2F9IB

Crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
260
structure length
260
Chain Sequence
PAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIALTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDGMKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQMGKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTINEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the carboxyltransferase component of acetyl-coA carboxylase reveals a zinc-binding motif unique to the bacterial enzyme.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords acetyl-coenzyme A carboxylase carboxyl transferase subunit a
total genus 86
structure length 260
sequence length 260
chains with identical sequence D
ec nomenclature ec 2.1.3.15: Acetyl-CoA carboxytransferase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
B PF17848 zf-ACC Acetyl-coA carboxylase zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2f9iB00
3T8AA 4NEKA 3H0QA 2F9IA 4HC8A 1YG8A 3TT6A 5DL1A 1SG4A 1XNYA 2J5GD 1WDKA 3TT7A 4U1AA 4OG1A 2W3PA 4F47A 3TLFA 1TYFA 3WG5A 3RSTA 4LK5A 5C90A 3STAA 2F6IA 4IZCA 2VSSE 1RJNA 3KTIA 1EY3A 5DU6A 2VSSF 3QKAA 4G2RA 3QK8A 3R0OA 3ISAA 4KD6A 5DZKH 4ZDBA 5INFA 4EMPA 4ELWA 4I42A 4KPKA 1HNUA 1XX4A 2A81A 3JU1A 1UYSA 4GHNA 4JVTA 3GF3A 3ZWAA 2ZQQA 2WTBA 4GM2A 3RSIA 5KDRA 2A7KA 4YLHA 3TZ3A 5E0SA 4WYOB 2J5SA 5G1QA 4IZDA 4MI2A 1Y7OA 5INIA 2DUBA 4I4ZA 4U0HA 3HP0A 4JCQA 3IB9A 3KTKA 3KQFA 3SWXA 2FBMA 3TRRA 4ZDEA 2ZL4A 1FC7A 4U18A 2VSUC 3V5EA 4U0GH 4K3WA 5KJPA 4MOUA 3BPPA 4B3JA 3NJDA 2F9IB 2EJ5A 3M6MA 2C8TA 5INGA 1OD4A 3T8BA 1SZOA 1FC6A 2VSUF 3KTJA 4OLQA 5JBWA 5G1SA 4RYFH 4K2NA 5C9GA 3TV5A 3BF0A 3K50A 2F9YA 4Z0MA 3ST9A 1MJ3A 4JJTA 4FZWA 3QYRA 3SLLA 3I47A 4FN8A 1XO6A 3R9QA 5CTCA 5JBXA 2ZL2A 4U0GA 3IBBA 3GMAA 1JXZA 3QXIA 4JOTA 4JSBA 3ZW9A 5DUFA 1EF9A 3ZW8A 3Q0JA 4NNQA 3QWDA 4JCRA 3TVWA 2Q34A 3U9TB 2NP9A 1TG6A 5DUCA 3R9TA 2Q35A 3Q1TA 2Q2XA 4JYLA 4WCZA 1HZDA 1UYTA 3ZWCA 1ON3A 3T3WA 2X24A 1WZ8A 3GF7A 2CE3A 3G64A 5FIFA 4QIJA 1N6DA 4Q0GA 2CBYA 2HW5A 3PZKA 1YG6A 3MYBA 1Q52A 4QIIA 5DTWA 5DKPA 1Q51A 2J5IB 3LAOA 3KTHA 4RYFA 1OD2A 2PG8A 3FDUA 1N6EA 2D3TA 3L3SA 2VX2A 3QMJA 3T89A 1K32A 3R6HA 2ZQRA 4ELXA 