2F9PA

Crystal structure of the recombinant human alpha i tryptase mutant d216g in complex with leupeptin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha-1
publication title X-ray Structures of Free and Leupeptin-complexed Human alpha I-Tryptase Mutants: Indication for an alpha to beta-Tryptase Transition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9pA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9pA01
3PLPA 1O3OA 2CHAB 1GG6C 1ELFA 1ZSLA 1P2NA 1LPGB 2HNTE 1J15A 3F9HA 4HTCH 2XYAA 3GY8A 1L1NA 3LGTA 1O3BA 5CHAB 3O8DA 1NRQH 3LC5A 4CRCA 3BEIB 4NIWA 4YLUA 5BPEA 2UUYA 4JYTA 4FU9A 1EX3A 2GT8A 1FPCH 3MU8A 2AERH 1AB9C 2P16A 3V3MA 4B74A 4Y8ZA 1IQIA 1FONA 4UFFH 2WV5A 3I29A 2TGAA 5C5NA 4NCYA 5A0CA 4A7IB 1P2JA 1QBOA 1H8IH 1C5LH 2FOHA 1MQ6A 3RC5A 3TK5A 4Y0ZE 1W7GH 2OP9A 3O8RA 1T8OA 3W95A 5A8YA 2PLXA 3P8FA 2ZDLA 1C5RA 4GAWA 4K8YA 1GI1A 1YPMH 4AB9A 3C27B 2PUQH 3TIUA 1YCPH 4OS2A 4LZ1H 1DWEH 1LHCH 2DUCA 3SZNA 1C5YB 1VCWA 2A4OA 2O8TA 2AYWA 2B5TB 4E7RG 5JB9S 2D2DA 1ID5H 4MQAA 3L3TA 2YNBA 2XNIA 4ABIA 2BVXH 1C2JA 3ZZ8A 3K6ZA 1AKSA 1NFUA 1VITH 5A8ZA 2Y5GA 1F0SA 4X8TH 1P9SA 2V6NA 8ESTE 3DFLA 4ISNA 1O3FA 3UPEA 1LVBA 1ZHRA 1C1WH 1OWKA 2BDHA 2FOMB 1TPOA 2Z3EA 3LGYA 4U32A 2VIQA 2EEKA 5TJXA 3PMHB 1CU1A 4OGYA 5JPMH 2VGCC 1ZLRA 2XTTB 1BMLA 1HNEE 2BHGA 1MZDA 3D23A 3QZQA 1TA2A 1EPTB 3LGUA 1ELGA 1OX1A 1DT2A 1DM4B 2F9VA 1Z71A 1W7XH 1HAYB 2ZNKH 2VH6A 1GHBG 1NRNH 1ZMLA 1J8AA 1BUIA 3LJOA 5C2ZA 4IMQA 2PKAB 1O3NA 3BV9B 2OD3B 1S83A 1SGYE 3SJKA 2OC0A 1GJ6A 3A8BA 1P8VC 1HAPH 3BTGE 3ATIA 1P2IA 3VGCC 5I46H 2QXIA 3ZZ6A 1XUIA 1C5TA 4I31A 2ESTE 1MKWH 2ODPA 4WMDA 4BANB 3TNTA 3PMJA 3E1XB 4IN2A 1AE5A 1TNGA 3U98H 1FJSA 2C90B 1Z7KA 1LKBA 1G3EA 4D76A 3VEQB 1AU8A 1KXFA 1EJAA 2JH0D 6CHAB 2W7SA 1AZZA 4H4FA 3A88A 1ETSH 1GBIA 1NESE 1FI8A 5GPIB 2BDIA 1BBRE 1HAGE 2YNAA 1A7SA 2ZO3H 3RXHA 3HK3B 4BXWA 5GXPA 1K28D 1J17T 1UK4A 1HJ9A 1ELEE 1GMCF 1A5HA 3BF6H 2BQ7B 2FLBH 1BQYA 5K7RA 1GI6A 1C5PA 4IMZA 3GCHB 1AN1E 1DX5M 3A8DA 2QXGA 2W3KA 3MMGA 1OWEA 1TX8A 1D3PB 4CRAA 1VITF 2BOKA 2JH5D 1ZPBA 2ZHWH 1DXWA 4PROA 1IQKA 1FN6A 1INCA 2CN0H 1SLXB 1WCZA 2ZCLP 1P05A 3MH7A 4B73A 2Z9GA 1BZXE 1Y8TA 1HCGA 3KNXA 1HJAB 1OP0A 1F0TA 1FY4A 3A7YA 1ABJH 3MNBA 1UJ1A 1TOCB 1ELCA 1O31A 4KTUA 1EOLA 3V0XA 4E06H 3ZVAA 2NU4E 4CREA 3KN2A 1E36B 3EYDA 2QF0A 3AAVA 4AZ2B 1OYQA 1O2OA 2A5IA 3LOXA 3SUGA 4ESTE 2BY5X 7KMEH 5SGAE 1RRKA 2UUKB 2BVRH 3MI4A 5FBIA 2HALA 1P10A 2P8OC 2JKHA 3E90B 2BDGA 3UOUA 1RFNA 3RU4T 3ZZ7A 4ABFA 2BD2A 3TH3H 4O03A 3PB1E 4O3TA 3KIDU 4RKJB 3RXAA 1V2KT 1GVLA 1RD3B 1BRUP 2O8UA 1N6YA 4UFDH 2B9LA 1ZSJA 2W3IA 5DPAA 1GL0E 3VXFH 4D9QA 1CVWH 2AGEX 1FMGA 3BIVH 2ZEBA 1UTKA 1V2ST 4DG4A 3OYPA 1C2DA 3E0PB 1VJAU 2PFEA 1O2LA 1DDJA 1SGEE 3NKKA 1YGCH 3ZVDA 5C5OA 3SN8A 3LGWA 3TJOA 2ALPA 4FVDA 6LPRA 4CBNA 5DP5A 3TITA 2PWXA 1MUEB 1GHZA 1TALA 3AASA 3QTOH 3AW1A 2ZFTA 4CBOA 4HGCA 2F3CE 4WH8A 4K5ZA 1S85A 1GJ5H 1LHGH 2BDAA 3M3VA 4F4OC 3DD2H 4BAOB 1QHRB 2QYIA 3RMLH 1IQLA 4Y7AA 2G5NA 3O8BA 3GICB 3RMMH 5LPRA 1QTFA 4JZDH 1P11E 1VITG 1YPLH 5PTPA 3P17H 1O35A 2B0FA 2FTMA 1O2WA 1TGBA 2OBQA 2A4GA 2Y7XA 1TFXA 2F9NA 2OC7A 2I6SA 1XX9A 4AFSA 1T31A 4ABBA 9LPRA 1GI4A 3K65B 2BXUH 4I8LA 1E38B 1DPOA 3JZ2B 4NGAH 1AHTH 1YKTA 1QFKH 1WTGH 5FCRA 1DS2E 3SNDA 2FYRA 4HI3A 4B76A 5DP3A 2ZHQH 2VVCA 3SNBA 2ZDAH 4VGCC 4MNWA 3A83A 1V2PT 3QGJA 2BOHB 2TPIZ 1AMHA 1BRAA 2RG3A 4YTAA 3SU4A 5GDSH 2QC2A 3U69H 5JBAS 2H9EH 3MH5A 2F9OA 1HXFH 3M36A 2TIOA 1J16A 3HK6B 1C2IA 5CE1A 3EA7A 1E35B 4CH8B 2GKVE 1SFQB 1TRNA 5E0JA 1P3CA 1AVWA 3FP7E 1GDUA 4XFQA 3VPKA 1K21H 1S82A 3NWUA 2NWNA 4ZUHA 1O3PB 4X1NU 1HFDA 3BEFB 3VB4A 1C4Y2 1NRPH 1O2YA 3ATLA 2Y7ZA 3MU4A 3UR9A 1AQ7A 3UNSA 4BAHB 3RMOH 5J4QA 2FOEA 3A86A 3OSYA 3SU3A 3FAOA 1YP9A 1W12U 1P2MA 1VJ9U 3RXDA 3PMBB 5CMXH 1C1NA 1OXGA 1K2I1 1SQOA 2ZHFH 3FVFB 3RC4A 1C1TA 4TY7A 5EODA 1K1NA 1B0EA 1IQJA 2Q1JA 1W14U 2SGFE 1XUHA 4X2WA 1XKBC 2C8ZB 2ASUB 4KP0A 5EQRA 4KKDA 1DOJA 1WBGB 4YESB 3ZVCA 4U2WA 1XXFA 3BTFE 1ZPZA 1SHYA 1TNJA 4YOGA 2ANWA 1BA8B 5HYOA 1E0FD 6GCHF 2DE9A 4FUEA 4GCHF 3RU4D 3TNSA 1O2IA 2A0QB 2AS9A 4ABJA 3SU5A 3ZZAA 1MQ5A 2O8LA 2ANMH 1G2LA 1UK2A 4FVBA 3BTQE 1AUTC 2GZ7A 3M37A 2R3YA 1BTYA 3T29A 3GDVA 1O2VA 4DW2U 1UTQA 4FU7A 1G30B 1IQNA 1NFYA 2Q6DA 2THFB 2AGIX 4ASHA 2D1JA 4IS5A 2V35A 1GGDC 1NZQH 1CE5A 1QBVH 5E0HA 2EC9H 1C1QA 4X1SU 4FUCA 2PV9B 1V3XA 4X2YA 3T62A 1YPHC 4X2VA 3ESTA 1GDQA 1AIXH 1MCVA 1EJMA 5A0BA 1SC8U 3FFGA 3GY5A 1CT0E 1S0RA 3OTJE 1CBWC 1CT2E 1QB9A 1EAUA 3TJNA 1QNJA 1O5BB 2D26C 2D8WA 2PKSC 1KYNA 4I8GA 5ESBA 2QGRA 4OGXA 3CS0A 4JK6A 1D3TB 1GJ8B 2ZI2H 1EB2A 3DA9B 2FOAA 2ZU1A 3RC6A 4NA7A 1FIWA 2ZA5A 1P0SH 2C93B 1XUFA 1TGNA 2IOTA 1WQSA 3RXEA 1AFEH 1BTPA 1MTNB 2BDCA 3S7HB 1CHOF 3P95A 5ABWA 1O3IA 3LJJA 2BQ6B 3M7QA 4CRGA 2AFQB 1SGIB 1V2RT 1TB6H 3ZZ4A 1FIZA 4FUGA 2GV7A 1GHXH 2W7UA 4UONA 4ZAEA 1A1RA 1JIRA 4ISOA 1SB1H 3RM2H 2GVFA 5E8EH 2F91A 5AFZH 4B2AA 1EAWA 3RXJA 4CRFA 5EQSA 2HNTC 2PGBB 2XW9A 2PHBA 3OY6U 3RLYH 3P70B 1SQTA 2P59A 4TWYA 2Y82A 3Q76A 1DWCH 4WJG2 2BVSH 1EB1H 4A1XA 1CA8B 3B9FH 4YM9A 1BBRK 4BXSA 