2F9PA

Crystal structure of the recombinant human alpha i tryptase mutant d216g in complex with leupeptin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha-1
publication title X-ray Structures of Free and Leupeptin-complexed Human alpha I-Tryptase Mutants: Indication for an alpha to beta-Tryptase Transition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9pA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9pA01
3K6ZA 5DPAA 1QB6A 5JBAS 1A0JA 2VNTA 2M5TA 3ATKA 1P02A 1FY5A 3P8OA 4NZLA 1DWBH 1O2GH 8LPRA 2PUXB 1JIRA 4X1QU 4GSOA 1QBVH 3RXFA 5E2OA 3NPSA 1YPLH 2CGAA 2BQWB 1TMTH 2W26A 1HJ8A 1V2NT 5A8YA 3VB3A 1Y3XA 2G00A 2SGDE 5E0HA 1SI5H 2JETB 1TMUH 1DFPA 1O2ZA 3RMMH 3MNXA 3SU2A 1GCTC 1YC0A 1XX9A 3BV9B 3A85A 3VB6A 4X8SH 2J95A 1F5LA 1ELCA 1FNIA 1QBNA 9ESTA 4IMQA 3TJUA 1F7ZA 1G30B 1LVYA 3UNQA 4ZHMU 2A0QB 1C2LA 4A1VA 1ZLRA 3LC5A 1YPEH 5DP3A 2BYAX 4X1RU 4SGAE 2Y82A 3S7KB 2PGBB 4FUBA 4R0IA 1D3DB 3UY9A 4WJG2 1TQ7B 1CO7E 1UTQA 2G55A 2PTCE 1OWHA 1RGQA 1TWXB 1ZMJA 2ZF0H 1LTOA 3T25A 1C5RA 3U8TH 2SGQE 4AN7A 3TH4H 1HCGA 1WTGH 2ZHEH 1V2UT 2A2QH 2BLQA 2OQUA 4MPWA 1WTHD 2JH5D 1FAXA 4X6PA 4IN2A 2C93B 3T5FH 5SGAE 2A7CA 2R9PA 2ZFTA 1PFXC 1QQUA 2GVFA 1GJ7B 5GCHG 3ZZBA 5AFZH 1AB9B 1DPOA 3DD2H 1P2MA 2CHAC 1SHHB 7ESTE 2ZFSA 1XVOA 1A3EH 4TWYA 1H4WA 4O3UA 3QUMP 3QX5H 1P2IA 1S82A 3O8RA 4FVBA 3BG8A 1Z1IA 1TABE 2GDDA 1O2VA 1QB9A 2ZEBA 4K1EA 2BVXH 2P3FH 1L4DA 3O8CA 2HALA 1GI5A 2TRMA 2WPKS 1HXEH 4XOJA 1TGNA 4E7NA 3GICB 1EATA 1O5DH 5GPIB 1O38A 1KLJH 4FU7A 1L1JA 1TPOA 2ZU1A 1VZQH 2G52A 2JKHA 2UUYA 3GCTF 1O5EH 4WVPE 3LC3A 1MTUA 1EZSC 1WAYB 2HNTF 3V13A 3RXSA 1IQJA 1SSXA 2RDLA 1P12E 1GCDA 1Y3YA 2GT8A 2BXTH 1BMAA 1G3DA 1KXEA 2XBYA 1V3XA 1BTWA 3M3SA 2ZGBH 1HAPH 4ISIH 1O3PB 3LIWA 1TNJA 4AX9H 1ANBA 5IYTA 2FOEA 2OD3B 1EX3A 1UO6A 3B9FH 4FVDA 2JH6D 3A88A 1DM4B 2ZDNA 4XDEA 5EQSA 3RDZA 3VB5A 1UTNA 3PMAB 5FX5A 4BAHB 1TGSZ 4JK6A 2CMYA 1G3CA 1EASA 1TBRH 2FTMA 1KSNA 4A5TS 2ZDVH 3RP2A 2RA3A 2I6QA 1OWKA 5EOKA 4ABIA 3RXBA 2Z9JA 2O9QA 1IQGA 1PPFE 1LHEH 2B8OH 3FFGA 1TNGA 1C1PA 1DY9A 1FY1A 4DURA 4TYDA 3K2UA 1HAZB 2BVRH 2OUAA 2OCVB 3SGBE 3ZVDA 5EPNA 1SGRE 4UFDH 1C5WB 2OC7A 1J16A 1OX1A 1C2KA 1HJ9A 3MH4A 4JZDH 3S9AA 5AFYH 2PSXA 1V2RT 1C9TA 3HK3B 4HGCA 1NT1A 4GPGA 1IQFA 1J17T 2A2XH 5C5NA 3D62A 2PW8H 2YOLA 1PPBH 2PGQB 2DUCA 4ZKNU 1TNHA 2HRVA 3MNCA 1YCPH 3K6YA 2QY0B 4NG9H 2ZGHA 3L3TA 4X8TH 1ELEE 3FP6E 3TJOA 1O2IA 1RTLA 2Z9GA 1J8AA 1TX7A 1K22H 2C4FH 4WF8A 4Q2KA 3SV7A 2BDIA 2UUFB 1O3NA 1DDJA 1QR3E 1SGPE 3NXPA 3RC4A 3T28A 1VR1H 1QRXA 4E06H 2C8ZB 3SJIA 1ORFA 1ESBA 2GZ8A 1TNLA 2SGEE 1G2LA 5T6FA 1BRUP 4AORA 3QZRA 2PKAB 2EC9H 1PQ8A 1INCA 1O3EA 1TRYA 3PTNA 2AEIH 2FWWA 4FUEA 1C2GA 3DFJA 3KEEA 3PB1E 2BDHA 5J4SA 1BTUA 3SV6A 1HRTH 1WV7H 2FEQH 3LPRA 3LH3A 1UK2A 2O8UA 4K3JA 2NU0E 1SOZA 1BJUA 3MFJA 4IMZA 3QO6A 4YO9A 3TLOA 2PSYA 3MI4A 1OOKB 4Q7ZA 2ILNA 3RXIA 1BRCE 4U30A 2PLXA 2BVSH 4OGXA 1TPSA 2P95A 2O8WA 3PMBB 1O2RA 1QL9A 4A92A 1QGFA 2AMQA 1IQNA 1K1MA 1S6HA 1ANEA 1UHBB 1Q31A 1C5XB 3GYLB 2RG3A 1S5SA 3ZZ9A 5A09A 5LH8A 3F9FA 2RA0A 3E1XB 4FUJA 4DW2U 1YPHC 3ZZAA 1QJ1B 5ESBA 1GBIA 1RS0A 3UOUA 1IQEA 5EW2H 1GDUA 2R0LA 1BRAA 5TJXA 3RXOA 1V2VT 4FUFA 3RC5A 1L2EA 4B2AA 1EJMA 1KXCA 1W11U 2CJIA 3FANA 1GJDB 1BA8B 1GI9B 1OPHB 1V2PT 3UREA 4LK4A 3URDA 1N8OB 1GBLA 1E0FD 1MKXH 2YNBA 5E2PA 1E37B 3DHKH 4Y79A 3P8GA 1P2OA 3P8NA 1K1LA 1ZRBA 1YKTA 1NRNH 4FUIA 3VFEA 3TITA 2WPMS 3U8OH 1G3BA 1O2YA 2B9LA 4QT8C 1PPCE 5JBCS 1ETRH 4NWLA 4X1NU 1THPB 2VIDA 3TPIZ 2ZHWH 3QK1A 1IHSH 1AU8A 4BNRA 2OQ5A 3M7QA 4MNYA 2BD3A 1FPHH 1L1NA 3LDXH 4WXIA 1EPTC 1O3MA 1HLTH 2J38A 5FHTA 2I6SA 1C1OA 1KXAA 4ZUHA 1C5VA 1QRWA 4K2YA 4BANB 2BDAA 2ESTE 1NRRH 3RXRA 1QB1A 1O39A 3O8BA 3RXLA 4Y0YE 3E6PH 1MKWK 3OU0A 1GWAA 1NRSH 4K1TA 1NROH 4BXWA 2GKVE 2F83A 2R2MB 3SUGA 1H1BA 1QA7A 2FOHA 3MO6A 1ZTJA 2QGRA 5CHAC 1ABIH 1LQEA 3BG4C 1RJXB 1H9IE 1WU1A 4BTIB 1NN6A 2AGIX 1THRH 5FPTA 5C1XA 2ODYB 2ZFPH 1CSOE 1MQ6A 1P2QA 4DIIH 4DG4A 1YPMH 1EZQA 1OWDA 3C27B 1BIOA 4AGJA 3E0PB 1C2HA 1PQAA 5EPYA 3ZV8A 5JB8S 5LPRA 1GHAF 2KAIA 4NWKA 4BAKB 1C5TA 5DGJA 3RXDA 4BOHA 2FOBA 5GDSH 1GMCG 4JYTA 2GCHF 5A0BA 2F9OA 1EB1H 3S7HB 3AVZA 3EA9A 1PJPA 1W14U 2P59A 3BEIB 3M5OA 1GMHF 1SGTA 1OKXA 4INKA 2V35A 2FS8A 1QURH 1TMBH 3TH3H 2WYJA 1IQLA 4AZ2B 2H6MA 3BTDE 4FUGA 1Z7KA 2ZHDA 1ZMLA 3PWBA 1W7GH 5H4IB 1KY9A 3SUEA 1NO9H 3RXMA 2GDEH 2Z9LA 2PKSB 1A0LA 1OWEA 4FUDA 3E3TA 2AGEX 1PQ7A 3SU6A 5LGOA 1UTMA 1V2WT 5EG4A 1O3OA 3TJVA 2AGGX 1SGQE 2UWOA 3S0NA 1OXGA 6CHAB 2FZZA 3MO9A 1P0SH 1GI0A 4ABDA 1BTXA 1P2NA 5TCAA 3F9HA 3EA7A 1XUGA 2BY9X 3JZ2B 1SLXB 1P03A 1P3CA 3RMLH 4D7GA 1N6XA 1SQOA 1HAIH 2ZC9H 4X6OA 1K1PA 3PMJA 1B5GH 1K1NA 1WOFA 1YPHE 2D26C 3LGUA 4I8LA 5LPFA 2ZKSA 1VJ9U 3GY5A 5IDKA 1DLEA 2FI4E 4JMYA 1UCYE 3GY3A 4B74A 4PROA 4Y76A 2BHGA 3E90B 2ZI2H 4UD9H 2WINI 4B75A 1BMLA 2ANKH 2ZGXH 2GGVB 3EQ0H 1TX6A 1NU7B 2IOTA 2W7SA 3RU4T 1CGJE 1QL8A 5C3NA 1UVUH 3BF6H 3UIRA 2FP7B 1P04A 1GHZA 5EXLA 2PV9B 3UR6A 3PWCA 4BTTB 1V2OT 1W10U 1SHYA 3AAUA 4GLYA 1KLTA 4CHAC 2EI6A 1O2QA 4BAQB 2DE8A 1A4WH 3LT3A 2Y5FA 1GHVH 