2F9RA

Crystal structure of the inactive state of the smase i, a sphingomyelinase d from loxosceles laeta venom
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
285
structure length
285
Chain Sequence
b'ADNRRPIWNLAHMVNAVAQIPDFLDLGANALEADVTFKGSVPTYTYHGTPCDFGRDCIRWEYFNVFLKTLREYTTPGNAKYRDGFILFVLDLKTGSLSNDQVRPAGENVAKELLQNYWNNGNNGGRAYVVLSLPDIGHYEFVRGFKEVLKKEGHEDLLEKVGYDFSGPYLPSLPTLDATHEAYKKAGVDGHIWLSDGLTNFSPLGDMARLKEAIKSRDSANGFINKIYYWSVDKVSTTKAALDVGVDGIMTNYPNVLIGVLKESGYNDKYRLATYDDNPWETFKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sphingomyelinase D 1
publication title Structural basis for metal ion coordination and the catalytic mechanism of sphingomyelinases D.
pubmed doi rcsb
source organism Loxosceles laeta
molecule tags Hydrolase
total genus 103
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2005-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2f9rA00
2ISDA 5T91A 4R7OA 1DJWA 6PTDA 1QASA 3OHMB 4I9TA 4RW3A 1XX1A 2PLCA 4I9JA 3CH0A 3KS6A 3H4XA 1T8QA 4S3GA 1V8EA 3QVQA 1PTDA 1DJGA 2F9RA 1VD6A 1DJXA 4Q6XA 2O55A 1DJHA 1DJIA 2PTDA 3EA2A 4F2BA 1ZCCA 1DJZA 1T6MA 3I10A 4RW5A 2ZKMX 4F2UA 1AODA 5PTDA 3EA3A 4I8YA 7PTDA 4QJ5B 1DJYA 3RLGA 3H4WA 1GYMA 3EA1A 3NO3A 3QR1A 2PZ0A 4I90A 4GNKB 3L12A 3KS5A 4OECA 4QJ4B 3PTDA 2OOGA 1YDYA 4I9MA 3MZ2A 3RLHA 3V18A 3V16A 2OTDA 3V1HA 2P76A 1QATA 2FJUB 5T9BG 4RV3A 4F2TA 4PTDA 1O1ZA 5T9CE 2OR2A 3QR0A 1PTGA 4QJ3B
chains in the Genus database with same CATH superfamily
1V02A 5CAHA 4DZAA 3LPFA 3EOLA 4UFIA 2QJJA 2Z00A 3CK5A 2JGQA 4HJFA 4D8LA 3GHSA 3TWBA 2Q09A 2W62A 4UTTA 4PFMA 5L9FA 3W4RA 2O4QA 4AUBA 2Q8LA 1E1CB 4KBXA 1PYMA 3KZPA 1BGAA 3AUOA 4FIRA 4OOZA 4HU3A 4JKKA 1TWSA 1SO4A 1JGIA 2YBVA 5AZ1A 1LL7A 1W56A 4FNUA 1NWRA 3QV6A 2JK2A 1CXLA 2PCQA 1UZ4A 3SCSA 1EJRC 4OWGA 1PE1A 4MNJA 2HK0A 4WR3A 3E0LA 1GYMA 2BB0A 4W5ZA 3VDHA 2WJZA 3NEVA 2Z6JA 3K13A 1XIFA 1NY1A 3ARYA 4IH3A 3TZFA 4UR8A 4GG9A 1X6UA 1YIXA 1FXPA 1XW8A 1UC5A 4PMUA 4GA8A 1PX4A 3U2CA 1OCJA 5ABTA 2PDCA 4IMCA 1ZGDA 5JXQA 1NP2A 3GVVA 4CN6A 3TX9A 4L7ZA 1W6TA 3PTMA 2Y5SA 4AVNA 2ZYFA 2ZDSA 3MWAA 3ZVHA 2PWHA 3CAKA 4Z1CA 2HISA 2E6AA 1E1EA 2BV9A 1TV2A 3UR2A 4RPPA 3WJXA 3G8RA 4LUTA 2D24A 4K3ZA 3O1NA 1I0DA 2PSNA 4CD6A 4HMDA 4MPQA 1FWIC 3URAA 1GOOA 4LNYA 4ECLA 1UB3A 1LBLA 3S0CA 5G2IA 2WPBA 3QGAC 4D8AA 1A5CA 4QRNA 3S6DA 4JFUA 3RPMA 5EL1A 5AOUA 1BTCA 1JQXA 3W1LA 3KVMA 5BRPA 4JCMA 3O6DA 2C1GA 3PZOA 5C2CA 3B4YA 3PZNA 4H6RA 5K9XA 1PTAA 3W1PA 3LHZA 4MKSA 1SO6A 4KGLA 2O92A 3VIHA 5HWMA 4OJYA 1EQCA 2PGEA 3BLFA 1B2YA 5CC3A 1ECQA 3BJTA 2Y88A 4HPHA 2OQHA 1RPXA 4L9YA 4KCWA 1XLGA 4C6OA 3W26A 1HKIA 1UC4A 3ARZA 3TSDA 4AD1A 4FPSA 1GQJA 4F2TA 4OUIA 3HFYA 3V0UA 3BC9A 1TJ2A 4E4FA 1XIBA 2Y2WA 4W89A 4HA3A 5CAKA 3L4TA 1A5BA 3STEA 3WH8A 1TWWA 4MAVA 2WJDA 2X7VA 4FNTA 3PZ9A 4B2DD 1H3GA 1TTPA 1F5ZA 1MXDA 3W07A 1VYPX 3KZSA 4IP5A 2YXXA 3HGRA 4BQ2A 2IXVA 1SZFA 2ZXAA 1W3HA 2BHYA 2NQ9A 3KBMA 3DFYA 1PIGA 1BSLA 3AIEA 4MDPA 2ZX9A 5DMMA 1XICA 2LLEA 4A3HA 1RJRA 1J18A 1JZ5A 2PLKA 5LIWX 5AC7A 3GW0A 3GH4A 4JCLA 3PP7A 1JUBA 1Z6KA 4B9ZA 3VZXA 1KFBA 4DEFA 4NZCA 3OEXA 3ARSA 3DC8A 3C5QA 3D3AA 4O1FA 2XUCA 3UVIA 7A3HA 2FPTA 2QCLA 5F2LA 3PBGA 4F66A 4H8UA 3FYYA 3KHJA 1YXDA 1OX4A 1LRQA 5H91A 2WK2A 1B3OA 2HROA 2WMJA 3OVQA 3MCNA 3OOQA 1GVIA 4WKFA 3N2CA 2UWFA 4AISA 4O0QA 1TVNA 3DFNA 3OHMB 3FEQA 2Y7EA 3MUIA 2X1TA 2X30A 3CMFA 2YLAA 1YEYA 3BE7A 2OXNA 3NJ3A 2VFGA 3DCPA 1HJUA 2ZDRA 4MYAA 3BGAA 3CQ0A 3ZYZA 5FF0A 5JBEA 1DJGA 3VUSA 4HCDA 5CSYA 4Q8QA 1R86A 4EACA 1NU5A 2CLKA 1WUFA 1LUCB 3KFTA 5DMYA 1F2JA 1R38A 2Y61A 3KM8A 1PL9A 1ZTVA 3N9SA 3VNMA 4Z42C 3VGGA 1V08A 2EPOA 2VL4A 3HV8A 1JZ8A 2VHLA 3B9OA 4GE8A 4MG4A 4O8AA 4ORIA 1OFOA 3DHDA 3UP8A 1GOXA 4GIAA 3QOKA 2GWNA 4GNKB 3REQA 3CL6A 3D5HA 3G1XA 4A29A 4PMRA 4AZCB 3FOKA 1TIWA 1HGWA 4DPQA 1PS9A 2A1YA 2GQ9A 1XBVA 3EWZA 5I06A 4L4OA 1PDZA 2PGFA 1VFHA 1MSSA 3CZJA 5I24A 1YTKA 4QX4A 2HMCA 4QNWA 4UQ9A 3ARTA 2VYOA 4YCPA 2I9EA 3JZEA 4I5RA 4PCPA 4AY8A 4B16A 1R3RA 1VBHA 4HCLA 4C91A 4PRTA 3BL3A 1PIIA 3M6YA 1E70M 2XWEA 4OU1A 1IWAA 3SUWA 3GE7A 4JDYA 1IZJA 5AHEA 3ZFHA 3N17A 1POKA 2XYLA 2VOTA 4GJ1A 3CT7A 4S3GA 2ZUWA 4EANA 4HZ8A 1NEYA 3LV6A 3V7PA 1IXQA 3F5KA 3DHFA 5CXPA 2EAWA 2Z2BA 3CV2A 4IUGA 3UR5A 2HPIA 1BG9A 3VNIA 3IAQA 2I5GA 5B7YA 4B3LA 4L61A 5C8BB 1UCWA 4XZWA 3QKEA 1NM9A 3WSUA 2CLPA 2ODOA 1FXQA 1GKPA 3PNZA 2PFHA 2WHJA 3L2MA 1EIXA 3SW6A 7ODCA 2VR2A 1BPLB 1Q63A 7PTDA 2W91A 4S3CA 5KSWA 2E6DA 3FHQA 2NV2A 3LDVA 1S5NA 1RH9A 2I7GA 1EC8A 6REQA 3BK0A 3C52A 3ARRA 1W8GA 3GHRA 1C8VA 2WQDA 1CW2A 4O16A 1QBBA 1KM1A 3R8GA 2GVJA 4LCQA 2DIJA 4YVXA 1EWDA 5D9PA 3A13A 4TMCA 2PC4A 2VRKA 4GBUA 3WUGA 1WB0A 3S1VA 3H7VA 3FVMA 4LF1A 5C9WA 3A21A 4R88A 3G1AA 3UPMA 3Q4DA 4ZL1A 3L4UA 5H6HA 3SZ8A 1SR0A 1G5AA 4DBDA 1Z44A 2PC8A 3UZYA 3TTSA 4WCJA 3TQVA 1UUMA 3IS4A 2Y24A 3E2SA 3WNPA 2RDWA 4OGZA 1TV4A 3G6MA 4QTGA 1JD7A 4TOQA 5DF0A 4B15A 3WDIA 3K4DA 3UR8A 2IPFA 3QKZA 1MXSA 2VEIA 4XD3A 1OC7A 3IIZA 4G6CA 4RLIA 2Y70A 3LG3A 5D30A 4XAYA 1QI3A 3PHAA 4Q4OA 3LK6A 2ZZ1A 1GQKA 8A3HA 2EBNA 1KCXA 2QCMA 1OB0A 4FIQA 4FR6A 2J13A 4Q7NA 1A80A 5CBBA 3LXAA 1R85A 1J8VA 3A5FA 3UY7A 