4L6WA 5DZKA 3MT6A 5MGBA 5DU4A 5E0SH 4JCSA 3PGQA 1EF8A 4B3HA 3MOYA 3H81A 4ELSA 3N6RB 1FC9A 3P5MA 4FJWD 1W2XA 2ZL0A 3HLN1 3H02A 4ASIA 4B3IA 3QXZA 4ZDDA 1WDMA 2VSSA 4FZWC 4KWBA 1J7XA 1PIXA 3OC7A 5G1RA 3NJBA 2VSUA 1VRGA 4JWVA 1ON9A 2J5II 3P2LA 1UYVA 1X0UA 2VREA 3H0JA 4Q1IA 3ZWBA 2PBPA 3TVUA 4WZ8B 3PEAA 4ZDCA 3H0UA 3Q0GA 1NZYA 3M6NA 2F6QA 3R9SA 4DI1A 3HINA 3OMEA 2FW2A 3V5IA 2X58A 2J5IA 3DORA 3TDCA 3MFMA 1FCFA 3GLMA 3H0SA 1XNWA 1PJHA 3BEZA 4JFCA 4HNKA 4EMMA 2BZRA 4ZU2A 5IKLB 1K39A 2J5GA 2PPYA 2IEXA 2A7SA 1DUBA 4OMRA 4ZDFA 4FB8A 1N6FA 2FZSA 4FNBA 3OT6A 4MXIA 4EMLA 3DJAA 3U9SB 3GKBA 2QQ3A 4RCNA 5FUSA 3FF6A 3LKEA 3HRXA 1DCIA 5DTPA 5DU8A 5KDRB 1WDLA 3RRVA 1UYRA 3KTGA 3U9RB 3Q7HA 3HE2A 1XNVA 3T88A 2UZFA 4IZBA 3PE8A 4JYJA 2ZL3A 4K29A 1UIYA 3K8XA 4KNPA 4U19A 1O8UA 2DEOA 2F9YB 2VSUE 4JCTA 4FN7A 3IAVA 2GTRA 4I52A 5CTBA 1NZYB 3VIVA 4FNDA 4L8KA 3P85A 4QFEA 1RJMA 3QREA 5E0NX 1HNOA
chains in the Genus database with same CATH superfamily
3T8AA 4NEKA 3H0QA 5HUQA 2F9IA 4HC8A 1YG8A 3TT6A 5DL1A 1SG4A 1XNYA 2J5GD 1WDKA 3TT7A 4U1AA 4OG1A 2W3PA 4F47A 3TLFA 1TYFA 3WG5A 3RSTA 4HDTA 4LK5A 5C90A 3STAA 4NARA 2F6IA 4IZCA 2VSSE 1RJNA 3KTIA 1EY3A 5DU6A 2VSSF 3QKAA 4G2RA 3QK8A 3R0OA 3ISAA 4KD6A 5DZKH 4ZDBA 5INFA 4EMPA 4ELWA 4I42A 4KPKA 1HNUA 1XX4A 4J2UA 3BPTA 2A81A 3JU1A 1UYSA 4GHNA 4JVTA 3GF3A 3ZWAA 2ZQQA 2WTBA 4GM2A 3RSIA 5KDRA 2A7KA 4YLHA 3TZ3A 5E0SA 4WYOB 2J5SA 5G1QA 4IZDA 4MI2A 1Y7OA 5INIA 2DUBA 4I4ZA 4U0HA 3HP0A 4JCQA 3IB9A 3KTKA 3KQFA 3SWXA 2FBMA 3TRRA 4ZDEA 2ZL4A 1FC7A 4U18A 2VSUC 3V5EA 4U0GH 4K3WA 5KJPA 4MOUA 3BPPA 4B3JA 3NJDA 2F9IB 2EJ5A 3M6MA 2C8TA 5INGA 1OD4A 3T8BA 1SZOA 1FC6A 2VSUF 3KTJA 4OLQA 5JBWA 5G1SA 4RYFH 4K2NA 5C9GA 3TV5A 3BF0A 3K50A 2F9YA 4Z0MA 3ST9A 1MJ3A 4JJTA 4FZWA 3QYRA 3SLLA 3I47A 4FN8A 1XO6A 3R9QA 5CTCA 5JBXA 2ZL2A 4U0GA 3IBBA 3GMAA 1JXZA 3QXIA 4JOTA 4JSBA 3ZW9A 5DUFA 1EF9A 3ZW8A 3Q0JA 4NNQA 3QWDA 4JCRA 3TVWA 2Q34A 3U9TB 2NP9A 1TG6A 5DUCA 3R9TA 2Q35A 3Q1TA 2Q2XA 4JYLA 4WCZA 1HZDA 1UYTA 3ZWCA 1ON3A 3T3WA 2X24A 1WZ8A 3GF7A 2CE3A 3G64A 5FIFA 4QIJA 1N6DA 4Q0GA 2CBYA 2HW5A 3PZKA 1YG6A 3MYBA 1Q52A 4QIIA 5DTWA 5DKPA 1Q51A 2J5IB 3LAOA 3KTHA 4RYFA 1OD2A 2PG8A 3FDUA 1N6EA 2D3TA 3L3SA 