1DUEA 1SLWB 1Z8GA 4GHTA 1NU9A 2ZCLP 3RMNH 4B73A 1YLDA 6GCHF 1YBWA 2FTLE 2J9NA 4CR5A 3AW0A 1MD8A 2FS9A 1ZR0A 1MTNB 1PYTC 1UCYH 3TGIE 2NU4E 1HB0B 3M5MA 3PO1B 2R0KA 2QC2A 2H9HA 1O3KA 2VB0A 1QHRB 1O3DA 2ZGCA 1SGEE 4MPUA 3BEFB 4ZKSU 1W2KH 1CU1A 3H7OA 1MTWA 3M7UA 4O3TA 5ETXA 2VIOA 4NIWA 3MH6A 4AB8A 4X6MA 2JETC 4BAMB 3U1JB 5F8XA 2BZAA 3M7TA 3CS0A 1XM1A 5FPSA 8GCHF 1BBRK 1G36A 4Q7XA 1LO6A 1TNIA 1F5RA 1G37A 2C3SA 1O37A 2TIOA 1GBTA 3A8BA 5FCKA 1EB2A 1ZMNA 3URCA 2GMTB 1FY8E 1GL1A 2A1DB 1K21H 4IS5A 2LPRA 1EQ9A 5EQQA 2PFEA 2TGTA 1JBUH 1HBTH 2FODA 2UWPA 2F9UA 2A5IA 5EXNA 1Y8TA 1ZPZA 1GJ6A 1NC6A 2VGCC 1V2QT 3SGQE 3L33A 2GV6A 2XBXA 3U9AH 1O2XA 2Q6DA 3T2NA 1QTFA 1DVAH 4FUHA 2WPLS 3IWMA 4ABGA 1K1IA 1HNEE 1XXFA 1CGHA 4AFZA 4BAOB 3RXEA 3LOXA 1GHBG 2ZTZA 4U32A 1Q3XA 4OS2A 2ZU5A 3SI4H 4Y8XA 1SLVB 4GCHG 1D9IA 1S85A 4B2BA 3RMOH 2H9EH 1IHTH 5FCRA 1BJVA 2GV7A 3U69H 1AHTH 2FOFA 1FXYA 5T6GA 1TGTA 3SJOA 2XCNA 3OSYA 2H9TH 1T4VH 1D6WA 4ISOA 2ZTXA 3TVJB 1SLUB 5A2MH 2HLCA 2NWNA 3EAJA 1DT2A 5E0JA 1C5PA 3A7VA 1FMGA 3LONA 3VEQB 5HM9A 1HUTH 1OYTH 2UUKB 4BXSA 1Y5BT 2IN2A 1HAVA 1YPJH 5EQRA 1LHDH 1ARBA 2XC4A 4FXGH 1EUFA 1WQVH 2XWBI 1CT0E 1BZXE 3ENSB 4IBLH 3UWIA 1MAYA 3PLBA 5E0GA 3G01A 9LPRA 1GCTB 3I78A 1AY6H 2PTNA 4MDSA 3RXHA 1C4U2 4NCYA 1BTYA 1O2UA 3ZYDA 1TA2A 2QXGA 4D7FA 3SV2H 2CF8H 1DWDH 2Y5GA 3Q00A 2F3CE 1GDQA 1FONA 4X2YA 2BDCA 1O5BB 3ZZ6A 4RKJB 4UDWH 2BD2A 5T3HA 2ASUB 1D3QB 2KAIB 7GCHG 2HVXA 4K5ZA 4Y6DA 4JZFH 1GGDC 3H7TA 3EE0B 1S0QA 4OS5A 2QAAA 4CH2B 2CXVA 3JZ1B 3HGPA 1ZSJA 2BD8A 4WWYA 2TPIZ 2STBE 4MNVA 4FUCA 3SNCA 1TA6A 5C1YA 4E05H 3SV9A 2FLBH 1FN6A 3IG6B 2Y81A 1KIGH 1IQKA 3S9BA 1AIXH 1KTSB 3RU4E 1C4Y2 2ODQA 2P8OC 4XSKU 3SU5A 2GX4A 1VITG 1SGNE 5I46H 3VB4A 1Y5UT 4MPVA 3SUDA 2VINA 1M9UA 2AERH 1S83A 1MZDA 1O3BA 2ULLA 3M35A 1AUJA 3KGPA 4WMDA 2VIQA 4WH8A 3SU0A 4TWWA 3ATIA 1TGCA 1SMFE 5JBTA 1XUJA 3ZVGA 2BLOA 1A5HA 1D6RA 1GMDG 1GBBA 1BUIA 1AZ8A 1W8BH 2XYAA 1HIAA 1C2MA 2XTTB 4F4OC 1T8LA 2FDAA 1ANCA 3KQBA 4XE4A 1U6QA 1GBDA 1O3CA 4UFFH 4U01A 4DT7B 2F9VA 3LGIA 3KIDU 4NA7A 1XVMA 3MU1A 4ESTE 1F0TA 4RN6A 2ZDMA 4A1XA 1FQ3A 1ESTA 1O31A 3M36A 2Z7FE 1FIWA 1ZYOA 1QQ4A 1UK4A 2XNIA 1O36A 2HOBA 3GCOA 1SB1H 2A5KA 1AUTC 1NY22 1UMAH 3GDVA 3D23A 1KXDA 1TRNA 3SQEE 2BQ6B 3Q3YA 3SNBA 1EAWA 4AB9A 3MH7A 1C2EA 1C4V2 1LPKB 3PYHA 1B0EA 4A6LA 2HPPH 1ZZZA 1TPPA 2QCYA 4X6NA 1F0RA 2GCTC 1NRQH 1PPEE 3E8LA 5FXLA 3RXQA 5DKMA 3KL6A 1FV9A 2EI7A 1O32A 2J94A 4WMEA 4OS4A 1L4ZA 1ZTLA 3P92A 3RXCA 4Y7BA 4YZUA 1CHOG 1ZHMA 4I31A 3EGKH 1C5NH 2FXRA 2GD4B 1ZOMA 2G5NA 2VU8E 1C5YB 3TK6A 2XC5A 2ANYA 1LVMA 2OXSA 1C5UA 1V2JT 2BY6X 3STJA 3VXEH 2QXHA 1FY3A 1TIOA 2A31A 4YTAA 2SGPE 4X2VA 8ESTE 4B71A 2ZTYA 1ZPCA 2BY7X 4WXVA 2Z3EA 1T8MA 2Y5HA 1GI2A 4LZ1H 2ZG0H 4NA9H 1ELDE 1GG6C 5F6MA 2QA9E 4Q80A 1P09A 3T26A 1EXFA 2Z6BD 3L6PA 1WQSA 3RC6A 4Y10E 1J15A 5JB9S 5JBBS 3F9GA 3GY8A 1RIWB 4THNH 2ODPA 2WV4A 3MTYA 3T29A 3NUMA 2Y7XA 1YCPK 1N8OC 1VGCC 1KXFA 4D9QA 3EDXB 4ZH8A 2PWXA 1D4PB 1GBCA 1MZAA 2D8WA 3UQOA 2A4QA 4H4FA 2A45B 4J2YB 4WMFA 2G51A 2Z9KA 4OS7A 1GI3A 1HFDA 3UPEA 1JIMA 1Y3UA 1E36B 1LQDB 3KQCA 7KMEH 1AVWA 1TOMH 1P57B 2ZHQH 1ZHPA 1LKAA 2OINA 2SNVA 3VGCB 1CT4E 1JMOH 3FZZA 3RXJA 4KGAA 1AVXA 1BQYA 1F92A 2ZECA 2ZA5A 2R3UA 1TGBA 4I33A 2F9BH 3RLWH 3SHAH 2BZ6H 2SNWA 4NA8A 1AE8H 1WYKA 3M3VA 3SHCH 2FI5E 1BTPA 3OYPA 1T32A 4ZAEA 4DVAU 4AYVB 1WUNH 4IN1A 4TY6A 1B7XB 1ZRKA 5L2ZH 1GI4A 2A32A 3D49H 1DICA 3BTME 3A86A 2AS9A 4I32A 4RKOB 5BRRE 1DY8A 4AFSA 3UNRA 3IITA 2AMPA 1FZZA 1THSH 2F91A 2Z3CA 2O8LA 1BTHH 3BTEE 1GJBB 5ABWA 2ZDKA 3VB7A 3BTQE 3FP7E 4ISLA 3WY8A 1JRTA 1PPHE 1SGIB 1YCPM 1TLDA 1ZJKA 1HAVB 1O2JA 5AHGH 1O2OA 1MU6B 2VWNA 2VIPA 3MYWA 5AVDA 1O0DH 1QA0A 1VCWA 4NFEA 1OP8A 5HMAA 5TCCA 2WPJS 3ITIA 2BDYA 1TX8A 2OC0A 1RFNA 3ZVAA 3GCTG 4B1TA 4XBCA 2CN0H 1CQQA 1MBQA 1O5GH 3TJNA 2ANMH 1S81A 1V2ST 1MCTA 3QZQA 1LMWB 3HGNA 4X2WA 5ESTE 4JZIA 1FI8A 1MKXK 3P8FA 1HAGE 1C2DA 2NU3E 4NZQA 4D8NA 1YP9A 2BDBA 4AFQA 3BEUA 3A8CA 4Y0ZE 1NPMA 4YOGA 1C2IA 4OS6A 4H6TA 2QV1A 1HJAB 4CRCA 1O2WA 1EAUA 2ZO3H 1G2MA 4CH8B 4GVUA 4ABFA 2A4GA 2TBSA 1XMNB 1SOTA 2SGFE 2VVUA 3GY4A 4NIXA 1EPTB 3FVFB 1W0ZU 1Z71A 4CRAA 3QN7A 2ZFRH 1KXBA 1A61H 1CA0C 2B0FA 1K1JA 1H8DH 5GCHF 3SGAE 3ZZ3A 1CT2E 2B7DH 1BCUH 3SNEA 3GY6A 1AWFH 4KELA 5EW1H 3CENA 2BOHB 4LZ4B 1IQHA 2ALVA 1GHWH 3BG4B 3FP8E 2VJ1A 3EA8A 1OSSA 7LPRA 4OS1A 1W12U 4MG3A 1UTLM 3GCHC 2ZHFH 3BTWE 2XRCA 1NS3A 1BBRE 2XWAA 4YESB 3Q3KA 2VIVA 4X8UH 1UTPA 1T7CA 3GY2A 2HPQH 3GY7A 1TYNA 2BD4A 3LJOA 1AWHB 1HGTH 1HPGA 4X8VH 1HYLA 1XKAC 4AG2A 4CRGA 2XC0A 1C1NA 3HK6B 3HATH 2QN5T 3A82A 1YM0A 3O8DA 1RRKA 2GTBA 2BX3A 3BN9A 1QY6A 3TU7H 3KNXA 3ODDA 2ZPSA 1DSUA 1HIAB 1O3IA 5FBEA 3BTKE 5PTPA 3U1IB 4O9VA 2Z94A 2B5TB 4VGCC 1FDPA 2BD5A 5G4BA 1C5SA 5A0CA 4DOQA 3SO3A 3UUZA 2OP9A 2FIRH 3PO1C 1XUFA 1XKBC 2VWOA 1ELTA 1BTZA 3T62A 4AOQA 2HNTC 1VJAU 1CBWC 2ZU3A 1QCPA 5T6DA 3LJJA 4NIVA 1W7XH 1RXPA 3BTFE 3V3MA 1V6DA 4WH6A 5GJ4B 2C8WB 1EP5A 3KF2A 3CS7A 1QFKH 4H42U 4AG1A 3SQHE 1C5MD 1LKBA 2VWLA 2VH0A 1V2KT 2O8TA 2VVCA 3CP7A 2BY5X 2FPZA 1GDNA 2QF3A 1P9UA 1Z6JH 