3KL6A 1AZ8A 1W0ZU 3L6PA 4GCHG 4XBDA 1ELTA 5I25A 3SI4H 1C5MD 1PYTD 4WMFA 3UWJH 1F7ZA 2G55A 3SI3H 1C9PA 1K1LA 3GY7A 4TYDA 2FS8A 1GI3A 4GHTA 1GVZA 5DP8A 3RM0H 4AN7A 3RMNH 4BTUB 1ZTLA 1EZXC 3B8JA 5H4IB 3PO1B 3KGPA 1C5QA 3M3SA 5ETXA 3VB3A 3URCA 3S7KB 2ZU5A 2FOGA 2WPIS 3KHVA 2ZPRA 2ZPSA 2GGVB 5DKMA 5F6MA 2GMTB 1CGJE 1O2QA 1S84A 3UOPA 1C5XB 8LPRA 4Z6AH 2JETC 1T32A 2CMYA 3KQCA 1IHTH 3ITIA 1QCPA 3M7UA 1A5IA 2G5VA 1SHHB 3MOCA 5F8ZA 1RXPA 1BITA 1EPTA 4GLYA 1VR1H 3SU0A 4IGDA 1LKAA 2P95A 3FP6E 3HGNA 5A8XA 1MU6B 1O3DA 5EPNA 1H9LB 1HAXB 4JZFH 3HGPA 3GYMA 2XBYA 1OPHB 2CHAC 1FY5A 4ABAA 1JMOH 1IAUA 4OS6A 1SI5H 1TQ0B 3F9GA 1L4DA 3BTME 2Y5FA 1W2KH 4UE7H 5LH8A 2ZP0H 1FAKH 1LHFH 2BZ6H 3STIA 3URDA 1SLVB 1WYKA 2ANYA 2GD4B 3SUDA 1Y3VA 1BCUH 3BG8A 1L1GA 1CHOG 1B0FA 4UFGH 1ZJDA 4X6MA 1GJAB 4A6LA 2R0LA 3MH4A 1AB9B 3SNCA 3B23B 1C5UA 3Q3YA 2HNTF 2VWMA 5EXMA 1CGIE 1LHEH 3GDUA 3W94A 5AHGH 1HIAA 1SGTA 2EI6A 1TAWA 3SJIA 2P93A 3QTVH 4TWWA 4DIIH 1YPEH 1SL3A 5EXNA 1FLEE 2BX4A 3RXLA 3QGNB 5FHTA 1ELAA 2HGTH 3TH4H 4SGBE 1GCTB 1DUAA 2C8YB 2BLWA 1O3JA 3MO3A 1A4WH 1TPSA 4X2XA 1TPPA 4BNRA 1SLWB 3SQEE 1V2TT 1BOQA 3A89A 3LH3A 1KLJH 3AAUA 1GCDA 3HKIB 4JMYA 1GBTA 2UUJB 2VIOA 3PLBA 5FX5A 5DP9A 3SV6A 1LDTT 1O2PA 3PM3A 1BBRH 1Y3UA 5EU8A 2Z9LA 3HATH 3H5CB 5C1YA 2W5EA 4AGKA 3RP2A 1A46H 2V3OH 1DSTA 4D7GA 1KDQB 1S0QA 1O5AB 3SQHE 1ETRH 4I8JA 1N8OC 1VGCB 4CHAB 1GBAA 1C9TA 2WUBA 3P8GA 1Z6JH 1EPTC 1RJXB 1T4UH 3A7WA 1NT1A 4DGJA 2OLGA 2AGGX 2Z94A 4LZ4B 1LTOA 1FXYA 1E34B 2G52A 5FX6A 4NIXA 1TABE 5EQQA 1NTPA 1UTPA 1BHXB 4ZHAA 1O3HA 2ZU3A 1V2JT 1AGJA 2F9PA 2HOBA 3MNXA 3MFJA 3VGCB 3P92A 1BB0B 2H9TH 1B5GH 1BRCE 1C4V2 1GBMA 3M3TA 2P94A 4TPIZ 1TONA 3UREA 1OP2A 4IC6A 1JXPA 2PSXA 4U01A 6CHAC 2VWNA 1NS3A 1GJCB 4K1EA 2R3UA 3ZV8A 3A7ZA 2BD8A 3A85A 1O5FH 2HLCA 3U1IB 1B7XB 1UTOA 1TPAE 1UVOA 1AD8H 2Z9KA 1SGQE 1UTJA 1GI5A 1ESAA 1NY22 2J94A 1GWAA 2R0KA 4E05H 3VB6A 1DSUA 1O2KA 1BTUA 1DUEA 5TCAA 5JDUB 1S81A 4OS5A 1SGFG 5EPYA 3H7OA 8KME2 3GCHC 1O2NA 1TMUH 2UWLA 2J92A 4Y76A 1GBJA 1F5LA 1ZGIA 3IITA 4ZKRU 2XCFA 4UEHH 4NFFA 3RXUA 1YLDA 1EZUC 3RXRA 1VZQH 5EG4A 3T2NA 1ZRBA 2QY0B 3NZIA 1P2KA 2NU3E 2QAAA 4CR9A 3NXPA 4LK4A 1KXBA 3ZZ3A 4UDWH 1UCYK 1HJAC 3GY2A 1WAYB 2BY8X 3MU1A 4DOQA 1AKSB 2CJIA 2TGDA 2BXTH 1ARCA 4D7FA 1L4ZA 3F1SB 3TVJB 4Y71A 1O2UA 4WH6A 2GCHF 2JH6D 2RA3A 2Z7FE 2ZQ1A 3ATKA 2K1QA 3E6PH 2ZWLH 4K1TA 1NO9H 4Q80A 3E91A 4H6SB 5E2OA 4SGAE 3KEEA 1HBTH 1TGSZ 3TK9A 1YCPM 1DY9A 1SGDE 1T7CA 1OWJA 2KAIB 1BMMH 1BTXA 2ZDVH 1HXEH 1MKXK 1BDAA 3RLWH 1OYTH 4NIYA 3QX5H 4INKA 1TX6A 3ATWA 1QRWA 3RXOA 3MNCA 2PGQB 3ZZ5A 1S6FA 1F0UA 2A7CA 1M9UA 3RXCA 5JYIA 2ZZUH 1O36A 2BQWB 1UHBB 3S69A 5A2MH 3QWCH 3A7XA 3ZZ9A 4AG2A 4ZXXH 1O34A 4MG3A 1LCYA 2XC5A 1Z1JA 2Z3CA 1O3EA 2VH0A 2BMGB 1EUFA 2WINI 3QLPH 5IDKA 4LXBH 4NWLA 3MO6A 3SU1A 3UNRA 5L2YH 2VB0A 3E3TA 1TNIA 2I6QA 4Y6DA 5JBCS 3F68H 3QN7A 2FM2A 4ZKNU 3FZDA 1A61H 3UUZA 3GCOA 1RIWB 5E0GA 1P12E 1ZHPA 5DP7A 1MD7A 4AG1A 4WVPE 4J2YB 1DXPA 4ISIH 1AWHB 1TQ7B 3S9CA 1PPFE 2ZGJA 4DURA 4FUJA 1ZMNA 1THSH 1TYNA 1IOEA 1GJ7B 1MH0A 2CGAA 2ZHEH 1GMDF 3SV7A 1HAVA 1QY6A 2BD3A 1UK3A 2TGTA 1W13U 4I33A 2A4QA 2FLRH 2FTLE 1SLUB 2AMQA 3SGAE 2QV1A 1Y5UT 1EAXA 4MPWA 1QQ4A 5ESTE 3UIRA 4Z0KA 3SUFA 1SVPA 3V7TA 4CRBA 4B2BA 1EASA 2A4RA 3T27A 1HB0B 1OKXA 2STAE 1K1OA 2AEIH 1UVSH 2GCHG 2CF9H 2XBVA 3GYLB 2G8TA 3NCLA 1ACBE 2ZCKP 1ZOMA 1D6WA 4B71A 2NU1E 5FPYA 4JYUH 3PMAB 2ODQA 2PR3A 1BT7A 4QT8C 4A1VA 2Q6FA 3TJVA 4I7YH 1CQQA 2G4TA 1NFWA 1KIGH 2GDEH 2A45B 4BOHA 1T8NA 1SGPE 2HRVA 4AOQA 2ZGCA 3BEUA 2WPJS 4MTBA 1WQVH 1D9IA 2WYJA 2ZHDA 1DANH 3BG4B 3MYWA 1MMJN 1UTNA 5DG6A 1UMAH 1TA6A 1MKXH 1WU1A 1BMNH 2GTBA 1V2MT 5FCKA 1A3EH 4NZLA 1S6HA 2OC8A 1YBWA 4R8TB 3U1JB 5IYTA 3VXEH 3M5OA 1JRTA 3QDZB 4YLQH 4B1TA 2BDBA 2G51A 2XC4A 2ZDKA 2P3TB 1LPKB 3P6ZB 1V2NT 1Q31A 1H8DH 5E2PA 1C1UH 3OX7U 2LPRA 5EW1H 5F8XA 4DCDA 3EDXB 2RDLA 1UCYE 2ZG0H 4A5TS 4AYVB 2AIQA 2QXHA 2TGPZ 1G3DA 4M7GA 2ZGXH 1CA0C 5JBBS 3FP8E 1MAYA 1SGCA 3U8TH 3U8OH 4E7NA 1MTWA 3CS7A 3KF2A 1F5KU 1IQHA 3E8LA 1O2RA 5FAHA 5DO4H 2FPZA 2VWLA 1P03A 3F9FA 1UVTH 4IN1A 5HM2A 4MNVA 2OBOA 3LH1A 1AFQB 2IPHA 4ZHMU 1T4VH 3UQVA 4NFEA 2GCTC 1SGFA 2FO9A 1Z8JB 4I8KA 4YT6H 1F5RA 1YM0A 1GMDG 2ZFQH 1OP8A 5EXLA 4X1RU 2FX6A 1BRBE 1RTLA 1UTMA 1P9UA 1FY1A 3ENSB 2XXLA 1C2LA 3V12A 2BLOA 5JBTA 3RXMA 2ZFRH 3BTKE 3LGVA 3QUMP 4YO9A 1GPZA 3PTNA 1U6QA 1WUNH 5DGJA 3EA8A 1O2JA 3UNQA 1O3MA 1C1SA 2G81E 5C1XA 2TRMA 1KXAA 1WSSH 3ZZCA 3M5LA 2GDDA 1TIOA 1V2OT 3BTDE 1ZHMA 2BX3A 4MDSA 1HPGA 1CO7E 5T6GA 1TGCA 1Z6EA 3OU0A 3E16B 2RCEA 1QBNA 2VNTA 4XBBA 1GBBA 2A1DB 2H1UA 4I8HA 5AFYH 1HAOH 1KXEA 3V13A 1FDPA 5GCHF 4Y10E 1CT4E 1D3QB 1OWDA 3GY6A 2FOFA 1ESBA 4RSPA 1J9CH 1O3KA 3GCNA 3SW2B 2LNCA 3P8OA 4DT7B 1EQ9A 2VIDA 2ZGHA 1GJDB 3ZVFA 1QL7A 1GBKA 2ZF0H 1MD8A 1EJNA 2OQ5A 1QA0A 2ZU2A 2BD4A 2BD9A 3GISB 1MTNC 2Y80A 1GVKB 3MU5A 1MTVA 2H2ZA 1GBHA 1PPZA 3LIWA 1Z8RA 1L0ZA 1C1MA 3RXPA 2BD5A 1QRXA 1K22H 3SV8A 2ODYB 2WUCA 3LU9B 1FPHH 2SNWA 3MU0A 1P57B 4GHQA 1O33A 1J14A 8GCHG 2ZFFH 1ELBA 4H42U 4WWYA 2EI7A 4MPVA 1JOUB 3A8CA 1FY8E 1NRRH 