4DHGA 3QM3A 1CXIA 3HBLA 1L0PA 2J77A 5TD4A 4U5KA 3OLGA 4I7VA 4RNIA 3IARA 2VP8A 2XHYA 4A8NA 3FNDA 5REQA 2G37A 1C8QA 4I9MA 3TTYA 1GTHA 1GEHA 2J6XA 4U10A 3DENA 4RNJA 1M7OA 3MDUA 4ZOEA 2P5NA 4CU7A 3M5XA 1OF6A 1OM0A 2P1FA 4LH8A 4ZENA 1XCFA 2DIEA 4KESA 1R3YA 4BQ4A 3TUUA 2IPGA 2QF8A 2ZRXA 3LPOA 3LUTA 4EKJA 1D7FA 4BA0A 3FXGA 3DAQA 3M6DA 2G95A 3IJ8A 3K2GA 1JF6A 3D0CA 3N18A 4M6UA 2OT1A 4JTHA 4MY1A 3VD4A 4UNLA 3I7SA 1BRLA 3W29A 1G6CA 4ZO6A 2IKJA 3AMCA 1ZBVA 3B8DA 3WJSA 3KCJA 3NR0A 1XPGA 2BGQA 4G5DA 4MB5A 3W2KA 1O5QA 3M07A 4Y9NA 3TN6A 3B9AA 3BW3A 1QPRA 4Y9OA 4HGXA 5DANA 3G1HA 3DG7A 3VOJA 2D3LA 3WFAA 4U33A 1A4LA 3BV7A 2PDYA 1P0KA 2IXUA 2WNZA 3S2CA 5HNRA 1FHDA 4FO4A 3T0DA 4QGCA 3MYPA 3IGHX 3F7JA 2C0HA 2WLYA 3BOLA 3W1AA 2EO7A 3AYSA 2BMBA 4K7YA 4PGLA 1XIDA 3UXKA 1MW0A 4CNOA 1RVGA 2B31A 4MSSA 1NDWA 4RZ5A 4W4QA 2G50A 1YE6A 3TYBA 1OD0A 4M7SA 1KFCA 2QMKA 2PDBA 3C6CA 2ZRUA 3PB2A 4GZIA 1UKOA 2YDRA 5HNTA 1KM3A 2PDFA 1OVDA 3ICJA 3LERA 3SCRA 3RF9A 3RITA 4FLOA 2HVMA 3O0FA 4R7OA 5C9ZA 2VUYA 1P7TA 3CT2A 1UUOA 3GLCA 5L6UA 5IXEA 1XKJA 1I2NA 3KX6A 3GDLA 3UXLA 3VFLA 1EZWA 3KVLA 4HSHA 3E1F1 5LIKX 3WDQA 2POZA 3KRZA 3WBWA 3H2NA 1H5YA 3G2GA 3GH5A 5EGRA 4DWSC 4K36A 1MFVA 4NY2A 5AZ0A 4IP7A 5AHFA 2GGIA 4PB5A 4F40A 2QIIA 3OJGA 3W00A 3NSMA 2G4JA 3R0UA 1B5TA 3FV9A 4O1DA 4DZ5A 3EKZA 2A7PA 2DZSA 3R4IA 2PLMA 3KOWA 5HNUA 2VVSA 3TLLA 1SU5A 2GVYA 5HDRA 3OU8A 3ARWA 2VRQA 3MANA 2P8CA 3M41A 1FDYA 3T78A 4AHOA 5JIPA 2PWVA 1FX6A 1EO5A 3IVSA 2XZ9A 2WXDM 3T0AA 4MDOA 3LLDA 1W9BM 2AGKA 4J7RA 4MJZA 1H7WA 4GCAA 1S46A 2SFPA 7XIMA 1OQFA 4F0KA 3SGUA 3HPXA 2VFEA 1TUXA 4G8TA 4DBUA 4QDWA 2F61A 5HPCA 3P80A 2YDAA 4R3UA 4FMVA 4I6VA 1X8FA 2WW5A 4FA3A 1EUNA 2V68A 2EF9A 2J8FA 1MQPA 3O05A 5BU6A 4E38A 2NQ5A 2HBXA 1D3GA 4M6QA 4QLLA 4GZJA 4FNPA 3C2FA 1VFOA 1GNXA 4HT3A 1WXZA 1Q6GA 3SUTA 1I1XA 1UMYA 2FYMA 3LCFA 1Q6RA 3H7UA 2VCCA 3MUCA 1PZ2A 4O0ZA 3KXQA 3RR1A 1FRBA 1EH9A 4FAMA 2R6OA 2OOFA 4OV4A 1F3XA 1B31A 4QJ4B 4F9JA 5BNKA 5BWAA 5H8PA 1ADOA 3PR2A 3T0CA 5EB8A 1QOXA 3P3BA 1EF3A 4RUBA 4UOJA 1TPUA 1J5TA 2VRJA 1C3FA 2UBPC 3CXOA 1B9BA 2P3EA 3PG8A 1XJBA 2BGSA 2PDWA 2WVSA 3UWZA 3BLEA 1TO3A 4XVEA 3W27A 2OO0A 4LUSB 1L2UA 5LGZA 5A8OA 3PAOA 2BLEA 3BICA 4LV9A 2VCAA 1XS2A 4HZMA 1ZS2A 3WDHA 1DV7A 3HIJA 3NZGA 4W7VA 1GJPA 4CCCA 3HQ1A 3GDBA 2CLHA 3QY6A 4KGJA 2PEVA 5LSMA 1CX9A 3IJDA 4CKQA 4XQ6A 3E9AA 4AEOA 3KDNA 2BASA 1OG0A 4NX0A 1MDRA 2BHZA 4KWOA 3KWXA 1QOQA 3W7KA 4BF7A 3F4NA 4NZ3A 3B8IA 1JEZA 2FZMA 1EDTA 1Z7AA 1TX0A 3ELFA 5FA5A 2PBGA 3MHGA 4EAMA 2PDHA 2WMIB 2WANA 1WBJA 2VGIA 3H6OA 1Z89A 2XGBA 1L6SA 4YPJA 5D2WA 1YYAA 4Y7EA 1ZBWA 2VQUA 4A05A 1WPCA 2D22A 4PFHA 5D04C 2R1LA 3CS2A 3NM1A 4CCZA 4KMQA 1JD9A 4XD6A 3GD6A 4AH7A 1SSDA 3JU2A 4V15A 4H6QA 4LOCA 1AZ2A 2G96A 3W84A 1E1FA 2WO5A 5LKYA 1VRDA 3GDTA 4CEXC 1XD0A 1OHLA 3TOYA 1EJXC 1Y5WA 4UWMA 1J0KA 2DDXA 2O56A 1K9FA 3NA8A 3RN6A 2ONEA 4HU8A 3PNUA 4MZ8A 3HQNA 1ZPTA 1FUYA 1Q6CA 1W3LA 3NOEA 3V5OA 3WLRA 2PF0A 5A8QA 4US6A 4YHGA 3CTTA 1VEMA 1DJHA 1X38A 3OIHA 4ZR8A 2HNHA 4NI3A 1AZ1A 3UJ2A 3ITYA 3S1UA 4FR1A 4NAFB 5C54A 3CO8A 1XQKA 3VUPA 2WWCA 3NO3A 3U5UA 5G4EA 5ECUA 1ZAJA 3DN5A 3NOYA 5F7UA 3MCMA 3RNDA 1JAKA 3SCTA 2HDJA 3UJSA 5IM51 3EX4A 1EOKA 1K8CA 2P76A 4LCSA 3NL5A 4GK8A 1GOWA 1S2WA 1S1PA 4AB4A 1GZ1A 1JQVA 2ZUMA 3S5YA 3EOSA 2CZVA 1PZ1A 2XPKA 1W91A 3VI2A 4AC1X 1AQ0A 5I07A 1RLDA 4D71A 2NW0A 1HFBA 4H83A 5HK4A 5XIAA 4RNHA 3PZGA 1NOWA 4Z2IA 3PVFA 3T08A 5F2IA 1Y5VA 3JRKA 1LQ2A 4U4MA 3QYSA 1O95A 1UH4A 2P3ZA 4IPJA 2ISVA 2OZTA 4EAYA 5U4NA 3EWYA 3W6LA 1JGMA 1WDQA 4GO8A 2GLKA 5E9AA 3M9YA 2QIWA 3CWNA 3FY1A 1JULA 3S2LA 2FDSA 4H9YA 2DP3A 1PKMA 4O57A 3E2VA 4HA1A 4I8DA 4O28A 2VI0A 2J62A 3CUGA 4R5EA 1MEWA 4HN4A 2QDHA 1VLWA 4X3ZA 5CSUA 2YXGA 5BROA 4ZOBA 3CB3A 2FVKA 1CI1A 1N8IA 4DRSA 2FMOA 2ZRYA 5FJPA 4AVFA 1MUCA 4PH6A 4JIHA 1OCNA 4C6CA 1GJWA 3R94A 3FGCB 4O1AA 3SCNA 4PRWA 2WJFA 2XIOA 4K1GA 4L1WA 2YX0A 4XWUA 1ZALA 1W3TA 4QQUA 1VJIA 1RY8A 1NWUA 2MANA 1EGVA 2W67A 2HXTA 2PE4A 2O9PA 5EBAA 1KXQA 1G7VA 4YTTA 4WY0A 1L9WA 2GUBA 3M44A 3WD0A 3L4WA 4GFIA 5EMUA 3LHWA 4M6VA 4C6KA 2E9BA 3STFA 3QHMA 3WL0A 3ZJ7A 1UA3A 3WQ5A 5IDZA 3IK2A 1WAWA 4XUYA 1O5KA 2I17A 1AG1O 4I3GA 5BMWA 1GVSA 4RE2A 1OK4A 2E25A 4XBKA 5E0CA 1C90A 4ACZA 3VILA 3UERA 3NVTA 2PZNA 3VABA 3H4WA 3N9KA 3UA3A 2X2GA 1Q7QA 2WSQA 2QJGA 4H9ZA 3TOPA 2OEJA 4Q6JA 4XAGA 1TREA 2FVLA 3VIMA 3TAOA 4GQRA 5IOBA 1W1VA 4W7WA 2PA6A 5HA7A 3DH7A 3EZ4A 3GHUA 3VD3A 3LRKA 3IRDA 1SW0A 4I5UA 3WMCA 1R9YA 3QW3A 4WKHA 3LCLA 1XM3A 4IL2A 4PA8A 2C16A 3LNMA 2YGYA 2X1UA 5A6TC 3IV8A 1E0TA 2WMFA 3IV3A 3WUEA 4Z1YA 2O0TA 1KKOA 4I9TA 1TTIA 1PWLA 4JIIX 5CBJA 3L0KA 3MKCA 3GXFA 1QI5A 3TQ0A 4TU1A 2QKFA 3UWYA 1QNVA 3EYPA 3W22A 4J2PA 1QWGA 2Q3OA 1ZHAA 1MFUA 4JTAA 3CL8A 1TA3A 3GH7A 4LB3A 3LPGA 3AYTA 3PBVA 2TSYA 3AXKA 4ML4A 2O55A 2PWEA 4ZFCA 4Q8WA 3RRXA 1UWAA 1GCYA 1VB9A 3BUVA 5FL1A 3OG3A 8XIAA 3Q58A 4RW5A 1GVOA 3UNTA 2BXZA 2V5LA 3GG8A 2CPUA 4Q4RA 3O63A 1P1MA 1YPIA 2QV5A 2BY2A 3AU6A 3F4VA 1TCDA 3V36A 4GQBA 4LUJA 4YTQA 3KOZA 3RLGA 1KD0A 1P0DA 1OC5A 3AAMA 3IPWA 1H63A 4LU0A 5I3JA 1SZGA 4GQQA 3ZQ9A 1SMDA 3RU6A 2VC6A 4QG8A 4D72A 4O4VA 3ARXA 2QV4A 3BW2A 