3MH5A 3RUOA 5DP7A 4MPXA 2EA3A 1UTKA 2H1UA 4M7GA 1ACBE 3T27A 1O35A 4CREA 1LCYA 3ZZ7A 2WUCA 4NSVA 2OC8A 3UWJH 2F9PA 1O3GA 2ZWLH 2AIPA 1SPJA 1W0YH 2EI8A 1FY4A 3A83A 1K1OA 3HKJB 1HAOH 1AFQB 3SN8A 1GVLA 4INLA 1ZPBA 4X0WU 3N7OA 4DIHH 3NZIA 4UEHH 2CF9H 2OBQA 3OX7U 5E8EH 1EOLA 1DANH 1MCVA 1P9SA 3SI3H 3SORA 3ZYEA 1F0UA 4MNWA 3QLPH 4JCNA 5F8ZA 2A5AA 3ZZ8A 1C1RA 1DWCH 2BDGA 3RXTA 1ELAA 2JH0D 2UWLA 2OTVA 2FYRA 2H5DA 3NWUA 1FAKH 2P16A 1GJ8B 1ZSLA 3AASA 4Y8YA 1IOEA 3QGNB 3SUFA 1UVPA 3UNSA 3DUXH 1SVPA 1PQ5A 3LGVA 1FIZA 1JOUB 3TNSA 1Z8JB 1A1RA 3I77A 1H9LB 2BOKA 3ODFA 5C20A 4B2CA 3SJ9A 1AGJA 1ZHRA 4ZXYH 4SGBE 3RLYH 1UCYK 3ZVEA 1O2MA 1AKSA 3BIUH 3TNTA 1AVGH 1O3LA 4LOYH 1V2TT 4HFPB 4CR9A 1UVTH 2XW9A 3D65E 1O2SA 2IJOB 3RM0H 4WY3A 3SU4A 3ATWA 3S9CA 3B8JA 3V12A 1ETSH 1SL3A 1P2KA 1EP6A 5A8XA 4YT7H 1NFXA 1QBOA 1G32B 1SGCA 2VIWA 2W5EA 3HPTB 3TIUA 4H6SB 1GI1A 2D1JA 3C1KA 3F1SB 3I29A 2R2WU 3PV4A 1A0HB 1AB9C 1GBJA 1QJ6B 1GJ9B 1Z6EA 4TPIZ 1J9CH 3MNBA 4CBNA 3F9EA 1MUEB 1GBKA 8KME2 2V3HH 1UTOA 1BITA 1GBMA 4ABBA 2C90B 1GJAB 2BX4A 2OC1A 2ZCKP 4NIYA 3M61U 1O2LA 1NFUA 1AD8H 6ESTA 1P06A 1DX5M 1TE0A 1O2PA 2G4TA 1CA8B 4TPYA 4R8TB 1GHAG 2BTCE 1C1TA 2HNTE 1C2FA 3E16B 3A7TA 1HAYB 3P70B 2A7HA 2GCHG 3GISB 2ZGJA 3PM3A 2VGCB 1SGFG 4ZHAA 1GMHG 1TALA 1AZZA 1F0SA 2Q6GA 1T4UH 3B23B 2BMGB 2GT7A 3M5NA 2BLVA 2BQ7B 5K7RA 1P8VC 4ASHA 2G81E 1AMHA 1TONA 1O2HA 3BIVH 2V0BA 1BHXF 4TY7A 2D2DA 1MMJN 3K9XB 1AI8H 1LHCH 1O33A 1DWEH 4YLUA 2P3UB 1LVOA 3SZNA 3LKWA 3SBKA 1O2NA 3SNAA 1HXFH 3GDSA 1D3TB 1O5AB 5BPEA 1ELBA 3MHWU 1QJ7B 3PROA 1N6YA 2H5CA 3A8DA 1VCPA 1EPTA 3ZZCA 1Q2WA 2STAE 3A80A 3RXGA 3AW1A 3MOCA 2CV3A 3V0XA 1EJNA 2LNCA 2BD7A 1DE7H 1DXPA 2ZQ2A 2FOGA 1ELGA 4A1TA 3H5CB 1F2SE 1YF4A 1XUKA 3M3TA 3LGTA 1O2TA 1SGYE 4ZKRU 3LGYA 3RXUA 1ESAA 1GBAA 1HDTH 1GVKB 4LXBH 5EU8A 1OS8A 2CHAB 2Y80A 4X1PU 1GI8B 2G5VA 3SU1A 3ZV9A 5I25A 2FOMB 3W95A 3E0NB 4JYUH 1S0RA 1JXPA 1FN8A 1NRPH 1WBGB 2AIQA 1AN1E 2G8TA 1GVZA 4YT6H 3LH1A 4XFQA 3SW2B 4GAWA 1GMCF 2ZZUH 2PHBA 1ETTH 3OY5U 4DCDA 2A4OA 1H9HE 1KDQA 3BTHE 3FAOA 1BRBE 4I8JA 1T31A 1T8OA 1GGDB 4XBDA 1C1MA 1O5FH 4HTCH 4CRBA 1UVOA 2BXUH 1PPGE 2TGDA 4HI3A 1F5KU 3GDUA 6GCHG 4ISNA 1TPAE 1RTKA 1A2CH 3TK5A 3MWIU 2W3IA 4JK5A 2FOCA 2ZFQH 4FU9A 2P8OB 4I8GA 1D3PB 1NFWA 4KKDA 1DLKB 4RSPA 5FBIA 4GHQA 5L2YH 1BT7A 1K9OE 2QYIA 3QDZB 1TBZH 1OP2A 4CBOA 4Y11E 1CE5A 4CRDA 2FESH 2ZQ1A 3UQVA 1WSSH 1TOCB 1GJ5H 2GP9B 1A46H 1C5ZB 4Y8ZA 5DP9A 1CHGA 3A89A 4ABAA 4AFUA 5JYIA 2FX6A 2P94A 1CVWH 1GI6A 4YOIA 3ZZ5A 2HWLB 5C5OA 1ABJH 3K65B 2XBVA 1EZUC 1XUIA 4CRFA 3ZZ4A 1SC8U 4GUXA 2ANWA 1WCZA 1HV7A 3KN2A 3R0FA 8GCHG 1QRZA 2WUBA 1C5OH 1C1UH 4K8BA 1RIWC 1C5QA 4F49A 5DG6A 5DP5A 1TNKA 1OWJA 1T8NA 1Z8RA 1Y5AT 1ZTKA 2UUJB 1GHYH 2BLWA 1FPCH 1LPGB 3PLKA 2SGAA 1C1QA 5CMXH 2AMDA 1TRMA 3A81A 5A0AE 2C8YB 5CE1A 1FLEE 4OGYA 5JPMH 4IW4E 5DO4H 3A7XA 1P2JA 4INHA 3UOPA 2H2ZA 3STIA 2OBOA 5DK1A 3VGCC 2OLGA 2XBWA 3ZZDA 3A7YA 2WPHS 2FLRH 4KTCA 1O2KA 5EGMA 5F03A 1A5IA 1SBWA 2GCTB 1DS2E 3P6ZB 3SJKA 5L6NH 3ZVBA 4ABHA 1EOJA 2Q1JA 4AYYB 3TGKE 1SQTA 1P11E 3TH2H 3UTUH 2ALPA 4I8HA 4MLFB 1O3JA 4Y7AA 2XCFA 1TQ0B 2ZCHP 1TAWA 4HZHA 1K2I1 2J34A 4ISHH 1SFQB 4O03A 1JWTA 1UK3A 1IAUA 1NTPA 1W3CA 3V7TA 1XXDA 2VH6A 3LU9B 3P17H 3NKKA 4A7IB 3A8AA 3A87A 3A7WA 1CGIE 1AKSB 1S6FA 1YYY1 1LHFH 2WPIS 2F9NA 1MKWH 4DJZB 4ZHLU 1L1GA 5FPYA 2FX4A 1SR5C 2AFQB 2FMJA 3NK8A 4AGKA 1A5GH 1JRSA 1QL7A 5B6OA 3RXKA 3QTVH 2ZIQH 1V2LT 4I7YH 3ZVFA 3SU3A 4O97A 1RD3B 1GG6B 5GWZA 1GL0E 3BTGE 1C1SA 4MQAA 2YNAA 1YLCA 1UJ1A 2QF0A 1P10A 1Y3WA 1PPZA 1MU8B 1YPKH 3E91A 1C1VH 1HAXB 1VGCB 1O34A 2A7JA 1ELFA 2FM2A 3MNSA 2ZPQA 4K8YA 3U8RH 1TBQH 4KP0A 5DP6A 1ZGVA 1AQ7A 1SFIA 3VXFH 1EJAA 3MU4A 4Y71A 3SOSA 5DJ7A 1PYTD 5HXFA 2BB4A 3M5LA 1TB6H 1DXWA 1Y3VA 1EZXC 1MH0A 1NZQH 3TGJE 2ZDLA 4IC5A 3PLPA 2Y6TA 5LPEA 5JDUB 1X7AC 5DP4A 1HJAC 2AYWA 2WYGA 3QGJA 2O8MA 4YLQH 4NSYA 1GJ4H 3DT0H 3ATMA 1GHBF 1N1LA 2SFAA 1IQIA 2VWMA 1XUHA 2PKSC 1G3EA 3U98H 4GCHF 1C5LH 1H8IH 2THFB 5HGGA 4D76A 4ABEA 1GI7B 3EYDA 2NU2E 3QTOH 3QWCH 3ZVCA 6CHAC 3BSQA 2J4IA 3FZDA 3F68H 3UFAA 4D9RA 2TGAA 3A84A 3RU4D 4JZ1A 1YGCH 3KHVA 4UONA 1MD7A 1OYQA 3MU0A 5K0HA 3UR9A 1W13U 1Z8IB 1E35B 5C67A 4YM9A 5C2ZA 1DUAA 2VVVA 3ESTA 4I8KA 4UE7H 1RTFB 2GZ9A 2AH4X 4UFGH 4KTUA 4B76A 1ANDA 3KCGH 3RXAA 2Z9IA 2IPHA 1DSTA 1P3EA 1O3HA 1MTSA 4XBBA 1NFYA 1E34B 5HM2A 1LHGH 4ABJA 2ZU4A 1C2JA 4UFEH 3PMHB 4IC6A 5CHAB 4MTBA 1FUJA 3F6UH 1KLIH 2HGTH 1A7SA 1ZGIA 1QIXB 1J14A 1GHXH 5C1UA 2FOAA 4ZMAH 5EODA 5A8ZA 3Q3XA 3A7ZA 4JZEH 5GIBA 1C1WH 5DP8A 3GYMA 3S69A 5HYOA 2BY8X 1BB0B 2ZDAH 2QIQA 7GCHF 1L0ZA 2TGPZ 3KQEA 1BOQA 4J1YA 3RXVA 3ATLA 5FX6A 1NESE 4YOJA 3AAVA 1OWIA 2QXJA 1NM6A 2P93A 1FJSA 1KDQB 2ZU2A 1DOJA 1LPZB 3GOVB 3NCLA 1VITH 4MVNA 3DA9B 1P05A 2ZP0H 1V2MT 3GCNA 2Y7ZA 1E38B 2DE9A 1MTNC 2Q6FA 1CA0B 4K1SA 1Y59T 1YPGH 2J2UA 4E7RG 1S84A 4BTUB 1P01A 5L30H 2RCEA 1MAXA 1VITF 1OP0A 1B0FA 1BMNH 3BTTE 3R3GB 3ELAH 1O5CB 3SJ8A 1EKBB 3OY6U 3MU5A 2P3TB 4JYVH 1KYNA 4X2XA 3HKIB 5F8TA 2BD9A 1BHXB 5FAHA 2ZPRA 5EXMA 1AFQC 2R3YA 1GBEA 2GZ7A 2QXIA 4FU8A 2K1QA 3GCHB 4U2WA 4Z0KA 1BBRH 2C8XB 1UVSH 1BMMH 1MTVA 5AF9H 2FI3E 3MU8A 1GBHA 1C9PA 2ZNKH 1ARCA 3W94A 4ZKOU 1AO5A 1SGDE 1ID5H 3Q76A 1GMDF 2V3OH 2PUQH 2XXLA 3RXPA 3PTBA 2Z3DA 4IGDA 1MQ5A 1ELVA 4Z6AH 1SG8B 4MNXA 1KTTB 5J4QA 1SGFA 3OTJE 3P95A 5GXPA 4DY7B 1AFEH 2GMTC 4NFFA 2V6NA 2A4RA 1GJCB 4K69A 2W3KA 3DFLA 1TFXA 2ZFFH 4KTSA 1O30A 4VGCB 3Q77A 1GBFA 1QNJA 2PKAA 3TK9A 2W7UA 4NGAH 1G9IE 4ZXXH 1DITH 1EAIA 2PR3A 2G4UA 2NU1E 1GPZA 3SV8A 3RM2H 1IQMA 1BDAA 3MMGA 1LDTT 4ZROA 1CBWB 1Z1JA 4CHAB 1O3AA 3M37A 1HAHH 3KQDA 4DGJA 1UTJA 6LPRA 4Q7YA 1A3BH 3VPKA 1AE5A 1ZSKA 1MBMA 2BM2A 1EAXA 2FO9A 4K60A 2EEKA 3MO3A 3LGWA 1SQAA 2WV5A 3SNDA 2J92A 1VCQA 1CHOF 4X1SU 1K28D 1O3FA 1LVBA 1ZJDA 2FYQA 1UHBA