2VX2A 3QMJA 3T89A 1K32A 3R6HA 2ZQRA 4ELXA 4L6WA 5DZKA 3MT6A 5MGBA 5DU4A 2YJGA 5E0SH 4JCSA 3PGQA 1EF8A 4B3HA 3MOYA 3H81A 4ELSA 3N6RB 1FC9A 3P5MA 4FJWD 1W2XA 2ZL0A 3HLN1 3H02A 4ASIA 4B3IA 3QXZA 4ZDDA 1WDMA 2VSSA 4FZWC 4KWBA 1J7XA 1PIXA 3OC7A 5G1RA 3NJBA 2VSUA 1VRGA 4JWVA 1ON9A 2J5II 3P2LA 1UYVA 1X0UA 2VREA 3H0JA 4Q1IA 3ZWBA 2PBPA 3TVUA 4WZ8B 3PEAA 4ZDCA 3H0UA 3Q0GA 1NZYA 3M6NA 2F6QA 3R9SA 4DI1A 3HINA 3OMEA 2FW2A 3V5IA 2X58A 2J5IA 3DORA 3TDCA 3MFMA 1FCFA 3GLMA 3H0SA 1XNWA 1PJHA 3BEZA 4JFCA 4HNKA 4EMMA 2BZRA 4ZU2A 5IKLB 1K39A 2J5GA 2PPYA 2IEXA 2A7SA 1DUBA 4OMRA 4ZDFA 4FB8A 1N6FA 2FZSA 4FNBA 3OT6A 4MXIA 4EMLA 3DJAA 3U9SB 3GKBA 2QQ3A 4RCNA 5FUSA 3FF6A 3LKEA 3HRXA 1DCIA 5DTPA 5DU8A 5KDRB 1WDLA 3RRVA 1UYRA 3KTGA 3U9RB 3Q7HA 3HE2A 1XNVA 3T88A 2UZFA 4IZBA 3PE8A 4JYJA 2ZL3A 4K29A 1UIYA 3K8XA 4KNPA 4U19A 1O8UA 2DEOA 2F9YB 2VSUE 4JCTA 4FN7A 3IAVA 2GTRA 4I52A 5CTBA 1NZYB 3VIVA 4FNDA 4L8KA 3P85A 4QFEA 1RJMA 3QREA 5E0NX 1HNOA
chains in the Genus database with same CATH topology
3T8AA 4NEKA 3H0QA 5HUQA 2F9IA 4HC8A 1YG8A 3TT6A 5DL1A 1SG4A 1XNYA 2J5GD 1WDKA 3TT7A 4U1AA 4OG1A 2W3PA 4F47A 3TLFA 1TYFA 3WG5A 3RSTA 4HDTA 4LK5A 5C90A 3STAA 4NARA 2F6IA 4IZCA 2VSSE 1RJNA 3KTIA 1EY3A 5DU6A 2VSSF 3QKAA 4G2RA 3QK8A 3R0OA 3ISAA 4KD6A 5DZKH 4ZDBA 5INFA 4EMPA 4ELWA 4I42A 4KPKA 1HNUA 1XX4A 4J2UA 3BPTA 2A81A 3JU1A 1UYSA 4GHNA 4JVTA 3GF3A 3ZWAA 2ZQQA 2WTBA 4GM2A 3RSIA 5KDRA 2A7KA 4YLHA 3TZ3A 5E0SA 4WYOB 2J5SA 5G1QA 4IZDA 4MI2A 1Y7OA 5INIA 2DUBA 4I4ZA 4U0HA 3HP0A 4JCQA 3IB9A 3KTKA 3KQFA 3SWXA 2FBMA 3TRRA 4ZDEA 2ZL4A 1FC7A 4U18A 2VSUC 3V5EA 4U0GH 4K3WA 5KJPA 4MOUA 3BPPA 4B3JA 3NJDA 2F9IB 2EJ5A 3M6MA 2C8TA 5INGA 1OD4A 3T8BA 1SZOA 1FC6A 2VSUF 3KTJA 4OLQA 5JBWA 5G1SA 4RYFH 4K2NA 5C9GA 3TV5A 3BF0A 3K50A 2F9YA 4Z0MA 3ST9A 1MJ3A 4JJTA 4FZWA 3QYRA 3SLLA 3I47A 4FN8A 1XO6A 3R9QA 5CTCA 5JBXA 2ZL2A 4U0GA 3IBBA 3GMAA 1JXZA 3QXIA 4JOTA 4JSBA 3ZW9A 5DUFA 1EF9A 3ZW8A 3Q0JA 4NNQA 3QWDA 4JCRA 3TVWA 2Q34A 3U9TB 2NP9A 1TG6A 5DUCA 3R9TA 2Q35A 3Q1TA 2Q2XA 4JYLA 4WCZA 1HZDA 1UYTA 3ZWCA 1ON3A 3T3WA 2X24A 1WZ8A 3GF7A 2CE3A 3G64A 5FIFA 4QIJA 1N6DA 4Q0GA 2CBYA 2HW5A 3PZKA 1YG6A 3MYBA 1Q52A 4QIIA 5DTWA 5DKPA 1Q51A 2J5IB 3LAOA 3KTHA 4RYFA 