2W92A 1W9DM 3G8EA 5DBTA 3N6JA 4LRTA 1JXKA 2IPWA 3TYDA 2AL2A 3WH7A 1MUWA 4EXQA 3TCSA 4OOUA 2HV5A 6TAAA 1HKJA 1V3HA 1W1A1 2DVTA 3JW7A 1CGTA 3BG5A 5AC4A 3SM0A 3NQ8A 2FTYA 4P7RA 1LWIA 3CLWA 5BWFA 2E5BA 4YHEA 3GXIA 2FLIA 1DOSA 4AG0A 3C86A 1EBHA 5BZAA 2Y5JA 3W0KA 3MUZ1 5CPSA 3D46A 3N2XA 1B4EA 1OX5A 3G1YA 1UP3A 4U3CA 3MI3A 5E9XA 3UZZA 2QCDB 1KQZA 3RMJA 5A6JA 3LXBA 4O11A 2QPUA 2RDXA 3VMOA 1ZCCA 3WLJA 2QLYA 5TIMA 1XLAA 3MB9A 4DF0A 2ACRA 9XIMA 5GNXA 4HZ7A 4C6NA 3EKLA 3ANYA 3DFTA 3KOFA 1Q6LA 2Q71A 5EU9A 3UXIA 5A1AA 4H01A 4MB3A 2PWUA 3EWCA 4N02A 4DI9A 4PTMA 1KRCC 2WKLA 1DL3A 1TELA 2NVAA 1UIPA 3QGVA 4GYFA 1XC4A 1R2RA 1UBSA 2GWGA 4NU7A 1BF6A 1S5TA 4JQ1A 2YW4A 3A3HA 3QY8A 4H1ZA 2C3ZA 3JR2A 3EDFA 4AWUA 4J3VA 4AD0A 1M7JA 1PZ0A 4BKNA 2QUMA 4BI7A 1BXNA 3CMJA 1UW9A 2WZIA 2GSJA 2NQLA 1OJXA 5EBUA 7TAAA 1GHSA 2YCJA 4IPIA 3W7GA 2J24A 4PMQA 4X22A 1K7EA 3L0NA 4EPDC 5I5RA 2FDMA 4NL1A 3CH0A 5H1WA 1W32A 3KTXA 2GJRA 5K3VA 3P8IA 1F3WA 1PVNA 2QT3A 1TJ0A 1ZL1A 3WFLA 3C0LA 3VK5A 1EIBA 2Y8UA 2YB4A 1E1CA 3TZNA 3PJXA 3PUOA 3SGZA 4EOUA 3ES7A 1DJIA 3HO8A 3EA2A 3B9DA 3ABZA 2DZUA 3LLXA 3CHFA 4S3AA 2OU4A 1LP6A 1BKSA 3TXVA 1DP0A 4WKAA 3S46A 4B5UA 2XTKA 3TW9A 4IQJA 2BP1A 4GVFA 4FXJA 3QEZA 3AIBA 2VX4A 1XLHA 4NI8A 2R9RA 4JTCA 2WZHA 4IMGA 2X2YA 1JI1A 3R0KA 3TJ4A 1KBLA 4NIRA 1EDGA 3URBA 2E67A 4OE7A 1OWQA 3MP4A 8XIMA 3BLOA 1AW5A 1N2VA 4NJGA 5C5YA 1Z41A 4XVDA 3U7VA 5BXRA 5D02A 3BLKA 8CGTA 2NUWA 3AIWA 3PUGA 2F6KA 3HPAA 4ZFMA 3C56A 4TIMA 5I00A 1EJWC 1TQJA 2WNQA 3WQVA 2QEZA 5D32A 4F0HA 2BSLA 1DWGM 1V3LA 3AFBA 3W81A 4YWIA 5D09A 1K8YA 1GOQA 3MQTA 3QGKC 1Z42A 4KRZA 4HOXA 1XBZA 3VIFA 4Z17A 4KH2A 4AZIA 2X09A 1G0CA 2ZUVA 2A3AA 1VHCA 1EP2A 1PTDA 1FVPA 3TVAA 4MUPA 3A3WA 2HCVA 4M51A 1V6VA 2XIQA 3W7JA 4UTMA 5C70A 5FCZA 1TG7A 2A3EA 2CLOA 3NG3A 2VEGA 1K4GA 3O9NA 3MI6A 3DEQA 3N11A 1TRDA 2FGBA 4EIVA 3WD4A 2DQWA 3UYCA 1KRBC 3FFSA 1J6OA 1XUUA 4J4KA 5HQLA 3WD1A 1TPFA 2Q02A 4TR9A 1C9DA 3HU7A 1TVPA 4ZB0A 5I0DA 3GBDA 3BLDA 2H3DA 3LTSA 4FXRA 2CLEA 4PUNA 1VKFA 5A6AA 2J78A 1OC6A 3EB2A 4ZXLA 2ESCA 1W3JA 2E0PA 1DVJA 1E51A 4EVZA 3W53A 4QM1A 4GX8A 1JXJA 1FA2A 1LWJA 2DT3A 3N2BA 1DWAM 3GAKA 1VFTA 1KWKA 1M6JA 4EF9A 2BGNE 1BVNP 5CSRA 3THUA 4Y2WA 4LCRA 3IUHA 3T6CA 3LXCA 3CZEA 2CZDA 2PWFA 2X7WA 2ZFAA 1JDCA 1CB7B 2FHCA 4WDXA 3WLOA 4KCUA 1ALDA 4B91A 5IHRA 1Q3NA 3SCUA 4GACA 3YPIA 4HHLA 2GYIA 3UZ5A 2D3NA 3QMSA 1GQIA 3AS1A 4UZUA 3I4EA 2XSXA 5A2BA 4AMAA 2V81A 2IW0A 3VX0A 3SI9A 3KW3A 1H51A 1RBOB 1TB3A 4Q8VA 1H09A 3QBUA 2YL9A 1UH3A 1PHWA 1H60A 2X42A 5DQPA 5J8LA 4Z2JA 2PWDA 3S9ZA 3N6HA 5A8MA 1J0HA 2YDSA 2A4AA 1QAPA 1RP9A 4UR9A 1KBKA 1LRNA 3W75A 4S3FA 1VEPA 3N13A 4DJDA 2ACQA 2E9LA 3WLPA 4MYXA 3N3MA 1SQ7A 4Z2KA 1Q6QA 1A3WA 1EJUC 3VOIA 2PUZA 3TA6A 2D1ZA 4GQ0A 4M1RA 4PUJA 5BW6A 4JIPA 2XM2A 4HPNA 1LQAA 4YTRA 3TYUA 1LRTA 1Q65A 3CHCA 4GYKA 2G3IA 4L1XA 1AL7A 2GQ8A 1VZWA 3W38A 3C0SA 2VDGA 4YWSA 3H4XA 1UH2A 2YR1A 2JIWA 5DY3A 2VZUA 4CLMA 1LDCA 3VC6A 3OQ8A 1OYCA 3SO7A 2XIIA 3ITCA 1OBAA 2NUYA 4ZOCA 3M47A 2CC0A 3CAQA 4BZYA 4UMCA 2XVNA 2FGZA 3RHGA 1LCOA 3CAWA 1UPMB 2GGJA 2TMDA 4JIRA 3VZYA 1E0VA 2E6FA 4NXSA 1ZAHA 4KEVA 4A22A 3WF3A 2GJPA 1IT7A 1LOQA 5FL0A 2ATMA 4JHZA 3WBEA 1JCXA 3VNLA 2XH0A 3WLIA 3NO1A 3TQKA 5ENLA 1YBQB 4WQ6A 4K2SA 5MKGB 1FWDC 1PV8A 3BTNA 3FK4A 4XISA 1JPIA 1RLCL 5BOFA 3MHUA 2WVUA 3UA4A 4YYCA 1WKYA 1BLIA 1DE5A 4XK2A 1P48A 2NZLA 1XGEA 2O9TA 4OQVA 2W6RA 4MWAE 1B1YA 4UQCA 2XJ7A 1V93A 4JX4A 5FOOA 2B7QA 2PODA 2OWWA 1TCMA 2Y5EA 5D2XA 2XN0A 1NAL1 5DLCA 3W1MA 2VDIA 3LX9A 1WZMA 1T99A 3O3RA 3S42A 4RW3A 1A50A 3M43A 2VENA 1XLDA 4DZHA 3A9BA 5H8UA 3I6EA 4LS1A 1OFDA 1H62A 5AYBA 2R1NA 2ZXQA 4GISA 1G4EA 3MJYA 1TTJA 3DZ1A 3LBOA 2EEXA 3QZEA 5LZLA 3POHA 4ZO7A 2IS7A 1ICSA 3GC5A 3WNNA 3NQEA 1BEUA 4H4IA 1DE6A 4HJWA 2ZZ6A 3IIVA 4C5ZA 4J27A 5D37A 3FSTA 2QCGA 1M41A 3GVGA 3PZQA 4BJHA 3CC1A 3AHVA 5HUOA 2FHFA 4QS5A 2FH6A 3VKBA 1MRAA 2DQXA 5M17A 3HMJG 1QHPA 1DQWA 1NDZA 4CQDA 2E28A 2XINA 2O7SA 1B9ZA 3KL5A 1PDYA 1GVEA 4HMEA 2YBTA 1CDGA 3LHYA 4HK6A 4NNCA 2YDQA 1A3XA 2C0AA 4HU4A 4F4RA 4IJRA 4AHQA 4JQ2A 3WH5A 1WUEA 5HPOA 1K77A 2VELA 4J5NA 2ISFA 3OBAA 1GOIA 3Q37A 5I3IA 4HCHA 3AXHA 3M5ZA 2XFYA 4MWAC 4HIBA 3N4EA 2CZ5A 4B5XA 2A3HA 4A35A 4CVUA 1EYWA 3HG2A 1HIZA 1U5VA 4WOZA 3T4CA 3BSGA 2GJLA 3ZJ8A 5CQ1A 2VGBA 1X39A 3AWNA 4Q32A 3W7IA 3GYCA 2V9DA 2QHAA 1A5LC 3XISA 3N2MA 4DO6A 4TVUA 2ZA2A 4NYYA 1KLYA 4Y6GA 1MMFA 1EGMA 5IHSA 1EC9A 3W72A 3OGSA 1ZFJA 4MJ4A 3WBYA 3AHXA 4LGXA 3W73A 4NRSA 3WFZA 1TMLA 4IXHA 2GGHA 3VYLA 3TC6A 4F79A 1ZBKA 5DELA 5ECVA 2Y0FA 3NIYA 1OF8A 1XF0A 4QJ5B 1YW1A 1LF1A 1RD5A 3LRMA 4M29A 1H1YA 4JEQA 2PTXA 2OLHA 5CH9A 2PDGA 2VEPA 4TUFA 3V75A 3VKCA 4DWSB 5BCAA 3RM4A 2P53A 2CHOA 2PP0A 1PZ3A 1AVAA 3PWGA 4GHRA 4XAFA 1NF0A 2AQWA 3MSDA 4D9PA 4IOTA 3WJWA 2DSZA 3HV9A 3ONCA 1XRFA 1QRQA 3AICA 3HQPA 3FYOA 5LNWA 3WLTA 3S47A 4QP0A 4UQBA 3KBNA 4UTUA 1NP0A 1WP6A 1CZ1A 1Z69A 2ZBTA 3CQKA 4XO7A 4WVXA 4NAEB 1D8CA 1XR2A 2CNCA 2FTWA 4X63A 3MUAA 4PE8A 3VNDA 3NURA 1QW9A 1UKSA 1HL8A 4GGHA 1KXVA 3CHDA 2V3GA 1Z8AA 3AI0A 2WYSA 3WKZA 4FK9A 3CAVA 2REQA 3CHVA 2EXOA 1IIHA 3AIVA 3RYSA 3WNKA 2CERA 1JZ4A 3DHPA 4TX8A 5A8PA 1REQA 1PKYA 