3SJ8A 2FI5E 1Z8GA 1BTHH 2F83A 1K1IA 3M5MA 4XDEA 3QZRA 1P02A 1EZQA 2OCVB 4FUDA 3S0NA 2XBXA 1W0YH 2Z3DA 4MLFB 4Q7XA 1TBQH 1V2QT 1YPHE 4WXVA 4XSKU 2SNVA 2O9QA 3BIUH 2SGAA 2FIRH 1QA7A 1DFPA 1ZSKA 4AGJA 1O3GA 2AMDA 2WV4A 1QQUA 3OY5U 1C1RA 5GJ4B 2V3HH 1ANBA 1IQMA 5EOKA 4AORA 1NM6A 1G9IE 1P04A 2H5CA 1KDQA 1KTTB 1KXDA 1JIMA 1RTKA 2GMTC 1DWBH 4X6OA 1BIOA 1W10U 5DP4A 4A92A 1NROH 2YOLA 4B75A 3U8RH 1PQ5A 2FWWA 1GJBB 2ZECA 2HPPH 3TJUA 1HV7A 2FESH 3RXFA 4FUFA 4IC5A 2JETB 2PKAA 1QJ6B 2VIVA 5L6NH 1W11U 3KQDA 3T28A 1TBZH 2BDYA 1GG6B 5GCHG 1GHAF 4ISLA 5CHAC 2OUAA 2C3SA 3SUEA 3UR6A 3T5FH 1LMWB 1NU7B 1ANDA 4LOYH 2FS9A 4WXIA 4X0WU 1LHDH 1TMTH 4K69A 1RTFB 4JK5A 4XBCA 5GIBA 1A2CH 3K6YA 2DE8A 1LVMA 4D8NA 1ELDE 4NA8A 3LGIA 1LVYA 2XWBI 4ZKOU 1GMHG 5FPSA 1XUJA 4JCNA 2TBSA 4FU8A 1BJVA 1SPJA 3A80A 1PQ7A 4BTIB 3KQEA 1IQGA 2IN2A 4XOJA 1NRSH 2BYAX 1AUJA 2IJOB 4ZHLU 3D49H 2J9NA 4O97A 3RU4E 4CRDA 5FBEA 5DP6A 2ZTZA 2F9BH 5F8TA 1Z8IB 3PWCA 1GBCA 2A7HA 2GZ9A 3L33A 2Q6GA 1GCTC 1ZJKA 3BTEE 4ABEA 1AI8H 3SBKA 1KLIH 1Y5BT 2GT7A 4GPGA 2ZPQA 1TNLA 2BTCE 3ATMA 2ZGBH 1TWXB 4INLA 1O2XA 2M5TA 3LDXH 5TCCA 3HPTB 4KTSA 2WPMS 2A2QH 4IW4E 2ZKSA 2WPHS 1Q2WA 1Z1IA 4ZMAH 1YC0A 1H1BA 4UD9H 4HFPB 4ISHH 5C67A 2BLVA 3RXVA 1P09A 2SFAA 1OWIA 1DE7H 1KXCA 2CXVA 3SV9A 1T8LA 3EE0B 1KTSB 9ESTA 1IHSH 3MHWU 3LT3A 1ZTKA 3M5NA 2H6MA 1PYTC 3GCTF 2HPQH 2VGCB 1PPCE 3S9BA 1VGCC 1FUJA 4CHAC 3IG6B 3ZVBA 1Y59T 1ZR0A 4ZKSU 3MO9A 1N8OB 1A0LA 1D3DB 1XMNB 1HDTH 1N6XA 2ZFPH 1HJ8A 3UY9A 4BAQB 4Y7BA 3RUOA 1QJ1B 1O3CA 1OOKB 2KAIA 1DVAH 3M35A 4Y8XA 3A7TA 1GJ9B 1UO6A 4FUHA 3VB7A 4YOIA 1QGFA 2BM2A 3P8NA 1CSOE 1THRH 1O2ZA 2P3UB 3A7VA 1IQEA 1HLTH 1S5SA 4I32A 1UTLM 3GY3A 1G2MA 2V0BA 1GHAG 4JZEH 4ABDA 2A32A 2RA0A 3ZYDA 2GP9B 1UHBA 2A5KA 1SOTA 4WF8A 1CHGA 5C1UA 3M7TA 4XE4A 2C4FH 1GHWH 1ZYOA 3EQ0H 1GI0A 1GDNA 1PPHE 3RXQA 2ULLA 2FI3E 4GSOA 3F9EA 4F49A 4ZXYH 1XUKA 2A5AA 1AWFH 1ANEA 4Y0YE 3MH6A 1C5OH 1HIAB 1C5SA 2UWPA 3UQOA 1C1PA 2VINA 3DT0H 1LO6A 4CH2B 2SGPE 2FODA 1ETTH 3AVZA 3A8AA 1JBUH 1TX7A 3BTTE 1DY8A 2BLQA 1XUGA 3SJ9A 2ZCHP 3R3GB 2F9UA 1MBQA 5T3HA 3TK6A 2VWOA 2ZDMA 1QURH 5J4SA 5G4BA 3NK8A 1FNIA 2B7DH 1RGQA 3BTHE 2NU2E 4KELA 5BRRE 5T6FA 4X6NA 5B6OA 4ZROA 5C3NA 1DICA 3PLKA 4IBLH 1O32A 1V2WT 3E0NB 2R2MB 1HAHH 2FZZA 1K1PA 1G32B 4RN6A 5HXFA 1SMFE 2ZIQH 2J95A 4X1QU 5JB8S 4BAMB 2OC1A 1TNHA 2GV6A 2UWOA 3SGQE 1K9OE 2SGEE 2VJ1A 3PTBA 2SGQE 3GCTG 4X8VH 1HUTH 2ALVA 4NZQA 1O5CB 1G36A 3SO3A 3C1KA 1C2MA 1BHXF 4OS4A 4MPUA 7LPRA 1O5DH 3JZ1B 1F92A 4NA9H 5LPFA 1EOJA 2HWLB 2GX4A 2PSYA 2C8WB 3O8CA 2P8OB 1MBMA 3F6UH 1O2HA 1P2QA 4JZIA 3CP7A 4WMEA 1HGTH 1EKBB 1O2SA 1TLDA 2VVVA 5DJ7A 4Q2KA 4CR5A 1PJPA 1GHYH 3TU7H 4MNYA 3SJOA 2EI8A 3BSQA 5DK1A 2FYQA 2VU8E 3TGJE 1C4U2 1C5NH 2FI4E 7ESTE 1QIXB 5F03A 1H9HE 1T8MA 1XM1A 2ZTXA 2SGDE 4O9VA 2CV3A 2ZDNA 1SGRE 4JZ1A 1NC6A 1WV7H 4NG9H 1ABIH 2FOCA 4U30A 2Z6BD 2ZC9H 2J2UA 5EGMA 1QL9A 1HRTH 1MCTA 3SNAA 2A31A 3ZVGA 4MPXA 3PYHA 1C2KA 1ORFA 1ZZZA 3GDSA 1PPGE 4YOJA 1RIWC 4BTTB 2ZTYA 1ANCA 2PUXB 1GMCG 4OS1A 4RKOB 4INHA 2FMJA 1Y5AT 3AW0A 2UUFB 1LQDB 3ODFA 2WYGA 1MU8B 1OWHA 1SOZA 4ABHA 1KLTA 1AO5A 3NUMA 3TH2H 1TE0A 2AMPA 1F0RA 1P3EA 3D62A 1LQEA 2C8XB 1BJUA 4Y79A 1G37A 2QA9E 1THPB 1UCYH 2O8MA 3WY8A 4Q7YA 2VVUA 3Q00A 4Y8YA 1Y3YA 1L2EA 1H9IE 3IWMA 2QN5T 1CGHA 1BTZA 2EA3A 2Y5HA 1LVOA 1GJ4H 1EZSC 3H7TA 1YYY1 3K9XB 2QCYA 3M61U 3MNSA 2FX4A 1O30A 2XWAA 3Q3KA 4HZHA 3I77A 4X8SH 4AB8A 1GBLA 1BMAA 4VGCB 1N1LA 2NU0E 3N7OA 1ZGVA 1F2SE 1P01A 1D4PB 3RXKA 3UWIA 4GUXA 1TGTA 6ESTA 1O2MA 2AIPA 7GCHF 1YF4A 2G4UA 3K2UA 2OINA 2FP7B 3A82A 3TLOA 4J1YA 3NPSA 1L1JA 1H4WA 1PPEE 3Q77A 4Q7ZA 3BG4C 4H6TA 5GWZA 2OQUA 2WPKS 1EATA 4ABGA 1O39A 1PQ8A 4R0IA 4K60A 1MTSA 2PTCE 3D65E 1ELVA 3T25A 5C20A 5K0HA 1P2OA 1QB6A 1XVMA 2Y81A 4KTCA 4AFQA 5L2ZH 3FZZA 3RXTA 1TOMH 3ODDA 2A7JA 2GZ8A 4DJZB 4DVAU 1TNKA 2A2XH 4O3UA 3KCGH 1GBDA 1V2LT 3ZVEA 1ZRKA 3DFJA 1MTUA 5HM9A 1KSNA 5LPEA 3ZZBA 3I78A 2O8WA 3SHAH 1A5GH 4X6PA 1FAXA 1O3LA 1FZZA 8GCHF 2ILNA 4ZH8A 3EA9A 4X1PU 1K1MA 1QRZA 1XVOA 3ZYEA 2XCNA 1Y3WA 5T6DA 4FUBA 3A84A 5AVDA 4FUIA 1CA0B 3SORA 1V6DA 1GI2A 1QJ7B 4BAKB 5A09A 1GI7B 1DITH 4UFEH 1AFQC 4KGAA 1W8BH 2QIQA 4X8UH 1FQ3A 5FPTA 3EGKH 2Z9IA 1EP5A 1O37A 4K8BA 1AE8H 3PROA 1C5WB 1C2GA 1HAVB 1UVPA 1P06A 1Y3XA 1AY6H 3VB5A 3LONA 1WOFA 2GCTB 2QXJA 3PWBA 1A3BH 3RXIA 1HAZB 4AYYB 2BY9X 1DLEA 3SU6A 4MNXA 2J4IA 1K1JA 2OXSA 1EP6A 1O5EH 2ANKH 1D6RA 3LKWA 4NIVA 3U9AH 2CF8H 3DHKH 3SNEA 1GGDB 3FANA 2B8OH 2Y6TA 1LPZB 1KY9A 3KQBA 1SG8B 2BB4A 5FXLA 2J38A 2STBE 2FEQH 1PPBH 2XBWA 1NU9A 1GBEA 4D9RA 5HMAA 2FDAA 3ELAH 4NWKA 4A1TA 5EW2H 1ZTJA 1C1OA 2G00A 1A0JA 1C2EA 4DY7B 1G3BA 1OS8A 7GCHG 1CBWB 1MAXA 2Z9JA 1EAIA 3QO6A 2PKSB 3RXBA 1WTHD 1O2TA 2ZQ2A 4DIHH 2H9HA 4YZUA 4TPYA 2P3FH 3LPRA 1GI9B 1V2UT 1C5ZB 1MZAA 1GMHF 1C2HA 1NFXA 1Q3XA 3GY4A 2VIPA 1HYLA 1FN8A 1SBWA 2OTVA 1G3CA 3LC3A 2FOBA 4NSYA 2HVXA 2XC0A 3PV4A 3RXSA 1VCQA 1O38A 4K1SA 1SSXA 3CENA 1JWTA 3STJA 3R0FA 5A0AE 1XXDA 1YPKH 1GBFA 1HAIH 3BTWE 2QF3A 1YCPK 3HKJB 1V2VT 2BY6X 4MVNA 1TRYA 4YT7H 3BN9A 3Q3XA 4THNH 3G01A 3GOVB 4GVUA 1OSSA 2WPLS 2XRCA 1O5GH 3VFEA 3TPIZ 1TMBH 1SFIA 1YPGH 1A0HB 3SGBE 1DWDH 1RS0A 4Y11E 1ZPCA 3EAJA 2R9PA 1PQAA 1SQAA 1BTWA 1QR3E 1DLKB 2BZAA 1GI8B 5HGGA 3T26A 3MTYA 3SV2H 2VIWA 4K2YA 2ZU4A 3TGKE 1C5VA 4OS7A 1FY3A 4AFZA 2R2WU 3TGIE 6GCHG 1EXFA 5L30H 4B2CA 3A87A 1YPJH 3SOSA 2FXRA 1UVUH 3PO1C 4AX9H 4FXGH 1GHVH 1ZMJA 2AH4X 3S9AA 3A81A 1AVXA 3MWIU 2PTNA 3UFAA 2BD7A 1PFXC 1XKAC 1C2FA 2J34A 4TY6A 1X7AC 1E37B 1QB1A 3ZV9A 4WY3A 3RXGA 1YLCA 1AVGH 1SR5C 1O0DH 3ZZDA 2ZFSA 1O2GH 2W26A 1NPMA 1QL8A 3QK1A 3RDZA 1SGNE 1C1VH 5AF9H 1O3AA 4K3JA 1JRSA 3UTUH 1GHBF 1TRMA 1VCPA 1W3CA 3SU2A 2H5DA 4JYVH 2PW8H 4NSVA 1FV9A 1MKWK 4AFUA 3DUXH 1GL1A 1IQFA 1NN6A 3SHCH 1ESTA 1ARBA 2BY7X 5LGOA 1TBRH