chains in the Genus database with same CATH superfamily
3K6ZA 5DPAA 1QB6A 5JBAS 1A0JA 2VNTA 2M5TA 3ATKA 1P02A 1FY5A 3P8OA 4NZLA 1DWBH 1O2GH 8LPRA 2PUXB 1JIRA 4X1QU 4GSOA 1QBVH 3RXFA 1BMFD 5E2OA 3NPSA 1YPLH 2CGAA 2BQWB 1TMTH 2W26A 1HJ8A 1V2NT 5A8YA 3VB3A 4ASUD 1Y3XA 2G00A 2SGDE 5E0HA 1SI5H 2JETB 1TMUH 1DFPA 1O2ZA 3RMMH 1K0HA 3MNXA 3SU2A 1GCTC 2W6ID 1YC0A 1XX9A 3BV9B 3A85A 3VB6A 4X8SH 2J95A 3OEED 2JIZD 1F5LA 1ELCA 1FNIA 1QBNA 9ESTA 3N7EA 4IMQA 3TJUA 1F7ZA 1G30B 1LVYA 3UNQA 5DSFA 4ZHMU 2A0QB 1C2LA 4A1VA 1ZLRA 3LC5A 1YPEH 5DP3A 2BYAX 4X1RU 4SGAE 2Y82A 3S7KB 2PGBB 4FUBA 4R0IA 1D3DB 5GNDA 3UY9A 4WJG2 1TQ7B 1CO7E 1UTQA 2G55A 2PTCE 1OWHA 1RGQA 1TWXB 1ZMJA 2ZF0H 1LTOA 4P00A 1C5RA 3T25A 3U8TH 2SGQE 4AN7A 3TH4H 1HCGA 1WTGH 2ZHEH 1V2UT 2A2QH 2BLQA 2OQUA 4MPWA 1H8ED 1WTHD 2JH5D 1FAXA 4X6PA 4IN2A 2C93B 2W6JD 3T5FH 5SGAE 2A7CA 2R9PA 2ZFTA 1PFXC 1QQUA 2GVFA 2KZ4A 1GJ7B 5GCHG 3ZZBA 5AFZH 1AB9B 1DPOA 4Q4LA 3DD2H 1P2MA 2CHAC 1SHHB 7ESTE 2ZFSA 1XVOA 1A3EH 4TWYA 1H4WA 3DCLA 4O3UA 3QUMP 3QX5H 1P2IA 1S82A 3O8RA 4FVBA 3BG8A 1Z1IA 1TABE 2GDDA 1O2VA 1QB9A 2ZEBA 4K1EA 2BVXH 2P3FH 1L4DA 3O8CA 2HALA 1GI5A 2TRMA 2WPKS 1HXEH 4XOJA 1TGNA 4E7NA 4B6EA 3GICB 1EATA 1O5DH 5GPIB 1O38A 1KLJH 4FU7A 1L1JA 1TPOA 2ZU1A 1VZQH 2G52A 2JKHA 2UUYA 3GCTF 1O5EH 4WVPE 3LC3A 2KCAA 1MTUA 1EZSC 1WAYB 2HNTF 3V13A 3H09A 3RXSA 1IQJA 1SSXA 2RDLA 1P12E 1GCDA 1Y3YA 2GT8A 2BXTH 1BMAA 1G3DA 1KXEA 2XBYA 1V3XA 1BTWA 3M3SA 2ZGBH 3F0OA 5B6LA 1HAPH 4ISIH 1O3PB 3LIWA 2J98A 1TNJA 4AX9H 1ANBA 5IYTA 2FOEA 2OD3B 1EX3A 1UO6A 3B9FH 4FVDA 2JH6D 3A88A 1DM4B 2ZDNA 4XDEA 5EQSA 3RDZA 3VB5A 1UTNA 3PMAB 5FX5A 4BAHB 1TGSZ 4JK6A 2CMYA 1G3CA 1EASA 1TBRH 2FTMA 1KSNA 4A5TS 2ZDVH 3RP2A 2RA3A 4RT0A 2I6QA 1OWKA 5EOKA 4ABIA 3RXBA 2Z9JA 2O9QA 1IQGA 1PPFE 1LHEH 2B8OH 3FFGA 1TNGA 1C1PA 1DY9A 1FY1A 2KM0A 3OAAD 4DURA 4TYDA 3K2UA 1HAZB 2BVRH 2OUAA 2OCVB 1YY3A 3SGBE 3ZVDA 5EPNA 1SGRE 4UFDH 1C5WB 2OC7A 1J16A 1OX1A 1C2KA 5CHBA 1HJ9A 3MH4A 4JZDH 3S9AA 5AFYH 2PSXA 1V2RT 1C9TA 3HK3B 4HGCA 1NT1A 4GPGA 5DN6D 1IQFA 1J17T 2A2XH 2AHME 5C5NA 3D62A 2PW8H 2YOLA 1PPBH 2PGQB 2DUCA 4ZKNU 1TNHA 2HRVA 3MNCA 1YCPH 3K6YA 2QY0B 2J5UA 3OFND 4NG9H 2ZGHA 3L3TA 4X8TH 1ELEE 3FP6E 3TJOA 1O2IA 1RTLA 2Z9GA 1J8AA 1TX7A 1K22H 2C4FH 4WF8A 4Q2KA 3SV7A 2BDIA 2UUFB 1O3NA 1DDJA 1QR3E 1SGPE 3NXPA 3RC4A 2PP6A 1VR1H 3T28A 1QRXA 4E06H 2C8ZB 2EQNA 1ORFA 1ESBA 2GZ8A 3SJIA 1TNLA 2SGEE 1G2LA 5T6FA 1BRUP 3KQ5A 4AORA 3QZRA 2PKAB 2EC9H 1PQ8A 1INCA 1O3EA 1TRYA 3PTNA 2AEIH 2FWWA 4FUEA 1C2GA 3DFJA 2KCYA 3N99A 3KEEA 3PB1E 2BDHA 5J4SA 1BTUA 3SV6A 1HRTH 1WV7H 2FEQH 3LPRA 3LH3A 1UK2A 2O8UA 4K3JA 2NU0E 1SOZA 1BJUA 3MFJA 4IMZA 3QO6A 4YO9A 3TLOA 2PSYA 3MI4A 1OOKB 4Q7ZA 2ILNA 3RXIA 1BRCE 4U30A 2PLXA 2BVSH 3UAIC 4OGXA 1TPSA 2P95A 2O8WA 3PMBB 1O2RA 1QL9A 4A92A 1QGFA 2AMQA 1IQNA 1K1MA 1S6HA 2QF4A 1ANEA 1UHBB 1Q31A 1C5XB 3GYLB 2RG3A 1S5SA 3ZZ9A 5A09A 5LH8A 3F9FA 2RA0A 3E1XB 4FUJA 4DW2U 1YPHC 3ZZAA 1QJ1B 5ESBA 1GBIA 1RS0A 3UOUA 1IQEA 5EW2H 1GDUA 2R0LA 1BRAA 5TJXA 3RXOA 1V2VT 2WZQA 2V7QD 4FUFA 3RC5A 1L2EA 4B2AA 1EJMA 1KXCA 1W11U 2CJIA 3FANA 1GJDB 1BA8B 1GI9B 1OPHB 1V2PT 3UREA 2KX4A 4LK4A 3URDA 3W1EA 1N8OB 1GBLA 3F0PA 1E0FD 1MKXH 2YNBA 5E2PA 1E37B 3DHKH 4Y79A 3P8GA 1P2OA 3P8NA 1K1LA 1ZRBA 1YKTA 1NRNH 4FUIA 3VFEA 3TITA 2WPMS 3U8OH 1G3BA 1O2YA 2B9LA 4QT8C 1PPCE 5JBCS 1ETRH 4NWLA 4X1NU 1THPB 2VIDA 3TPIZ 2ZHWH 3QK1A 1IHSH 1AU8A 4BNRA 2OQ5A 3M7QA 4MNYA 2BD3A 1FPHH 1L1NA 3LDXH 4WXIA 1EPTC 1O3MA 1HLTH 1YLNA 2J38A 5FHTA 2I6SA 1C1OA 1KXAA 4ZUHA 1C5VA 1QRWA 2J97A 4K2YA 2BDAA 2ESTE 4BANB 1NRRH 3RXRA 1QB1A 1O39A 3O8BA 3RXLA 4Y0YE 3E6PH 1MKWK 3OU0A 1GWAA 1NRSH 4K1TA 1NROH 4BXWA 2GKVE 2F83A 2R2MB 3SUGA 1H1BA 1QA7A 2FOHA 3MO6A 1ZTJA 2QGRA 5CHAC 1ABIH 1LQEA 3BG4C 1RJXB 1H9IE 1WU1A 4BTIB 2QF5A 1NN6A 2AGIX 1THRH 5FPTA 5C1XA 2ODYB 3PV2A 2ZFPH 1CSOE 4RT1A 1MQ6A 1P2QA 4DIIH 4DG4A 1YPMH 1EZQA 1OWDA 3C27B 1BIOA 4AGJA 3E0PB 1C2HA 1PQAA 5EPYA 3ZV8A 5JB8S 5LPRA 1GHAF 2KAIA 4NWKA 4BAKB 1C5TA 5DGJA 3RXDA 4BOHA 2FOBA 5GDSH 4F48B 1GMCG 4JYTA 2GCHF 5A0BA 2F9OA 1EB1H 3S7HB 3AVZA 3EA9A 1PJPA 1W14U 2P59A 3BEIB 3M5OA 1GMHF 1SGTA 1OKXA 4INKA 2V35A 2EY4C 2FS8A 1QURH 1TMBH 3AK5A 3TH3H 2WYJA 1IQLA 4AZ2B 2H6MA 3BTDE 4FUGA 1Z7KA 2ZHDA 1UW7A 1ZMLA 3PWBA 1W7GH 5H4IB 1KY9A 3SUEA 1NO9H 3RXMA 2GDEH 2Z9LA 1A0LA 2PKSB 1OWEA 4FUDA 3E3TA 2AGEX 1PQ7A 3SU6A 5LGOA 