 5F96L 3TO2A 4OF8A 4ZXBC 5I1KH 3NAAL 1AGFA 4YDIH 3BKCH 3RNQA 3IF1A 3G5YB 4G8FB 1R3JA 1NGYB 5LGHH 1M7XA 1SJVA 5FO7A 2Z8WC 4GMSL 2Z8RA 2BRRL 5MI0C 1KT2A 1R3HA 3D85D 3DPBA 4DKAA 3HAEA 2ERJC 4XRCB 1U0QA 1NAMB 1EAPB 4ONGL 5T1LD 3RPIB 4APQA 1QVOB 2EH7L 2IANB 3C5JA 1EZVX 2VN7A 2LV4A 3BDBA 2FO4B 4Y8AA 5EO1B 1LP9A 5C0DB 1BQHB 4ZPVB 2WIIB 4FTVA 3V6ZB 6FABH 3T0VA 2UWEA 3WIIL 3C5SA 3BGFB 4GAGH 3ZE1E 3NZ8A 4FRWA 2GHWB 1GPOH 3UEZA 1FNGA 2EDOA 5EC2A 3FB5B 4BH8A 1MEXL 1KACB 3CZFB 4EI5A 2J8OA 5HDBE 4L8CA 1P9MA 4OGYL 3QQ4B 3DO3A 2FGWH 4BZ2L 4QXTA 3MV8E 4MQSB 1AY1H 4I3SL 5DJYB 4M93B 1ACYL 1KYOJ 4ZTPL 4DGIL 4PREA 2VLRB 3G9VA 1S5HB 3MFFB 3L3DA 1T20B 4F8TA 5FF6B 1UVQB 1U8MA 4G8EA 4HUUA 3H9HA 3MBED 4RRPA 3AY4A 3S4SG 5FOJA 1QOKA 4YHML 2QQKH 1I3GL 3JV4B 1B88A 4P57B 2D03L 4FQXA 2JCCB 1EJOH 3MXWH 3V7AE 5I71C 4OFIA 1AKJA 1KENH 1CF8L 4WHYH 5BV7H 3OKKA 4MLIA 3V52L 1A2YA 4JANA 1KTDA 4HD9A 4PJHF 2JJWA 3BWUC 1X5IA 5ITFB 2OSLB 2DM7A 2W1NA 1VPOH 3RX5A 4K9EL 5EU5B 5E8NB 5F9WC 2C1PA 3MRMB 3OZ9L 1YUHB 3KYKL 3VFTA 4R2GB 1C1EH 4L5FH 2XNAA 4N0YH 2CKBB 3IDMB 1RQ5A 1J87A 3GB7B 5T1KA 1YEIL 5D1ZB 5IMMA 1Y6NR 3H42L 1JN6A 3DUSB 5F6IC 3UTZB 1G6RL 4LOUC 1SJHB 2ZOLA 5IIEA 3UZVB 2WUBL 3DIFA 4NJAL 1ORSB 1YEKH 2XN9A 3BPNC 5HYFA 4L4TB 4GH7B 3ROOA 1AGBB 1FV1B 1IEAB 2EE6A 5F9DC 2W9DH 3NFPA 5E4EC 3BSZH 5GS0H 3NCJH 4WGWB 3TNMA 5HYSB 1MCQA 2ZOKB 5JIHA 2EC8A 3K0WA 3SJVD 2OTUA 2X4RA 1GZQB 4QRPE 1J0JA 1R3LA 4OIAA 4GRWE 1FP5A 2A1WL 5JOFB 1JPTL 2YA1A 4K23L 5D7IF 1QRNB 3RNKB 5FO9B 4ZAKA 1XF2A 4RWYL 3G6JA 3TO4B 4YHMH 5GS2H 4PV9B 1MRFH 4LSRL 3QUXA 2LQRA 4L3CA 5CD3A 2UV3A 1N6QH 3PDDA 2YK1H 3DSFH 4WU7A 2ZCLH 5HHOB 5H94B 1CVSC 3FJTA 3RVVD 1MJJB 3MLXH 1F13A 5SX5H 3CMOH 3TESA 1FSKB 5IW1B 3V0VA 1CXKA 4EEEA 5KSVA 1KUMA 2IG2H 4X98B 1N0XL 2OJZL 5D1QA 3RL2A 2HWZH 2IBZX 4XPGL 2VDQL 3BP7B 1YN6A 2R1WA 4G8GB 4BKLB 4IOIB 4M7ZC 4KQ3L 5JLZA 1X5XA 4R7DB 1QP1A 1QFUH 1BZ7B 1KCVH 1EIBA 3KLDA 2X1OA 3RDTC 5JHDB 3FO1A 1PLGH 3QFJB 4UDUB 4Y4HB 4YDIL 2OJEB 3TBVA 2ZCHH 4PJ9A 2YXFA 4OT1L 1QA9B 2GY5A 3REWA 3U30C 4D0BB 1MCOH 5IG7A 1C1EL 4JM4H 4L5FL 3CX5J 4QRRA 5J12B 4H25B 4JFDA 1YEJL 2WUCH 5ESAA 3KPTA 1MHHB 4YAQA 3DTXB 5M95B 1AGDB 5BVJA 2PNDA 4OD1L 1Z2KA 3BKCL 3S34H 2DRUA 1NBZA 4MX7B 4F58H 3HFML 5F1IB 4M6OL 4OLEA 3LKNA 4C58B 5E2VL 4HS3B 2G60L 3NGBC 4HIXL 3L5XH 1DVFA 1X5YA 1QSFE 1MJ8H 1M4KA 4RGOH 3OKDB 1HNGA 4JZJB 2BVEA 1S7TB 3SCMD 3NIGE 1U8JB 3ZTNL 4Y2DC 1AO7A 2IH3A 2NY0C 4L8BA 4Z77A 1G7JA 1U8KB 4CW1B 1XGPB 1XF3B 4QOKE 4QYOA 3KNBA 3IJHB 2F8VA 3BO8B 5FA4A 4XWOC 3FHQA 1FIEA 4R4BB 3S5LB 1XGTB 3OQ3B 3H7BA 5ADOL 3WUWG 3MLXL 5C07A 3BAEL 2WWMC 5FV1L 1CDIA 5C0FA 3BQUC 1LK2A 5JZ7C 1S7SA 3AB0C 2NY0D 2W92A 1U8QA 4ACPA 3QUKB 43CAB 3IFLH 3TCXA 5T3XL 3QDJB 2X70A 5KVGH 4OKDA 2VDRH 5TFSH 3ZYZA 4JRWA 1EEZB 5ISZA 1DUZA 3SDAB 4MDIB 5IV2B 1FN4A 2X4TB 3GSOB 2FRGP 5GS2D 1FH5H 3KPLB 1L6ZA 4OKVA 4OCLC 2MQCA 2OX5A 3GRWL 4EVNA 2WBJC 4OCWL 4HF5H 3E8UH 1VACA 2N4IA 4YC2C 4GW5A 1KENL 1MNUL 1AGFB 2C3HA 5JA8B 5DD3L 1VFAA 1F4XL 1Z0MA 3LKRB 3BW9B 5J6HA 1NGYA 3K80A 4HXBL 5IFAL 1GGCL 3CGTA 5CZXC 1OAXL 4I4WB 1H3PH 2H3NA 4PJXF 4FXKA 5IGXH 1UCBL 4JG1H 4S1DD 2X7LB 5JOPE 3UXFA 1T6VN 3QEGL 3QAZB 1LP9B 5C0DA 4X7TA 4IMKC 2BSSB 3BQUA 1WZ1H 4XPTL 4LMQE 3V6ZA 3CVHA 4UIMA 2V2XB 5HYJA 4WFFD 1YNLL 4JO1H 1DQQA 3BRGC 3SBWC 4J3UA 1WFNA 4KVNL 1I85A 5DSCB 3LQAH 4XNUH 5D7IA 1FNGB 2R29L 4UUJA 2O26U 2X4QA 4DW2L 4JGMA 5HYQB 5INCA 3L3OA 2UWEE 5IHBA 