1OD2A 2PG8A 3FDUA 1N6EA 2D3TA 3L3SA 2VX2A 3QMJA 3T89A 1K32A 3R6HA 2ZQRA 4ELXA 4L6WA 5DZKA 3MT6A 5MGBA 5DU4A 2YJGA 5E0SH 4JCSA 3PGQA 1EF8A 4B3HA 3MOYA 3H81A 4ELSA 3N6RB 1FC9A 3P5MA 4FJWD 1W2XA 2ZL0A 3HLN1 3H02A 4ASIA 4B3IA 3QXZA 4ZDDA 1WDMA 2VSSA 4FZWC 4KWBA 1J7XA 1PIXA 3OC7A 5G1RA 3NJBA 2VSUA 1VRGA 4JWVA 1ON9A 2J5II 3P2LA 1UYVA 1X0UA 2VREA 3H0JA 4Q1IA 3ZWBA 2PBPA 3TVUA 4WZ8B 3PEAA 4ZDCA 3H0UA 3Q0GA 1NZYA 3M6NA 2F6QA 3R9SA 4DI1A 3HINA 3OMEA 2FW2A 3V5IA 2X58A 2J5IA 3DORA 3TDCA 3MFMA 1FCFA 3GLMA 3H0SA 1XNWA 1PJHA 3BEZA 4JFCA 4HNKA 4EMMA 2BZRA 4ZU2A 5IKLB 1K39A 2J5GA 2PPYA 2IEXA 2A7SA 1DUBA 4OMRA 4ZDFA 4FB8A 1N6FA 2FZSA 4FNBA 3OT6A 4MXIA 4EMLA 3DJAA 3U9SB 3GKBA 2QQ3A 4RCNA 5FUSA 3FF6A 3LKEA 3HRXA 1DCIA 5DTPA 5DU8A 5KDRB 1WDLA 3RRVA 1UYRA 3KTGA 3U9RB 3Q7HA 3HE2A 1XNVA 3T88A 2UZFA 4IZBA 3PE8A 4JYJA 2ZL3A 4K29A 1UIYA 3K8XA 4KNPA 4U19A 1O8UA 2DEOA 2F9YB 2VSUE 4JCTA 4FN7A 3IAVA 2GTRA 4I52A 5CTBA 1NZYB 3VIVA 4FNDA 4L8KA 3P85A 4QFEA 1RJMA 3QREA 5E0NX 1HNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8A A;  4NEK A;  3H0Q A;  2F9I A;  4HC8 A;  1YG8 A;  3TT6 A;  5DL1 A;  1SG4 A;  1XNY A;  2J5G D;  1WDK A;  3TT7 A;  4U1A A;  4OG1 A;  2W3P A;  4F47 A;  3TLF A;  1TYF A;  3WG5 A;  3RST A;  4LK5 A;  5C90 A;  3STA A;  2F6I A;  4IZC A;  2VSS E;  1RJN A;  3KTI A;  1EY3 A;  5DU6 A;  2VSS F;  3QKA A;  4G2R A;  3QK8 A;  3R0O A;  3ISA A;  4KD6 A;  5DZK H;  4ZDB A;  5INF A;  4EMP A;  4ELW A;  4I42 A;  4KPK A;  1HNU A;  1XX4 A;  2A81 A;  3JU1 A;  1UYS A;  4GHN A;  4JVT A;  3GF3 A;  3ZWA A;  2ZQQ A;  2WTB A;  4GM2 A;  3RSI A;  5KDR A;  2A7K A;  4YLH A;  3TZ3 A;  5E0S A;  4WYO B;  2J5S A;  5G1Q A;  4IZD A;  4MI2 A;  1Y7O A;  5INI A;  2DUB A;  4I4Z A;  4U0H A;  3HP0 A;  4JCQ A;  3IB9 A;  3KTK A;  3KQF A;  3SWX A;  2FBM A;  3TRR A;  4ZDE A;  2ZL4 A;  1FC7 A;  4U18 A;  2VSU C;  3V5E A;  4U0G H;  4K3W A;  5KJP A;  4MOU A;  3BPP A;  4B3J A;  3NJD A;  2F9I B;  2EJ5 A;  3M6M A;  2C8T A;  5ING A;  1OD4 A;  3T8B A;  1SZO A;  1FC6 A;  2VSU F;  3KTJ A;  4OLQ A;  5JBW A;  5G1S A;  4RYF H;  4K2N A;  5C9G A;  3TV5 A;  3BF0 A;  3K50 A;  2F9Y A;  4Z0M A;  3ST9 A;  1MJ3 A;  4JJT A;  4FZW A;  3QYR A;  3SLL A;  