1UTMA 1V2WT 5EG4A 1O3OA 3TJVA 2AGGX 1SGQE 2UWOA 3S0NA 1OXGA 6CHAB 2FZZA 3MO9A 1P0SH 1GI0A 4ABDA 1BTXA 1P2NA 5TCAA 3F9HA 3EA7A 1XUGA 2BY9X 3JZ2B 2J98B 1SLXB 1P03A 1P3CA 3RMLH 4D7GA 1N6XA 1SQOA 1HAIH 2ZC9H 4X6OA 1K1PA 3PMJA 1B5GH 1K1NA 1WOFA 1YPHE 2D26C 3LGUA 4I8LA 5LPFA 2ZKSA 1VJ9U 3GY5A 5IDKA 1DLEA 2FI4E 4JMYA 1UCYE 3GY3A 4B74A 4PROA 4Y76A 2BHGA 3E90B 2ZI2H 4UD9H 2WINI 4B75A 1BMLA 2ANKH 2ZGXH 2GGVB 3EQ0H 1TX6A 1NU7B 2IOTA 2W7SA 3RU4T 1CGJE 1QL8A 5C3NA 1UVUH 3BF6H 1W0KD 3UIRA 2FP7B 1P04A 1GHZA 5IK2D 5EXLA 2PV9B 4OM9A 3UR6A 2YMSC 3PWCA 4BTTB 1V2OT 1W10U 1SHYA 3AAUA 2XNDD 4GLYA 1KLTA 4CHAC 2EI6A 1O2QA 4BAQB 2DE8A 1A4WH 2M2AA 3LT3A 2Y5FA 1GHVH 1DUEA 1SLWB 1Z8GA 4GHTA 1NU9A 2ZCLP 3RMNH 4B73A 1YLDA 6GCHF 1YBWA 2FTLE 2J9NA 4CR5A 3AW0A 2KFWA 2FS9A 1MD8A 1ZR0A 1MTNB 1PYTC 2F4LA 1UCYH 3TGIE 2NU4E 1HB0B 3M5MA 3PO1B 2R0KA 4ACAA 2QC2A 2H9HA 1O3KA 2VB0A 5C0TA 1QHRB 3VG8A 1O3DA 2ZGCA 1SGEE 4MPUA 3BEFB 4ZKSU 1W2KH 1CU1A 3H7OA 1MTWA 3M7UA 4O3TA 5ETXA 2VIOA 4NIWA 3MH6A 1H8HD 4AB8A 4X6MA 2JETC 4BAMB 3U1JB 5F8XA 2BZAA 3M7TA 3CS0A 1XM1A 5FPSA 8GCHF 1BBRK 1G36A 2KCPA 4Q7XA 1LO6A 1TNIA 1F5RA 1G37A 2C3SA 1O37A 5KECA 2TIOA 1GBTA 3A8BA 5FCKA 5HKKD 1EB2A 1ZMNA 3URCA 2GMTB 1FY8E 1GL1A 2A1DB 1K21H 4IS5A 2LPRA 1EQ9A 5EQQA 2PFEA 2TGTA 1JBUH 1HBTH 2FODA 2UWPA 2F9UA 2A5IA 5EXNA 1Y8TA 1ZPZA 1GJ6A 1NC6A 2VGCC 1V2QT 3SGQE 3L33A 2GV6A 2XBXA 3U9AH 1O2XA 2Q6DA 3T2NA 1QTFA 1DVAH 4FUHA 2WPLS 3IWMA 4ABGA 1K1IA 1HNEE 1XXFA 1CGHA 4AFZA 4BAOB 3RXEA 3LOXA 1GHBG 2ZTZA 4U32A 1Q3XA 4OS2A 2ZU5A 3SI4H 1NBMD 4Y8XA 1SLVB 4GCHG 1D9IA 1S85A 4B2BA 3RMOH 2H9EH 1IHTH 5FCRA 1BJVA 2GV7A 3U69H 1AHTH 4B6FA 2FOFA 1FXYA 2HLDD 1TGTA 3FOAA 5T6GA 2XCNA 3SJOA 3OSYA 2H9TH 1T4VH 1D6WA 5HIZA 4ISOA 2ZTXA 3TVJB 1SLUB 5A2MH 2HLCA 2NWNA 3EAJA 1DT2A 5E0JA 1C5PA 3A7VA 1FMGA 3LONA 3VEQB 5HM9A 1HUTH 1OYTH 2UUKB 4BXSA 1Y5BT 2IN2A 1HAVA 1YPJH 5EQRA 1LHDH 1ARBA 2XC4A 4FXGH 3PV5A 1EUFA 1WQVH 2XWBI 1CT0E 1BZXE 3ENSB 4IBLH 3UWIA 1MAYA 3PLBA 5E0GA 3G01A 9LPRA 1GCTB 3I78A 1AY6H 2PTNA 4MDSA 4YXWD 3RXHA 1C4U2 4NCYA 1BTYA 1O2UA 3ZYDA 1TA2A 2XOKD 2QXGA 4D7FA 3SV2H 2CF8H 1DWDH 2Y5GA 3Q00A 2F3CE 1GDQA 1FONA 4X2YA 2BDCA 1O5BB 3ZZ6A 4RKJB 4UDWH 2BD2A 5T3HA 2ASUB 4Z1MD 1D3QB 2KAIB 7GCHG 2HVXA 4K5ZA 4Y6DA 4JZFH 1GGDC 3H7TA 3EE0B 1S0QA 4OS5A 2QAAA 4CH2B 2CXVA 3JZ1B 3HGPA 1ZSJA 2BD8A 4WWYA 2TPIZ 2STBE 4MNVA 5F53A 4FUCA 3SNCA 1TA6A 5C1YA 4E05H 3SV9A 2FLBH 1FN6A 3IG6B 2Y81A 3FKSD 1KIGH 1IQKA 3S9BA 1AIXH 1KTSB 3RU4E 3ZIAD 1C4Y2 2ODQA 2P8OC 4XSKU 3GS9A 3SU5A 2GX4A 1VITG 1SGNE 5I46H 3VB4A 1Y5UT 4MPVA 3SUDA 2VINA 1M9UA 2AERH 1S83A 1MZDA 1O3BA 2ULLA 3M35A 1AUJA 3KGPA 4WMDA 2VIQA 4WH8A 3SU0A 4TWWA 3ATIA 1TGCA 1SMFE 5JBTA 4TSFD 1XUJA 3ZVGA 2BLOA 2CK3D 1A5HA 1D6RA 1GMDG 1GBBA 1BUIA 1AZ8A 1W8BH 2XYAA 1HIAA 1C2MA 2XTTB 4F4OC 1T8LA 2FDAA 1ANCA 3KQBA 4XE4A 1U6QA 1GBDA 1O3CA 4UFFH 4U01A 4DT7B 2F9VA 3LGIA 3KIDU 4NA7A 1XVMA 3MU1A 4ACBA 4ESTE 1F0TA 4RN6A 2ZDMA 4A1XA 1FQ3A 1ESTA 1O31A 3M36A 2Z7FE 1FIWA 1ZYOA 1QQ4A 1UK4A 2XNIA 1O36A 2HOBA 3GCOA 1SB1H 2A5KA 1AUTC 1NY22 1UMAH 3GDVA 3D23A 1KXDA 1TRNA 3SQEE 2BQ6B 3Q3YA 3SNBA 1EAWA 4AB9A 3MH7A 1C2EA 1C4V2 1LPKB 3PYHA 1B0EA 4A6LA 2HPPH 1ZZZA 1TPPA 2QCYA 4X6NA 1F0RA 2GCTC 1NRQH 1PPEE 3E8LA 5FXLA 3RXQA 3F3BA 5DKMA 3KL6A 1FV9A 2EI7A 1O32A 2J94A 4WMEA 4OS4A 1L4ZA 1ZTLA 3P92A 3RXCA 4Y7BA 4YZUA 1CHOG 1ZHMA 2K0QA 4I31A 3EGKH 1C5NH 2FXRA 2GD4B 3DSOA 1ZOMA 2G5NA 2VU8E 1C5YB 3TK6A 2XC5A 2ANYA 1LVMA 2OXSA 1C5UA 1V2JT 2BY6X 3STJA 3VXEH 2QXHA 1FY3A 1TIOA 2A31A 3CNRA 3F2GA 5FL7D 4YTAA 2SGPE 4X2VA 8ESTE 4B71A 2ZTYA 1ZPCA 2BY7X 4WXVA 2Z3EA 1T8MA 2Y5HA 1GI2A 4LZ1H 2ZG0H 4NA9H 1ELDE 1GG6C 5F6MA 3WWBA 2QA9E 4Q80A 2OK5A 1P09A 3T26A 1EXFA 2Z6BD 3L6PA 1WQSA 3RC6A 4Y10E 1J15A 5JB9S 5JBBS 3F9GA 3GY8A 1RIWB 4THNH 2ODPA 2WV4A 3MTYA 3T29A 3NUMA 2Y7XA 1YCPK 1N8OC 5EJZA 3U28C 1VGCC 1KXFA 4D9QA 3EDXB 4ZH8A 2PWXA 1D4PB 1GBCA 1MZAA 2D8WA 3UQOA 2A4QA 4H4FA 2A45B 4J2YB 4WMFA 2G51A 2Z9KA 4OS7A 1GI3A 4I86A 5C17A 1HFDA 3UPEA 1JIMA 1Y3UA 1E36B 1LQDB 3KQCA 7KMEH 1AVWA 1TOMH 1P57B 2ZHQH 1ZHPA 1LKAA 2OINA 2SNVA 3VGCB 1CT4E 1JMOH 3FZZA 3RXJA 4KGAA 1AVXA 1BQYA 1F92A 2ZECA 2ZA5A 2R3UA 1TGBA 4I33A 2F9BH 3RLWH 3SHAH 2BZ6H 2SNWA 4NA8A 1AE8H 1WYKA 3M3VA 3SHCH 2FI5E 1BTPA 3WW7A 3OYPA 3PRBA 1T32A 4ZAEA 4DVAU 4AYVB 1WUNH 1QZ8A 4IN1A 4TY6A 1B7XB 1ZRKA 5L2ZH 1GI4A 4AC9A 2A32A 3D49H 1DICA 3BTME 3A86A 2AS9A 4I32A 4RKOB 5BRRE 1DY8A 4AFSA 3UNRA 3IITA 2AMPA 1FZZA 1THSH 2F91A 2Z3CA 2O8LA 1BTHH 3BTEE 1GJBB 5ABWA 2ZDKA 3VB7A 3BTQE 3FP7E 4ISLA 3WY8A 1JRTA 1PPHE 1SGIB 1YCPM 1TLDA 1ZJKA 1HAVB 1O2JA 5AHGH 1O2OA 1MU6B 2VWNA 2VIPA 3MYWA 5AVDA 1E79D 1O0DH 1QA0A 1VCWA 4NFEA 1OP8A 5HMAA 5TCCA 2WPJS 3ITIA 2BDYA 1TX8A 2OC0A 1RFNA 3ZVAA 3GCTG 4B1TA 4XBCA 2CN0H 1CQQA 1MBQA 1O5GH 3TJNA 2ANMH 1S81A 1V2ST 1MCTA 3QZQA 1LMWB 3HGNA 4X2WA 5ESTE 4JZIA 1FI8A 1MKXK 3P8FA 1HAGE 1C2DA 2NU3E 4NZQA 4D8NA 1YP9A 2BDBA 4AFQA 3BEUA 3A8CA 4Y0ZE 1NPMA 4YOGA 1C2IA 1E1RD 4OS6A 4H6TA 2QV1A 1HJAB 4CRCA 1O2WA 1EAUA 2ZO3H 1G2MA 4CH8B 4GVUA 4ABFA 2A4GA 2TBSA 1XMNB 1SOTA 2SGFE 2VVUA 1S6LA 