4K7FA 4F7TA 1BJ8A 1CD8A 5FM5O 4P9HC 1Z5LB 2P5WD 3HPJA 1ZLUK 3BX7C 4JZJC 3DI2B 5FGSA 1F42A 1BEYL 3W0WA 4JKKA 1FVDA 3BESR 3MRNB 4HT1L 4PRHE 4IDJL 2NY0B 2J8UB 2VLRA 4YUEL 4XVJL 5ENWA 3K1KC 4LSTL 4ZAKC 3MA7A 1T1ZA 3MFFA 4PJBF 1KG0A 3Q3GA 1OPGH 1FO0H 2OZ4H 5IF0B 4UNTA 4DFIA 1T20A 2CRIA 3MJ8B 5DJCB 4U1JA 1QBMH 4WW2C 5FF6A 3FZUC 5TQ0H 5C0AA 3CH8A 4KI5F 4YHPB 4NDMB 3JWOC 5J12C 4POZC 1E27A 1JGVL 1ZK9A 1KF9B 5J57B 2YUVA 1KN2L 2EDKA 4FQXB 3S5LG 4F9LC 1UZ6E 4CMMB 3MRLA 2QV2A 4JKPL 4XCYB 4R3SB 1IGCH 1NAKH 1KPUA 1LEIA 1H3WM 3CDYA 4OF7A 4JDVA 3GHEL 1DLFL 3HE7A 4BQ8A 5DS8A 5F93C 2C1PB 1FL6A 4HLZH 2APFA 4BSJA 1A0QH 2VLJA 4GLRI 2FWOB 4BELD 4S2SA 2MWCA 4H0HB 2CKBA 4RGNC 3GB7A 6CGTA 4P5TB 2RGSA 3KYOA 3ROLA 5IMMB 1T7XA 2GY7B 1MCOL 3EJYC 4N0FA 3GK8L 5FCSH 1QQDB 4I3RH 2DKMA 1VEOA 4X6DE 5AG8A 2ATKB 3TT1H 2VL4A 4K3JL 5DRWB 4ZQKA 3VH8A 5DEGB 3X12A 5E6ID 2XFXB 5IMKB 1FFPB 5HYSA 1L9NA 4H1LH 5FDYA 1D5BB 3GMOB 4G6JH 1IVLA 3U7YH 3B4NA 2NTFB 1S3KL 3L1OH 5TF0A 3RNKA 5JXAH 1XF2B 3O41B 3U79A 4G80A 3WE6A 1MFAL 3JWNC 4XAKE 2BVQB 5IOPB 1J9CT 1LDPH 4G6AC 1AD9B 4JCLA 2YSSB 4FOMA 1R3IL 4JPVL 1F45A 4NQCA 3UC0H 4PB0H 1I3RB 1YYML 2XZQL 5JW5B 2VUYA 1I1AD 5KSBB 5B39A 1OAUL 3V0VB 5IESL 8FABA 1L6XA 4JFHD 5F3HA 2EXYD 3R1GL 3LKOA 3CDGA 5KS9F 4FQHB 3BH9B 1J10A 4RAUA 4AL8H 5JA9A 4ODBD 2P1YA 1DR9A 5BV7C 2V5MA 3QCTH 4N8CH 1CLYL 1PYWA 1EUUA 1ZTXH 1CD9B 1AXTH 4PJ7E 3SKNA 3BP7A 4JKLA 1FH5L 5K93A 5FB8A 1WIPA 3MV9D 4H5SA 4HWUA 3NH7H 4B5EA 3FT3B 5E8DL 5HHQB 4HUVA 4APQC 2JELH 2WP3T 1WLHA 4Z78B 4RIRB 3M17B 4NCC1 3FO1B 2C3VA 4XXDA 2EDQA 1GL4B 3QCUL 5C86A 2DKUA 2OJEA 4NBZB 1CQYA 4M5YL 2QSVA 4I9WD 3P4OA 3MGTA 4JM2C 5CINH 1A6TB 1UCTA 4JQXA 4AT6B 5IG7B 4TTDC 1PX3A 1OARL 4PBVC 4NNYB 2NLJA 5DA0B 1X9QA 1LE5A 4JFQA 1IEBB 3QWOA 5D4QA 9CGTA 2BERA 5IJKC 3VMOA 3T4YA 1FZMA 1CS6A 2EIDA 1MAKA 3NIGF 4JDTH 2FLRT 4JFDE 4MWFB 5F1IA 1FZOA 5HHVL 4P5TC 2YD7A 4P4RB 3LS4H 2YBRB 3EFFA 3EDJA 3FQRA 1KB9K 4LCCB 1JI1A 4JZJA 5IMLB 3DVGB 3WNPA 4LCUA 4Z7VE 1K8IA 3VXUE 5DURD 4UIKH 1KNOA 3N1QC 5JDJA 4L8BB 1TZGL 1G7JB 1G0DA 2HKHH 4PJFA 3TJHD 1CGSL 1MNUH 1JTTA 1FGVH 3TN0B 4U1IB 2OP4H 3D9AL 1R3IH 4PS4H 4HKBB 3SQOL 5IFJB 2GITB 1T66D 1BFSA 3HZVA 4Q2ZA 4L8DA 1BBJA 1NGPL 4POYA 1CE6A 2G5BB 1JWSA 3BFOA 4IJ3C 1XCQB 3RZCC 4K94H 2HTLD 2OXGA 3CXHJ 1QFWH 4FXLA 4MJID 1WWAX 4NN6C 2V5TA 1KB5H 4GQPH 1JGLL 4FQ2H 2EYTB 4U2ZA 3RY6A 5F9WB 1H3UA 2NXYD 5CUSH 3BZFB 3TGXA 4JG0H 1ZSDA 3D2UB 1IFHL 1DE4B 2E27L 3B2UC 1MHPL 3GI9H 5DD0L 1AHWC 1XGUA 5LAXA 4U7KA 4OKVB 1Q8MA 4OCNC 4UTAL 5CD5C 1FZJA 3PJSA 1B3JA 1G6VK 5C08D 2VZUA 1S7QA 1DBKH 4QHKI 5B22A 2Y1VA 5DUML 4MXVF 1BZ9A 4EKXA 3TT3L 3T1WA 4KDVA 1WBXA 3MODH 2FEEL 5IMOA 5L6YH 2X4NB 3CUPA 3T8XA 1DLFH 1H3VA 5B4MC 1EBPA 4PLJD 3DRTB 3WNNA 4OLYH 4MNQD 2LFGA 5I1IH 4N0CD 1X5JA 1MF2L 3BPCA 4CVUA 2X7LA 5DK3A 3QNXB 2BCKA 1HHIB 2YKLH 3X11A 3QFDB 3G5ZB 3CVHB 4UIMB 1QBLL 5GRZA 2W0FB 5J8OA 2R1YA 4RQQA 3LKPA 1WIOA 3W11C 3AC0A 5LBSH 2BHYA 4NQVA 4UTAH 1HI6B 3BN9D 3JTSA 3QJFB 3MRQB 5D7IB 2ZCLL 4EOWH 2WBJA 5J4MA 5C09E 3SE9L 3WYRA 1UA6L 3OJDA 4YHZH 3ZHLA 3QDHA 3OB0H 4GXVL 2XG5A 2LU3A 5H2BA 4S11A 3MUGB 4DOHE 3RBSA 2NMSA 1UXWB 2A9ML 3DXAB 3NCYS 1EO7A 4HIHB 4GW1B 3JBG7 1A1OA 1FVDB 3MRNA 3UTTA 2FGZA 3O2WL 2J8UA 1RK0A 1R3KB 1DLHB 5L8JB 3X3FL 1T1XB 3SKUD 2A6KB 1KG0B 1OW0C 4LEOA 5IF0A 4OI9A 1U93A 3NIFE 4Y4HC 4P49A 3TFKD 1WZLA 2B0SL 4NYLB 4PJ5A 1CD0A 4ZNEA 1Y6KR 1ZS8A 1E27B 4IJ3B 2D0GA 4HH9A 1MCSA 