1UQYA 5CPLA 4IJBA 4M0XA 4DO7A 1ZUAX 1HVQA 3VKJA 1JFHA 5LIUX 1QK2A 2C71A 4N6FA 5F4SA 3DESA 5DCEA 3PBUA 2G0WA 3JS3A 4J3XA 2ZRVA 4QDMA 3BMWA 3QTGA 4WEVX 4M8UA 4PB3A 1KCKA 3W7NA 3ZWTA 2I56A 2BHUA 2W4XA 1F73A 3KBJA 4PN2A 1Q6OA 2Z7GA 1IGWA 1OEPA 2ZZ5A 1DXEA 3WIJA 5AVNA 3HG3A 2VGFA 3LMYA 2QPXA 4XKYB 2PS2A 3SIMA 2I14A 2E8ZA 2B7NA 5I03A 1HJXA 1IE7C 1NJJA 2ICSA 1ITQA 2E40A 4L9XA 1DQUA 3P62A 3USZA 2TPSA 3CQJA 2AOSA 1TV7A 2A5HA 2WZEA 3MW7A 3L4XA 3R43A 4E3TA 2OZ3A 1HF6A 4IX0A 3O0KA 4A3UA 1LM1A 1YDNA 2QUUA 4YN5A 1RK6A 1G7UA 5I3GA 2A3BA 4PMJA 1TR9A 3PFMA 2WNNA 1ESWA 3BAWA 3SY5A 3SN4A 3AYRA 3H2AA 4FHAA 4LBRA 4Q7IA 2UV8G 3HGJA 4O14A 5I79A 1W1B1 1P4CA 1HN1A 5AHMA 3LBCA 4XBSA 4Q6XA 1KR0A 4G7FA 1IXNA 3F1QA 3TJIA 4B5WA 3PANA 3SRHA 5JVLA 4YYFA 4FX6M 4U28A 1L8NA 3N14A 1VPYA 2TODA 3HJEA 4KPLA 4DBEA 1MDLA 2XZ7A 1JI2A 2E1DA 4RXGA 3T8LA 3N29A 3OODA 4PR4A 1S1RA 3VXGA 4GY1A 2WC4A 2VOMA 1E71M 3WNLA 3HB9A 4W84A 3A24A 3CWOX 3NQ2A 4KERA 2QCNA 4XZNX 4XD5A 4PTVA 4CU6A 1FH8A 4UUIA 3ATYA 4N9BA 4X9YA 5KZMA 3WQ4A 4OVXA 3MT1A 1W1YA 4QDPA 2WMKA 2V5JA 5T9CE 4PMOA 4CNPA 2NV1A 1W8SA 3UETA 3P61A 2Y6ZA 4LT9A 4BFAA 4WUIA 4J35A 1H7OA 2YA2A 5CPQA 5A8GA 1F6PA 3ZR4A 3H2FA 4JTUA 1DJWA 3SGGA 2WHKA 2I1OA 1XGZA 3E6EA 3Q2DA 3W7OA 3GWQA 4R7JA 3NDYA 5BU9A 3WY1A 1X1NA 3MV01 3BURA 4MTVA 3ZM8A 2FFCA 6CGTA 5GPRA 2RDUA 1GKQA 4DYKA 3R89A 5GJNA 5H2ZA 3O2LA 4G7EA 1JAEA 1DJXA 3S3GA 4LYRA 4AYGA 3BGGA 1EO7A 3NQMA 5FI8A 1QR7A 4P8VA 3AJXA 2PP1A 4IL0A 3LTYA 1EEPA 3SRKA 4GPNA 1YTEA 4GVIA 4QSFA 5DBUA 4AWEA 2OKTA 3S5ZA 1T0OA 2A21A 4LNCA 1BYAA 3B8VA 3P5ZA 2DW7A 2NSXA 1DJYA 1UR8A 1QPOA 4K1WA 1C91A 4J9JA 3UU0A 1IF2A 2P0IA 5CJMA 3U2EA 2VO5A 4PUWA 4UCFA 5CC7A 3C3NA 2YYUA 4PB4A 4XIAA 4EX4A 1E43A 4QJ1A 3GXMA 2WKGA 1DWHM 3PBWA 3QZAA 4S3JA 4JKMA 3SUUA 4JTJA 1LQ0A 3LS9A 4FNRA 3HGOA 4IIFA 4NG3A 1QUMA 4DJEA 3N2TA 4DBWA 4LVFA 3U9IA 3KL3A 5AC6A 1RBLA 1ISXA 2FZBA 5EPDA 1K8ZA 3WLNA 3TW6A 5G4HC 3H22A 4YTUA 4NSBA 1C9WA 1O66A 4AX6A 2VR4A 4AQLA 1JFXA 3KTCA 3WX7A 4PCFA 4EP8C 5IBXA 3DBNA 3F4WA 3PBMA 3IJ9A 3AU2A 5HR7A 2OPJA 5HR6A 3HA1A 2AQOA 3SECA 1HKWA 1KXTA 1AH0A 1I60A 2P8BA 2J7GA 2CXGA 4D2JA 3U6WA 3VD5A 1V6TA 4Y9PA 3TTOA 2JALA 4YNGA 4JICA 5FF2A 1GG1A 1PB0A 4HPJA 3W76A 3QXBA 5M5DA 3ZJKA 1JPMA 1D3HA 4GXPA 1HP5A 4WK9A 1XIEA 1UBPC 5F4XA 3EGJA 1AMKA 3WDJA 3S6TA 4JTDA 2C13A 3T1GA 4DXKA 4Z08A 3N73A 3LD5A 1X6LA 3NQVA 1GUVA 3IIPA 1ONRA 3AIQA 3K46A 4A21A 1A0CA 4HN8A 3F2CA 3CZKA 3W88A 2Z29A 4JQAA 2JKAA 3BG3A 3INPA 1J2BA 4ADUA 2WMIA 1Q5MA 5HJLA 3WDPP 3WMBA 1EX5A 3CQHA 1D8WA 1QK0A 4REQA 5JH1A 3UCDA 1EJSC 5E6ZA 2ZQ0A 1OX4B 3PPHA 2D69A 5LA0A 4D8ZA 1JCNA 1O94A 4AVOA 4J28A 4I9JA 2FH8A 2OCZA 3PPGA 2VTFA 4R9OA 5KZEA 4H9TA 4NQ1A 2E77A 5AHIA 1JNEA 4FOJA 4IPNB 3GDRA 4ZEPA 1XISA 3B9EA 2XSAA 3APYA 3QW4B 3VX1A 3GQYA 3H21A 2J9ZA 2ACSA 5A94A 4YCOA 5C2GA 3VO0A 3UD6A 1RQHA 4DJFA 3RU8X 3CU2A 4E0CA 4ZO8A 4K7VA 3MC5A 4NZ1A 2HS6A 1UKTA 2PAJA 2FHBA 3NPWA 1CNVA 2W27A 3LSCA 3NSNA 3WD3A 1W5NA 1UWRA 4NX5A 1XLFA 2HE8A 3U3HA 4G56A 4LVAA 1GONA 4GUIA 3GU9A 2YCKX 4WXYA 2OWXA 1W5PA 1UZ1A 4RDVA 3REQB 4INFA 1H2JA 5LNSA 1I6NA 1KM6A 5AECA 3CIWA 2Y62A 4CNTA 1MI3A 3IGUA 3CUIA 1IGSA 4C6LA 3A4AA 3AS0A 1A49A 3OGVA 5C71A 1DJNA 1GVFA 3ZZ1A 2Z7KA 1HL2A 4QQ3A 3A9IA 2GGEA 5IFPA 5KINA 3RLUA 1T8XA 1CBGA 3L5AA 2OVLA 4XD4A 3K4WA 3S9IA 3EWXA 3GTHA 4CQCA 1IWPA 1E6ZA 4IF2A 3W2LA 1RP8A 1V0NA 4Y8FA 3NL6A 1HZYA 1HKMA 4HHPA 4MAZA 2Z26A 1GQNA 1V7AA 2XSBA 4F0MA 4ZOAA 1TWZA 1A47A 4ADSA 1LG2A 3L23A 3CMGA 1EOMA 2OGYA 1WV2A 3U7BA 4W5UA 2G3FA 3VPLA 1D7KA 2ZKMX 4YMZA 1WOAA 4URIA 1VF8A 4AZ6A 5CZJA 1BWLA 4OBTA 4XZBA 4C6DA 3W74A 3CBWA 3WK0A 3GSMA 4ZQRA 3UY8A 5EMMA 3Q94A 4UR7A 4O8RA 1M5WA 2QVHA 1VCFA 3EOUA 3WQOA 1NOUA 5M3WA 2J8TA 3G6LA 1V3JA 4NUWA 3TN3A 2PDPA 1FY6A 4V27A 1HJVA 1US2A 1UKQA 1LLWA 4L56A 3RDKA 5LHEA 3S83A 3CUFA 4GC3A 2F6XA 1FP8A 1CPUA 2JGYA 1BAGA 3F4DA 1EYEA 3QR3A 3FGCA 4DLMA 4XO6A 2DPEA 3WQDA 3IJQA 1QW7A 1UD4A 1XX1A 4J3WA 2OQLA 5CKSA 3S2NA 1BGGA 1K8XA 4NHVA 2Y85A 3H55A 4G1NA 4QE5A 4QG9A 1UWQA 2IKGA 2ZC8A 3BSHA 4E2OA 3QQWA 3HOJA 4DJDD 3VD9A 2WM1A 3OYZA 2HWGA 3GG7A 1JDDA 1EPXA 3PBYA 1R9XA 3PM6A 5F2GA 3IACA 5IFTA 1KGWA 2V5CA 3LN3A 2WHMA 1CGUA 3AJ7A 1G67A 1Q2RA 3M7WA 1Y0EA 3S5NA 4XKMA 1V4YA 4WHBA 3FSUA 4IMAA 3FXYA 1V77A 4LVDA 4IWWA 2OEMA 2Z1VA 3FX4A 4QEEA 1ICPA 1E3ZA 2QDDA 1XCWA 3IJ7A 4IFRA 1W1ZA 1KGUA 4IP4A 4JQ3A 2H90A 3V5FA 3NO5A 3C2VA 2GOKA 3DYMA 1CXFA 1I2QA 4FSAA 2A3CA 5ABHA 1XG3A 1NELA 4MB4A 3P60A 3B3DA 3NL2A 4S38A 5JH2A 1E4LA 5KZDA 3WQ8A 4JL2A 2XGIA 1XXXA 4LXFA 2ZUNA 1M01A 3NDZA 2GPTA 3N1AA 4IGNA 1F74A 3P14A 1W31A 2DT2A 3BW4A 4GVGA 4N9CA 4B3KA 4C6EA 2V3DA 3A4XA 1UZHA 5BRQA 2PLCA 5E93A 2D73A 2QS8A 4NZ5A 3DFHA 3H2CA 3U48A 1M7XA 1GPWA 2HVOA 1LG1A 1TPH1 2O9OA 4W8LA 3TFCA 3C2YA 2VX5A 4LY8A 2UY5A 3HQOA 4ORMA 2WB5A 2ABAA 2GVGA 2QPSA 3RPTA 1T5AA 1CGVA 1LTDA 2YYTA 3GVQA 4NJKA 1X6NA 1FFQA 1MRQA 2PRLA 4RE3A 1B3VA 3BQ5A 5TNVA 2AKMA 5BYWA 4PCTA 2Y4SA 3T0TA 3ECQA 1XFBA 3I6TA 5A2CA 1F9CA 5LIYX 3N9RA 1TPC1 4IZGA 1TZZA 2RAGA 4X9SA 2DH3A 1U33A 4GABA 2X8RA 1M9HA 2F84A 3FDKA 1ZJHA 2DGAA 1H4PA 5G2WA 3URNA 5AY7A 2OX4A 3UEQA 1YXYA 4V1YA 1HNYA 1BYBA 