chains in the Genus database with same CATH superfamily
3PLPA 1O3OA 2CHAB 1GG6C 1ELFA 3KYGA 1ZSLA 1P2NA 1LPGB 2HNTE 1J15A 3F9HA 4HTCH 2XYAA 3GY8A 1L1NA 3LGTA 1O3BA 5CHAB 3O8DA 1NRQH 3LC5A 3ZIAD 3BEIB 4CRCA 2HVYB 4NIWA 4YLUA 5BPEA 2UUYA 4JYTA 5HKKD 4FU9A 1EX3A 2GT8A 1FPCH 3MU8A 2AERH 1AB9C 4XD7D 2P16A 3V3MA 4B74A 4Y8ZA 1IQIA 1FONA 4UFFH 2WV5A 3I29A 2TGAA 5C5NA 4NCYA 5A0CA 4A7IB 2GJGA 1P2JA 1QBOA 1H8IH 1C5LH 2FOHA 1MQ6A 2W6ID 3RC5A 3TK5A 4Y0ZE 1W7GH 2OP9A 3O8RA 1T8OA 3W95A 5A8YA 2PLXA 3P8FA 2HLDD 3W1EA 2ZDLA 1C5RA 4GAWA 4K8YA 1GI1A 1YPMH 4AB9A 3C27B 2PUQH 3TIUA 1YCPH 4OS2A 4LZ1H 1DWEH 1LHCH 2DUCA 3SZNA 1C5YB 1VCWA 2A4OA 2O8TA 2AYWA 2B5TB 4E7RG 5JB9S 2D2DA 1ID5H 4MQAA 3L3TA 2YNBA 2XNIA 4ABIA 2BVXH 1C2JA 3ZZ8A 2JIZD 1AKSA 1NFUA 3K6ZA 1VITH 5A8ZA 2Y5GA 1F0SA 4X8TH 1P9SA 2V6NA 8ESTE 2KZ4A 3DFLA 4ISNA 1O3FA 3UPEA 1LVBA 5EJ1A 1ZHRA 1C1WH 1OWKA 2BDHA 2FOMB 1TPOA 2Z3EA 3LGYA 4U32A 5EJLA 2VIQA 2EEKA 5TJXA 3PMHB 1CU1A 4OGYA 5JPMH 2VGCC 1ZLRA 2XTTB 1BMLA 1HNEE 2BHGA 1MZDA 3D23A 3QZQA 1TA2A 1EPTB 3LGUA 1ELGA 1OX1A 1DT2A 1DM4B 1SQRA 1Z71A 2F9VA 1W7XH 1HAYB 2ZNKH 2VH6A 1GHBG 1NRNH 1ZMLA 1J8AA 1BUIA 3LJOA 5C2ZA 4IMQA 5C0UA 2PKAB 1O3NA 3BV9B 2OD3B 1S83A 1SGYE 3SJKA 2OC0A 1GJ6A 3A8BA 1P8VC 1HAPH 3BTGE 3ATIA 1P2IA 2V7QD 3VGCC 5I46H 2QXIA 3ZZ6A 1XUIA 1C5TA 4I31A 2ESTE 1MKWH 2ODPA 4WMDA 4BANB 3TNTA 3PMJA 3E1XB 4IN2A 1AE5A 1TNGA 3FN8A 3U98H 1FJSA 2C90B 1Z7KA 1LKBA 1G3EA 4D76A 3VEQB 1AU8A 1KXFA 1EJAA 2JH0D 3N99A 6CHAB 2W7SA 1AZZA 4H4FA 3A88A 1ETSH 1GBIA 1NESE 1FI8A 5GPIB 5EJZA 2BDIA 1BBRE 1HAGE 2YNAA 1A7SA 2ZO3H 3RXHA 3HK3B 4BXWA 5GXPA 1K28D 1J17T 1UK4A 1HJ9A 1ELEE 1GMCF 1A5HA 3BF6H 2BQ7B 2FLBH 1BQYA 5K7RA 1GI6A 1C5PA 4IMZA 3GCHB 1AN1E 1DX5M 3A8DA 2QXGA 3FKSD 2W3KA 3MMGA 1OWEA 1TX8A 1D3PB 4CRAA 1VITF 2BOKA 2JH5D 1ZPBA 2ZHWH 1DXWA 4PROA 1IQKA 1FN6A 1INCA 2CN0H 1SLXB 1WCZA 2ZCLP 1P05A 3MH7A 4B73A 2Z9GA 1BZXE 1Y8TA 1HCGA 3KNXA 1HJAB 1OP0A 1F0TA 1FY4A 3A7YA 1ABJH 3MNBA 5C94A 1UJ1A 1TOCB 1ELCA 1O31A 4KTUA 1EOLA 3V0XA 4E06H 3ZVAA 2NU4E 4CREA 3KN2A 1E36B 3EYDA 2QF0A 3AAVA 4AZ2B 1OYQA 1O2OA 2A5IA 3LOXA 3SUGA 4ESTE 2BY5X 7KMEH 5SGAE 1RRKA 2UUKB 2BVRH 1S6LA 3MI4A 5FBIA 2WSSD 2HALA 1P10A 2P8OC 4OM9A 2JKHA 3E90B 2BDGA 3UOUA 1RFNA 3RU4T 3ZZ7A 4ABFA 5HIYA 2BD2A 3TH3H 4O03A 3PB1E 4O3TA 3KIDU 4RKJB 3RXAA 1V2KT 1GVLA 1RD3B 4B6FA 1BRUP 2O8UA 1N6YA 4UFDH 2B9LA 1ZSJA 2W3IA 5DPAA 1GL0E 3VXFH 4D9QA 1CVWH 2AGEX 1FMGA 3BIVH 2ZEBA 1UTKA 1V2ST 4DG4A 3OYPA 1C2DA 3E0PB 1VJAU 2PFEA 1O2LA 1DDJA 1SGEE 3NKKA 1YGCH 3ZVDA 5C5OA 3SN8A 3LGWA 3TJOA 2ALPA 4FVDA 6LPRA 4CBNA 5DP5A 3TITA 2PWXA 1MUEB 1GHZA 1TALA 3AASA 3QTOH 3AW1A 2CK3D 5F53A 2ZFTA 4CBOA 4HGCA 2F3CE 4WH8A 4K5ZA 1S85A 1GJ5H 1LHGH 2BDAA 3M3VA 4F4OC 3DD2H 4BAOB 1QHRB 2QYIA 3RMLH 1IQLA 4Y7AA 2G5NA 3O8BA 3GICB 1YLNA 3RMMH 5LPRA 1QTFA 4JZDH 1P11E 1VITG 1YPLH 5PTPA 3P17H 1O35A 2B0FA 2FTMA 3FOAA 1O2WA 1TGBA 2OBQA 2A4GA 2Y7XA 1TFXA 2F9NA 2OC7A 2I6SA 1XX9A 4AFSA 1T31A 4ABBA 9LPRA 1GI4A 3K65B 2BXUH 4I8LA 1E38B 1DPOA 3JZ2B 4NGAH 1AHTH 1YKTA 1QFKH 1WTGH 5FCRA 1DS2E 3SNDA 2FYRA 4HI3A 4B76A 5DP3A 2ZHQH 2VVCA 3SNBA 2ZDAH 4VGCC 4MNWA 3A83A 1V2PT 3QGJA 2BOHB 2TPIZ 1AMHA 1BRAA 2RG3A 4YTAA 3SU4A 5GDSH 2QC2A 3U69H 5JBAS 2H9EH 3MH5A 4AC9A 2F9OA 1HXFH 3M36A 2TIOA 1J16A 3HK6B 1C2IA 5CE1A 3EA7A 1E35B 4CH8B 2GKVE 1SFQB 1TRNA 5E0JA 3SZEA 1P3CA 1AVWA 3FP7E 1GDUA 4XFQA 3VPKA 1K21H 1S82A 3NWUA 2NWNA 4ZUHA 1O3PB 4X1NU 1HFDA 3BEFB 3VB4A 1C4Y2 1NRPH 1O2YA 3ATLA 2KCYA 2Y7ZA 3MU4A 3UR9A 1AQ7A 3UNSA 5KGOA 3RMOH 4BAHB 2FOEA 5J4QA 3A86A 3OSYA 3SU3A 1BMFD 3FAOA 1YP9A 1W12U 1P2MA 1VJ9U 3RXDA 3PMBB 5CMXH 1C1NA 1OXGA 1K2I1 1SQOA 2ZHFH 3FVFB 3RC4A 2WPDD 1C1TA 4TY7A 5EODA 1K1NA 1B0EA 1IQJA 2Q1JA 1W14U 2SGFE 1E1RD 1XUHA 4X2WA 1XKBC 2C8ZB 2ASUB 4KP0A 5EQRA 4KKDA 1DOJA 1WBGB 4YESB 3ZVCA 4U2WA 1XXFA 3BTFE 1ZPZA 1SHYA 1NBMD 1TNJA 4YOGA 2ANWA 1BA8B 5HYOA 1E0FD 6GCHF 2DE9A 4FUEA 4GCHF 3RU4D 3TNSA 1O2IA 5CDFE 1EFRD 2A0QB 2AS9A 4ABJA 3SU5A 3ZZAA 1MQ5A 2O8LA 1E79D 1G2LA 1UK2A 2ANMH 3BTQE 4FVBA 1AUTC 2GZ7A 3M37A 2R3YA 1BTYA 2KM0A 3T29A 3GDVA 1O2VA 4DW2U 1UTQA 4FU7A 1G30B 1IQNA 1NFYA 2KFWA 2Q6DA 2THFB 2AGIX 4ASHA 2D1JA 4IS5A 2V35A 1GGDC 1NZQH 1CE5A 1QBVH 2PP6A 5E0HA 2EC9H 1C1QA 4X1SU 4FUCA 2PV9B 1V3XA 4X2YA 3T62A 1YPHC 4X2VA 3ESTA 1GDQA 2QF4A 1AIXH 1MCVA 1EJMA 5A0BA 1SC8U 3FFGA 4Q63A 3GY5A 1CT0E 1S0RA 3OTJE 