1Z9LA 5CUSL 2X1XR 4GKZB 1II4E 4MA1C 5I1GL 1HKFA 3ULUC 5C08B 2ARJA 4HMEA 4ZS7H 1A14L 5CJXA 1AFVH 1ZE3C 4HC1A 2DM2A 3MLYH 3OG4B 1RI8A 3QO1A 3TIDB 1U36A 4JDVB 1MFDH 3MJ9A 4XAWL 2JCCF 2RCSH 4HMCA 2Y25A 4KQ4L 3GMLB 1LEKB 1FORL 5DUPL 2DQCL 4Y5XB 1CFNA 2VLJB 1I8KA 4LU5H 3D0VA 1U92A 4P5TA 3PWUA 1Y0LB 4NQEB 3VFNA 3WMSA 3BXNA 4GBXA 4FZEH 3D1MC 4KC3B 2X41A 5ETUB 5CEZE 2BHZA 2WAHA 3B9VA 2VAAA 1TVBB 1YMHB 4WUKH 5GQBA 3C6SA 5CJ8A 3VH8B 2D2OA 5EUKB 1ND0A 4FZ8L 3O3EA 3VWKD 4YHNB 5JORA 1DP0A 3FB8A 5DC9B 3UTQB 4HKZB 4X6DA 3QIUC 1S7VB 3CIQA 3VRLF 1RURH 4WV1A 1JWMA 4R96A 1KTLB 1IBGL 4P4KC 3DVIA 1MIML 3L3JA 2J4WL 1KN4L 5D1XD 1I9RH 1R5IA 3IKCA 1KSRA 4NQCB 1AXTL 4YO0A 4Y1AA 4PUBL 4YHIB 1AFVL 5KSBA 2E3VA 2X1WL 4PJ7A 1MHEB 4NO3A 1T4KA 2BNUA 3RWDB 4R97C 1I8IB 3Q1SH 3U4BH 4RAUB 1KPVA 4M02A 2AK4E 1B2WL 1YEFL 3SKNB 4JFFE 4L8SC 3FT3A 5EU3A 4MAYD 4LHUG 3RIFF 5BZWA 3P0GB 5IQ7L 2MQ0A 5F7EH 3U82B 1A7NL 3ZE2F 3S34L 5KS9E 3VMNA 2GUOA 5I76B 2C3VB 3VFWB 4XXDB 4R7NA 2EEBA 4TVPH 1A5FH 5ANME 2MOVA 2HKHL 3P4OB 4ZNCD 4UILL 3L95B 3MJ6A 5C0BE 5F3BA 1J1PL 3QJHB 4CAGA 4U3CA 4OZ4A 4LLUA 5D2LB 5E7BA 3W2DH 2I5YL 2NLJB 4QTIH 3HMWH 5ACMA 4R4NC 3U7WL 1XR8A 2XIDA 3SDYL 2XV6B 3QB7C 2SEBB 3O3BB 2Y6SD 2WV3A 1RZJH 3SCMB 4BSVB 3RPKA 5HI4D 4ZOEA 1ACZA 4TNVF 1V3JA 3L5IA 5K9OA 1JPTH 3RZWA 5F7HA 3FMGH 2P24B 2Y23A 2H2PD 1T2QH 2GYSA 2VDOH 2P8LB 2AJVH 4FMFA 2HWZL 4XPGH 5DK0B 4KZEL 4EBQH 5KVDH 1FIGH 3KPQA 2FHCA 5EO9A 3GIVB 3MR9A 4OM1H 3ZL4H 3ZKMD 1MAML 4S1RH 3S7GA 2ZPKH 4LCUB 5KZCB 1RJLA 1FNHA 2YK1L 4HX1A 1RJZA 3O8XB 5J1AA 4P2OC 5T3XH 1MFCH 4KTDH 1N5AB 5SWSA 1BJMA 4I5BA 2JJVA 1Q9KB 3CC5A 3LMJH 4O2CB 5I1CL 2OL3H 1FBIH 1GGYA 2DLFH 4YHKL 1J5OL 4MCYA 4NC2B 1URLA 4D8PA 3VXRD 3QHTC 3Q48A 4OI7A 2HT4D 3T3PE 3BIKB 4OZHE 4PIRF 4P4KB 5LBSL 1VESA 4XMPH 1HHKB 1QEWB 4QRRE 2HJKA 3PWVB 3BP5B 2JF1A 1UZ6F 3QZWA 4YUEH 5KSBF 3A6CL 4FG6D 5JUEH 3T0DA 5EBLA 4QRSB 2F74B 1JRHI 2DBJA 5TPWH 5E2VH 1IC4L 4NUJB 2E5EA 1MFDL 3STLA 4XC3L 1I1FB 2VDLH 5DMJB 4F58L 1ZSDB 1S9VA 4G6ML 2A73A 5D5MA 3LN5A 5FKPA 1EK3A 5TDPA 3SY0A 4KJYA 3QZWG 3P77B 1RZKH 3MLUH 3STZA 2EO9A 2GQHA 4QCIB 5E4EB 4TTDD 2V2TB 2AK4D 3RTQC 1HN1A 1P6FA 5E08H 4M7LL 1S7QB 3IU4L 2GJZB 5FM8A 4QHLA 4D0CA 1G9MC 2DIAA 4U6HB 3KYMB 5D7SH 5I1AA 3ELAT 2R1XA 3CUPB 1I9IH 4UIKL 3QIWA 4PJEE 5I1JL 4JHWL 4NN7C 3X3FH 4LP4A 3QQ9D 3H9SB 3P11L 1G7IA 5E2JA 1HNFA 4ZODA 4I13B 2WANA 1QHOA 3VXSA 3G5ZA 1CCZA 4IIQC 4O2FB 4XGZB 1BD2B 1XGRA 4QRQA 4LHJB 2G9HA 2X44D 3GIZH 3SN6N 1C16B 5INDB 2AS5M 3VGAB 1MWAH 2ZUYA 4NQVB 3S4SB 1CQKA 2BK8A 3T1FA 1ZT7A 4Z7WF 2NY7H 2R4RL 1JPFA 3DMMD 1FGVL 3IS1X 1VFBA 1WAAA 3RX7A 4KKLC 4KKNA 3R06A 5HHOD 5K9QI 3RDTB 2Z31C 1KIRB 1VADA 1A1OB 1I9JL 4U1MA 5IVZA 2DD8H 1UACH 3AS1A 4L8SA 4AMKL 1CFSA 2JB6B 4OUOA 1MFEL 3W0WD 1FLTX 1RK0B 3MROA 5IW6B 1DLHA 4XC1L 3GSVA 3IXTB 4DVBB 3U30B 5E00B 2ADGB 3F7PC 3LEXB 2O93L 3N1FC 3D0LB 5K9KA 4LEXL 4WWKB 3C5ZA 5I0ZA 3MJ9L 3GSNB 1JUFB 3C6LC 4PJ5B 2PTUA 1ZS8B 3WDJA 4K23H 5JNYB 3CDCA 4P3WA 4ETQA 2A38A 4GKZA 4PP2A 1A1MA 3KPRA 3D39A 5IQ9A 1M71A 5TE6H 1QR1B 3ARWA 4C56D 5E2TL 3GO1L 3CX2A 4WTXA 3EOBB 1AHWB 4JPWH 2BRRH 3QO1B 3TIDA 3DSFL 1P5UA 5EZJB 3VXQA 5CAYB 4QTIL 3VFPB 2ZUXA 5D7LD 4J3SA 4DW2H 5LXGL 5GRVK 4PJCF 1CBVH 1NFDF 4GAJL 3VWKA 2BSTB 2UY6A 5MEPB 4LGPB 4ODSH 4LCCC 3LN9A 2ED9A 3EOTL 3GBLA 1BD2D 3BEVA 5DD1H 1D3CA 4MXQC 3WLBA 2RFXA 1XF5A 3BN3B 4NN6B 1YEFH 3RGHA 1U8OA 3JWDH 3SOBH 2M2DA 3WS3A 3GKWL 4RZCB 2EYRB 