2YOCA 4O18A 3RLHA 5C0QA 3SDOA 1HJWA 3W7PA 1OFPA 3NPVA 3IIXA 3P5YA 3I7RA 1ZAIA 3TNOA 3N15A 2BVYA 4HOZA 5KTLA 1TFVA 1GKRA 3DC0A 1FWAC 1VFMA 4DQWA 3NQ7A 1HQTA 1KRAC 1CT5A 2E09A 2VZVA 1JNDA 5FKYA 2BY3A 1FTXA 3ATZA 3QRHA 4MM1A 4TMBA 3QV8A 2F7FA 3TE9A 2XM1A 3AQUA 1RY0A 1VBUA 3PJWA 1T8QA 1P7TB 1OIMA 1KBJA 2BWGA 4MY8A 4GIEA 3G24A 1CLVA 3G0XA 3GAYA 2R1KA 3GDKA 3IVTA 5SWUA 3ZVIA 1KM2A 2G3MA 4Q4MA 4Q3MA 2QCCA 3O16A 4JTEA 4J3ZA 3LHVA 3VA8A 1VGAA 1TV3A 5A6LA 3B0XA 1E6QM 3KLLA 4F2BA 4MUZA 4Q33A 4ZZ9A 2QCDA 2QUVA 3EAUA 1OCQA 4FALA 2PD9A 1Y5XA 4RZ4A 2Y63A 1RPKA 3W1NA 2R1MA 3BJFA 4Q22A 3QHOA 4Q7BA 2INFA 1IXOA 1XYMA 4ZTXA 4A2SA 1DTUA 1FOBA 4FLSA 3T0BA 5JMUA 1GORA 4WSJA 2DSWA 3UG3A 3CO4A 3V4BA 4FNQA 4TTGA 1OFBA 3W7LA 1MYRA 2CKRA 2V2DA 1J4EA 3CIVA 3LQLA 3TU9A 4AEEA 2HZGA 4JFTA 6XIMA 1W17A 1UZDA 3P0XA 3WUFA 1Q45A 2BNJA 3OPSA 5BRBA 2DFAA 2H9AB 1OZMA 4Z2LA 1W3KA 4FB7A 5HXMA 1IEXA 2ZZ2A 9RUBA 4I9AA 3XIMA 2GGGA 1D9EA 5JQ9A 1IEVA 1OABA 1IEWA 2PRHA 2YL8A 4C65A 3OYXA 4AZGA 4ML9A 4DUVA 4GYPC 4WIWA 4P2VA 3R10A 3SFKA 4RXFA 1L6FA 1H41A 1Z32X 1U5HA 4NKCA 4Y90A 5KETA 5BXPA 2C91A 3QN3A 4HYWA 4AYSA 4C6PA 4KIRA 3WH9A 2E68A 3UR7A 1WDSA 1FWFC 3U0HA 1YHTA 2YIHA 4I8YA 1H1ZA 1X1OA 5BMXA 1V6XA 1MQRA 3LYEA 1JL8A 1J0IA 5DRCA 3LRLA 2ZOXA 3B9NA 1YNQA 4PULA 1I8JA 3GNPA 3A5VA 2RH9A 2NX1A 1RBAA 5HANA 1N82A 2OTDA 4Q8PA 3H23A 1YKWA 4JTLA 5FAGA 3V0TA 3LM7A 4M82A 1ISWA 3NGFA 3PY2A 2BS9A 4U31A 5F1VA 4GUHA 3FVDA 1UD5A 3SAZA 3ARQA 4DI8A 3GR7A 2W63A 3APGA 3QF0A 4MJ2A 6PTDA 1K9TA 1EKOA 3NYZA 4E2VA 4RNFA 4JPGA 3DG3A 1L2QA 5HJXA 2OGJA 2W79A 3N04A 1AQHA 1P0EA 3ITVA 4PMDA 3TN4A 2QCFA 5CPTA 4CQAA 5TF0A 4M1BA 1U22A 2CLLA 4C6JA 3TDFA 2FZ8A 3ZJ6A 3M64A 4ES4A 4AXNA 5TBOA 3G1FA 1V3KA 4YL2A 3HJZA 1AUSL 4FX8A 1UP0A 1M04A 3CEUA 1KTNA 3THAA 3W24A 4JTIA 2ZE0A 3AISA 3W25A 4ZB2A 2GK1A 3STPA 4EPEC 2R8WA 3T81A 4OIFA 4LAMA 1OADA 3TWAA 4N4PA 3A6OA 2GDVA 4DM2A 3TP4A 2OLAA 3AUJA 2G5WA 3IJLA 3UGVA 1WOBA 4NNAA 2XIBA 5HMEA 2X1SA 3ARUA 1D3CA 1FDJA 2ZZ4A 3MPGA 1VJSA 4J40A 5A6MA 2BXVA 3ZMRA 1UR0A 1WDWA 1KWGA 4GOAA 1MWOA 1WDRA 3V5CA 2JF6A 3BLIA 2GFTA 2J25A 1BG4A 5D03A 4R9XA 2YCIX 2OYLA 4ZMGA 3G1SA 1NSJA 1M03A 1WYIA 3LCXA 4WDUA 5LYRA 4CU8A 2GZXA 1EJTC 4RJEA 3TR2A 3W1UA 4BQ3A 4EPBC 1VCGA 1RXOB 1E73M 4O10A 3L4YA 3R11A 5M03A 3POCA 4UFHA 1O5XA 4FOUA 3LBMA 3LY0A 2VM8A 3VDCA 1SFJA 3TCEA 2OYKA 3N12A 1I1WA 5CGTA 4ZODA 2XFRA 3L2IA 1FP9A 1KGXA 3VKKA 4IG2B 1KFJA 3M0IA 3H8AA 4H6EA 4PL2A 1RQBA 2L5HA 1BVWA 2V2CA 1Q6DA 3C61A 4CNUA 2ALRA 4DELA 3GU2A 2GL5A 2VURA 3UQNA 2DH2A 4MY9A 4AIUA 4QE4A 1JZ3A 3TROA 3O07A 2JQXA 4XX6A 2Q3RA 4AY1A 4IMFA 3UZJA 1IT0A 3KBWA 2V6AA 1L6YA 3KRUA 3CJPA 3WO8A 5AC5A 3HURA 1FWNA 4CD7A 2HE5A 3V18A 2WCAA 3STCA 1XIMA 3OZYA 4HNNA 2PRMA 1LLOA 1CGXA 3OVRA 2WPGA 4OKDA 4W8AA 3JVAA 1O1ZA 2FGLA 1GEQA 2WSYA 3BG9A 4MB1A 3WQCA 1K7FA 3K5XA 4E4PA 4KWVA 2DSUA 3F5JA 3SUSA 4LS2A 3GRIA 3FJLA 1RAKA 4DIAA 3TH6A 4IICA 4LUIA 1HJQA 4MGGA 3QSRA 2D2GA 2XFFA 5HMDA 3UW6A 4MWAB 4ZCWA 2QVNA 4HK5A 4D6CA 2CBVA 5M2FX 3NSXA 1S5WA 1YX1A 3Q67A 4GXWA 1XYLA 1EHAA 4GO9A 3MMTA 3W7RA 4CQBA 1GW9A 3VGDA 3DI1A 3I10A 3UPBA 1S2CA 4MZYA 4DJED 3SQMA 2PD5A 5E6YA 2NWSA 4AX7A 2FTPA 3OZMA 2INZA 1K70A 1GJUA 3KRBA 3TC7A 1T7LA 3OGRA 2EJAA 1K9EA 5DMLA 1HVXA 4IX2A 2X0HA 3II1A 4AZHA 2VCBA 2R1PA 3SJ3A 1WXJA 4UTWA 1PUDA 3C2RA 3W7DA 4S23A 3DFSA 1YBQA 3CQIA 4ZE5A 1U5JA 5MKGA 4CN1A 5K9DA 4LTSA 1JPHA 4AIOA 5BXTA 2DVUA 4Z1DA 1UUQA 2IQDA 1FWSA 4LANA 2BDQA 2F38A 5I09A 1QW8A 4E6MA 1DWJM 1P6BA 1UJPA 4BF5A 5EFDA 3CHEA 5FF3A 2YJQA 3T55A 1YNYA 2J7FA 1HO4A 3AS3A 4O0KA 1WCGA 4JYFA 3WLQA 2EGZA 1E9YB 2YCLA 1XBYA 3GTIA 4LVBA 4QXIA 3VMNA 1A5MC 4GGBA 1Q4NX 5K2ZA 5MF5A 4DO5A 1J10A 5K4XA 4WY0B 4QAWA 1ML1A 6A3HA 4L4PA 2BFGA 3VOCA 1KM4A 2Z28A 4AZ7A 2CBJA 2V5BA 2I57A 3RGTA 2OELA 3QQ0A 4V33A 2ZICA 1VYRA 1J12A 1TWDA 3K4AA 3OLDA 3WJZA 1SFTA 1V02E 1W0MA 2DZWA 1BYDA 1E6NA 3EWBX 1OIFA 4PMNA 3LTPA 5LXEA 3GB6A 3W82A 1I0BA 1F76A 1Z48A 4CCEA 5AYIA 4ACZB 4RCXA 1IT8A 3QLDA 5F1UA 4UQDA 4B90A 4WSKA 2J7CA 1V0LA 5CG7A 4PUEA 1BHGA 3B8UA 3E38A 3L2LA 3V0SA 3NCOA 2KX9A 4AAJA 2Q01A 3LGEA 5I6SA 3T7VA 4RL3A 5ABEA 1ISYA 1CWYA 2VC5A 3VGHA 1SM9A 1HKVA 2G4FA 3BZJA 1PSCA 1Q6EA 1E5JA 4C1NA 3GG1A 4OT7A 2WHLA 3C0JA 4XSMA 5FEPA 2OR2A 3W1QA 4DJFD 2Q6ZA 3Q45A 4TX9A 1OG6A 4S2CA 4LYQA 1BD0A 2X0SA 3WG6A 4XB3A 4ICMA 4J3TA 3T40A 3ZIZA 4N42A 4YU1A 4XIMA 5FJJA 1JVNA 2DT1A 3WF0A 4QS6A 1O7AA 3SURA 3UZWA 3OZPA 3IAPA 1JG9A 4KCVA 2BXYA 4TX6A 2F9RA 3NYDA 1KBIA 1QNOA 1IR1A 4O19A 3OG2A 3HPZA 4DAFA 1F05A 1WDDA 2WSPA 1XLEA 4F0RA 3MBDA 1QHOA 4DN1A 3EWWA 3NTYA 3H54A 3HGSA 2EKGA 4A2RA 3T44A 1MXGA 4A3RA 2QMJA 3W23A 2DT0A 3EWUA 4D6HA 4MF4A 4IPPA 4K8HA 4NZ4A 5CLWA 1V51A 2ABBA 1XLKA 2ACUA 3PK7A 4RDWA 4IFKA 1XDJA 4IQDA 1QPNA 4NVTA 4UTTC 2B7PA 4JIQA 3VE9A 4DWSA 4HMCA 3UWUA 5C7HA 1GVYA 1ZNNA 4MKNA 1VFSA 4O1BA 1UWUA 4K38A 3VKDA 3L5LA 5LXXA 2AL2B 3P82A 2FB2A 8RUCA 4O4WA 2ZXBA 4ICNA 3K1DA 3O6YX 5D2VA 1W5OA 4CCDA 5I7GA 2VX6A 1RA0A 3KP1A 4O1EA 1ZZMA 5CSSA 1KO0A 1XQLA 3OB8A 2PDXA 3ERPA 1IYXA 3SQSA 1W2PA 1B90A 4LEQA 3SN0A 4AEFA 1GZGA 4Q8NA 4J3UA 1GW1A 1FWJC 3KP0A 3NGJA 1I75A 1KKRA 3GNRA 2QUTA 3WK2A 3SY1A 