1CBWC 1CT2E 1QB9A 1EAUA 3TJNA 1QNJA 1O5BB 4XRNA 2D26C 2D8WA 2PKSC 1KYNA 4I8GA 5ESBA 2QGRA 4OGXA 3CS0A 4JK6A 1D3TB 1GJ8B 2ZI2H 1EB2A 3DA9B 2FOAA 2ZU1A 3RC6A 4NA7A 1FIWA 2ZA5A 1P0SH 2C93B 1XUFA 1TGNA 2IOTA 1WQSA 3RXEA 1AFEH 1BTPA 1MTNB 2BDCA 3S7HB 1CHOF 3P95A 2QF5A 5ABWA 1O3IA 3LJJA 2BQ6B 3M7QA 4CRGA 2AFQB 4P00A 1SGIB 1V2RT 1TB6H 3ZZ4A 1FIZA 4FUGA 2GV7A 1GHXH 2W7UA 4UONA 4ZAEA 1A1RA 1JIRA 4ISOA 1SB1H 3RM2H 2GVFA 5E8EH 2F91A 3NRLA 5AFZH 4B2AA 1EAWA 3RXJA 4CRFA 5EQSA 2HNTC 2PGBB 2XW9A 2PHBA 3OY6U 3RLYH 3P70B 1SQTA 2P59A 4TWYA 2Y82A 3Q76A 2JJ2D 1DWCH 3PRBA 4WJG2 2BVSH 1EB1H 4A1XA 1CA8B 3B9FH 4YM9A 1BBRK 1SKYE 4RI0A 3KL6A 4BXSA 1AZ8A 1W0ZU 3L6PA 4GCHG 4XBDA 1ELTA 5I25A 3SI4H 1C5MD 1PYTD 4WMFA 2JDID 3UWJH 1F7ZA 2G55A 3SI3H 1C9PA 1K1LA 3GY7A 4TYDA 2FS8A 1GI3A 4GHTA 1GVZA 5DP8A 4F55A 3RM0H 3OAAD 4AN7A 3RMNH 4BTUB 1ZTLA 1EZXC 3B8JA 5H4IB 3PO1B 3KGPA 1C5QA 3M3SA 5ETXA 3VB3A 3URCA 3S7KB 2YMSD 2ZU5A 2FOGA 2WPIS 3KHVA 2ZPRA 2ZPSA 2GGVB 5DKMA 5F6MA 2GMTB 1CGJE 1O2QA 1WXRA 1S84A 3UOPA 1C5XB 8LPRA 4Z6AH 2JETC 1T32A 2CMYA 3KQCA 1IHTH 3ITIA 1QCPA 3M7UA 1A5IA 1COWD 2G5VA 1SHHB 3MOCA 5F8ZA 1RXPA 1BITA 1EPTA 4GLYA 1H8HD 5DN6D 1VR1H 3SU0A 4IGDA 1LKAA 2P95A 3FP6E 3HGNA 5A8XA 1MU6B 1O3DA 5EPNA 1H9LB 1HAXB 4JZFH 3HGPA 3GYMA 2XBYA 1OPHB 2CHAC 1FY5A 4ABAA 1JMOH 1IAUA 4OS6A 2VBCA 1SI5H 1TQ0B 3F9GA 1L4DA 3BTME 3N7DA 2Y5FA 1W2KH 4UE7H 3U28C 5LH8A 2ZP0H 1FAKH 1LHFH 2BZ6H 3STIA 3URDA 1SLVB 1WYKA 2ANYA 2GD4B 3SUDA 2RFKC 1Y3VA 1BCUH 3BG8A 1L1GA 1CHOG 1B0FA 4UFGH 1ZJDA 4X6MA 1GJAB 4A6LA 2R0LA 3MH4A 1AB9B 3SNCA 3B23B 4Q4LA 1C5UA 3Q3YA 2HNTF 2VWMA 5EXMA 1CGIE 1LHEH 3GDUA 3W94A 5AHGH 1HIAA 1SGTA 2EI6A 1TAWA 1NBME 3SJIA 2P93A 3QTVH 4TWWA 4DIIH 1YPEH 1SL3A 5EXNA 1FLEE 2BX4A 3RXLA 3QGNB 5FHTA 2KCAA 1ELAA 2HGTH 3PRDA 3TH4H 4SGBE 1GCTB 1DUAA 2C8YB 2BLWA 1O3JA 3MO3A 1A4WH 2IJD1 1TPSA 4X2XA 1TPPA 4BNRA 1SLWB 3SQEE 1V2TT 1BOQA 3A89A 3LH3A 3PV5A 1KLJH 4ZCNA 3AAUA 1GCDA 3HKIB 4JMYA 1QZ8A 1GBTA 2EY4C 2UUJB 2VIOA 3PLBA 5FX5A 5DP9A 3SV6A 1LDTT 1O2PA 3PM3A 1BBRH 1Y3UA 5EU8A 2Z9LA 3HATH 3H5CB 5C1YA 2W5EA 4AGKA 3RP2A 1A46H 2V3OH 1DSTA 2IPQX 1KDQB 4D7GA 1S0QA 1O5AB 3SQHE 1ETRH 4I8JA 1N8OC 1VGCB 4CHAB 1GBAA 1C9TA 2WUBA 3P8GA 1Z6JH 1EPTC 1RJXB 1T4UH 3A7WA 1NT1A 4DGJA 2OLGA 2AGGX 2YMSB 2Z94A 4LZ4B 1LTOA 1FXYA 1E34B 2G52A 5FX6A 4NIXA 1TABE 5EQQA 1NTPA 1UTPA 1BHXB 4ZHAA 1O3HA 2ZU3A 1V2JT 1AGJA 2F9PA 2HOBA 3MNXA 3MFJA 3VGCB 3P92A 1BB0B 2H9TH 1B5GH 1BRCE 1C4V2 1GBMA 3M3TA 2P94A 4TPIZ 1TONA 3UREA 1OP2A 4IC6A 1JXPA 2PSXA 4U01A 6CHAC 2VWNA 1NS3A 1GJCB 4K1EA 2R3UA 3ZV8A 3A7ZA 5KEDA 2BD8A 3A85A 1O5FH 2HLCA 3U1IB 1B7XB 1UTOA 2KX4A 1TPAE 1UVOA 1AD8H 2Z9KA 1SGQE 1UTJA 1GI5A 1ESAA 1NY22 2J94A 1GWAA 2R0KA 4P02A 4E05H 3VB6A 1DSUA 1O2KA 1BTUA 1DUEA 5TCAA 5JDUB 1S81A 4OS5A 1SGFG 5EPYA 3H7OA 8KME2 3GCHC 1O2NA 1TMUH 2UWLA 2J92A 4Y76A 3F2HA 1GBJA 1F5LA 1ZGIA 3IITA 4ZKRU 5IK2D 2XCFA 4UEHH 4NFFA 3RXUA 1YLDA 1EZUC 3RXRA 1VZQH 5EG4A 3T2NA 1ZRBA 2QY0B 3NZIA 1P2KA 2NU3E 2QAAA 4CR9A 3NXPA 4LK4A 1KXBA 3ZZ3A 4UDWH 1UCYK 1HJAC 3GY2A 1WAYB 2BY8X 3MU1A 4DOQA 1AKSB 2CJIA 2TGDA 2BXTH 1ARCA 4D7FA 1L4ZA 3F1SB 3TVJB 4Y71A 1O2UA 4WH6A 2GCHF 2JH6D 2RA3A 2Z7FE 2ZQ1A 3ATKA 2K1QA 3E6PH 2ZWLH 4K1TA 1NO9H 4Q80A 3E91A 4H6SB 5E2OA 4SGAE 3EE7A 3KEEA 1HBTH 1TGSZ 3TK9A 1YCPM 3WWBA 1DY9A 1SGDE 1T7CA 1OWJA 2KAIB 1BMMH 1BTXA 2F4LA 3H09A 3DSOA 2ZDVH 1HXEH 1MKXK 1BDAA 3RLWH 4TSFD 1OYTH 4NIYA 3QX5H 4INKA 1TX6A 3ATWA 1QRWA 3RXOA 3MNCA 2PGQB 3ZZ5A 1S6FA 1F0UA 2A7CA 1M9UA 3RXCA 5JYIA 2ZZUH 1O36A 2BQWB 1UHBB 3S69A 5A2MH 3QWCH 3A7XA 3ZZ9A 4AG2A 3MQKC 4ZXXH 1O34A 4MG3A 1LCYA 2XC5A 1Z1JA 2Z3CA 1O3EA 2XNDD 2VH0A 5T1VA 2BMGB 1EUFA 2WINI 3QLPH 3N7EA 5IDKA 4LXBH 4NWLA 3MO6A 3SU1A 3UNRA 5L2YH 2VB0A 3E3TA 1TNIA 2I6QA 4Y6DA 5JBCS 3F68H 3QN7A 2FM2A 4ZKNU 3FZDA 1A61H 3SYJA 3UUZA 3GCOA 1RIWB 5E0GA 1P12E 1ZHPA 5DP7A 1MD7A 4AG1A 4WVPE 4J2YB 1DXPA 4ISIH 1AWHB 1TQ7B 3S9CA 1PPFE 2ZGJA 4DURA 4FUJA 1ZMNA 1THSH 1TYNA 1IOEA 1GJ7B 1MH0A 2CGAA 2ZHEH 1GMDF 3SV7A 4Z1MD 1HAVA 1QY6A 2BD3A 1UK3A 2TGTA 1W13U 4I33A 2A4QA 2FLRH 2FTLE 2LELA 1SLUB 2AMQA 3SGAE 2QV1A 1Y5UT 1EAXA 4B6EA 4MPWA 1QQ4A 5ESTE 3UIRA 4Z0KA 3SUFA 1SVPA 3V7TA 4CRBA 4B2BA 1EASA 2A4RA 3T27A 1HB0B 1OKXA 2STAE 1K1OA 2AEIH 1UVSH 2JJ1D 2GCHG 2CF9H 2XBVA 3GYLB 2G8TA 3NCLA 5GNDA 1ACBE 2ZCKP 1ZOMA 1D6WA 4B71A 2NU1E 5FPYA 4JYUH 3PMAB 2ODQA 2PR3A 1BT7A 4QT8C 4A1VA 2Q6FA 3TJVA 4I7YH 1CQQA 2G4TA 2J98B 2XOKD 1NFWA 1KIGH 2GDEH 2A45B 4BOHA 1T8NA 1SGPE 2HRVA 4AOQA 2ZGCA 3BEUA 2WPJS 4MTBA 1WQVH 1D9IA 2WYJA 2ZHDA 1DANH 3BG4B 3MYWA 1MMJN 1UTNA 5DG6A 1UMAH 1TA6A 1MKXH 1WU1A 1BMNH 3KYFA 2GTBA 1V2MT 5FCKA 1A3EH 4NZLA 1S6HA 2OC8A 3F0OA 1YBWA 4R8TB 3U1JB 5IYTA 3VXEH 3M5OA 1JRTA 3QDZB 4YLQH 4B1TA 2BDBA 2G51A 2XC4A 2ZDKA 2P3TB 1LPKB 3P6ZB 1V2NT 1Q31A 1H8DH 5E2PA 1C1UH 3OX7U 2LPRA 5EW1H 5F8XA 4DCDA 3EDXB 2RDLA 1UCYE 2ZG0H 4A5TS 4AYVB 2AIQA 2QXHA 2TGPZ 1G3DA 1UW7A 2ZGXH 3OFND 4M7GA 1CA0C 5JBBS 3FP8E 1MAYA 1SGCA 3U8TH 3U8OH 4E7NA 1MTWA 3CS7A 3KF2A 1F5KU 1IQHA 3E8LA 1O2RA 5FAHA 5DO4H 2FPZA 2VWLA 1P03A 3F9FA 1UVTH 4IN1A 5HM2A 