2DBLL 1OY3B 1EGJA 5FGBA 2P4AB 1TCRB 4FABL 3TBYA 1S7VA 1JFQH 4JRYA 3BVNB 1NH6A 5JHDD 1BECA 3ILPB 4R0LC 4LCYB 4UV4H 5JO5B 4YNYA 1XGQA 1JZ2A 3SDAC 3OAZK 1QHPA 4DK3A 5CJOH 3GKZA 3WKNA 1NCWL 1ZANL 3OJ2C 7FABH 4P2RA 3UDWA 1JF1A 4PJIE 4ORGB 4DN3L 2PTTB 4Y1AB 2AK4A 3VGFA 2J2ZA 3O6FD 1MHEA 3I85A 1NCCH 1DN0B 3GFUA 3JVGC 3EO0B 2BNQD 4KI1A 4AH2A 4HJGB 3CVHL 4F8QA 3IDGB 5CEYB 1AQKH 2F54B 1PG7L 4J23A 4DN4L 3O3UN 3QPQC 4A2LA 3G5VA 1YPZA 5D72H 4NWUL 4W70A 3S88L 4DGVL 4PJDF 2IPKB 1NFIA 2UZIH 1MCLA 2K7QA 5DZLA 5HHXL 1XAUA 2Q6WB 3VFWA 4KY1L 3PHQB 1FBIL 1NC2A 4JFFA 5DF0A 2BY2A 2VIRA 5DWUH 2DQDL 2YEZB 3DMMC 5GGUB 1U8NB 2NTSP 3L95A 3A0OA 5E8OB 2PETA 4XP5L 1T1YB 2I60H 3DETD 2HVKB 4M43H 5CP3A 3L7EB 3EOAA 4X83A 5DVOA 4DWHA 3V6OE 2VDOL 3KGRA 4PRIE 4P46C 3O3BA 3MLTA 3ARGB 5DHVA 4AEEA 2DS4A 3QUZA 1WZMA 4KTEH 4H8WH 2F5BH 5K9OB 3B2VL 2D7MA 2YPVH 4ZFZB 3RWIB 5IHZA 2HFEB 2YPKA 1F3DH 3S36X 5JZ7D 1B9ZA 3C60C 3O6ML 2D4FA 4D9RE 3ZKSD 2AJSL 4PJBA 4JREC 4Q0XH 3ZDZF 4XH2A 4QRTA 4P3DB 1MI5D 3HNSH 4TOYL 1RPQA 2IPUG 3CVIL 4P9HL 1GSMA 5CJBA 3CNKA 4I5BB 3ARSA 4MNHA 4EUPH 2K1MA 4H20L 3H0TB 1D5MA 5F9OL 2Z9TA 5T1KD 5F1NA 5HHPB 4LK4A 4NO0A 3UO1H 4HWEH 1A7NH 2PYEE 4O2EA 4LLDB 4Y4KB 5L88L 1SMAA 4HBQA 4P46D 5EOCH 5FYKD 1HHKA 3G6AA 1P4IL 2QSCH 1IGYA 4GRLA 4ZOBA 3PWVA 3ARRA 3PGDA 4C56B 3QZWB 4BFGA 3FOMB 2G75B 3TN0D 5MEQB 2I5YH 3F5WB 4Y16B 2AXFA 4ODUA 5AD0A 4HGMA 3VXPB 3QCVL 2KQMA 4D9RD 3STLB 1JGDB 4JO3L 4LL9A 4G9FE 4JFEB 3ARDD 4F57L 3ISWA 5HY9A 4LSDA 1NEZB 3CSYB 1XFPA 4KRNA 3QRGH 4TVPL 4LSSH 3V8CA 5HYEA 3AUVA 4RMSA 2CD0A 3LS4L 3OGCB 4WW1A 1UGNA 4UU9A 3UBXA 4TSBL 3V2AR 4GAGL 5AZEH 3UPAA 1I1AC 5D5ME 1IAIH 5DQ9B 3S35X 2VDMH 4V2CB 3I02A 1IAMA 5I1AB 4L3EB 1CICC 4ETYA 2DB8A 2XWJA 2Q7YB 1NGXB 5FDWA 4NM8L 4TULL 1OGAE 5IB1A 4TUJB 3UTSD 1G7IB 1RIVL 2XN9E 3TA3B 4N0RA 1HSAB 4XVTL 1T5WB 2UUDK 2O5YH 3T2NL 3MA9H 1NGQH 1W72L 1MQ8A 4ZUWA 2DWDA 3VXSB 4M03A 4WI7A 3VRJB 4OM1L 2XWBA 4IRSB 1RIHL 3OXSA 1HCFX 3LKSA 3H3PL 3N0PB 2DQFA 1RK1A 2R4SH 1J1OL 4MQ7A 1F3RB 2EE9A 1NFDB 3W5MA 2R8SL 4IHOB 1N8ZB 4KJPC 3DO7B 1ZA3B 2EDLA 5DQJA 4FHBD 3V4UL 3AM8C 1Q9LA 5BVPH 2W0KA 2VDKH 3GZKA 1S9YA 3CLEL 4MXWH 1XIWB 3V5KA 2R69H 4GG6F 4OZGF 1KPRB 1FYTD 2VR9A 2F19L 3IDXH 3VI3F 3CFBB 5I18L 4HH8A 4L8SB 1INEH 3TLRA 3VFRB 2RR3A 3G5XA 4MAYC 5IW6A 1S7RA 5KANI 4KKCC 1CD1B 2ADGA 3GSQB 4P2CG 3OTTA 3CCHA 1P9MC 1YYLH 3OG6B 1SYSA 1VKXA 1JUFA 4EIZC 5HSFA 2XZZA 2FIRT 1NEZG 2A6IB 4ETQB 4HCRH 4LOUD 1DEEA 3HG1A 5HPMB 2BDNH 1PVHA 4MB4A 4X6BB 1E6OH 2GTWA 2H32A 1O5DT 1FG2B 3HZKA 1RZKL 1NC4B 3W2DL 1U8LB 5K59E 3VD4A 3QDJD 5IB2A 4E41D 5H37H 1WBZA 5EZJA 3BD3A 5LWYH 4M43L 5CJ5A 1U91A 2IALA 1FDLL 2OQJB 5B39G 4BK5A 4LLQA 4N0UE 4JN1H 4PJGB 2O61A 1INDH 5DEFB 4F7EB 5ID1B 1RU9L 3VWKB 3RRQA 3FN0L 5EZIH 2DQIH 4F2MB 2C3GA 3VGGA 4ELMA 1XF4A 4PY7A 4U1HB 3LRSA 4OFDA 3BEVB 1VGKA 4OAWB 5EOTB 1JGUH 1JRHH 5EOCJ 1I7ZB 1CL7L 1IM9D 3PP3K 4D9QD 1RZGA 3IYLW 2BSED 3GIZL 4QWWC 4IIQB 4KJQC 3WS3B 3BP6B 4MHHG 2EXWD 4NQED 4RZCA 3DVFA 4YHZL 5F9OH 2D7TH 1V7NH 1FDLH 3HE7C 2C7UA 4LPVA 4S1DC 5IROA 1J8HD 2VABB 4MYWB 3VJ6B 4KRLB 4NKOA 1SMOA 4YNYB 1UM4L 1NAMH 2ID5A 4IRSC 2PYFB 5TQ0L 4UBDD 3D5OF 2G60H 3CSGA 3KYNA 4IMLA 5MI0B 1EEUA 3Q2CA 5IVXE 4L4VB 2Z31B 3FN0H 4M6OH 3OR7B 3HC0A 4RFEB 2VWEC 1R5WA 2PTTA 4XVUD 5DHVH 3THML 1TDQA 3SPVA 3GM8A 2AV1A 5E99L 3ETBF 2NY2B 2PCPB 4G6FD 4LU5L 3EDDA 3NFSH 2X4UA 3QDGA 4Y16D 2W0LA 4GG6A 3T08A 4OGZA 3L6FB 5L9DL 4Y7MA 