3GY4A 4NIXA 1EPTB 3FVFB 1W0ZU 1Z71A 4CRAA 3QN7A 2ZFRH 1KXBA 1A61H 1CA0C 4TT3D 2B0FA 5T1VA 1K1JA 1H8DH 5GCHF 3SGAE 3ZZ3A 1CT2E 2B7DH 1BCUH 3SNEA 3GY6A 1AWFH 4KELA 5EW1H 3CENA 2BOHB 4LZ4B 2V3MA 1IQHA 2ALVA 1GHWH 3BG4B 3FP8E 2VJ1A 3EA8A 1OSSA 7LPRA 4OS1A 1W12U 3F2HA 4MG3A 5CDFE 1UTLM 3GCHC 2ZHFH 3BTWE 2XRCA 1NS3A 1BBRE 2XWAA 4YESB 3Q3KA 2VIVA 4X8UH 1UTPA 1T7CA 3GY2A 2HPQH 3GY7A 1TYNA 2BD4A 3LJOA 1AWHB 1HGTH 1HPGA 4X8VH 1HYLA 1XKAC 4AG2A 4CRGA 2XC0A 1C1NA 3HK6B 3HATH 2QN5T 3A82A 1YM0A 3O8DA 1RRKA 2GTBA 4XD7D 2BX3A 3BN9A 1QY6A 3TU7H 3KNXA 3ODDA 2ZPSA 1DSUA 1HIAB 1O3IA 5FBEA 3BTKE 5PTPA 3U1IB 4O9VA 2Z94A 2B5TB 4VGCC 1FDPA 2BD5A 5G4BA 1C5SA 5A0CA 3NRLA 4Q63A 4DOQA 3SO3A 3UUZA 2OP9A 2FIRH 3PO1C 1XUFA 1XKBC 2VWOA 1ELTA 1BTZA 3T62A 4AOQA 2HNTC 1VJAU 1CBWC 2ZU3A 1QCPA 5T6DA 3LJJA 4NIVA 5C94A 1W7XH 1RXPA 3BTFE 3OTPA 3V3MA 1V6DA 4WH6A 5GJ4B 4DT4A 2C8WB 1EP5A 3KF2A 3CS7A 1QFKH 4H42U 4AG1A 3SQHE 1C5MD 1LKBA 2VWLA 2KR7A 2VH0A 1V2KT 2O8TA 2VVCA 3CP7A 2BY5X 2RFKC 2FPZA 1GDNA 2QF3A 1P9UA 1Z6JH 3MH5A 3RUOA 3DSPA 5DP7A 5C0UA 4MPXA 2EA3A 1UTKA 2H1UA 4M7GA 1ACBE 3T27A 1O35A 4CREA 1LCYA 3ZZ7A 2WUCA 4NSVA 2OC8A 3UWJH 2F9PA 1O3GA 2ZWLH 2JDID 2AIPA 1SPJA 1W0YH 2EI8A 1FY4A 3A83A 1K1OA 3HKJB 1HAOH 1AFQB 5EJ1A 3SN8A 1GVLA 4INLA 1ZPBA 4X0WU 3N7OA 4DIHH 1MABB 3NZIA 4UEHH 2YMSB 4F55A 2CF9H 2JJ1D 2IPQX 2OBQA 3OX7U 5E8EH 3MQKC 1EOLA 1DANH 1MCVA 1P9SA 3SI3H 3SORA 3ZYEA 1F0UA 3SYJA 4MNWA 3QLPH 4JCNA 5F8ZA 2A5AA 3ZZ8A 1C1RA 1DWCH 2BDGA 3RXTA 1ELAA 2JH0D 2UWLA 2LELA 2OTVA 2FYRA 2H5DA 3NWUA 1FAKH 1GJ8B 1ZSLA 2P16A 3AASA 4Y8YA 1IOEA 3QGNB 3SUFA 1UVPA 3UNSA 3DUXH 1SVPA 1PQ5A 3LGVA 1FIZA 1JOUB 3TNSA 1Z8JB 1A1RA 3I77A 1H9LB 2BOKA 3ODFA 5C20A 4B2CA 3SJ9A 1AGJA 1ZHRA 4ZXYH 4SGBE 2WPDD 3RLYH 1UCYK 3ZVEA 4M9FA 1O2MA 1AKSA 3BIUH 3TNTA 1AVGH 1O3LA 4LOYH 1V2TT 4HFPB 4CR9A 1UVTH 2XW9A 3D65E 1O2SA 2IJOB 4P02A 4WY3A 3RM0H 3SU4A 3ATWA 1FX0B 3S9CA 3B8JA 3V12A 1ETSH 1SL3A 1P2KA 1EP6A 5A8XA 4FOUC 4YT7H 1NFXA 1QBOA 2LP6A 1G32B 1SGCA 2VIWA 2W5EA 3HPTB 3TIUA 4H6SB 1GI1A 2D1JA 3C1KA 3F1SB 3I29A 2R2WU 3FN8A 3PV4A 1A0HB 1AB9C 1GBJA 1QJ6B 1GJ9B 1Z6EA 4TPIZ 1J9CH 3MNBA 4CBNA 3F9EA 1MUEB 1GBKA 8KME2 2V3HH 1SKYE 1UTOA 1BITA 1GBMA 4ABBA 2C90B 1GJAB 2BX4A 2OC1A 2ZCKP 4NIYA 3M61U 1O2LA 1NFUA 1AD8H 6ESTA 1P06A 1DX5M 1TE0A 1O2PA 5HIYA 2G4TA 1CA8B 4TPYA 4R8TB 1GHAG 2BTCE 1C1TA 2HNTE 1C2FA 3E16B 3A7TA 1HAYB 3P70B 4RI0A 2A7HA 2GCHG 3GISB 2ZGJA 3PM3A 2VGCB 1SGFG 4ZHAA 2QE7D 3UB0A 1GMHG 1TALA 1AZZA 1F0SA 2Q6GA 1T4UH 3B23B 2BMGB 2L6OA 2GT7A 3M5NA 2BLVA 2BQ7B 5K7RA 1P8VC 4ASHA 2WSSD 2G81E 1AMHA 1TONA 1O2HA 3BIVH 2V0BA 1BHXF 4TY7A 2D2DA 1MMJN 3K9XB 1SQRA 1AI8H 1LHCH 1O33A 1DWEH 4YLUA 2P3UB 1LVOA 3SZNA 3LKWA 3SBKA 1O2NA 3SNAA 1HXFH 3GDSA 1D3TB 1O5AB 5BPEA 1ELBA 3MHWU 1QJ7B 3PROA 1N6YA 2H5CA 3A8DA 1VCPA 1EPTA 3ZZCA 1Q2WA 2STAE 3A80A 3RXGA 3AW1A 3MOCA 2CV3A 2F43B 3V0XA 1EJNA 2LNCA 4XRNA 2BD7A 1DE7H 1DXPA 2ZQ2A 2FOGA 1ELGA 4A1TA 3H5CB 1F2SE 1YF4A 1XUKA 3M3TA 3LGTA 1O2TA 1SGYE 4ZKRU 3LGYA 1WDIA 1ESAA 1GBAA 3RXUA 1HDTH 1GVKB 4LXBH 5EU8A 1OS8A 3WWFA 2CHAB 2Y80A 4X1PU 1GI8B 2G5VA 3SU1A 3ZV9A 5I25A 2FOMB 3W95A 3E0NB 4JYUH 1S0RA 1JXPA 1FN8A 1NRPH 1WBGB 2AIQA 1AN1E 2G8TA 1GVZA 4YT6H 2GJGA 3LH1A 4XFQA 3SW2B 4GAWA 1GMCF 2ZZUH 2PHBA 1ETTH 3OY5U 4DCDA 2A4OA 1H9HE 1KDQA 3BTHE 3FAOA 1BRBE 4I8JA 1T31A 1T8OA 1GGDB 4XBDA 1C1MA 2RDEA 1O5FH 4HTCH 4CRBA 1UVOA 3SZEA 2BXUH 1PPGE 2TGDA 4HI3A 1F5KU 3GDUA 6GCHG 4ISNA 1TPAE 1RTKA 1A2CH 3TK5A 3MWIU 2W3IA 5KEDA 4JK5A 2FOCA 2ZFQH 5KGOA 4FU9A 2P8OB 4I8GA 1D3PB 1NFWA 4KKDA 1DLKB 4RSPA 5FBIA 4GHQA 5L2YH 1BT7A 1K9OE 2WHXA 2QYIA 3QDZB 1TBZH 1OP2A 4CBOA 4Y11E 1CE5A 4CRDA 3PRDA 2FESH 2ZQ1A 3UQVA 1WSSH 1TOCB 1GJ5H 2GP9B 1A46H 1C5ZB 4Y8ZA 5DP9A 1CHGA 3A89A 5EJLA 4ABAA 4AFUA 5JYIA 2FX6A 2P94A 1CVWH 1GI6A 4YOIA 3ZZ5A 2HWLB 5C5OA 1ABJH 3K65B 2XBVA 1EZUC 1XUIA 4CRFA 3ZZ4A 1SC8U 4GUXA 2ANWA 1WCZA 1HV7A 3KN2A 3R0FA 1OHHD 8GCHG 1QRZA 2WUBA 1C5OH 3KYGA 1C1UH 1W0JD 4K8BA 1RIWC 1C5QA 4F49A 5DG6A 5DP5A 1TNKA 1OWJA 1T8NA 1Z8RA 1Y5AT 1ZTKA 2UUJB 1GHYH 3OEHD 2BLWA 1FPCH 1LPGB 3PLKA 2SGAA 1C1QA 5CMXH 2AMDA 1TRMA 3A81A 5A0AE 2C8YB 5CE1A 1FLEE 4OGYA 5JPMH 4IW4E 5DO4H 3A7XA 1P2JA 1YWUA 4INHA 3UOPA 2H2ZA 3STIA 2OBOA 5DK1A 2HVYB 3VGCC 2OLGA 2XBWA 3ZZDA 3F2FA 2L74A 4FETA 3A7YA 2WPHS 2FLRH 4KTCA 1O2KA 5EGMA 5F03A 1A5IA 1SBWA 2GCTB 1DS2E 3P6ZB 3SJKA 5L6NH 3ZVBA 4ABHA 1EOJA 2Q1JA 4AYYB 3TGKE 1WXRA 1SQTA 1P11E 3TH2H 3UTUH 2ALPA 4I8HA 4MLFB 1O3JA 4Y7AA 2XCFA 1TQ0B 2ZCHP 1TAWA 4HG6A 4HZHA 1K2I1 2J34A 4ISHH 1SFQB 4O03A 1JWTA 1UK3A 1IAUA 1NTPA 1W3CA 3V7TA 1XXDA 2VH6A 3LU9B 3P17H 2IJD1 3NKKA 4A7IB 3A8AA 3A87A 3A7WA 1CGIE 1AKSB 1S6FA 1YYY1 1LHFH 2WPIS 2F9NA 1MKWH 4DJZB 4ZHLU 1L1GA 5FPYA 2FX4A 1SR5C 2AFQB 2FMJA 3FO8D 3NK8A 4AGKA 1A5GH 1JRSA 1QL7A 5B6OA 3RXKA 2YMSD 3QTVH 2ZIQH 1V2LT 4I7YH 3ZVFA 3SU3A 4O97A 1RD3B 1GG6B 5GWZA 1GL0E 3BTGE 1C1SA 4MQAA 2YNAA 1YLCA 1UJ1A 1EFRD 2QF0A 1P10A 1Y3WA 1PPZA 1MU8B 1YPKH 3E91A 1C1VH 1HAXB 3KYFA 1VGCB 1O34A 2A7JA 1ELFA 2FM2A 3MNSA 2ZPQA 4K8YA 3U8RH 1TBQH 4KP0A 5DP6A 1ZGVA 1AQ7A 1SFIA 