2OSYA 4L4MA 3VDBA 3DFOA 4D1IA 1Q13A 1E6XM 2R82A 4QE1A 1W2VA 4RDZA 1AQMA 1CGWA 4C6MA 4H8VA 3CM4A 1BXCA 3RILA 5T8GA 3V1PA 2VFIA 3W87A 4IGMA 4A8LA 2PDLA 3RXZA 3FHAA 1XLMA 1A5AA 3EB3A 4EXBA 4DO4A 1V6UA 1WDPA 4HBKA 3R1ZA 4JTSA 4RX0A 3N34A 3UGRA 4B4FA 3B05A 1G4PA 1C29A 1YNPA 3GKFA 3MUY1 4AMCA 4JFSA 2FFIA 2CBIA 1F07A 5FJUA 2A85A 1MW3A 4XG1A 1HW6A 2CLMA 6ALDA 2AMGA 4GWEA 2INEA 2HBVA 4XKYA 1KFWA 4O13A 3S2MA 3AMKA 4GZ7A 2PF8A 5HUPA 3IVUA 4K39A 3R7MA 1WKEA 1QVBA 3KTSA 1ONEA 1HL9A 3GXDA 1F8MA 4L6DA 3S9YA 4MVAA 1O12A 1QCWA 3B0VC 3CUZA 2DSKA 1XBXA 2X0YA 5LNRA 1YPFA 1M68A 3WQFA 4IUOA 1PX3A 5A2AA 1RHCA 4A3QA 1XYFA 5I77A 2IUZA 1F6KA 3M0MA 1W1IE 1EUAA 2KAUC 4M7TA 3KCOA 3L65A 2ZCGA 2PTDA 2VD8A 1ICQA 4P5UA 1DHPA 2ISWA 2V69A 1E5NA 4B3ZA 4KWWA 1VBRA 4GI9A 1RCOB 2OX1A 2W61A 4KEZA 2OJPA 4DY1A 3WMSA 1UD6A 1UP2A 4RPQA 5D4YA 4ERAA 1KV5A 2ZUTA 3QR1A 3W7EA 4IMDA 3KS5A 1JCTA 3AZRA 3SRFA 2R14A 1YDVA 4KFPA 1CXEA 1V79A 3MZ2A 1DKWA 3G1VA 3K8MA 1UKPA 2E1WA 4DUOA 1XH1A 5A5WA 3F2DA 4S3KA 4JN6A 1EX1A 3N19B 2QGYA 4MNMA 1ME9A 1EDQA 2VFDA 3WZ0E 1SZNA 1Q8JA 5TQLA 4ZGYA 3ZWSA 1HO1A 2FIQA 5DT5A 2V67A 1KLZA 3KRSA 1LT8A 3NEHA 4UNKA 4W9TA 2D0HA 1HT6A 3QTPA 3GXPA 3W01A 2UY2A 1OGSA 3S6OA 3CEPA 4S39A 3P8JA 1RQEA 2CIPA 1TE1A 2WBKA 1I9CB 1P1XA 3E0WA 4JX6A 3Q65A 3BAJA 3THQA 1S2VA 2ISSA 3HMCA 2W9MA 1QNSA 1XSKA 3VIPA 1B54A 4B92A 5E09A 3NQFA 1H0IA 2ON3A 4LWWA 2DW6A 2PWGA 4AFYA 3M1ZA 2QGHA 2IQ0A 3L67A 2B0MA 2QDEA 4CQ8A 1FWEC 2Z2AA 2ADAA 1K9DA 3N2OA 4IMEA 4L80A 1OFQA 3APTA 3LA4A 2WVVB 3WF4A 3WLSA 4LS0A 5CZKA 5ABGA 1VYSX 1XSJA 3U8GA 2P50A 3CNYA 4N0RA 3RCMA 1ZJAA 4QCFA 1E6SM 1UYQA 4W8BA 4Y96A 4IQLA 4F9DA 1A0EA 2VFHA 3SRDA 4M24A 3G0UA 3TC3A 4HA0A 5CBIA 4LRSA 1JDFA 5G1YA 3OLEA 1XWYA 2WCSA 1A0DA 1Q4WA 3WQGA 3ZR6A 4AWSA 1E0WA 1Y65A 3S1GA 1KW1A 3F03K 4PSPA 3W6YA 3PF3A 5GVJA 2YKKA 1TPB1 1LYXA 1C92A 1F61A 4QIUA 5CG0A 2C6QA 4KFNA 4YVPA 1UR2A 2XISA 1R3TA 2WBGA 1FWBC 4QLJA 3L21A 4HQVA 3L7RA 4C1KA 5C9UA 3TAKA 1DWIM 4NZFA 4ILSA 2IPJA 4J1OA 2O7QA 4YJ5A 2QF7A 1Q7ZA 1GT8A 1DIDA 1L8PA 2OZ0A 1X96A 1QPQA 1PIFA 3ZS4A 4DUWA 4F2UA 3M0HA 3W2MA 4LC6A 4GVHA 1TKKA 1V0KA 2DZXA 5TAOA 2VZTA 4JN7A 3ONBA 4R27A 1K6AA 1FFRA 2PDMA 4POCA 3PAJA 4XZMX 5GNZA 3FCPA 3QYQA 4LALA 1A5KC 5EY5A 3S4TA 4XBJA 2PMQA 4U2ZA 2OFJA 5JUVA 4RDYA 3A23A 3PN8A 3EDDA 1DIKA 2PI6A 5AFDA 3VINA 2QCHA 4CNNA 5G5IA 3R5EA 2FZNA 3T9PA 5E0KA 1NOFA 3C4UA 2YCEA 2D2OA 2BZNA 1ECEA 2GJXA 3WLHA 5EMJA 1DHKA 4JIEA 3RJXA 3VC5A 7REQA 1BQGA 3PUEA 1MNZA 2G3NA 1QU4A 1CECA 2ZTKA 5XINA 4MOZA 4H8HA 3BMXA 5AYYA 4A4AA 1CTNA 1H7PA 2BG5A 2VJXA 2CITA 1IEIA 1MEIA 1E56A 4C60A 3FAXA 3GZAA 3A22A 4X0NA 4ZXOA 4QROA 3EEZA 3TA9A 2R24A 1J2WA 1XP3A 3OA5A 4WJ8A 4P7OA 1PCKA 2ZTJA 3H24A 2J7DA 1G4SA 3HZ3A 1US3A 1XKYA 3E5BA 1EPVA 4MPKA 5HATA 3VAVA 1DPMA 1PO9A 1DXFA 5B80A 3VMPA 3SCOA 4BS0A 4AXKA 4HZ6A 2YSWA 4S3DA 3TK7A 4AIBA 1QWKA 4GYJA 2WAGA 2ZE3A 5A95A 1JYVA 3VGBA 4JTGA 3O15A 4EXAA 2UZ9A 2J74A 2DJLA 4PCSA 3WL1A 3VM7A 4Z1AA 2QDGA 3PZUA 2GSHA 3QJAA 4AHPA 3S1XA 1X98A 1TSIA 2HNEA 2FJKA 2AKZA 2C14A 2PP3A 3MJMA 4KEMA 4HNLA 2QNEA 3K8KA 2GJNA 5F4WA 1ME8A 3MSGA 1GWJA 1B3XA 2CHNA 1T41A 2QJHA 3HPSA 3WNMA 4OFCA 3EWDA 3DFQA 4K68A 3SSZA 2CEQA 4JR5A 1CXHA 4S2BA 5HAOA 3PFRA 5ABFA 1F7BA 5E70A 4JS3A 1AK5A 2B4GA 3NL3A 3QV7A 4N7QA 3T4WA 4O52A 1PKNA 3BQ6A 4U5IA 1FWWA 4GQGA 1T40A 4C90A 2HEJA 2F8QA 1GGOA 4ROPA 1OFAA 5A69A 4K37A 1BWKA 3AWOA 2QXWA 1JR1A 4JN8A 4V2XA 4Y9MA 3EA3A 3G18A 4PSRA 4PODA 3PWIA 1SZEA 1WNOA 1HJSA 1KV8A 2QCEA 5F2MA 4D1JA 2R94A 5D05A 4GH1A 1U1UA 4HTBA 1J0ZA 2ZUSA 2OO6A 3KAOA 2YA1A 4R53A 1JPKA 4JTKA 5CZ0A 1MNSA 1EJ7L 3KOYA 1AW1A 3PTQA 3LCIA 1GHRA 5FF4A 3GG0A 1K6WA 2J9XA 3NQBA 1OGBA 5T9BG 3WLLA 3S5OA 4IPLA 1ZSXA 2VT0A 4YTSA 1PTGA 1U83A 2Z0IA 3F4CA 1QOPA 4LAUA 2ASHA 5DN1A 1XRSA 1YADA 1J01A 4LYKA 2JF7A 3MMWA 3NQGA 1A53A 2CWXA 4JTTA 3GC2A 2OSWA 3R6IA 5HMSA 1AH3A 3AMDA 2ATSA 3ZT7A 2XU2A 3AMLA 3T2PA 2NT1A 2V2HA 3ANVA 1EXPA 1JCLA 3OP2A 1PJ9A 3ID7A 2GVEA 1J6PA 3FAWA 4V1XA 3S1WA 4HU0A 3H12A 2WKJA 4DBSA 1DJZA 3RLVA 4QHRA 4UC5A 1NQ6A 2YB1A 2XN2A 2QAFA 1XLIA 2B7OA 1KCLA 3E0IA 4UTWC 3T07A 3UWEA 3MMDA 5LNVA 5HMFA 5DO8A 1QI2A 5IDIA 1L6GA 1XD1A 1ONWA 3WYZA 1MZHA 4A8IA 4AD5A 3M0YA 4PC8A 4XZIA 2JBMA 2Y7GA 3H70A 1LOSA 4PMVA 3VNYA 5EA9A 4GUJA 4QNEA 1GOKA 4AW7A 5C7VA 3W2JA 3QPYA 1V0MA 3RK8A 4D6FA 1AL8A 5FACA 4P8WA 1QFEA 2IKHA 1H11A 1UR1A 2HK1A 4BQ5A 4NJIA 4Q4SA 2OZ8A 1VRXA 3KEHA 3TIMA 2Z1BA 3MO4A 2A6NA 2PDUA 2QUNA 1G94A 2GQAA 2FZDA 3MTWA 1XLBA 4KRTA 1YXCA 2PLJA 1XIJA 3GO2A 7ENLA 2XGZA 4Z2GA 4IT1A 2WMHA 2REQB 4IIDA 1GYLA 4PTNA 2ZZ3A 3SB0A 4GKTA 3R13A 4GJIA 2VNCA 5G2HA 3M5VA 5A8NA 1OD8A 4RE4A 1NARA 1PAMA 1REQB 2OT0A 1LOLA 3BSMA 3NNTA 4FLRA 3EDKA 1HXJA 1WZLA 3MP5A 5HULA 3U4FA 1QHZA 3VU2A 1EEXA 1TVLA 1KA9F 3UCCA 2FPYA 1R30A 3MA8A 2ZX5A 3P93A 5I02A 3NQDA 2WLZA 1RCQA 5AN7A 3AYVA 3SCVA 1OFRA 1E4NA 4LEFA 3FA3A 3FKRA 4IQEA 4CN4A 3ANUA 4M6PA 4FF5A 1W37A 3PZIA 4CQ9A 1KTCA 5U7SA 4H7CA 1UR4A 1JYWA 1EL3A 2G97A 4BHYA 4IFOA 3QH2A 3G1RA 3CUXA 4KF1A 2VXNA 4C6IA 3DDMA 1PEZA 1AH4A 2WQPA 1ADSA 2DZVA 2PTWA 3I68A 1N7KA 1J5SA 5LHFA 1EGZA 5E0FA 3GDMA 2NWRA 2V30A 3CV1A 4FLQA 1H7XA 