3I47 A;  4FN8 A;  1XO6 A;  3R9Q A;  5CTC A;  5JBX A;  2ZL2 A;  4U0G A;  3IBB A;  3GMA A;  1JXZ A;  3QXI A;  4JOT A;  4JSB A;  3ZW9 A;  5DUF A;  1EF9 A;  3ZW8 A;  3Q0J A;  4NNQ A;  3QWD A;  4JCR A;  3TVW A;  2Q34 A;  3U9T B;  2NP9 A;  1TG6 A;  5DUC A;  3R9T A;  2Q35 A;  3Q1T A;  2Q2X A;  4JYL A;  4WCZ A;  1HZD A;  1UYT A;  3ZWC A;  1ON3 A;  3T3W A;  2X24 A;  1WZ8 A;  3GF7 A;  2CE3 A;  3G64 A;  5FIF A;  4QIJ A;  1N6D A;  4Q0G A;  2CBY A;  2HW5 A;  3PZK A;  1YG6 A;  3MYB A;  1Q52 A;  4QII A;  5DTW A;  5DKP A;  1Q51 A;  2J5I B;  3LAO A;  3KTH A;  4RYF A;  1OD2 A;  2PG8 A;  3FDU A;  1N6E A;  2D3T A;  3L3S A;  2VX2 A;  3QMJ A;  3T89 A;  1K32 A;  3R6H A;  2ZQR A;  4ELX A;  4L6W A;  5DZK A;  3MT6 A;  5MGB A;  5DU4 A;  5E0S H;  4JCS A;  3PGQ A;  1EF8 A;  4B3H A;  3MOY A;  3H81 A;  4ELS A;  3N6R B;  1FC9 A;  3P5M A;  4FJW D;  1W2X A;  2ZL0 A;  3HLN 1;  3H02 A;  4ASI A;  4B3I A;  3QXZ A;  4ZDD A;  1WDM A;  2VSS A;  4FZW C;  4KWB A;  1J7X A;  1PIX A;  3OC7 A;  5G1R A;  3NJB A;  2VSU A;  1VRG A;  4JWV A;  1ON9 A;  2J5I I;  3P2L A;  1UYV A;  1X0U A;  2VRE A;  3H0J A;  4Q1I A;  3ZWB A;  2PBP A;  3TVU A;  4WZ8 B;  3PEA A;  4ZDC A;  3H0U A;  3Q0G A;  1NZY A;  3M6N A;  2F6Q A;  3R9S A;  4DI1 A;  3HIN A;  3OME A;  2FW2 A;  3V5I A;  2X58 A;  2J5I A;  3DOR A;  3TDC A;  3MFM A;  1FCF A;  3GLM A;  3H0S A;  1XNW A;  1PJH A;  3BEZ A;  4JFC A;  4HNK A;  4EMM A;  2BZR A;  4ZU2 A;  5IKL B;  1K39 A;  2J5G A;  2PPY A;  2IEX A;  2A7S A;  1DUB A;  4OMR A;  4ZDF A;  4FB8 A;  1N6F A;  2FZS A;  4FNB A;  3OT6 A;  4MXI A;  4EML A;  3DJA A;  3U9S B;  3GKB A;  2QQ3 A;  4RCN A;  5FUS A;  3FF6 A;  3LKE A;  3HRX A;  1DCI A;  5DTP A;  5DU8 A;  5KDR B;  1WDL A;  3RRV A;  1UYR A;  3KTG A;  3U9R B;  3Q7H A;  3HE2 A;  1XNV A;  3T88 A;  2UZF A;  4IZB A;  3PE8 A;  4JYJ A;  2ZL3 A;  4K29 A;  1UIY A;  3K8X A;  4KNP A;  4U19 A;  1O8U A;  2DEO A;  2F9Y B;  2VSU E;  4JCT A;  4FN7 A;  3IAV A;  2GTR A;  4I52 A;  5CTB A;  1NZY B;  3VIV A;  4FND A;  4L8K A;  3P85 A;  4QFE A;  1RJM A;  3QRE A;  5E0N X;  1HNO A; 
#chains in the Genus database with same CATH topology