3PP3H 4JFFD 4BZ1L 5D6CB 1JHKL 4XHJD 5HGDA 1ZEAH 4KTYA 3TFKC 4WRLA 5L2KD 2D7PA 1OAQH 2JE8A 3MXVL 4NKDA 3UO1L 4Z7UB 3FO9B 3QO0B 4FQCH 2FECI 3T0WA 3OKLA 3PHOB 4G3YH 4M00A 1UT9A 1NFIB 2R23A 5F8QC 1QSEB 2GKIA 4S1SL 5D8JH 5DQDL 1CGUA 2H26A 4NN7B 4PTTA 3O0RH 5K59F 5B4MD 1U8NA 4POZD 1MIMH 4PRNA 4HULB 3GSXB 5ACZB 2BOBB 2CKNA 5KSUB 2OTWB 1T1YA 1CN4A 3BRDA 3EOAB 3QA3A 1V7NL 4AENA 2EE2A 4NQTA 3MV11 2I24N 2X4PB 1XF1A 4XXCC 1HHGA 4F7CB 5I1EH 4Z0XB 4L1HA 4E42A 5JW3H 4NKIL 4HAGA 3E8UL 1ONQA 3E2HB 4ZFZA 1NGZB 2OK0L 3LZFH 1ES0A 3VFMA 1BF8A 5IR1A 3DV4B 2BOCB 1S9XB 5HI5C 2GJJA 1SEBB 5J13C 5IM7A 5SWSE 1YEHL 1DCLA 1UYWH 1G6RB 3QXVA 3O0RL 3D69B 3D87B 3S9DB 1LO5A 2PYEA 1P7QA 5DJDB 2A2QT 3O4LB 1CDYA 2E7CA 3BOVA 4UT9H 5CLTA 3D3VA 2OCFD 1CICD 4ZD3L 3H0TA 2FECL 2P8MB 5E4IA 5D7JC 1DBJH 3O6LH 5FAAA 4YK4B 4HJ0C 5C7XL 3GRWH 4LVNC 3IFPB 2BY0A 1T66C 1Z0NA 5FGCB 1J1PH 2UYLA 2GAZB 3VRIA 1T7YA 1BIIA 1H8SA 4WO4A 2HT2C 4HFWB 4X5WA 1H5BA 3BT2H 5DA4A 5DZNA 4R4ND 1WWWX 1S7XA 4OZFB 4HJ0D 3LQAL 4EN3C 5I19L 3WIHA 3PGDB 1MY5A 4OZFG 5A2KH 3WHXB 3BZ4A 3FAXA 2PXYA 5F7EL 5C6PB 4RMTA 4HFUL 4Z9KB 2OR7A 4LQFL 2OR9L 1J0IA 1CG9A 1XEDA 1MQKL 4YBQD 4ZUTB 1OSZA 1NCDH 1BVLA 2B8OT 4EQ3A 3RVWD 4UILH 2H1PL 4UU9B 4OM0H 1TCMA 3TJEH 3RBGA 2YUZA 4N9GB 1SEQH 4XVTH 2EICA 3UBXG 1HXMA 3LS5L 1G9EA 4H8WC 1RV6X 5EU6E 3D25A 3WFCH 4CU6A 5I1LB 2GCYA 2J6EL 4LDEB 3QI9C 4RGNE 4DGYL 4P46B 4J8RA 5IB1B 3N85H 3H7LA 1JNJA 1BZQK 1NBQA 3QXDB 2YWZA 4X6CB 4YZFE 3U36A 3GHBL 3NMEA 1TITA 5FYJU 3MV8B 1JGLH 1AI1L 4GRMB 1I3VA 1AD0A 3BIBX 2VLRE 2DWDB 3G04B 3L5WA 2Z91B 3MO1B 3UJTL 1IMHC 3RWHA 1N2RA 4IRSA 4Y5YB 4PG2A 1TZHA 4GLRH 3BI9X 1WAAE 1IE5A 3WL9B 1XR9B 3RGVB 5ALBL 5D7LE 1F90H 1WFUA 2DJUA 4GG8B 4HXAL 1YJDC 2NZ9C 4GAJH 1T03H 4A6YH 3CZJA 5C0EA 4LP5A 4JKPH 5DYOB 2CLRB 3VFGH 5DO2D 1D5ZA 3C9NB 1A6AA 2IH1A 5HHME 4P2QB 4LSSL 4TUOB 4ZDHA 3OHXA 5EU7E 3IFNL 1HYRC 2GIYA 3MRRB 2FR4A 2JLLA 4PY8J 1RVFL 1WICA 4FFYL 5I1HH 1I1YB 1TVDA 4HS8H 1KBGL 1UWGL 2EXYC 4NGHH 3REVA 3VA6A 4EXKA 2DQHH 2NY5C 2DIBA 1DEEB 3HG1B 3BP4B 5CMAA 1E6JL 1N3NB 5CJQH 1QFOA 2GTWB 2ESVD 1INDL 1J05A 4L4TE 3R4DA 3UYRL 4WWKD 1HEZB 2N56A 2ZUSA 1IQDA 2G2RA 5EZLB 2I27N 3FQUA 1F6FB 3O2DA 3IVKB 4ODVH 1AP2B 3IB4A 4PJGA 3U4BL 1MLBA 4JFOB 4K3HA 5GJSL 1ZGLA 4NRXB 4K9EC 4X7SL 3GMMB 4N0UA 4RDQG 3F7RA 4M61A 1OGTB 1DUYB 2YD3A 3OGOE 4Q74A 1VGKB 3MRIB 1P4LA 5C2UB 3QUML 2WUCL 2OL3A 1KXTB 2A9NH 1KYOK 4KTEL 2PO6A 3P73A 4WI8A 4MJIB 4HCRA 3RVUD 3CFKA 4NC1E 4PG2C 4RGND 1T21B 1KLGA 1NLDL 2E8YA 1B90A 1QKZL 1NJ9B 3JWDC 1OB1A 1A7OH 3WEXA 2R0KL 3NVQA 4FFYH 3HHRB 1A6PA 5I9QC 2ZG3A 4MNQE 1X7QA 5BVPL 4AG4H 1NMCC 4JPWL 1M6OA 3I3BA 3ZDYE 1UA6H 1ZT4B 1A9BA 1BGXH 1FVEA 3GSNH 1T7ZA 4FMKA 5KSAA 1R5WB 4PJHB 1ZWIB 3KG5A 5FCUH 5KBNC 3FOLA 1CBVL 3QDGB 5M94B 3TBWA 4ISVB 3G08B 2FB4L 3FFCB 4YX2L 4ONFL 2V5SA 3RWJA 1QYGL 3QDMA 3MMEB 1CR9L 1IC5H 2MPAH 5D93C 4ESKA 1R6VA 1F97A 4HBCL 4A6YA 4QHNB 1JV5B 1KB5B 4OCRL 5D9SA 4WNQB 2ED8A 2VLKE 3BKJH 3QO0A 4RGOL 3WCYA 2R0KH 5DMIH 3V0WH 1UH3A 4NQDE 4HWBA 3OKLB 3TVMC 3MV7B 1HHJB 3DV6B 5EO0B 3N1GC 1OP5K 1QSEA 3O6FB 4XPFH 1PKOA 4PLNC 4LDLB 5HVHB 4Z76B 4ZPTB 3ULUE 4PTTB 1FYHB 1PAMA 4M7JL 2XYCA 1MCKA 2MCPL 1EHXA 1J8HB 3LAFA 4K94L 5I75B 2IGFL 3VFUA 3ZYJA 1TJIH 5CIPH 3RPIA 1NAMA 1ZHNA 5GRJL 3M07A 4UQ2A 2BNRA 3IGAB 2C3XA 1L0YA 4PRNB 2Q76B 3QRFM 5ACZA 3ZTJG 1WFOA 5KSUA 3QFJD 4U4BA 2ITCA 1TJGL 2OP4L 3K2MC 5LG1A 3HLAB 2AERT 4U31A 4CVZB 4PJEF 3NZ8B 