4MNVA 2OBOA 3LH1A 1AFQB 2KR7A 2IPHA 4ZHMU 1T4VH 3UQVA 4NFEA 2GCTC 1SGFA 4M9FA 2FO9A 1Z8JB 3VG8A 4I8KA 4YT6H 1F5RA 1YM0A 1GMDG 2ZFQH 2EQNA 1OP8A 5EXLA 3F3BA 4X1RU 2FX6A 1BRBE 1VKYA 1RTLA 1UTMA 1P9UA 3DCLA 3OTPA 1FY1A 3ENSB 1WDIA 1C2LA 2XXLA 3V12A 2BLOA 5JBTA 3RXMA 2ZFRH 3BTKE 3LGVA 3QUMP 4YO9A 1GPZA 3PTNA 1U6QA 4FOUC 1WUNH 5DGJA 3EA8A 1O2JA 3UNQA 1O3MA 1C1SA 4TT3D 2G81E 5C1XA 2TRMA 1KXAA 1WSSH 3ZZCA 3M5LA 2GDDA 1TIOA 1V2OT 3BTDE 1ZHMA 2BX3A 4MDSA 3UAIC 1HPGA 1CO7E 5T6GA 1TGCA 1Z6EA 3OU0A 3E16B 2RCEA 1QBNA 2VNTA 4XBBA 1GBBA 2A1DB 2H1UA 4I8HA 5AFYH 1HAOH 1KXEA 3V13A 1FDPA 5GCHF 4Y10E 1CT4E 4RT1A 1D3QB 1OWDA 3GY6A 2FOFA 1ESBA 4RSPA 1J9CH 1O3KA 3GCNA 3SW2B 2LNCA 3P8OA 4DT7B 1EQ9A 2VIDA 2ZGHA 1GJDB 3ZVFA 1QL7A 1GBKA 2ZF0H 1MD8A 1EJNA 2OQ5A 1QA0A 2ZU2A 2BD4A 2BD9A 3GISB 3UB0A 1MTNC 2Y80A 1GVKB 3MU5A 1MTVA 2H2ZA 1GBHA 1PPZA 3LIWA 1Z8RA 1L0ZA 1C1MA 3RXPA 2BD5A 1QRXA 1K22H 3SV8A 2ODYB 2WUCA 3LU9B 1FPHH 1OHHD 2SNWA 3MU0A 1P57B 4GHQA 1O33A 1J14A 8GCHG 2ZFFH 1ELBA 4H42U 4WWYA 2EI7A 4MPVA 5FL7D 1JOUB 3A8CA 1FY8E 1NRRH 3SJ8A 2FI5E 1Z8GA 3FO8D 5CHBA 1BTHH 2F83A 1K1IA 1W0KD 3M5MA 4XDEA 3QZRA 1P02A 1EZQA 2OCVB 4FUDA 3S0NA 2XBXA 1W0YH 2Z3DA 4MLFB 4Q7XA 1TBQH 1V2QT 1YPHE 4WXVA 4XSKU 2SNVA 2O9QA 3BIUH 2SGAA 2FIRH 1QA7A 2J5UA 1DFPA 1ZSKA 4AGJA 1O3GA 2AMDA 2WV4A 1QQUA 3OY5U 1C1RA 5GJ4B 2V3HH 1ANBA 1IQMA 5EOKA 4AORA 1NM6A 1G9IE 1P04A 2H5CA 1KDQA 1KTTB 1KXDA 1JIMA 1RTKA 2GMTC 1DWBH 4X6OA 1BIOA 1W10U 5DP4A 4A92A 1NROH 2YOLA 4B75A 3U8RH 1PQ5A 2FWWA 1GJBB 2ZECA 2HPPH 3TJUA 1HV7A 2FESH 3RXFA 2KCOA 2K0QA 4FUFA 4IC5A 2JETB 2PKAA 1QJ6B 3GS9A 2VIVA 5L6NH 1W11U 5C17A 3KQDA 3T28A 1TBZH 2BDYA 1GG6B 5GCHG 1GHAF 4ISLA 5CHAC 2C3SA 2OUAA 3SUEA 3UR6A 3T5FH 1LMWB 1NU7B 1ANDA 4LOYH 2FS9A 4WXIA 4X0WU 1LHDH 1TMTH 4K69A 1RTFB 4JK5A 4XBCA 5GIBA 1A2CH 3K6YA 2DE8A 1LVMA 4D8NA 1ELDE 4NA8A 4ACAA 3LGIA 1LVYA 2XWBI 4ZKOU 1GMHG 5FPSA 1XUJA 4JCNA 2TBSA 4FU8A 1BJVA 1SPJA 4YXWD 3A80A 1PQ7A 4BTIB 3KQEA 1IQGA 2IN2A 4XOJA 1NRSH 2BYAX 1AUJA 2IJOB 4ZHLU 3D49H 2J9NA 4O97A 3RU4E 4CRDA 5FBEA 5DP6A 1KMHB 2ZTZA 2F9BH 5F8TA 1Z8IB 3PWCA 1GBCA 2A7HA 2GZ9A 3L33A 2Q6GA 1GCTC 1ZJKA 5B6LA 3BTEE 2J97A 5EIYA 4ABEA 1AI8H 3SBKA 1KLIH 1Y5BT 2GT7A 4GPGA 2ZPQA 1TNLA 2F43B 2BTCE 3ATMA 2ZGBH 1TWXB 2L74A 4INLA 1O2XA 2M5TA 3LDXH 5TCCA 3HPTB 4KTSA 2WPMS 2A2QH 4IW4E 2ZKSA 2W6JD 1Q2WA 2WPHS 1Z1IA 4ZMAH 3WWFA 1YC0A 1H1BA 4UD9H 4HFPB 4ISHH 5C67A 2BLVA 3RXVA 1P09A 2SFAA 1OWIA 1DE7H 1KXCA 2CXVA 3SV9A 1T8LA 3EE0B 1KTSB 9ESTA 1IHSH 3MHWU 3LT3A 1ZTKA 3M5NA 2H6MA 1PYTC 3GCTF 2HPQH 2VGCB 3KQ5A 1PPCE 3S9BA 1VGCC 1FUJA 4CHAC 3IG6B 3ZVBA 1Y59T 1ZR0A 4ZKSU 3MO9A 1N8OB 1A0LA 1D3DB 1XMNB 4FETA 1HDTH 1N6XA 2ZFPH 3DSPA 1HJ8A 3UY9A 4BAQB 4Y7BA 3RUOA 1QJ1B 1O3CA 1OOKB 2KAIA 1DVAH 2YMSC 3M35A 3A7TA 1GJ9B 1YWUA 4Y8XA 1UO6A 4FUHA 2M2AA 3VB7A 4YOIA 1QGFA 2BM2A 3P8NA 3WW7A 1CSOE 1THRH 4I86A 1O2ZA 2P3UB 3A7VA 1IQEA 1HLTH 1S5SA 4I32A 1UTLM 3GY3A 1G2MA 2V0BA 1GHAG 4JZEH 4ABDA 2A32A 2RA0A 3ZYDA 2GP9B 1UHBA 2A5KA 1SOTA 4WF8A 1CHGA 5C1UA 3M7TA 4XE4A 2C4FH 1GHWH 1ZYOA 3EQ0H 1GI0A 1GDNA 1PPHE 3RXQA 2ULLA 2FI3E 4GSOA 3F9EA 4F49A 4ZXYH 1XUKA 2A5AA 1AWFH 1ANEA 4Y0YE 3MH6A 4HG6A 1C5OH 1HIAB 1C5SA 2UWPA 3UQOA 1C1PA 2VINA 3DT0H 1LO6A 4CH2B 2SGPE 2FODA 1ETTH 3AVZA 3A8AA 1JBUH 1TX7A 3BTTE 1DY8A 2BLQA 1XUGA 3SJ9A 2ZCHP 3R3GB 2F9UA 1MBQA 5T3HA 2K8IA 3TK6A 2VWOA 2ZDMA 1QURH 5J4SA 5G4BA 1W0JD 1FNIA 2B7DH 3NK8A 1RGQA 3BTHE 2NU2E 4KELA 5BRRE 5T6FA 4X6NA 5B6OA 4ZROA 4ASUD 5C3NA 1DICA 3OEED 3PLKA 4IBLH 1O32A 1V2WT 3E0NB 2R2MB 1HAHH 2FZZA 1K1PA 2OK5A 1G32B 4RN6A 5HXFA 1SMFE 2ZIQH 2J95A 4X1QU 3F2GA 5JB8S 4BAMB 2OC1A 1TNHA 2GV6A 2UWOA 3SGQE 3DSGA 1K9OE 2SGEE 2VJ1A 3PTBA 2SGQE 3GCTG 4X8VH 1HUTH 2ALVA 4NZQA 1O5CB 1G36A 3SO3A 3C1KA 1C2MA 3AK5A 1BHXF 1YY3A 4OS4A 4MPUA 7LPRA 1O5DH 3JZ1B 1F92A 4NA9H 5LPFA 1EOJA 2HWLB 2GX4A 2PSYA 2C8WB 2WHXA 2P8OB 1MBMA 3F6UH 1O2HA 1P2QA 4JZIA 3CP7A 4WMEA 3O8CA 1HGTH 1EKBB 1O2SA 2J98A 1E1QD 1TLDA 2VVVA 5DJ7A 4Q2KA 4CR5A 1PJPA 1GHYH 3TU7H 4MNYA 3SJOA 2EI8A 3BSQA 5DK1A 3F0PA 2FYQA 2VU8E 3TGJE 1C4U2 1MABB 2FI4E 1C5NH 7ESTE 1QIXB 5F03A 1H9HE 1T8MA 1XM1A 2ZTXA 2SGDE 4O9VA 2CV3A 2ZDNA 1SGRE 4JZ1A 1NC6A 1WV7H 4NG9H 1ABIH 2FOCA 4U30A 2Z6BD 2ZC9H 2J2UA 5EGMA 1QL9A 1HRTH 1MCTA 3SNAA 2A31A 3ZVGA 4MPXA 3PYHA 1C2KA 1ORFA 1ZZZA 3GDSA 1PPGE 4YOJA 1RIWC 4BTTB 2ZTYA 1ANCA 2PUXB 4RT0A 1GMCG 4OS1A 4RKOB 4INHA 2FMJA 1Y5AT 3AW0A 2UUFB 1LQDB 3ODFA 2WYGA 1MU8B 1OWHA 1SOZA 4ABHA 1KLTA 1AO5A 3NUMA 3TH2H 1TE0A 2AMPA 1F0RA 1P3EA 3D62A 1LQEA 2C8XB 1BJUA 4Y79A 1G37A 2QA9E 1THPB 1UCYH 2O8MA 3WY8A 4Q7YA 2VVUA 3Q00A 4Y8YA 1Y3YA 1L2EA 1H9IE 3IWMA 2QN5T 1CGHA 1BTZA 2EA3A 2Y5HA 1LVOA 1GJ4H 1EZSC 3H7TA 1YYY1 3K9XB 2QCYA 3M61U 3MNSA 2FX4A 1O30A 2XWAA 3Q3KA 4HZHA 3I77A 4X8SH 4AB8A 1GBLA 1BMAA 4VGCB 1N1LA 2NU0E 3N7OA 1ZGVA 2AHME 1F2SE 1P01A 1D4PB 3RXKA 3UWIA 4GUXA 1TGTA 6ESTA 1O2MA 2AIPA 7GCHF 1YF4A 2G4UA 3K2UA 2OINA 2FP7B 3A82A 3TLOA 4J1YA 3NPSA 1L1JA 1H4WA 1PPEE 3Q77A 4Q7ZA 3BG4C 4H6TA 5GWZA 2OQUA 2WPKS 1EATA 4ABGA 1O39A 1PQ8A 4R0IA 4K60A 1MTSA 2PTCE 3D65E 1ELVA 