 3T8A A;  4NEK A;  3H0Q A;  5HUQ A;  2F9I A;  4HC8 A;  1YG8 A;  3TT6 A;  5DL1 A;  1SG4 A;  1XNY A;  2J5G D;  1WDK A;  3TT7 A;  4U1A A;  4OG1 A;  2W3P A;  4F47 A;  3TLF A;  1TYF A;  3WG5 A;  3RST A;  4HDT A;  4LK5 A;  5C90 A;  3STA A;  4NAR A;  2F6I A;  4IZC A;  2VSS E;  1RJN A;  3KTI A;  1EY3 A;  5DU6 A;  2VSS F;  3QKA A;  4G2R A;  3QK8 A;  3R0O A;  3ISA A;  4KD6 A;  5DZK H;  4ZDB A;  5INF A;  4EMP A;  4ELW A;  4I42 A;  4KPK A;  1HNU A;  1XX4 A;  4J2U A;  3BPT A;  2A81 A;  3JU1 A;  1UYS A;  4GHN A;  4JVT A;  3GF3 A;  3ZWA A;  2ZQQ A;  2WTB A;  4GM2 A;  3RSI A;  5KDR A;  2A7K A;  4YLH A;  3TZ3 A;  5E0S A;  4WYO B;  2J5S A;  5G1Q A;  4IZD A;  4MI2 A;  1Y7O A;  5INI A;  2DUB A;  4I4Z A;  4U0H A;  3HP0 A;  4JCQ A;  3IB9 A;  3KTK A;  3KQF A;  3SWX A;  2FBM A;  3TRR A;  4ZDE A;  2ZL4 A;  1FC7 A;  4U18 A;  2VSU C;  3V5E A;  4U0G H;  4K3W A;  5KJP A;  4MOU A;  3BPP A;  4B3J A;  3NJD A;  2F9I B;  2EJ5 A;  3M6M A;  2C8T A;  5ING A;  1OD4 A;  3T8B A;  1SZO A;  1FC6 A;  2VSU F;  3KTJ A;  4OLQ A;  5JBW A;  5G1S A;  4RYF H;  4K2N A;  5C9G A;  3TV5 A;  3BF0 A;  3K50 A;  2F9Y A;  4Z0M A;  3ST9 A;  1MJ3 A;  4JJT A;  4FZW A;  3QYR A;  3SLL A;  3I47 A;  4FN8 A;  1XO6 A;  3R9Q A;  5CTC A;  5JBX A;  2ZL2 A;  4U0G A;  3IBB A;  3GMA A;  1JXZ A;  3QXI A;  4JOT A;  4JSB A;  3ZW9 A;  5DUF A;  1EF9 A;  3ZW8 A;  3Q0J A;  4NNQ A;  3QWD A;  4JCR A;  3TVW A;  2Q34 A;  3U9T B;  2NP9 A;  1TG6 A;  5DUC A;  3R9T A;  2Q35 A;  3Q1T A;  2Q2X A;  4JYL A;  4WCZ A;  1HZD A;  1UYT A;  3ZWC A;  1ON3 A;  3T3W A;  2X24 A;  1WZ8 A;  3GF7 A;  2CE3 A;  3G64 A;  5FIF A;  4QIJ A;  1N6D A;  4Q0G A;  2CBY A;  2HW5 A;  3PZK A;  1YG6 A;  3MYB A;  1Q52 A;  4QII A;  5DTW A;  5DKP A;  1Q51 A;  2J5I B;  3LAO A;  3KTH A;  4RYF A;  1OD2 A;  2PG8 A;  3FDU A;  1N6E A;  2D3T A;  3L3S A;  2VX2 A;  3QMJ A;  3T89 A;  1K32 A;  3R6H A;  2ZQR A;  4ELX A;  4L6W A;  5DZK A;  3MT6 A;  5MGB A;  5DU4 A;  2YJG A;  5E0S H;  4JCS A;  3PGQ A;  1EF8 A;  4B3H A;  3MOY A;  3H81 A;  4ELS A;  3N6R B;  1FC9 A;  3P5M A;  4FJW D;  1W2X A;  2ZL0 A;  3HLN 1;  3H02 A;  4ASI A;  4B3I A;  3QXZ A;  4ZDD A;  1WDM A;  2VSS A;  4FZW C;  4KWB A;  1J7X A;  1PIX A;  3OC7 A;  5G1R A;  3NJB A;  2VSU A;  1VRG A;  4JWV A;  1ON9 A;  2J5I