2FH6A 3H42H 3EYFB 4XPAL 3RIFK 2WM0A 3CXDH 1K3IA 2C5DC 2PTVA 5HI5D 2WINB 4EI5B 4QHUA 1N6UA 5IR1B 4O02H 2RQ8A 2QHLA 1FL3B 3CLFL 4MJ2A 5IM7B 4L3ED 1K4DB 3NIDF 2CK2A 4QXTB 1HE7A 2APTA 2Y07L 3VFSA 4YWGL 1K4CB 4PREB 4Z7NE 1QLRA 1P7QB 3BT2L 2H1PH 3HUJE 1RURL 1WEJL 5HGGS 2M1KA 4KRPB 3TPKA 3S88H 4U05A 2XQBL 4Q9QL 3QUYA 1U8HA 4G8EB 2CLVA 3PABB 4WI6A 5E5MB 5IFHH 1BVKA 1T1WA 3BUYA 4XXCA 1R0AL 4ERSL 2VR4A 3U7AA 4I0KA 4HFWA 2ADFL 4RMQA 4BFIA 3HI6L 3ES6B 5ILTL 4ODWB 2Z8SA 1RUAH 5E0QA 1A21A 1Q9WB 2YN5A 2VSDA 4ODXA 2NW2A 4N90E 5JQHC 3VMPA 4WFED 3DWTA 5ITFA 4LF3B 1NCBL 2R4RH 4Q6YA 5GGVY 3VGHA 3V0WL 3QH3A 1UB6B 2DWEB 3VFTB 3CDFA 1PG7X 2XNAB 1D9KD 1OF2A 5MERA 1LP9E 2BVUA 3IDMA 1HCVA 2Q87A 2DLEA 3OKMB 3PIQB 2DD8L 5I1HL 1X5ZA 1F58L 3B5HA 3TA3D 5JMOC 4DTGL 1UENA 2HJLA 1SJHA 1G0YR 2ZOLB 3QIUD 1NDGA 1A3RL 2D7OA 4DZ8A 3OL2A 3V4PL 5A1AA 2BVOB 2CLZB 3IFNH 1CL7H 1SY6H 1BFTA 5EU7C 2AJVL 4IRSD 4QT5A 4R0LB 1J12A 1MCWM 2GCYB 1FV1A 3V79C 4KKAD 4OD3H 1JGEA 4HKXA 3UJJH 1CXLA 2GK0B 2HJFB 5CP7B 4NKIH 3S3SA 1GZQA 4D2NA 1JK8A 2IBBA 3QXDA 2FNBA 2BDNL 3U36B 3O45B 3WHXA 4MJ4A 4Y19D 1NKOA 4PRHB 5DRNB 4G6AD 4GKOA 5D2NC 1A7OL 2IFFH 2J8UE 4PRPB 2IQ9H 2XTJB 5F21B 3TO4A 5DD6A 3L5WB 4EDWL 4MNGB 4NZRL 4Y5VA 3D18B 1MFNA 3QDMD 2VC2H 3IXAA 4P9HH 4QEGA 1UQSA 4G6MH 2AGJH 3BPNB 1XR9A 3RGVA 1FZKB 4K3DH 1U3HC 4NT6B 4OIBA 2AP2A 1YMMD 1T2JA 4HCRL 1Q0YL 2YPLD 2EDYA 4G9FA 1L9MA 5FECB 3F6LA 4JAMA 1VEPA 5DYOA 1RUQL 2P45B 4X98A 5HGAB 1U8PA 5GJSH 1G7MA 2C4XA 2UZXB 3JTTA 4KKLD 3KPPB 1C5DB 3PQYE 1ZVYA 5AWNH 1TJHL 4PRBA 5DUBA 1UC6A 4AG4L 4OZFH 4ZFFB 4NWTH 5CILL 3GJFH 4BKLA 5JLZB 5TH2A 4R7DA 4OF6A 4G6KH 1I1YA 3QFJA 4C54A 3MV8D 3IFLL 1UH4A 4PJGF 5GS1B 5K9JH 3MA9L 4LCIL 1W72A 3PXJA 1PEZA 3ARGC 4PUBH 1YJDL 3OJVC 2VZ3A 5KS9A 3DVNA 1MLCA 1FCCA 2J8UF 2VXQL 4OUUA 5F7DB 3W9EA 4H25A 1BFVH 2ESVB 2YZ8A 4ZTOH 2CO7B 4ZFGL 3W82A 2I07A 3ZE2E 3IVKA 3FB7B 5C09D 1D5IL 4XNZB 3EBAA 3LPFA 5D7KE 3RWCA 4Y4FD 3QXUA 2AKRB 2YS4A 4H88H 3IRPX 3HE6B 4XC1H 3GMMA 3OWEA 5I8CB 5TGBA 5KZCD 4KXZH 1RZ8B 3KWWB 3VXRB 1OGTA 1QO3A 3LRHA 1AE6L 2CR6A 1S7TA 1LP9F 4Y19E 1AC6A 1U8JA 3DGGA 5E8DH 2EKJA 1KCSH 5A16A 5C0ND 1X5KA 5IJKA 3QWRD 5D7JB 1HK6A 5LQBH 4FG6C 1G7QB 1G7PA 2EDRA 3CFKB 4KRPD 5HTSA 2OS7A 2FGWL 3AFLA 5C1MB 3I2CH 4AMKH 2VZOA 3MBEC 1NJ9A 3ARBD 5I66B 1OB1B 2CDFB 1FO0B 5ICXB 3IDJA 3TWCL 2Q1EA 5MENA 5LCVL 1QUNA 4X0KA 5IVXA 2ATPA 2HT4C 4FQ1L 4FQXD 4HHAA 4CADA 3TIEB 1NPUA 2NX5D 2CKBL 5LVEA 1E4KA 5KSAB 4YXLH 4NFCA 5TE7L 1ZWIA 1QLFA 3F58H 1MAJA 1YNLH 3MRJB 4NHUB 3G08A 3MRKB 3W9DB 1I1AB 5ISZB 1MQKH 4MDIA 4PD4K 2K3TA 1S9WB 2X4TA 4NQDA 4EUPG 4HPYH 1CICB 3MCLH 4QNPE 1OSPL 4G9DB 1IJ9A 3DURB 1CF8H 1UH2A 1KELL 4PP1D 1J5OH 3KXFE 4KDWA 5DGRA 5BS0B 4G6FB 4UV7H 5ADPL 5C0CE 5SX4I 3VWJB 5F71A 1VFOA 1TJGH 1X3DA 3LKRA 4MDJA 4QF1A 1G7HA 4CDGC 5GXBB 2ICWJ 2ZPKL 3CU1A 1FC2D 1ZHNB 3QQ3B 1A0QL 3FB6A 5DJZB 3PWNA 3A6CH 4HEME 3MPCA 4Z7VB 3QQ9C 2NY3B 2ITCB 3MUZ1 2Z93A 1EGJH 2JTDA 3NFNB 5GGRY 5C0IB 3HLAA 2DLFL 1A47A 1U3JA 5CIPB 3AAZB 4U1SB 4K07A 2VDNH 2CXKA 1Q9OA 2P44B 1P1ZB 5I1DA 1DQMH 1G9ML 2P7TA 5HYQA 4XWOD 4GAYB 2ICWI 2Y7QA 4LLVA 4ZOCA 3HE6C 2L4OA 2BC4A 1A64A 3NN8B 1NCBH 1PKQB 2CIKB 3RHWK 3PV6A 5D6DC 1NMAL 4JZNB 3W0WB 4AM0A 5BJTA 1DSFL 4H1LA 2YA2A 4MZ3A 4CRPA 4WI3A 2GFBB 1QLRB 3RVTD 5EU6D 1S3KH 2NY1D 1SY6L 2IBZY 1K8DB 1VDGA 4NQCD 3MLSH 4ZFOB 1IAII 5D2NA 3X13A 3BEWA 4NRZA 5CJOL 3EYSL 2HA1A 4G43B 1OT1A 2XPGA 5C0BD 4M3JA 1S78C 5KG9B 