5C9XA 4MZ1A 4MMWA 4HKPA 4LBUA 3LI1A 3GYEA 2PDQA 2HSAA 3P74A 1G69A 1RJQA 2PB1A 3GNDA 1P0BA 3J7HA 3URQA 2NXHA 2AAAA 4TQTA 2P10A 2CLFA 4LQ1A 1V5XA 2J6VA 2VX7A 1I2RA 2EPKX 1UOZA 4HVXA 1C93A 3CTLA 3WEOA 1O1HA 4IM4A 2Z4GA 2WV8A 3CUHA 4HSOA 3B8WA 1HGYA 1OK6A 2V0TA 3TJXA 1NVMA 4B5VA 4QAIA 4DYJA 4GFSA 4EPKA 1FWCC 2C1HA 1C7TA 4KWUA 3WQ6A 4QLKA 4PMZA 1PPIA 3LHTA 1R46A 3TW7A 2Y89A 1H5VA 3GIYA 4GJJA 4CD4A 1JPDX 1SW7A 2Y8KA 3MKVA 3I3BA 1E40A 3B0YA 4TO8A 1OINA 5DEZA 1RSCA 4C6FA 4F0SA 2RKXA 4BWLA 4H7VA 1KQYA 1XYAA 4B5NA 4FP1A 1SGJA 1MZRA 4Z1BA 3ABSA 3P7YA 1TZ9A 2J4GA 4PZVA 3HM7A 4GXMA 4N4QA 3PJUA 2H9AA 1C8XA 3UXDA 1RR2A 2QJMA 3VCCA 1DBTA 5I3DA 4HMNA 1LUCA 1IZKA 1AJZA 4S3BA 1AJ2A 4QSHA 4ZSTA 1AQFA 3HG4A 2JE8A 4H19A 1NWSA 3W7MA 2H8XA 3DECA 5EYWA 4DWSD 3R58A 4CUCA 3LZ3A 4G7EB 4XSLA 3PPCA 3QFWA 3C0QA 2P88A 3GXTA 1XCXA 3R8HA 1AODA 4GUGA 3W1TA 4MFEA 4DX3A 3FYPA 2PU1A 3W9ZA 1W9PA 5EFFA 4AZCA 4U3AA 4JDBA 5B7ZA 2ZWYA 5E5CA 1LWHA 4E5TA 2QULA 1UR9A 3CWHA 4FXFA 2HQAA 2O4MA 3GR4A 3M4HA 3IK4A 2YFNA 5HWJA 2ZUUA 3H2MA 4N6EA 1JJKA 3GW3A 1TE6A 4TV6A 4DWDA 3ITXA 3MVIA 2CWNA 1W1PA 3MBFA 2PDIA 4BI5A 1QI0A 4GI8A 4NRRA 3ALGA 1C7SA 2D23A 2J66A 4JY8A 2TYSA 1TPEA 1WX0A 1WA3A 3RRAA 1ZQ5A 2NT0A 4QISA 4UZSA 5DCDA 3GC4A 4WXZA 3IJIA 1BTMA 3BV4A 3WK3A 3UG4A 1NIUA 1S3TC 3RUBL 2DEPA 3WELA 2CU0A 2C1IA 1XLCA 3RG6A 3SEPA 4WJXA 3GM8A 5DXYA 3ZSTA 1OYAA 3RAOA 3BJSA 3G5EA 2DVXA 3RR4A 2C79A 4UCGA 3EKGA 3QC0A 2QR6A 3GY1A 3VKAA 5CGQA 2HXUA 4P7QA 3KLKA 4E3VA 1FCQA 3FW6A 1UQZA 1CXKA 4PUKA 3NZPA 3DX5A 4P8XA 4ZVJA 1TIMA 3MO7A 3EX6A 2XH7A 3LI0A 4M3PA 1UWSA 4ZA0A 2NQZA 3ZO9A 3B04A 4GH3A 2BVTA 3ITOA 1S3HA 1IXPA 1TWIA 4UXDA 2HVNA 5HJYA 1GPFA 1JZ7A 1JYXA 4GKLA 1H49A 4LW7A 4I90A 1DTNA 3IUIA 1H1NA 2WJEA 3N4FA 3FJ4A 4E8GA 3ITGA 2WZMA 3G3MA 3ZSSA 2XVKA 1XC6A 4JX5A 2E8YA 3TYAA 3BOFA 3EXSA 2TAAA 1SJBA 1TJRA 5FJIA 1KFLA 4UTLA 3UPWA 3AC0A 1PCWA 1X7FA 2J47A 1RVKA 1VIZA 4M19A 1B57A 2NXIA 1ZB5A 1ZBCA 4UTKA 4Q8TA 1G01A 1VIWA 2ZX6A 4C6BA 1AFSA 1VS1A 3LGGA 4REQB 3SADA 4J2MA 4XAZA 3UG8A 2IQTA 2E6YA 3WCZA 3DGBA 2G41A 3TR9A 3BMVA 1Z9AA 1XG4A 3TSBA 2CBUA 4HSNA 1XIIA 1NTHA 4WD0A 3S8HA 3BCDA 1MUMA 2DZBA 2VEMA 1CLXA 1BVZA 4ONVA 4LAKA 3XINA 1SW3A 3VOHA 3DYOA 3OQEA 1E6PA 3I3DA 4FEZA 4LVGA 4Q8OA 1W1TA 3BO9A 2X16A 1KTBA 3EOOA 4JL1A 4P8UA 3UJFA 5MHBA 4HYVA 4HD5A 4UB9A 4IG2A 2Q8ZA 4O54A 4Y8EA 4ASTA 1DXIA 2XFWA 1W9VA 3M7SA 3NZ1A 1NDVA 5C2XA 1XH0A 1CEOA 3VGFA 2VZSA 1OT1A 3M0XA 1LT7A 2EPNA 2QAPA 4UFKA 2D0GA 4QR6A 3HTWA 4HYRA 4M80A 4NJJA 1E0UA 3RMEA 5A6BA 3QMRA 3WQWA 3CL7A 3DBPA 1WKDA 4UTHA 3DG6A 4D6IA 1XYBA 4CNSA 5I3FA 4WJEA 5DFAA 3W2UA 2ZC1A 3GNXA 5FJTA 1W3IA 1TPDA 3I3EA 4PBFA 4L1GA 4AF0B 4QG6A 5KMYA 3UWQA 3VNJA 2CKSA 3E0VA 4AZ5A 1TPVA 2WM0A 3H2EA 2NVDA 1VFUA 3AHZA 4MFDA 1Q6FA 4LF2A 4YS1A 5DXXA 3VDGA 2O9RA 1CLKA 2PDKA 1YMYA 2NQJA 4GIYA 3UESA 3D3FA 5K7JA 3W6MA 3IGSA 1KCZA 3WF2A 2RJHA 1ITCA 3P6LA 1E3XA 1TV5A 3O7UA 1VEOA 2RDTA 3TMLA 1A3HA 3ENLA 4QBXA 4C5YA 2ZXDA 3GTFA 4MWAA 3MMUA 4P7LA 1R0MA 3VM5A 4AWTA 4FZIA 5LIXX 3IWPA 4LPCA 3WUBA 5CJNA 1UJQA 3PUDA 1EA9C 3T09A 3FIGA 1G9HA 4MIMA 4H9VA 2GSEA 8TIMA 4AY7A 3NVDA 3MP3A 2G3JA 4JTQA 5LGXA 3FN9A 1EB3A 2OOGA 1UD2A 1TJPA 2XIMA 3L4VA 3KBSA 4JGDA 2RFGA 5EMLA 5HNNA 4MLJA 3RX2A 3EPOA 5CPMA 4Y9AA 3CZ8A 1P0NA 3BXWA 3E96A 3CPUA 4K8EA 5D9OA 3M0ZA 4IXXA 3L66A 4RV8A 1U1JA 3DKJA 4JFVA 2DU2A 3TQPA 2H8ZA 1BQCA 4HNOA 2PGRA 2XH4A 3CUJA 3CYJA 3L4ZA 5DX7A 5C55A 4GIRA 1R3SA 1JCMP 4QFUA 4M81A 5J5RA 3EX1A 5G1MA 5AYZA 4XZLX 3MUXA 1VD6A 2JKEA 4KW2A 1FH7A 3RFAA 2RJGA 1AD1A 1QNRA 1H61A 4PTWA 3TSMA 1CENA 3QPEA 4F3HA 3CIXA 3MS8A 1FCUA 4LC8A 5HQEA 1MQQA 2V5KA 2OLSA 1HTIA 2V5DA 4UFMA 1IV8A 3BVJA 4GI4A 3R2GA 4LAOA 2C15A 3BAYA 3BPWA 4LV4A 3EA1A 3BARA 1YE4A 2TRSA 2ZX7A 2YFOA 4WLCA 5D33A 4JQ4A 4L6HA 1SJCA 2DUZA 1SO3A 1I4NA 4R33A 2XIJA 2EG8A 3AIRA 1WE5A 2XN1A 4J3SA 4DZIA 2UY4A 3ZVHB 2C7FA 5CCZA 3ALFA 1SMAA 3NUKA 1A5OC 1LJYA 4IGHA 5HWNA 1W9UA 1FKXA 2QZRA 4LUTB 1NWTA 5C9RA 1ME7A 1X97A 4QEHA 5T91A 3PC0A 3W7QA 1O68A 5JBFA 4HPXA 4P7NA 1LBMA 1FHLA 2PCEA 3TV8A 1VBJA 4GZEA 1C8YA 1DQXA 1ZP4A 3CZGA 4US5A 4NT0A 3MV11 2I5QA 1SPQA 3V3WA 3TFXA 1A4MA 3EXRA 1EXBA 5E1QA 4BK9A 2WC7A 2A3LA 3GK0A 5CC6A 3B0PA 2YZ5A 3THDA 3W70A 3EPNA 1IQ8A 3RCNA 3LCHA 1US0A 2PURA 1K4HA 3CH9A 5M1TA 2WMGA 1J79A 1SSGA 3VDAA 1X7IA 1MEHA 2I16A 1W54A 3VIGA 4EK7A 4UQEA 1IEQA 3STGA 2J9YA 1FDZA 3O8AA 1NQKA 3WLMA 4JZ5A 1OGGA 5IRPA 3L68A 3FA4A 3PSVA 2Y7DA 3T2OA 1SR9A 2J7HA 1ISZA 1R9ZA 4ADTA 3WBXA 2Y8VA 2PZ0A 3AO0A 3HF3A 1P5BA 4B5SA 2RGMA 5HBFA 1XI3A 1Q7MA 2WWDA 3LNPA 1DIEA 2EPHA 2D0FA 3M0JA 3HFTA 3EDEA 4ZQMA 3K8LA 3G3DA 3T2QA 3U2ZA 4ENLA 1FWHC 1I2PA 5BOOA 3IGXA 4K8GA 1JUEA 4OHQA 3T42A 5AC8A 2VD9A 4LB4A 3TYEA 4LUSA 1ADDA 6ENLA 1GVRA 2Z1SA 4AC7C 1AA1B 4OBSA 3MHFA 1K02A 4ERIA 5G1TA 3MYOA 4NJHA 4PL1A 4JY9A 4F48A 3KCLA 3V35A 3GFXA 4MKVA 2CZEA 2ZA1A 1QO2A 4Q4PA 4NZJA 3TTEA 5CLTA 1TMHA 4UMBA 2VGGA 3EXTA 2WC3A 4LFYA 4CD5A 3GXNA 4D6JA 1R8LA 4H8NA 1TUFA 2OQYA 1T96A 4W86A 1XHGA 2QW5A 3CGTA 1U30A 4TV5A 3ZT6A 1EBGA 4EF8A 2XH2A 3KVKA 3GBEA 2OMAA 3T05A 3AOFA 1SZRA 1XPYA 2VFFA 4Q4QA 4JYEA 2ANUA 3EB4A 3QFEA 4JD4A 1E9ZB 1R47A 