I;  3P2L A;  1UYV A;  1X0U A;  2VRE A;  3H0J A;  4Q1I A;  3ZWB A;  2PBP A;  3TVU A;  4WZ8 B;  3PEA A;  4ZDC A;  3H0U A;  3Q0G A;  1NZY A;  3M6N A;  2F6Q A;  3R9S A;  4DI1 A;  3HIN A;  3OME A;  2FW2 A;  3V5I A;  2X58 A;  2J5I A;  3DOR A;  3TDC A;  3MFM A;  1FCF A;  3GLM A;  3H0S A;  1XNW A;  1PJH A;  3BEZ A;  4JFC A;  4HNK A;  4EMM A;  2BZR A;  4ZU2 A;  5IKL B;  1K39 A;  2J5G A;  2PPY A;  2IEX A;  2A7S A;  1DUB A;  4OMR A;  4ZDF A;  4FB8 A;  1N6F A;  2FZS A;  4FNB A;  3OT6 A;  4MXI A;  4EML A;  3DJA A;  3U9S B;  3GKB A;  2QQ3 A;  4RCN A;  5FUS A;  3FF6 A;  3LKE A;  3HRX A;  1DCI A;  5DTP A;  5DU8 A;  5KDR B;  1WDL A;  3RRV A;  1UYR A;  3KTG A;  3U9R B;  3Q7H A;  3HE2 A;  1XNV A;  3T88 A;  2UZF A;  4IZB A;  3PE8 A;  4JYJ A;  2ZL3 A;  4K29 A;  1UIY A;  3K8X A;  4KNP A;  4U19 A;  1O8U A;  2DEO A;  2F9Y B;  2VSU E;  4JCT A;  4FN7 A;  3IAV A;  2GTR A;  4I52 A;  5CTB A;  1NZY B;  3VIV A;  4FND A;  4L8K A;  3P85 A;  4QFE A;  1RJM A;  3QRE A;  5E0N X;  1HNO A; 
#chains in the Genus database with same CATH homology
 3T8A A;  4NEK A;  3H0Q A;  5HUQ A;  2F9I A;  4HC8 A;  1YG8 A;  3TT6 A;  5DL1 A;  1SG4 A;  1XNY A;  2J5G D;  1WDK A;  3TT7 A;  4U1A A;  4OG1 A;  2W3P A;  4F47 A;  3TLF A;  1TYF A;  3WG5 A;  3RST A;  4HDT A;  4LK5 A;  5C90 A;  3STA A;  4NAR A;  2F6I A;  4IZC A;  2VSS E;  1RJN A;  3KTI A;  1EY3 A;  5DU6 A;  2VSS F;  3QKA A;  4G2R A;  3QK8 A;  3R0O A;  3ISA A;  4KD6 A;  5DZK H;  4ZDB A;  5INF A;  4EMP A;  4ELW A;  4I42 A;  4KPK A;  1HNU A;  1XX4 A;  4J2U A;  3BPT A;  2A81 A;  3JU1 A;  1UYS A;  4GHN A;  4JVT A;  3GF3 A;  3ZWA A;  2ZQQ A;  2WTB A;  4GM2 A;  3RSI A;  5KDR A;  2A7K A;  4YLH A;  3TZ3 A;  5E0S A;  4WYO B;  2J5S A;  5G1Q A;  4IZD A;  4MI2 A;  1Y7O A;  5INI A;  2DUB A;  4I4Z A;  4U0H A;  3HP0 A;  4JCQ A;  3IB9 A;  3KTK A;  3KQF A;  3SWX A;  2FBM A;  3TRR A;  4ZDE A;  2ZL4 A;  1FC7 A;  4U18 A;  2VSU C;  3V5E A;  4U0G H;  4K3W A;  5KJP A;  4MOU A;  3BPP A;  4B3J A;  3NJD A;  2F9I B;  2EJ5 A;  3M6M A;  2C8T A;  5ING A;  1OD4 A;  3T8B A;  1SZO A;  1FC6 A;  2VSU F;  3KTJ A;  4OLQ A;  5JBW A;  5G1S A;  4RYF H;  4K2N A;  5C9G A;  3TV5 A;  3BF0 A;  3K50 A;  2F9Y A;  4Z0M