3ECBB 3VI4F 1JZ5A 3GBNL 5EH1A 5J3HD 3UYPA 5B38B 3ES6A 4X4YB 4KHTH 1OAYH 4O58L 1Q9WA 1X4YA 1N26A 4JGUA 2JJUA 3HKFA 3MCLL 1L0QA 2FDBP 1LEIB 1BBDL 5AWNL 3DETC 3C5JB 2DYPA 2NXYC 4DGYH 5DS8B 2J88L 4KMLB 4F9LA 5ICZA 4WW2B 3WIHH 1OF2B 3C5SB 1N0XH 3O6FC 3B83A 3EJJX 1OAKL 4M7JH 5GIRB 3PWPA 4OZGA 2D0HA 5C70A 4K3GA 2BSRB 3QISA 4H0GA 5EBWA 4OLUL 4BH8B 4DAGL 1NDGB 4PLKC 5FHAL 4FQLL 4L9LC 5DLMH 4B7LA 3EYVB 2CLZA 5D7IE 5J9PB 2FCBA 4OB5L 3R8BB 1JYNA 5DEGA 5DFWH 5HHNB 3Q0HA 3VXTA 3MLVL 5IMKA 1WV7T 2ZUQB 2XACC 2FJFB 1FJ1A 2E7LC 1D5BA 1JK8B 1H15A 3IJYA 5DRNA 3L3DB 5GGTA 1JPGA 4K8RH 5EA0L 1QSVA 1QLEH 4HUUB 4M9OA 1RVFH 4YZFF 4I77H 2W9EL 4Q9BA 4CNIA 4EI6A 5DMGD 4P57A 1AJ7H 4PLOB 4JFZL 1ZLWH 5JW5A 1TVHB 1FZKA 2OI9C 3NACH 5KVEL 2FB4H 8FABB 32C2B 1BJ1H 1X5GA 1KJMA 2EH8H 3CFCH 3FQXB 1KTDB 4G6KL 1MCHA 3MRBB 4JAMB 4YGVA 3ARFA 1A3LH 1AIFB 5GJTL 3KPPA 1C5DA 3K1DA 5E8NA 1FLRL 2NY5L 2AEPL 3QIBA 5FB8B 1YUHA 4PJAF 4PRBB 5DUBB 2VL5B 4ZFFA 3ARFC 1DQJA 4IOSD 2NXZD 3U4AA 3PF2A 1ZAGA 4WUKL 1Y18A 4FABH 4U1KB 5DTFB 3F6IA 5FHAH 5T33H 4NQEE 5DJXB 1A4JA 1QFWM 2B1AH 1FFOB 3DIFB 4J12A 3BPOC 4WI5A 3N85L 4LSPH 1MWAA 5HGBB 1CGWA 1OTTD 4YEFA 1ORQB 1BWWA 5F7DA 3TNMB 3WFCL 1P7KB 5FKAB 5B3JF 3G6JE 1E4JA 1A6WH 3PGCB 5JOFA 2YPLB 3OKNB 2I07B 2JIXB 2E6JA 1A6VL 5T3ZH 1IGIL 2BFVH 3RL1A 2F5AL 4QRUB 4P59L 2JK5B 4PGBA 2VISB 1FZOB 2RJMA 3QBTB 1INEL 5IVOA 5F6HI 3UYOD 1J86A 3QUXB 1FGNL 3MV7D 1OT2A 4K7PX 4WI4A 5B38G 4PJXA 4DEPB 1JHTB 2VYRE 1AO7E 4L9LB 1RZ8A 4MQTB 4KVNH 4F37K 1N64H 2CRYA 4YWGH 1T83A 4MQXC 5DD3H 5IB3A 3DGCR 4PJFB 4PLKD 1RUKL 2NY1B 4U1IA 4LLWB 3ARYA 3C2AH 5FEBA 5IFJA 5I66A 2PW1A 3HZVB 4Q2ZB 1LO0H 1H3PL 1GZPA 4U6YB 1C12B 4YPJA 5HJ3A 4M6ML 5J11B 1IAKA 3MC0A 3QULB 1JYWA 4GXVH 2R2HA 4KKBC 2DLTA 3EZ8A 4XP9L 3PWJB 2Q20A 3RA7H 4DUXA 3GBML 4PB9L 4PJ9B 3N50A 4HK3N 4JM2A 2CGRL 1AQDA 2OM5A 1N7MH 1MFCL 2EDWA 4KTDL 3ZDXF 3P3YA 5JIPA 3RJDA 3LD8B 1FPTL 1P53A 3TA3C 3S8WA 4K7PH 15C8L 5D2LE 4NQXA 3Q5OA 1T2QL 4MD5A 3V6OA 4G9DA 4XMKH 2EDXA 3U9UA 1YY8A 2Y07H 2YC1B 4MX7A 3V0AC 4LSTH 1PW3A 4M8QA 2V2WB 3U0WL 3DYPA 2ORBL 1L7IL 5IJVB 3BMVA 4JRXB 1X5AA 1FL5A 1NFKA 1B0RA 1HH9A 1DVFB 2IADA 3TZVB 4ZFGH 4OB5H 4LSVL 4TNVK 1QBML 4JFYA 1ZT1A 4FQLH 3RKPA 3VFOB 3WNMA 3QQ3A 3L5XL 2ITDA 2IH3B 2NX5B 4V1DD 3PWNB 4KI5D 5J6GB 4I8DA 1LO2L 1U2CA 2L7JA 5IT2H 5FYJD 3VI3E 3C6LB 4KRMB 4OZGE 1U3YA 1VERA 4LLAA 4RX4A 3S5LA 3LKPB 4TVPD 1JCKA 5EBGA 4M7LH 5GGSY 1PD6A 3H7BB 3U1SL 1M1SA 4JCMA 2CQVA 1FHGA 4O5LL 1FCGA 5A2LH 2DLHA 2A74A 1LD9B 1UB5A 2HVJA 4P2OA 1LK2B 3V5HA 2Q86A 4XVUC 1NSNL 1I9IL 1PSKL 2BC4B 1RUML 1S7SB 1VA9A 5HYIA 1XCTB 5B8CA 4EN3D 3PV6B 4MJ5B 5GS1C 1UXWA 3QDJA 2EDDA 4XMLH 1EA9C 5BJTB 3U46B 5E08L 5D1XA 5GRVL 1J11A 3JWOH 1S7UB 3CH1B 4NZUL 4LPCA 2EC9T 5DJAB 2VTFA 1Z9MA 1GGCH 2DF3A 3H3PH 1GC1L 1GHFH 1GAFH 3F7YB 3ZE0E 3T65A 2O5XL 2P5EA 4NPYB 1LK3L 2IANE 5B38A 5HI4C 2ZG1A 1T89C 4M1DL 4OCRH 1INQA 3BUTA 1MCBA 4BJLA 4PGJA 2H3NB 4JN2A 4NM8H 4TULH 5E6IC 5I8KH 5I8OL 5GS0D 3B6SA 4PJEB 2DL9A 4EZMA 1T83C 3FO2A 4FQXC 2R29H 2OBGA 3H9SE 4U6VH 3H9YA 3O3AB 1YEEL 2V2XA 3NCFB 5HYJB 1U92B 2DQJH 3L3KA 4WUUA 1DQQB 4G8IB 5CINL 2HAZA 3I6KB 3E6HA 3M45A 3OJMB 5I1EL 4PJAB 4G7YH 1YC7A 5EIQA 3GSWB 5SX5K 4UUJB 3BKYL 2CK0L 2H45A 3BKJL 1JPSH 5EBWB 1ZTXL 3Q5TA 4OFYD 2X4SA 3TYFB 5D1XC 1IQWH 3B5GA 2HTKC 5SV4A 4K8RL 2NY3C 1HWGB 4XPHH 2JELL 5FYJE 5HHNA 5SV3A 4ELME 5HBBA 5DRXA 4JVPA 3WXVL 2EO1A 1ND0B 3EIFA 3AXLA 1RFDL 4N8PA 