4OV9A 3L5MA 3JUGA 4M5PA 4IHCA 1VP5A 2ZVRA 4E8CA 1OFEA 2VWSA 4QITA 3WD2A 4R85A 1VFLA 4NNBA 3TKFA 3A4JA 1IIGA 1V6WA 4XZHA 4UBPC 3WJYA 2PBOA 1N8FA 5HQMA 3BLLA 1I45A 3S5SA 4KCTA 3WNOA 4G2DA 4S1FA 1WO2A 3BCFA 3CV6A 4I5XA 2A6LA 2W5FA 4LY4A 1WZKA 4MLRA 2H3BA 3M16A 2YPIA 1JZ6A 1ITXA 3LCGA 5AHNA 2G8ZA 2FKPA 4BCEA 3RCYA 3VFCA 1RUSA 3PPFA 3UNDA 1W9XA 1V8EA 4LSBA 5G4WA 4YXGA 3B97A 2EG6A 5GJPA 1HX0A 3SN1A 2X1RA 2FB3A 4DF2A 1FCBA 1LZOA 4ALDA 1NF7A 2EKCA 5CEWA 3CZLA 3MI2A 1IWBA 3DXIA 2HPMA 1K3UA 4NAFA 1T6MA 5EMYA 4ZSUA 4H41A 5D2YA 4DAIA 1S39A 3NXFA 5HOSA 1TMQA 1F6YA 2OWCA 3WEZA 4UIOA 5AHLA 5FJOA 4PUMA 1A5UA 3LOTA 3R8RA 1RALA 1ZLPA 1FH9A 3UXAA 1B0IA 1ZP3A 3QY7A 3CLMA 1WKFA 4GNVA 3AXXA 4PUUA 2QJIA 3MZNA 4E8DA 4ZB5A 1NFPA 2NUXA 4ATWA 4UOZA 4I7WA 3I65A 2Z1XA 1KNWA 2A2IA 2OYMA 3NQCA 1SJAA 3L9CA 3PG9A 1P6CA 1CYGA 4FF7A 3ISIX 4GD0A 3SJNA 1E6RA 4H2CA 1FQ0A 1KC7A 3AROA 3B40A 3PB0A 2J75A 3TTQA 2EPLX 4ICCX 3ZLHA 3KOXA 4Q8MA 3LZ5A 1XFCA 3MCOA 1P43A 1V3MA 4D6GA 1O4UA 4H9XA 2RUSA 3UJEA 1P6WA 4KRUA 1SFLA 3VOFA 1Y7VA 4DJDC 2QJNA 3ZT5A 4C7GA 2VWTA 3GS6A 4G9PA 4DNHA 1JCJA 3CYVA 1J96A 3LGDA 1A5SA 2C8NA 9XIAA 1UIOA 1EC7A 4L5ZA 3H53A 4GCXA 4HK7A 1SJDA 4JAWA 3NQ6A 2WOQA 5CPNA 3G0SA 2HS8A 3QZ6A 1CIUA 6REQB 2GK1B 2W0UA 5FESA 1FWTA 1HP4A 3DGRA 3WMLA 3RPDA 4C1LA 1YDYA 2E5DA 2BX7A 2VDHA 4B9YA 3W1RA 4IIHA 3DHUA 4HNVA 1PXGA 5CPOA 3NPUA 2WVVA 3RO8A 1YPXA 2NLIA 2CZFA 3CB8A 2YLLA 1QT1A 3VOGA 1KBBA 1FKWA 2NQHA 2BTMA 2EHHA 1M7PA 2DUXA 1E55A 4HB7A 1M3UA 5I23A 1KFKA 4BWLC 3N25A 1VR6A 4PTXA 1PX8A 1XSIA 4UOQA 1GYNA 1TTQA 2F2HA 5FIPA 1QNPA 4I7UA 1EWEA 5CZTA 4L65A 1FBAA 2Z25A 2RHGA 1K1DA 1QASA 3SIZA 3UT0A 3GR8A 2FQIA 3KBVA 4FX7A 2D20A 3OZOA 2DJXA 3B06A 3SQLA 3QOMA 1WZAA 1OSEA 1WXYA 3THCA 2J7BA 3CASA 1X8CA 1OYBA 4O15A 4NXKA 3VIIA 2V8ZA 4PYSA 5DT7A 4DYEA 1VPXA 3TYZA 3NWRA 2UY3A 1R7OA 1YRRA 3ABQA 2A0NA 2EJ1A 1R3VA 3SSJA 1X1ZA 1O5RA 3BWWA 5DMNA 3IJ6A 3KE0A 2QYGA 3P0WA 1ZU8A 3O6CA 3W7HA 2VKZG 3MY9A 1DORA 1B4KA 3PZMA 1R2TA 1H0GA 4WY0F 5REQB 1QO5A 4UMAA 2HJPA 2OB3A 2ZWZA 3HG5A 3L12A 2NXGA 1FCVA 1OT2A 4RR4A 3AZTA 1V3IA 1UASA 3RO6A 3GHTA 3W02A 3IEBA 1JDEA 1LLZA 1VH7A 4NF7A 3HN3A 4A3YA 1K03A 4RV3A 3RM9A 2EG7A 4OTKA 3DERA 1DWFM 3ME3A 1BSIA 3NDOA 2GUYA 1BWVA 3QR0A 4QJ3B 2BOFX 4BF9A 4DB7A 1HUVA 4RZBA 5GQBA 2J88A 2CHRA 9CGTA 3W1XA 2ZIDA 1EFZA 4H2HA 2ZRWA 1BRLB 2XVGA 5J04A 4JTFA 3DI0A 2XDFA 1W5MA 3MDWA 2JKPA 3ITTA 4IIBA 1F3TA 1PBGA 4JHMA 4Z0JA 3TLQA 4E2DA 3PULA 3ABXA 2Z1KA 4HPGA 1ZJIA 4H9UA 4KWSA 5D9NA 1CCWB 4W87A 2AL1A 5AB3A 1M1BA 1V7YA 4ACYA 1ITUA 2VEKA 4JNYA 5JU6A 3O06A 4JBRA 1XYZA 3VD7A 1TZ7A 1AJ0A 4UTIA 3OVPA 2A79A 5KZ6A 1GG0A 1R2SA 3B8SA 1VBGA 3WF1A 2PTYA 1VLIA 3PWAA 4IIGA 2GOUA 3CPGA 3E5PA 2ZA3A 1RJPA 5A6SA 1BXBA 1XIHA 3VTRA 3LM3A 2Q8XA 3IUDA 1LBFA 4E4UA 1B30A 3AALA 3D47A 1XINA 4GX9A 3LQGA 5FEXA 2VUNA 3A64A 1SUXA 1LORA 1UHVA 4BEUA 3MWCA 4GY0A 2KZHA 3P67A 4PUDA 3R25A 2OG9A 2Y7FA 1E0XA 3DIPA 5BXSA 2X1IA 4H00A 3E74A 4CEUC 1EA0A 1G1YA 4EWJA 3PS7A 4CVWA 4UFJA 1ELSA 4DUXA 2NX3A 2VC7A 1WQ5A 4A6GA 3TYCA 1BKHA 5FJRA 3C2OA 2GDUA 1H50A 4ROQA 3KWSA 2DZPA 2AMXA 3NZRA 3SR7A 1ONXA 3C2EA 2YCLB 4L9ZA 3UG5A 1TQXA 4UQAA 1NFGA 1ZENA 2YW3A 1FHVA 3O6AA 3ITLA 5AYXA 3I7QA 3NAVA 3GNOA 2DV0A 2AGTA 4ERGA 1ZCOA 2BODX 2XVPA 4X2PA 2HRWA 3OW1A 1S5VA 4Q4KA 1FHUA 1MVYA 2BVDA 4B2DA 4E2BA 4LAZA 1Q8AA 1AW2A 3N4AA 1QBAA 4KQNA 4JOMA 4XV0A 3PZTA 4W85A 6TIMA 3AXIA 3FJ6A 4N2YA 5J5DA 1KB3A 3BZGA 4U2YA 2Z24A 3FJNA 3U57A 4GLEA 3RIKA 2DZAA 2RGLA 3VNZA 3RX4A 3EX3A 4W7UA 3GNNA 4LBSA 4FOKA 3EMCA 2DORA 4ZO9A 3VVGA 2JEQA 3M5YA 5D2TA 2DUAA 3LU2A 3F5LA 4IJCA 2PPGA 4C1NB 2CXEA 4X0VA 3OBEA 1UWTA 1EHNA 1XYCA 3EBVA 2CESA 1S2AA 2D2HA 2OSXA 2XWDA 1BF2A 3EEGA 2GDQA 1QJWA 2BVWA 3KS6A 3VNKA 3KVJA 5EKYA 2R91A 2ZZ7A 3USBA 1N55A 3W85A 3UWVA 4DLFA 5AVHA 5DCBA 2I5IA 3FEMA 4AU0A 4ZQCA 3E2QA 3H26A 3VCRA 3VIKA 1UR3M 2XVLA 1U1HA 4WGXA 1ZJBA 5A6BD 4HA4A 2ZVIA 3C8NA 3B0UX 4XTDA 4PEEA 2Z2UA 3B8TA 4WX2A 2EQDA 3OO2A 3BDKA 3NQAA 4HOWA 5PTDA 1XDLA 1JCYA 2WNWA 1KFEA 4DNMA 5K9CA 2FZ9A 3M0LA 3FA5A 4QCEA 2CFFA 1D2KA 1PHQA 3AMGA 2VC9A 4NILA 3SUVA 2C18A 3N3TA 2PDJA 3LSBA 3WENA 1W5QA 2VZOA 1SVDA 5D8ZA 1FWRA 4A8RA 4IFKB 2VVNA 4DF1A 3ARPA 3DOPA 1QATA 2FJUB 1J11A 3BCJA 3ZR5A 1E4MM 2JIEA 3A3XA 1MW1A 4KT2A 1VQTA 1J0YA 2VMFA 3B4UA 5XIMA 1E9IA 4JKLA 2POTA 4MWAD 5A6KA 3VE7A 4MNLA 3TXZA 4XTIA 1UROA 4ZTYA 3VGEA 3E12A 4BEQA 1XIGA 1PWMA 3ZOAA 4M56A 4AIEA 1L6WA 4RK8A 2MNRA 4LX4A 3LB0A 1JDAA 1TJ1A 3LPPA 1G4TA 5FEZA 4Z0SA 1DYSA 4H04A 3P2VA 3PSWA 4O17A 2ZADA 4PEKA 2V63A 3ZXWA 4V28A 3GVRA 4RZ6A 4ZQOA 1FWGC 2PTZA 1QI4A 4TXEA 3WBAA 1TPWA 5RUBA 2NSOA 1QPKA 4ATDA 3OVGA 2BBFA 1R5YA 3B03A 4GMEA 1XUZA 3H4GA 4MJMA 2CYGA 1IR2A 2E5CA 2F2KA 2CETA 1QMLA 5EMKA 4AD3A 2MUCA 4ZQPA 1XGDA 4ATLA 1U2YA 2IKIA 4GYPA 2DZTA 2E3ZA 2X41A 4MHBA 1MW2A 4O12A 3UYIA 1QTWA 2WCGA 2CLIA 4KKXA 3TEVA 1UA7A 2W66A 3S2JA 3V16A 3P81A 2C19A 2H6RA 3BOXA 4PBEA 3JZUA 3K30A 1NFBA 3PJTA 3W2NA 1KM5A 1R7AA 1BYCA 5I2UA 4BI6A 3GTXA 4GRSA 1VFFA 3LCWA 4YVVA 4X61A 3E02A 1H7RA 6XIAA 4IIEA 1J0JA 1M53A 4KFOA 1AMYA 4DXVA 1VPQA 4AD4A 1QDSA 2YXOA 2I9UA 3I6RA 4XUGA 3DFPA 5CJ5A 3OLIA 4NYUA 5FAJA