A;  3ST9 A;  1MJ3 A;  4JJT A;  4FZW A;  3QYR A;  3SLL A;  3I47 A;  4FN8 A;  1XO6 A;  3R9Q A;  5CTC A;  5JBX A;  2ZL2 A;  4U0G A;  3IBB A;  3GMA A;  1JXZ A;  3QXI A;  4JOT A;  4JSB A;  3ZW9 A;  5DUF A;  1EF9 A;  3ZW8 A;  3Q0J A;  4NNQ A;  3QWD A;  4JCR A;  3TVW A;  2Q34 A;  3U9T B;  2NP9 A;  1TG6 A;  5DUC A;  3R9T A;  2Q35 A;  3Q1T A;  2Q2X A;  4JYL A;  4WCZ A;  1HZD A;  1UYT A;  3ZWC A;  1ON3 A;  3T3W A;  2X24 A;  1WZ8 A;  3GF7 A;  2CE3 A;  3G64 A;  5FIF A;  4QIJ A;  1N6D A;  4Q0G A;  2CBY A;  2HW5 A;  3PZK A;  1YG6 A;  3MYB A;  1Q52 A;  4QII A;  5DTW A;  5DKP A;  1Q51 A;  2J5I B;  3LAO A;  3KTH A;  4RYF A;  1OD2 A;  2PG8 A;  3FDU A;  1N6E A;  2D3T A;  3L3S A;  2VX2 A;  3QMJ A;  3T89 A;  1K32 A;  3R6H A;  2ZQR A;  4ELX A;  4L6W A;  5DZK A;  3MT6 A;  5MGB A;  5DU4 A;  2YJG A;  5E0S H;  4JCS A;  3PGQ A;  1EF8 A;  4B3H A;  3MOY A;  3H81 A;  4ELS A;  3N6R B;  1FC9 A;  3P5M A;  4FJW D;  1W2X A;  2ZL0 A;  3HLN 1;  3H02 A;  4ASI A;  4B3I A;  3QXZ A;  4ZDD A;  1WDM A;  2VSS A;  4FZW C;  4KWB A;  1J7X A;  1PIX A;  3OC7 A;  5G1R A;  3NJB A;  2VSU A;  1VRG A;  4JWV A;  1ON9 A;  2J5I I;  3P2L A;  1UYV A;  1X0U A;  2VRE A;  3H0J A;  4Q1I A;  3ZWB A;  2PBP A;  3TVU A;  4WZ8 B;  3PEA A;  4ZDC A;  3H0U A;  3Q0G A;  1NZY A;  3M6N A;  2F6Q A;  3R9S A;  4DI1 A;  3HIN A;  3OME A;  2FW2 A;  3V5I A;  2X58 A;  2J5I A;  3DOR A;  3TDC A;  3MFM A;  1FCF A;  3GLM A;  3H0S A;  1XNW A;  1PJH A;  3BEZ A;  4JFC A;  4HNK A;  4EMM A;  2BZR A;  4ZU2 A;  5IKL B;  1K39 A;  2J5G A;  2PPY A;  2IEX A;  2A7S A;  1DUB A;  4OMR A;  4ZDF A;  4FB8 A;  1N6F A;  2FZS A;  4FNB A;  3OT6 A;  4MXI A;  4EML A;  3DJA A;  3U9S B;  3GKB A;  2QQ3 A;  4RCN A;  5FUS A;  3FF6 A;  3LKE A;  3HRX A;  1DCI A;  5DTP A;  5DU8 A;  5KDR B;  1WDL A;  3RRV A;  1UYR A;  3KTG A;  3U9R B;  3Q7H A;  3HE2 A;  1XNV A;  3T88 A;  2UZF A;  4IZB A;  3PE8 A;  4JYJ A;  2ZL3 A;  4K29 A;  1UIY A;  3K8X A;  4KNP A;  4U19 A;  1O8U A;  2DEO A;  2F9Y B;  2VSU E;  4JCT A;  4FN7 A;  3IAV A;  2GTR A;  4I52 A;  5CTB A;  1NZY B;  3VIV A;  4FND A;  4L8K A;  3P85 A;  4QFE A;  1RJM A;  3QRE A;  5E0N X;  1HNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...