3T25A 5C20A 5K0HA 1P2OA 1QB6A 1XVMA 2Y81A 3OE7D 4KTCA 4AFQA 5L2ZH 3FZZA 3RXTA 1TOMH 3ODDA 2A7JA 2GZ8A 4DJZB 4DVAU 1TNKA 2A2XH 4O3UA 3KCGH 1GBDA 1V2LT 3ZVEA 1ZRKA 3DFJA 1MTUA 5HM9A 1KSNA 5LPEA 3ZZBA 3I78A 2O8WA 3SHAH 1A5GH 4X6PA 1FAXA 1O3LA 1FZZA 8GCHF 2ILNA 4ZH8A 3EA9A 4X1PU 1K1MA 1QRZA 1XVOA 3ZYEA 2XCNA 1Y3WA 3CNRA 5DSFA 5T6DA 4FUBA 4ACBA 3A84A 5AVDA 4FUIA 1CA0B 3SORA 1V6DA 1GI2A 2V3MA 1QJ7B 4BAKB 5A09A 1GI7B 1DITH 4UFEH 1AFQC 4KGAA 1W8BH 2QIQA 4X8UH 1FQ3A 5FPTA 3EGKH 2Z9IA 1EP5A 1O37A 4K8BA 1AE8H 3PROA 1C5WB 2WV9A 1C2GA 1HAVB 1UVPA 1P06A 1Y3XA 1AY6H 3VB5A 3LONA 4F48B 1WOFA 2GCTB 2RDEA 2KCPA 2QXJA 1H8ED 3PWBA 1A3BH 3RXIA 1HAZB 4AYYB 2BY9X 1DLEA 3SU6A 4MNXA 2J4IA 1K1JA 2OXSA 1EP6A 1O5EH 2ANKH 1D6RA 3LKWA 4NIVA 3U9AH 2CF8H 3DHKH 3SNEA 1GGDB 3FANA 2B8OH 2Y6TA 1LPZB 1KY9A 3KQBA 1SG8B 2BB4A 5FXLA 2J38A 2STBE 2FEQH 1PPBH 2XBWA 1NU9A 1GBEA 4D9RA 5HMAA 2FDAA 3ELAH 3PV2A 4NWKA 4A1TA 5EW2H 1ZTJA 1C1OA 2G00A 1A0JA 1C2EA 4DY7B 1G3BA 1OS8A 7GCHG 1CBWB 1MAXA 2Z9JA 1EAIA 3QO6A 2PKSB 3RXBA 1WTHD 1O2TA 2ZQ2A 4DIHH 1K0HA 2H9HA 4YZUA 4TPYA 2P3FH 3LPRA 1GI9B 1V2UT 1C5ZB 1MZAA 1GMHF 1C2HA 1NFXA 1Q3XA 3GY4A 2VIPA 1HYLA 1FN8A 1SBWA 2OTVA 5HIZA 1G3CA 3LC3A 2FOBA 4NSYA 2HVXA 2XC0A 3PV4A 3RXSA 1VCQA 1O38A 4K1SA 1SSXA 3CENA 1JWTA 3STJA 3R0FA 5A0AE 1XXDA 1YPKH 1GBFA 1HAIH 3BTWE 2QF3A 2L6OA 1YCPK 3HKJB 5C0TA 1V2VT 2BY6X 4MVNA 1TRYA 4YT7H 3BN9A 3Q3XA 4THNH 3G01A 3GOVB 4GVUA 1OSSA 2WPLS 2XRCA 1O5GH 3VFEA 3TPIZ 1TMBH 1SFIA 1YPGH 1A0HB 3SGBE 1DWDH 1RS0A 4Y11E 1ZPCA 3EAJA 2R9PA 1PQAA 1SQAA 1BTWA 1QR3E 1DLKB 2BZAA 3OEHD 1GI8B 5HGGA 3T26A 3F2FA 3MTYA 3SV2H 2VIWA 4K2YA 2ZU4A 3TGKE 1C5VA 4OS7A 1FY3A 4AFZA 2R2WU 3TGIE 6GCHG 5KECA 1EXFA 5L30H 4B2CA 3A87A 1YPJH 3SOSA 2FXRA 1UVUH 3PO1C 4AX9H 2LP6A 4FXGH 1GHVH 1ZMJA 2AH4X 3S9AA 3A81A 1AVXA 3MWIU 2PTNA 3UFAA 2BD7A 1PFXC 1XKAC 1C2FA 2J34A 4TY6A 1X7AC 1E37B 1QB1A 3ZV9A 4WY3A 3RXGA 1YLCA 1AVGH 1SR5C 1O0DH 3ZZDA 2ZFSA 1O2GH 2W26A 1NPMA 1QL8A 3QK1A 3RDZA 1SGNE 1C1VH 5AF9H 1O3AA 1FX0B 4K3JA 1JRSA 3UTUH 1GHBF 1TRMA 1VCPA 1W3CA 3SU2A 2H5DA 4JYVH 2PW8H 2WZQA 4NSVA 1FV9A 1MKWK 4AFUA 3DUXH 1GL1A 1IQFA 1NN6A 3SHCH 2QE7D 1ESTA 1ARBA 2BY7X 4DT4A 5LGOA 1TBRH
chains in the Genus database with same CATH topology
3PLPA 1O3OA 2CHAB 1GG6C 1ELFA 1ZSLA 1P2NA 1LPGB 2HNTE 1J15A 3F9HA 4HTCH 2XYAA 3GY8A 1L1NA 3LGTA 1O3BA 5CHAB 3O8DA 1NRQH 3LC5A 4CRCA 3BEIB 4NIWA 4YLUA 5BPEA 2UUYA 4JYTA 4FU9A 1EX3A 2GT8A 1FPCH 3MU8A 2AERH 1AB9C 2P16A 3V3MA 4B74A 4Y8ZA 1IQIA 1FONA 4UFFH 2WV5A 3I29A 2TGAA 5C5NA 4NCYA 5A0CA 4A7IB 1P2JA 1QBOA 1H8IH 1C5LH 2FOHA 1MQ6A 3RC5A 3TK5A 4Y0ZE 1W7GH 2OP9A 3O8RA 1T8OA 3W95A 5A8YA 2PLXA 3P8FA 2ZDLA 1C5RA 4GAWA 4K8YA 1GI1A 1YPMH 4AB9A 3C27B 2PUQH 3TIUA 1YCPH 4OS2A 4LZ1H 1DWEH 1LHCH 2DUCA 3SZNA 1C5YB 1VCWA 2A4OA 2O8TA 2AYWA 2B5TB 4E7RG 5JB9S 2D2DA 1ID5H 4MQAA 3L3TA 2YNBA 2XNIA 4ABIA 2BVXH 1C2JA 3ZZ8A 3K6ZA 1AKSA 1NFUA 1VITH 5A8ZA 2Y5GA 1F0SA 4X8TH 1P9SA 2V6NA 8ESTE 3DFLA 4ISNA 1O3FA 3UPEA 1LVBA 1ZHRA 1C1WH 1OWKA 2BDHA 2FOMB 1TPOA 2Z3EA 3LGYA 4U32A 2VIQA 2EEKA 5TJXA 3PMHB 1CU1A 4OGYA 5JPMH 2VGCC 1ZLRA 2XTTB 1BMLA 1HNEE 2BHGA 1MZDA 3D23A 3QZQA 1TA2A 1EPTB 3LGUA 1ELGA 1OX1A 1DT2A 1DM4B 2F9VA 1Z71A 1W7XH 1HAYB 2ZNKH 2VH6A 1GHBG 1NRNH 1ZMLA 1J8AA 1BUIA 3LJOA 5C2ZA 4IMQA 2PKAB 1O3NA 3BV9B 2OD3B 1S83A 1SGYE 3SJKA 2OC0A 1GJ6A 3A8BA 1P8VC 1HAPH 3BTGE 3ATIA 1P2IA 3VGCC 5I46H 2QXIA 3ZZ6A 1XUIA 1C5TA 4I31A 2ESTE 1MKWH 2ODPA 4WMDA 4BANB 3TNTA 3PMJA 3E1XB 4IN2A 1AE5A 1TNGA 3U98H 1FJSA 2C90B 1Z7KA 1LKBA 1G3EA 4D76A 3VEQB 1AU8A 1KXFA 1EJAA 2JH0D 6CHAB 2W7SA 1AZZA 4H4FA 3A88A 1ETSH 1GBIA 1NESE 1FI8A 5GPIB 2BDIA 1BBRE 1HAGE 2YNAA 1A7SA 2ZO3H 3RXHA 3HK3B 4BXWA 5GXPA 1K28D 1J17T 1UK4A 1HJ9A 1ELEE 1GMCF 1A5HA 3BF6H 2BQ7B 2FLBH 1BQYA 5K7RA 1GI6A 1C5PA 4IMZA 3GCHB 1AN1E 1DX5M 3A8DA 2QXGA 2W3KA 3MMGA 1OWEA 1TX8A 1D3PB 4CRAA 1VITF 2BOKA 2JH5D 1ZPBA 2ZHWH 1DXWA 4PROA 1IQKA 1FN6A 1INCA 2CN0H 1SLXB 1WCZA 2ZCLP 1P05A 3MH7A 4B73A 2Z9GA 1BZXE 1Y8TA 1HCGA 3KNXA 1HJAB 1OP0A 1F0TA 1FY4A 3A7YA 1ABJH 3MNBA 1UJ1A 1TOCB 1ELCA 1O31A 4KTUA 1EOLA 3V0XA 4E06H 3ZVAA 2NU4E 4CREA 3KN2A 1E36B 3EYDA 2QF0A 3AAVA 4AZ2B 1OYQA 1O2OA 2A5IA 3LOXA 3SUGA 4ESTE 2BY5X 7KMEH 5SGAE 1RRKA 2UUKB 2BVRH 3MI4A 5FBIA 2HALA 1P10A 2P8OC 2JKHA 3E90B 2BDGA 3UOUA 1RFNA 3RU4T 3ZZ7A 4ABFA 2BD2A 3TH3H 4O03A 3PB1E 4O3TA 3KIDU 4RKJB 3RXAA 1V2KT 1GVLA 1RD3B 1BRUP 2O8UA 1N6YA 4UFDH 2B9LA 1ZSJA 2W3IA 5DPAA 1GL0E 3VXFH 4D9QA 1CVWH 2AGEX 1FMGA 3BIVH 2ZEBA 1UTKA 1V2ST 4DG4A 3OYPA 1C2DA 3E0PB 1VJAU 2PFEA 1O2LA 1DDJA 1SGEE 3NKKA 1YGCH 3ZVDA 5C5OA 3SN8A 3LGWA 3TJOA 2ALPA 4FVDA 6LPRA 4CBNA 5DP5A 3TITA 2PWXA 1MUEB 1GHZA 1TALA 3AASA 3QTOH 3AW1A 2ZFTA 4CBOA 4HGCA 2F3CE 4WH8A 4K5ZA 1S85A 1GJ5H 1LHGH 2BDAA 3M3VA 4F4OC 3DD2H 4BAOB 1QHRB 2QYIA 3RMLH 1IQLA 4Y7AA 2G5NA 3O8BA 3GICB 3RMMH 5LPRA 1QTFA 4JZDH 1P11E 1VITG 1YPLH 5PTPA 3P17H 1O35A 2B0FA 2FTMA 1O2WA 1TGBA 2OBQA 2A4GA 2Y7XA 1TFXA 2F9NA 2OC7A 2I6SA 1XX9A 4AFSA 1T31A 4ABBA 9LPRA 1GI4A 3K65B 2BXUH 4I8LA 1E38B 1DPOA 3JZ2B 4NGAH 1AHTH 1YKTA 1QFKH 1WTGH 5FCRA 