3VXFH 1EJAA 3MU4A 4Y71A 3SOSA 5DJ7A 1PYTD 5HXFA 2BB4A 3M5LA 1TB6H 1DXWA 1Y3VA 1EZXC 1MH0A 1NZQH 3TGJE 2ZDLA 4IC5A 3PLPA 2Y6TA 5LPEA 3EE7A 5JDUB 1X7AC 5DP4A 1HJAC 2AYWA 2WV9A 2WYGA 1NBME 3QGJA 2KCOA 2O8MA 4YLQH 4NSYA 1GJ4H 3DT0H 3ATMA 1GHBF 1N1LA 2SFAA 1IQIA 2VWMA 1XUHA 2PKSC 1G3EA 3U98H 4GCHF 1C5LH 1H8IH 2VBCA 2THFB 2JJ2D 5HGGA 4D76A 4ABEA 3OE7D 1GI7B 3EYDA 2NU2E 3QTOH 3QWCH 3ZVCA 6CHAC 3BSQA 2J4IA 3FZDA 3F68H 3UFAA 4D9RA 2TGAA 3A84A 3RU4D 4JZ1A 1YGCH 3KHVA 4UONA 1MD7A 1OYQA 3MU0A 5K0HA 3UR9A 1W13U 1Z8IB 1E35B 5C67A 4YM9A 5C2ZA 1DUAA 2VVVA 3ESTA 4I8KA 4UE7H 2K8IA 1RTFB 2GZ9A 2AH4X 4UFGH 4KTUA 4B76A 1ANDA 3KCGH 3RXAA 2Z9IA 2IPHA 1DSTA 1P3EA 1O3HA 1MTSA 4XBBA 1NFYA 1E34B 5HM2A 1LHGH 4ABJA 2ZU4A 1E1QD 1C2JA 4UFEH 3PMHB 4IC6A 5CHAB 4MTBA 1FUJA 3F6UH 1KLIH 2HGTH 1A7SA 1ZGIA 1QIXB 1J14A 1GHXH 5C1UA 2FOAA 4ZMAH 5EODA 5A8ZA 3Q3XA 3A7ZA 4JZEH 5GIBA 1C1WH 5DP8A 3GYMA 3S69A 5HYOA 2BY8X 1BB0B 2ZDAH 2QIQA 7GCHF 1L0ZA 2TGPZ 3KQEA 1BOQA 4J1YA 3RXVA 3ATLA 5EIYA 5FX6A 1NESE 4YOJA 3AAVA 1OWIA 2QXJA 1NM6A 2P93A 1FJSA 1KDQB 2ZU2A 1DOJA 1KMHB 1LPZB 3GOVB 3NCLA 1VITH 4MVNA 3DA9B 1P05A 2ZP0H 1V2MT 3GCNA 2Y7ZA 1E38B 2DE9A 3DSGA 1MTNC 2Q6FA 1CA0B 4K1SA 1Y59T 1YPGH 2J2UA 4E7RG 1S84A 4BTUB 1P01A 5L30H 2RCEA 1MAXA 1VITF 1OP0A 1B0FA 1BMNH 3BTTE 3R3GB 3ELAH 1O5CB 3SJ8A 1EKBB 3OY6U 3MU5A 2P3TB 4JYVH 1KYNA 4X2XA 3HKIB 5F8TA 2BD9A 1BHXB 5FAHA 2ZPRA 5EXMA 1AFQC 2R3YA 1GBEA 2GZ7A 2QXIA 4FU8A 2K1QA 3GCHB 4U2WA 4Z0KA 1COWD 1BBRH 2C8XB 1UVSH 1BMMH 1MTVA 5AF9H 2FI3E 3MU8A 1GBHA 1C9PA 2ZNKH 1ARCA 3W94A 4ZKOU 1AO5A 1SGDE 1ID5H 3Q76A 1GMDF 2V3OH 2PUQH 2XXLA 3RXPA 3PTBA 2Z3DA 4IGDA 1MQ5A 1ELVA 4Z6AH 1SG8B 4MNXA 1KTTB 5J4QA 1SGFA 3OTJE 3P95A 5GXPA 4DY7B 1AFEH 2GMTC 4NFFA 2V6NA 2A4RA 1GJCB 4K69A 2W3KA 3DFLA 1TFXA 2ZFFH 4KTSA 1O30A 4VGCB 3Q77A 1GBFA 1QNJA 2PKAA 3TK9A 2W7UA 4NGAH 1G9IE 4ZXXH 4ZCNA 1DITH 1EAIA 2PR3A 2G4UA 2NU1E 1GPZA 3SV8A 3RM2H 1IQMA 1BDAA 3MMGA 1LDTT 4ZROA 1CBWB 1Z1JA 4CHAB 3N7DA 1O3AA 3M37A 1HAHH 3KQDA 4DGJA 1UTJA 6LPRA 4Q7YA 1A3BH 3VPKA 1AE5A 1ZSKA 1MBMA 2BM2A 1EAXA 2FO9A 4K60A 2EEKA 3MO3A 3LGWA 1SQAA 2WV5A 3SNDA 1VKYA 2J92A 1VCQA 1CHOF 4X1SU 1K28D 1O3FA 1LVBA 1ZJDA 2FYQA 1UHBA
chains in the Genus database with same CATH topology
3K6ZA 5DPAA 1QB6A 5JBAS 1A0JA 2VNTA 2M5TA 3ATKA 1P02A 1FY5A 3P8OA 4NZLA 1DWBH 1O2GH 8LPRA 2PUXB 1JIRA 4X1QU 4GSOA 1QBVH 3RXFA 5E2OA 3NPSA 1YPLH 2CGAA 2BQWB 1TMTH 2W26A 1HJ8A 1V2NT 5A8YA 3VB3A 1Y3XA 2G00A 2SGDE 5E0HA 1SI5H 2JETB 1TMUH 1DFPA 1O2ZA 3RMMH 3MNXA 3SU2A 1GCTC 1YC0A 1XX9A 3BV9B 3A85A 3VB6A 4X8SH 2J95A 1F5LA 1ELCA 1FNIA 1QBNA 9ESTA 4IMQA 3TJUA 1F7ZA 1G30B 1LVYA 3UNQA 4ZHMU 2A0QB 1C2LA 4A1VA 1ZLRA 3LC5A 1YPEH 5DP3A 2BYAX 4X1RU 4SGAE 2Y82A 3S7KB 2PGBB 4FUBA 4R0IA 1D3DB 3UY9A 4WJG2 1TQ7B 1CO7E 1UTQA 2G55A 2PTCE 1OWHA 1RGQA 1TWXB 1ZMJA 2ZF0H 1LTOA 3T25A 1C5RA 3U8TH 2SGQE 4AN7A 3TH4H 1HCGA 1WTGH 2ZHEH 1V2UT 2A2QH 2BLQA 2OQUA 4MPWA 1WTHD 2JH5D 1FAXA 4X6PA 4IN2A 2C93B 3T5FH 5SGAE 2A7CA 2R9PA 2ZFTA 1PFXC 1QQUA 2GVFA 1GJ7B 5GCHG 3ZZBA 5AFZH 1AB9B 1DPOA 3DD2H 1P2MA 2CHAC 1SHHB 7ESTE 2ZFSA 1XVOA 1A3EH 4TWYA 1H4WA 4O3UA 3QUMP 3QX5H 1P2IA 1S82A 3O8RA 4FVBA 3BG8A 1Z1IA 1TABE 2GDDA 1O2VA 1QB9A 2ZEBA 4K1EA 2BVXH 2P3FH 1L4DA 3O8CA 2HALA 1GI5A 2TRMA 2WPKS 1HXEH 4XOJA 1TGNA 4E7NA 3GICB 1EATA 1O5DH 5GPIB 1O38A 1KLJH 4FU7A 1L1JA 1TPOA 2ZU1A 1VZQH 2G52A 2JKHA 2UUYA 3GCTF 1O5EH 4WVPE 3LC3A 1MTUA 1EZSC 1WAYB 2HNTF 3V13A 3RXSA 1IQJA 1SSXA 2RDLA 1P12E 1GCDA 1Y3YA 2GT8A 2BXTH 1BMAA 1G3DA 1KXEA 2XBYA 1V3XA 1BTWA 3M3SA 2ZGBH 1HAPH 4ISIH 1O3PB 3LIWA 1TNJA 4AX9H 1ANBA 5IYTA 2FOEA 2OD3B 1EX3A 1UO6A 3B9FH 4FVDA 2JH6D 3A88A 1DM4B 2ZDNA 4XDEA 5EQSA 3RDZA 3VB5A 1UTNA 3PMAB 5FX5A 4BAHB 1TGSZ 4JK6A 2CMYA 1G3CA 1EASA 1TBRH 2FTMA 1KSNA 4A5TS 2ZDVH 3RP2A 2RA3A 2I6QA 1OWKA 5EOKA 4ABIA 3RXBA 2Z9JA 2O9QA 1IQGA 1PPFE 1LHEH 2B8OH 3FFGA 1TNGA 1C1PA 1DY9A 1FY1A 4DURA 4TYDA 3K2UA 1HAZB 2BVRH 2OUAA 2OCVB 3SGBE 3ZVDA 5EPNA 1SGRE 4UFDH 1C5WB 2OC7A 1J16A 1OX1A 1C2KA 1HJ9A 3MH4A 4JZDH 3S9AA 5AFYH 2PSXA 1V2RT 1C9TA 3HK3B 4HGCA 1NT1A 4GPGA 1IQFA 1J17T 2A2XH 5C5NA 3D62A 2PW8H 2YOLA 1PPBH 2PGQB 2DUCA 4ZKNU 1TNHA 2HRVA 3MNCA 1YCPH 3K6YA 2QY0B 4NG9H 2ZGHA 3L3TA 4X8TH 1ELEE 3FP6E 3TJOA 1O2IA 1RTLA 2Z9GA 1J8AA 1TX7A 1K22H 2C4FH 4WF8A 4Q2KA 3SV7A 2BDIA 2UUFB 1O3NA 1DDJA 1QR3E 1SGPE 3NXPA 3RC4A 3T28A 1VR1H 1QRXA 4E06H 2C8ZB 3SJIA 1ORFA 1ESBA 2GZ8A 1TNLA 2SGEE 1G2LA 5T6FA 1BRUP 4AORA 3QZRA 2PKAB 2EC9H 1PQ8A 1INCA 1O3EA 1TRYA 3PTNA 2AEIH 2FWWA 4FUEA 1C2GA 3DFJA 3KEEA 3PB1E 2BDHA 5J4SA 1BTUA 3SV6A 1HRTH 1WV7H 2FEQH 3LPRA 3LH3A 1UK2A 2O8UA 4K3JA 2NU0E 1SOZA 1BJUA 3MFJA 4IMZA 3QO6A 4YO9A 3TLOA 2PSYA 3MI4A 1OOKB 4Q7ZA 2ILNA 3RXIA 1BRCE 4U30A 2PLXA 2BVSH 4OGXA 1TPSA 2P95A 2O8WA 3PMBB 1O2RA 1QL9A 4A92A 1QGFA 2AMQA 1IQNA 1K1MA 1S6HA 1ANEA 1UHBB 1Q31A 1C5XB 3GYLB 2RG3A 1S5SA 3ZZ9A 5A09A 5LH8A 3F9FA 2RA0A 3E1XB 4FUJA 4DW2U 1YPHC 3ZZAA 1QJ1B 5ESBA 1GBIA 1RS0A 3UOUA 1IQEA 5EW2H 1GDUA 2R0LA 1BRAA 5TJXA 3RXOA 1V2VT 4FUFA 3RC5A 1L2EA 4B2AA 1EJMA 1KXCA 1W11U 2CJIA 3FANA 1GJDB 1BA8B 1GI9B 