3KJ4B 3LH2L 4MA7L 5T33L 2AK1H 3LHPL 1RHHA 4OFKA 3V5DA 5ENWB 4OFVA 4Y4FC 1F02I 1RUAL 12E8L 1JWMB 2CJUL 4KZDL 4YE4H 1N5YL 3RWGA 2JCCE 2ADFH 3MJ8A 5CZVH 5DJCA 1I7UB 1NCTA 4NDMA 4ZSOE 4ZO9A 1R5IB 4N5ED 1HDMB 3AREA 3SDCC 1MPAH 3J7HA 1BREA 4EI6B 4YO0B 4O58H 4J3VA 4XAKD 1TQBB 2XQBH 4Q9QH 1TVHA 3VE0B 3O2VH 3C6LD 4J7RA 32C2A 4NO3B 1CDUA 1TXKA 2ZG2A 1P84J 5FHBL 4KK6D 3MRBA 4PRPD 1KPVB 1MJUH 2ZCKL 2FHFA 1I1CA 1GGIL 4GG6E 4OJFH 1D5XA 4MLSA 4XBPA 2VL5A 4ZTOL 5BZWB 1D6EB 4TQEH 2VXTL 3FQWB 1GGTA 3C60B 5GZOC 1FO0L 3EDKA 2HLFC 1KIUA 4U0RB 3RDTD 3ROLB 1I7TA 2GUOB 5E2WL 5I76A 1M7DA 4R7NB 2QHRH 3VRLE 1MFBL 5GRUH 3SDXB 5J06A 4M5ZH 4YHOH 1A4JB 1KJVB 4DTGH 1ZV5A 4KK5D 3ARDB 1CFBA 3KPNB 3TWCH 2AJUL 5HGBA 4H1LG 3MV9B 5TPWL 4F80A 2VMFA 1TETH 1QRNE 3MNWB 1TQCC 4KKAC 3OV6A 1FFPA 3PNWB 2FL5B 4UZGA 5FYLD 1C7TA 2CMRL 2EKSB 4J6RL 2E8ZA 2PR4H 4RGMB 5MHSE 5CGYD 2X9WA 4Y4KC 4G7YL 2SEBA 1QSZA 2AI0H 4XBEH 3GHBH 3OKNA 4YLQT 2HT3C 1N7ML 1MCFA 5HHOE 3U0TA 3KAAA 1CGVA 5IOPA 3R1GH 1DJSA 4N5EC 4K8RC 4GSDH 4PY8I 1JZ8A 1FNSL 5JHLL 1CFQA 2E27H 3KPQB 1JHLL 3JVGA 1DBML 3P9MB 4JQVA 3CFJB 3M1BA 4KU1A 3FFCD 1P69B 3ULVF 1B0GB 2R2EA 1BHGA 3NA9L 3TPUA 3P4NB 1N5AA 2P5ED 1KEML 1DBKL 3BKML 4FQHA 2FBJH 4JQVC 5ID0A 3VI4E 2UZIL 3EDFA 1FVCB 1HIML 2KH2B 3KLAA 4LLWA 4MCYB 3HPLB 4GS7C 1A6UH 5MENE 3N06B 4G6JL 1M05A 5A43C 4K94C 3EYOB 5L0QC 4Z7OE 1HH6A 3PL6A 2MJWA 1IAKB 3QULA 2B7DT 4YFEA 1VFMA 2RBLA 5EBMB 2DI9A 1FYTB 3MJ7A 3O2WH 2FZ3B 3PWJA 2BNQA 5I30L 1BX2B 4OZHA 2QBWA 3BRFA 4ELKB 5EOQL 4ALAH 2APVA 2V6HA 4PJCE 3I75A 2QQKL 4MSWB 1FFNA 2DQEL 3OR6B 3WFZA 3U0WH 2FX9L 2WQ8A 2VXVH 1I1FA 1S9VB 4JFQB 2LVCA 3QWOB 1HYSC 3W5NA 4D9LL 3RKDD 3STZB 3GJFA 4NQXB 3O6MH 1FZMB 5EUOB 2CUIA 2XICA 5TF1H 5KOMC 1IT9L 2IFGA 1EEYB 4HWBL 3BPOB 2L7UA 4M62H 4HIJA 5EZOL 4MD4B 4JRXA 1QRND 5C3TA 2IADB 3RY6C 4ENED 1IQWL 5DJ2A 4LCCA 1RZFL 1KN2H 5DURB 1OTUC 3ULSB 1NGWB 1R0AH 1K8IB 2KL6A 3H9SA 1SYVB 3B9EA 1DDHB 2H2SD 4CKVX 1MHCA 1KCRL 1X5HA 4YHYC 2DQJL 4WUUE 4WVRA 4RGMC 1LK3H 3SJVA 3C6LA 3GMQA 4DCQB 4XCCH 5FV2A 4MXVE 3TVMD 3C8KA 4L8DB 4N90D 1BBJB 4WO4D 5A2FA 2G5BA 5AYQA 1V7ML 1FORH 4X9GA 5DUPH 5E8PA 3S4SA 3TH2T 1CLOL 1I8LA 1A1NB 5KVFH 4XAWH 2VNCA 4Y1AD 4PJDE 4MHHI 4O51B 4NM4H 1QNZL 4P5TD 4I1NB 2NY1C 4J1UB 3WUZA 4B0MM 3RDTA 5F7MC 3NCCB 1A6ZA 5DGQA 2BMKA 5IVZB 5DFTA 3U46A 1KIPA 4N1EA 1P84K 4YXHH 1KB5L 3QEUB 2HG5B 3MROB 5D2NE 2FYYB 2QADD 5E00A 1YQ2A 3IJSA 1XGUB 3K4ZA 4JFHE 1GXEA 4LNVA 1CL7I 5CZVL 5DJAA 3PJSB 4HKJA 2D7NA 3EYUL 5DJ8A 2EECA 2WWMD 3I50H 1JZ4A 5MEND 3TO2B 1BZ9B 3VXOB 2P5EB 4NPYA 2DI8A 2ZSWB 1Q1JL 3QUXC 4KHXL 1KELH 3RWFA 4HK0B 4OGAD 4YDLC 3VXQB 2VQTA 3FT4B 2IANA 2KBGA 2XZCH 4MAUH 2VXSH 2FO4A 1JPSL 4XI5D 3FO2B 3VFPA 3QNXA 2JJSC 4XCFH 1YY9C 1OGAB 4NOBA 1HHIA 3X11B 2WIIA 1NL0L 4XPBH 4P59H 3OKEA 4LKCB 3O3AA 2NPLX 4JFED 2UWEB 1SM3H 4OCSH 1WZ1L 5D6DA 2VOTA 5B21A 3VXSE 1DSFH 4OF5A 4U3HA 3GSWA 4BSWA 2YKLL 4I48B 3MRQA 4OTXH 4U2YA 4NGHL 1AGCB 3HMWL 4X9IA 3BGAA 4K7PY 4ZO7A 3OJDB 4MAYA 4OZIA 2NY2D 3WO4C 4L8CB 3EYQC 3QG7L 4JFZH 3T3PF 5H2BB 2AXGB 4PJ5D 1LE9B 3DXAA 4HIHA 4GW1A 4KK8C 4Z7WE 3ILQC 5DZOA 1HZHL 3O9WB 4F15B 1CE1L 4MQXD 4F3FA 5KVFL 2IAMB 2R15A 3DHJA 2P42B 4I18B 4X4XA 1Q38A 2FIKB 2X89A 4JB9L 2P46B 1SBSL 3NA4A 1F3JA 4JRYE 3WJJA 2P49B 1ITBB 4ORGA 3RIAF 4M1DH 1C8PA 3O4LD 4YDJA 2X6MA 4W81A 3DOSA 3HI6H 5EG6C 3K8MA 2DQCH 2DOCA 5FYLL 1UZ8A 3VWJC 4HPOL 4HJGA 3T0EE 3IDGA 1WWCA 4M7ZB 4S1RL 3SDDA 1OAKH