1DS2E 3SNDA 2FYRA 4HI3A 4B76A 5DP3A 2ZHQH 2VVCA 3SNBA 2ZDAH 4VGCC 4MNWA 3A83A 1V2PT 3QGJA 2BOHB 2TPIZ 1AMHA 1BRAA 2RG3A 4YTAA 3SU4A 5GDSH 2QC2A 3U69H 5JBAS 2H9EH 3MH5A 2F9OA 1HXFH 3M36A 2TIOA 1J16A 3HK6B 1C2IA 5CE1A 3EA7A 1E35B 4CH8B 2GKVE 1SFQB 1TRNA 5E0JA 1P3CA 1AVWA 3FP7E 1GDUA 4XFQA 3VPKA 1K21H 1S82A 3NWUA 2NWNA 4ZUHA 1O3PB 4X1NU 1HFDA 3BEFB 3VB4A 1C4Y2 1NRPH 1O2YA 3ATLA 2Y7ZA 3MU4A 3UR9A 1AQ7A 3UNSA 4BAHB 3RMOH 5J4QA 2FOEA 3A86A 3OSYA 3SU3A 3FAOA 1YP9A 1W12U 1P2MA 1VJ9U 3RXDA 3PMBB 5CMXH 1C1NA 1OXGA 1K2I1 1SQOA 2ZHFH 3FVFB 3RC4A 1C1TA 4TY7A 5EODA 1K1NA 1B0EA 1IQJA 2Q1JA 1W14U 2SGFE 1XUHA 4X2WA 1XKBC 2C8ZB 2ASUB 4KP0A 5EQRA 4KKDA 1DOJA 1WBGB 4YESB 3ZVCA 4U2WA 1XXFA 3BTFE 1ZPZA 1SHYA 1TNJA 4YOGA 2ANWA 1BA8B 5HYOA 1E0FD 6GCHF 2DE9A 4FUEA 4GCHF 3RU4D 3TNSA 1O2IA 2A0QB 2AS9A 4ABJA 3SU5A 3ZZAA 1MQ5A 2O8LA 2ANMH 1G2LA 1UK2A 4FVBA 3BTQE 1AUTC 2GZ7A 3M37A 2R3YA 1BTYA 3T29A 3GDVA 1O2VA 4DW2U 1UTQA 4FU7A 1G30B 1IQNA 1NFYA 2Q6DA 2THFB 2AGIX 4ASHA 2D1JA 4IS5A 2V35A 1GGDC 1NZQH 1CE5A 1QBVH 5E0HA 2EC9H 1C1QA 4X1SU 4FUCA 2PV9B 1V3XA 4X2YA 3T62A 1YPHC 4X2VA 3ESTA 1GDQA 1AIXH 1MCVA 1EJMA 5A0BA 1SC8U 3FFGA 3GY5A 1CT0E 1S0RA 3OTJE 1CBWC 1CT2E 1QB9A 1EAUA 3TJNA 1QNJA 1O5BB 2D26C 2D8WA 2PKSC 1KYNA 4I8GA 5ESBA 2QGRA 4OGXA 3CS0A 4JK6A 1D3TB 1GJ8B 2ZI2H 1EB2A 3DA9B 2FOAA 2ZU1A 3RC6A 4NA7A 1FIWA 2ZA5A 1P0SH 2C93B 1XUFA 1TGNA 2IOTA 1WQSA 3RXEA 1AFEH 1BTPA 1MTNB 2BDCA 3S7HB 1CHOF 3P95A 5ABWA 1O3IA 3LJJA 2BQ6B 3M7QA 4CRGA 2AFQB 1SGIB 1V2RT 1TB6H 3ZZ4A 1FIZA 4FUGA 2GV7A 1GHXH 2W7UA 4UONA 4ZAEA 1A1RA 1JIRA 4ISOA 1SB1H 3RM2H 2GVFA 5E8EH 2F91A 5AFZH 4B2AA 1EAWA 3RXJA 4CRFA 5EQSA 2HNTC 2PGBB 2XW9A 2PHBA 3OY6U 3RLYH 3P70B 1SQTA 2P59A 4TWYA 2Y82A 3Q76A 1DWCH 4WJG2 2BVSH 1EB1H 4A1XA 1CA8B 3B9FH 4YM9A 1BBRK 4BXSA 3KL6A 1AZ8A 1W0ZU 3L6PA 4GCHG 4XBDA 1ELTA 5I25A 3SI4H 1C5MD 1PYTD 4WMFA 3UWJH 1F7ZA 2G55A 3SI3H 1C9PA 1K1LA 3GY7A 4TYDA 2FS8A 1GI3A 4GHTA 1GVZA 5DP8A 3RM0H 4AN7A 3RMNH 4BTUB 1ZTLA 1EZXC 3B8JA 5H4IB 3PO1B 3KGPA 1C5QA 3M3SA 5ETXA 3VB3A 3URCA 3S7KB 2ZU5A 2FOGA 2WPIS 3KHVA 2ZPRA 2ZPSA 2GGVB 5DKMA 5F6MA 2GMTB 1CGJE 1O2QA 1S84A 3UOPA 1C5XB 8LPRA 4Z6AH 2JETC 1T32A 2CMYA 3KQCA 1IHTH 3ITIA 1QCPA 3M7UA 1A5IA 2G5VA 1SHHB 3MOCA 5F8ZA 1RXPA 1BITA 1EPTA 4GLYA 1VR1H 3SU0A 4IGDA 1LKAA 2P95A 3FP6E 3HGNA 5A8XA 1MU6B 1O3DA 5EPNA 1H9LB 1HAXB 4JZFH 3HGPA 3GYMA 2XBYA 1OPHB 2CHAC 1FY5A 4ABAA 1JMOH 1IAUA 4OS6A 1SI5H 1TQ0B 3F9GA 1L4DA 3BTME 2Y5FA 1W2KH 4UE7H 5LH8A 2ZP0H 1FAKH 1LHFH 2BZ6H 3STIA 3URDA 1SLVB 1WYKA 2ANYA 2GD4B 3SUDA 1Y3VA 1BCUH 3BG8A 1L1GA 1CHOG 1B0FA 4UFGH 1ZJDA 4X6MA 1GJAB 4A6LA 2R0LA 3MH4A 1AB9B 3SNCA 3B23B 1C5UA 3Q3YA 2HNTF 2VWMA 5EXMA 1CGIE 1LHEH 3GDUA 3W94A 5AHGH 1HIAA 1SGTA 2EI6A 1TAWA 3SJIA 2P93A 3QTVH 4TWWA 4DIIH 1YPEH 1SL3A 5EXNA 1FLEE 2BX4A 3RXLA 3QGNB 5FHTA 1ELAA 2HGTH 3TH4H 4SGBE 1GCTB 1DUAA 2C8YB 2BLWA 1O3JA 3MO3A 1A4WH 1TPSA 4X2XA 1TPPA 4BNRA 1SLWB 3SQEE 1V2TT 1BOQA 3A89A 3LH3A 1KLJH 3AAUA 1GCDA 3HKIB 4JMYA 1GBTA 2UUJB 2VIOA 3PLBA 5FX5A 5DP9A 3SV6A 1LDTT 1O2PA 3PM3A 1BBRH 1Y3UA 5EU8A 2Z9LA 3HATH 3H5CB 5C1YA 2W5EA 4AGKA 3RP2A 1A46H 2V3OH 1DSTA 4D7GA 1KDQB 1S0QA 1O5AB 3SQHE 1ETRH 4I8JA 1N8OC 1VGCB 4CHAB 1GBAA 1C9TA 2WUBA 3P8GA 1Z6JH 1EPTC 1RJXB 1T4UH 3A7WA 1NT1A 4DGJA 2OLGA 2AGGX 2Z94A 4LZ4B 1LTOA 1FXYA 1E34B 2G52A 5FX6A 4NIXA 1TABE 5EQQA 1NTPA 1UTPA 1BHXB 4ZHAA 1O3HA 2ZU3A 1V2JT 1AGJA 2F9PA 2HOBA 3MNXA 3MFJA 3VGCB 3P92A 1BB0B 2H9TH 1B5GH 1BRCE 1C4V2 1GBMA 3M3TA 2P94A 4TPIZ 1TONA 3UREA 1OP2A 4IC6A 1JXPA 2PSXA 4U01A 6CHAC 2VWNA 1NS3A 1GJCB 4K1EA 2R3UA 3ZV8A 3A7ZA 2BD8A 3A85A 1O5FH 2HLCA 3U1IB 1B7XB 1UTOA 1TPAE 1UVOA 1AD8H 2Z9KA 1SGQE 1UTJA 1GI5A 1ESAA 1NY22 2J94A 1GWAA 2R0KA 4E05H 3VB6A 1DSUA 1O2KA 1BTUA 1DUEA 5TCAA 5JDUB 1S81A 4OS5A 1SGFG 5EPYA 3H7OA 8KME2 3GCHC 1O2NA 1TMUH 2UWLA 2J92A 4Y76A 1GBJA 1F5LA 1ZGIA 3IITA 4ZKRU 2XCFA 4UEHH 4NFFA 3RXUA 1YLDA 1EZUC 3RXRA 1VZQH 5EG4A 3T2NA 1ZRBA 2QY0B 3NZIA 1P2KA 2NU3E 2QAAA 4CR9A 3NXPA 4LK4A 1KXBA 3ZZ3A 4UDWH 1UCYK 1HJAC 3GY2A 1WAYB 2BY8X 3MU1A 4DOQA 1AKSB 2CJIA 2TGDA 2BXTH 1ARCA 4D7FA 1L4ZA 3F1SB 3TVJB 4Y71A 1O2UA 4WH6A 2GCHF 2JH6D 2RA3A 2Z7FE 2ZQ1A 3ATKA 2K1QA 3E6PH 2ZWLH 4K1TA 1NO9H 4Q80A 3E91A 4H6SB 5E2OA 4SGAE 3KEEA 1HBTH 1TGSZ 3TK9A 1YCPM 1DY9A 1SGDE 1T7CA 1OWJA 2KAIB 1BMMH 1BTXA 2ZDVH 1HXEH 1MKXK 1BDAA 3RLWH 1OYTH 4NIYA 3QX5H 4INKA 1TX6A 3ATWA 1QRWA 3RXOA 3MNCA 2PGQB 3ZZ5A 1S6FA 1F0UA 2A7CA 1M9UA 3RXCA 5JYIA 2ZZUH 1O36A 2BQWB 1UHBB 3S69A 5A2MH 3QWCH 3A7XA 3ZZ9A 4AG2A 4ZXXH 1O34A 4MG3A 1LCYA 2XC5A 1Z1JA 2Z3CA 1O3EA 2VH0A 2BMGB 1EUFA 2WINI 3QLPH 5IDKA 4LXBH 4NWLA 3MO6A 3SU1A 3UNRA 5L2YH 2VB0A 3E3TA 1TNIA 2I6QA 4Y6DA 5JBCS 3F68H 3QN7A 2FM2A 4ZKNU 3FZDA 1A61H 3UUZA 3GCOA 1RIWB 5E0GA 1P12E 1ZHPA 5DP7A 1MD7A 4AG1A 4WVPE 4J2YB 1DXPA 4ISIH 1AWHB 1TQ7B 3S9CA 1PPFE 2ZGJA 4DURA 4FUJA 1ZMNA 1THSH 1TYNA 1IOEA 1GJ7B 1MH0A 2CGAA 2ZHEH 1GMDF 3SV7A 1HAVA 1QY6A 2BD3A 1UK3A 2TGTA 1W13U 4I33A 2A4QA 2FLRH 2FTLE 1SLUB 2AMQA 3SGAE 2QV1A 1Y5UT 1EAXA 4MPWA 1QQ4A 5ESTE 3UIRA 4Z0KA 3SUFA 1SVPA 3V7TA 4CRBA 4B2BA 1EASA