1OPHB 1V2PT 3UREA 4LK4A 3URDA 1N8OB 1GBLA 1E0FD 1MKXH 2YNBA 5E2PA 1E37B 3DHKH 4Y79A 3P8GA 1P2OA 3P8NA 1K1LA 1ZRBA 1YKTA 1NRNH 4FUIA 3VFEA 3TITA 2WPMS 3U8OH 1G3BA 1O2YA 2B9LA 4QT8C 1PPCE 5JBCS 1ETRH 4NWLA 4X1NU 1THPB 2VIDA 3TPIZ 2ZHWH 3QK1A 1IHSH 1AU8A 4BNRA 2OQ5A 3M7QA 4MNYA 2BD3A 1FPHH 1L1NA 3LDXH 4WXIA 1EPTC 1O3MA 1HLTH 2J38A 5FHTA 2I6SA 1C1OA 1KXAA 4ZUHA 1C5VA 1QRWA 4K2YA 4BANB 2BDAA 2ESTE 1NRRH 3RXRA 1QB1A 1O39A 3O8BA 3RXLA 4Y0YE 3E6PH 1MKWK 3OU0A 1GWAA 1NRSH 4K1TA 1NROH 4BXWA 2GKVE 2F83A 2R2MB 3SUGA 1H1BA 1QA7A 2FOHA 3MO6A 1ZTJA 2QGRA 5CHAC 1ABIH 1LQEA 3BG4C 1RJXB 1H9IE 1WU1A 4BTIB 1NN6A 2AGIX 1THRH 5FPTA 5C1XA 2ODYB 2ZFPH 1CSOE 1MQ6A 1P2QA 4DIIH 4DG4A 1YPMH 1EZQA 1OWDA 3C27B 1BIOA 4AGJA 3E0PB 1C2HA 1PQAA 5EPYA 3ZV8A 5JB8S 5LPRA 1GHAF 2KAIA 4NWKA 4BAKB 1C5TA 5DGJA 3RXDA 4BOHA 2FOBA 5GDSH 1GMCG 4JYTA 2GCHF 5A0BA 2F9OA 1EB1H 3S7HB 3AVZA 3EA9A 1PJPA 1W14U 2P59A 3BEIB 3M5OA 1GMHF 1SGTA 1OKXA 4INKA 2V35A 2FS8A 1QURH 1TMBH 3TH3H 2WYJA 1IQLA 4AZ2B 2H6MA 3BTDE 4FUGA 1Z7KA 2ZHDA 1ZMLA 3PWBA 1W7GH 5H4IB 1KY9A 3SUEA 1NO9H 3RXMA 2GDEH 2Z9LA 2PKSB 1A0LA 1OWEA 4FUDA 3E3TA 2AGEX 1PQ7A 3SU6A 5LGOA 1UTMA 1V2WT 5EG4A 1O3OA 3TJVA 2AGGX 1SGQE 2UWOA 3S0NA 1OXGA 6CHAB 2FZZA 3MO9A 1P0SH 1GI0A 4ABDA 1BTXA 1P2NA 5TCAA 3F9HA 3EA7A 1XUGA 2BY9X 3JZ2B 1SLXB 1P03A 1P3CA 3RMLH 4D7GA 1N6XA 1SQOA 1HAIH 2ZC9H 4X6OA 1K1PA 3PMJA 1B5GH 1K1NA 1WOFA 1YPHE 2D26C 3LGUA 4I8LA 5LPFA 2ZKSA 1VJ9U 3GY5A 5IDKA 1DLEA 2FI4E 4JMYA 1UCYE 3GY3A 4B74A 4PROA 4Y76A 2BHGA 3E90B 2ZI2H 4UD9H 2WINI 4B75A 1BMLA 2ANKH 2ZGXH 2GGVB 3EQ0H 1TX6A 1NU7B 2IOTA 2W7SA 3RU4T 1CGJE 1QL8A 5C3NA 1UVUH 3BF6H 3UIRA 2FP7B 1P04A 1GHZA 5EXLA 2PV9B 3UR6A 3PWCA 4BTTB 1V2OT 1W10U 1SHYA 3AAUA 4GLYA 1KLTA 4CHAC 2EI6A 1O2QA 4BAQB 2DE8A 1A4WH 3LT3A 2Y5FA 1GHVH 1DUEA 1SLWB 1Z8GA 4GHTA 1NU9A 2ZCLP 3RMNH 4B73A 1YLDA 6GCHF 1YBWA 2FTLE 2J9NA 4CR5A 3AW0A 1MD8A 2FS9A 1ZR0A 1MTNB 1PYTC 1UCYH 3TGIE 2NU4E 1HB0B 3M5MA 3PO1B 2R0KA 2QC2A 2H9HA 1O3KA 2VB0A 1QHRB 1O3DA 2ZGCA 1SGEE 4MPUA 3BEFB 4ZKSU 1W2KH 1CU1A 3H7OA 1MTWA 3M7UA 4O3TA 5ETXA 2VIOA 4NIWA 3MH6A 4AB8A 4X6MA 2JETC 4BAMB 3U1JB 5F8XA 2BZAA 3M7TA 3CS0A 1XM1A 5FPSA 8GCHF 1BBRK 1G36A 4Q7XA 1LO6A 1TNIA 1F5RA 1G37A 2C3SA 1O37A 2TIOA 1GBTA 3A8BA 5FCKA 1EB2A 1ZMNA 3URCA 2GMTB 1FY8E 1GL1A 2A1DB 1K21H 4IS5A 2LPRA 1EQ9A 5EQQA 2PFEA 2TGTA 1JBUH 1HBTH 2FODA 2UWPA 2F9UA 2A5IA 5EXNA 1Y8TA 1ZPZA 1GJ6A 1NC6A 2VGCC 1V2QT 3SGQE 3L33A 2GV6A 2XBXA 3U9AH 1O2XA 2Q6DA 3T2NA 1QTFA 1DVAH 4FUHA 2WPLS 3IWMA 4ABGA 1K1IA 1HNEE 1XXFA 1CGHA 4AFZA 4BAOB 3RXEA 3LOXA 1GHBG 2ZTZA 4U32A 1Q3XA 4OS2A 2ZU5A 3SI4H 4Y8XA 1SLVB 4GCHG 1D9IA 1S85A 4B2BA 3RMOH 2H9EH 1IHTH 5FCRA 1BJVA 2GV7A 3U69H 1AHTH 2FOFA 1FXYA 5T6GA 1TGTA 3SJOA 2XCNA 3OSYA 2H9TH 1T4VH 1D6WA 4ISOA 2ZTXA 3TVJB 1SLUB 5A2MH 2HLCA 2NWNA 3EAJA 1DT2A 5E0JA 1C5PA 3A7VA 1FMGA 3LONA 3VEQB 5HM9A 1HUTH 1OYTH 2UUKB 4BXSA 1Y5BT 2IN2A 1HAVA 1YPJH 5EQRA 1LHDH 1ARBA 2XC4A 4FXGH 1EUFA 1WQVH 2XWBI 1CT0E 1BZXE 3ENSB 4IBLH 3UWIA 1MAYA 3PLBA 5E0GA 3G01A 9LPRA 1GCTB 3I78A 1AY6H 2PTNA 4MDSA 3RXHA 1C4U2 4NCYA 1BTYA 1O2UA 3ZYDA 1TA2A 2QXGA 4D7FA 3SV2H 2CF8H 1DWDH 2Y5GA 3Q00A 2F3CE 1GDQA 1FONA 4X2YA 2BDCA 1O5BB 3ZZ6A 4RKJB 4UDWH 2BD2A 5T3HA 2ASUB 1D3QB 2KAIB 7GCHG 2HVXA 4K5ZA 4Y6DA 4JZFH 1GGDC 3H7TA 3EE0B 1S0QA 4OS5A 2QAAA 4CH2B 2CXVA 3JZ1B 3HGPA 1ZSJA 2BD8A 4WWYA 2TPIZ 2STBE 4MNVA 4FUCA 3SNCA 1TA6A 5C1YA 4E05H 3SV9A 2FLBH 1FN6A 3IG6B 2Y81A 1KIGH 1IQKA 3S9BA 1AIXH 1KTSB 3RU4E 1C4Y2 2ODQA 2P8OC 4XSKU 3SU5A 2GX4A 1VITG 1SGNE 5I46H 3VB4A 1Y5UT 4MPVA 3SUDA 2VINA 1M9UA 2AERH 1S83A 1MZDA 1O3BA 2ULLA 3M35A 1AUJA 3KGPA 4WMDA 2VIQA 4WH8A 3SU0A 4TWWA 3ATIA 1TGCA 1SMFE 5JBTA 1XUJA 3ZVGA 2BLOA 1A5HA 1D6RA 1GMDG 1GBBA 1BUIA 1AZ8A 1W8BH 2XYAA 1HIAA 1C2MA 2XTTB 4F4OC 1T8LA 2FDAA 1ANCA 3KQBA 4XE4A 1U6QA 1GBDA 1O3CA 4UFFH 4U01A 4DT7B 2F9VA 3LGIA 3KIDU 4NA7A 1XVMA 3MU1A 4ESTE 1F0TA 4RN6A 2ZDMA 4A1XA 1FQ3A 1ESTA 1O31A 3M36A 2Z7FE 1FIWA 1ZYOA 1QQ4A 1UK4A 2XNIA 1O36A 2HOBA 3GCOA 1SB1H 2A5KA 1AUTC 1NY22 1UMAH 3GDVA 3D23A 1KXDA 1TRNA 3SQEE 2BQ6B 3Q3YA 3SNBA 1EAWA 4AB9A 3MH7A 1C2EA 1C4V2 1LPKB 3PYHA 1B0EA 4A6LA 2HPPH 1ZZZA 1TPPA 2QCYA 4X6NA 1F0RA 2GCTC 1NRQH 1PPEE 3E8LA 5FXLA 3RXQA 5DKMA 3KL6A 1FV9A 2EI7A 1O32A 2J94A 4WMEA 4OS4A 1L4ZA 1ZTLA 3P92A 3RXCA 4Y7BA 4YZUA 1CHOG 1ZHMA 4I31A 3EGKH 1C5NH 2FXRA 2GD4B 1ZOMA 2G5NA 2VU8E 1C5YB 3TK6A 2XC5A 2ANYA 1LVMA 2OXSA 1C5UA 1V2JT 2BY6X 3STJA 3VXEH 2QXHA 1FY3A 1TIOA 2A31A 4YTAA 2SGPE 4X2VA 8ESTE 4B71A 2ZTYA 1ZPCA 2BY7X 4WXVA 2Z3EA 1T8MA 2Y5HA 1GI2A 4LZ1H 2ZG0H 4NA9H 1ELDE 1GG6C 5F6MA 2QA9E 4Q80A 1P09A 3T26A 1EXFA 2Z6BD 3L6PA 1WQSA 3RC6A 4Y10E 1J15A 5JB9S 5JBBS 3F9GA 3GY8A 1RIWB 4THNH 2ODPA 2WV4A 3MTYA 3T29A 3NUMA 2Y7XA 1YCPK 1N8OC 1VGCC 1KXFA 4D9QA 3EDXB 4ZH8A 2PWXA 1D4PB 1GBCA 1MZAA 2D8WA 3UQOA 2A4QA 4H4FA 2A45B 4J2YB 4WMFA 2G51A 2Z9KA 4OS7A 1GI3A 1HFDA 3UPEA 1JIMA 1Y3UA 1E36B 1LQDB 3KQCA 7KMEH 1AVWA 1TOMH 1P57B 2ZHQH 1ZHPA 1LKAA 2OINA 2SNVA 3VGCB 1CT4E 1JMOH 3FZZA 3RXJA 4KGAA 1AVXA 1BQYA 1F92A 2ZECA 2ZA5A 2R3UA 1TGBA 4I33A 2F9BH 3RLWH