2F9RA

Crystal structure of the inactive state of the smase i, a sphingomyelinase d from loxosceles laeta venom
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
285
structure length
285
Chain Sequence
ADNRRPIWNLAHMVNAVAQIPDFLDLGANALEADVTFKGSVPTYTYHGTPCDFGRDCIRWEYFNVFLKTLREYTTPGNAKYRDGFILFVLDLKTGSLSNDQVRPAGENVAKELLQNYWNNGNNGGRAYVVLSLPDIGHYEFVRGFKEVLKKEGHEDLLEKVGYDFSGPYLPSLPTLDATHEAYKKAGVDGHIWLSDGLTNFSPLGDMARLKEAIKSRDSANGFINKIYYWSVDKVSTTKAALDVGVDGIMTNYPNVLIGVLKESGYNDKYRLATYDDNPWETFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for metal ion coordination and the catalytic mechanism of sphingomyelinases D.
pubmed doi rcsb
source organism Loxosceles laeta
molecule tags Hydrolase
molecule keywords Sphingomyelinase D 1
total genus 103
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2005-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2f9rA00
5T9BG 3RLGA 4F2TA 2FJUB 1DJWA 2O55A 2P76A 3EA3A 4QJ3B 4QJ5B 4I9JA 4RW5A 4RW3A 1QATA 1T8QA 5T91A 3OHMB 3PTDA 4R7OA 5PTDA 4OECA 1QASA 2ZKMX 1GYMA 1DJZA 1DJIA 3CH0A 4F2UA 1YDYA 4PTDA 4QJ4B 3H4WA 7PTDA 4GNKB 3V1HA 3L12A 1VD6A 1XX1A 1AODA 1PTGA 3QVQA 4I90A 4Q6XA 2OOGA 1O1ZA 5T9CE 4F2BA 1DJGA 3RLHA 6PTDA 1DJXA 1ZCCA 3I10A 3KS6A 3NO3A 3V18A 1V8EA 3V16A 1T6MA 2F9RA 2ISDA 3EA2A 2OR2A 1DJYA 4I8YA 3H4XA 4S3GA 2PTDA 4RV3A 2PLCA 3KS5A 2OTDA 3EA1A 3QR0A 3MZ2A 2PZ0A 4I9TA 4I9MA 3QR1A 1PTDA 1DJHA
chains in the Genus database with same CATH superfamily
2PI6A 3MVTA 1GQIA 1W3TA 4OT7A 3VI2A 3PN8A 1ODUA 4RDVA 2V9DA 4NNAA 1OG0A 2XUCA 1UBSA 1H09A 4EWJA 4LV4A 2Y85A 4P7OA 1QO2A 2FGLA 5F1VA 4FXRA 2UY4A 2TSYA 8XIMA 3S1XA 3WLSA 2OEMA 3HGOA 4C1KA 2NLIA 1AG1O 3IVTA 4DJEC 5C54A 2HNEA 4A4AA 3MJYA 2P8BA 3KP1A 4PB5A 1PHQA 2HISA 3VABA 2EJAA 5DT5A 1Z69A 2FQIA 4AF0A 1O1HA 2CLIA 4JX4A 1OABA 2ATSA 1P0EA 6XIAA 1GOIA 4DO4A 4I6VA 4GWEA 3C2FA 5ABTA 3GWQA 1EOMA 1RXOB 3R10A 4W87A 2ZE0A 2C16A 4Q7NA 3P8JA 5LNSA 3LMZA 3GC5A 3B0VC 1FVPA 4Y96A 2Y7DA 3G1RA 3FSTA 1BVZA 5HK4A 3LGEA 1XLHA 1ZHAA 2DZBA 4UTTC 2X0SA 1WKFA 5KEZA 2DIJA 4U28A 2HXTA 2I5IA 4AUBA 1S3TC 4DLFA 3QSRA 4AZ5A 3GG0A 3AZSA 2PDJA 3VFCA 1YTDA 1UP3A 4FOJA 2AQVA 2OQLA 4L4OA 3MCMA 1DHKA 3CNYA 1Q7MA 3FAXA 1TRDA 4C7GA 3TA6A 1LQAA 1SFTA 2B7QA 3ZJKA 1J6PA 1JPKA 5E0CA 1H0IA 1B9ZA 3E2QA 1XIMA 1PZ0A 2GWGA 2OT1A 4AZCB 3RDKA 4UQEA 2ZUVA 1R2TA 2E1DA 1OCQA 1R3TA 4J40A 3VIPA 3GKFA 1NWSA 1PTGA 4BQ3A 1QUMA 1RA0A 3AWOA 4DBUA 4OBSA 4PMRA 3EPNA 1OSEA 5I06A 1QK0A 4CKQA 2VGGA 2Z7GA 2QR6A 4C6KA 2R82A 4MB4A 4TMBA 3NQMA 3NO5A 3H6OA 1BTMA 1ICPA 3WF3A 1FWRA 3QOKA 5A8PA 2DIEA 1QOPA 1LQ0A 5CJMA 4CUCA 2J27A 4B9ZA 2PGFA 3MV01 1Q63A 1DTUA 4S1FA 2WNNA 3LHZA 3ZT7A 3W86A 4XUYA 1VJZA 4LYKA 5FEXA 1TVLA 4IMGA 1R3QA 1EOKA 5BXRA 2PF8A 3W29A 4MNKA 2DZVA 1L6WA 1IWPA 2VFFA 1S2WA 3F4WA 4HN4A 1MXSA 4DI8A 3S3GA 3WQ4A 4WSJA 1EDQA 5HBFA 3M7SA 1VRXA 3N2TA 3BLLA 3S6OA 1V6YA 1XRVA 5MHBA 1GKQA 5A6KA 1B30A 3BLPX 3RJXA 3AJXA 4JICA 2ZKMX 3ZR5A 2V6AA 4C6CA 2PTXA 1X1NA 2WSQA 1A5SA 2J4GA 3RLVA 4XO7A 2DSWA 1J18A 4Q4PA 3GHTA 4JQ4A 1JDFA 5I2UA 1V6VA 4US5D 4ZOAA 2I9UA 3OOQA 3WIJA 4ICMA 1CXEA 3VNZA 4N2YA 1PTAA 1XHGA 4HPHA 3L4TA 3W2LA 3U4AA 4JCLA 4CQ9A 3NSXA 4U2YA 2ICSA 1YNYA 3U2CA 3CUGA 3FEQA 4DUVA 3LLDA 4QNWA 1JL8A 4HZ6A 5J5RA 4ZL1A 3GFZA 4LYRA 4PYSA 2HBXA 3ARVA 4IZGA 3WG6A 1M5WA 2XZ9A 2FB3A 2FH8A 3TMLA 2JKPA 4MPKA 3APYA 4M6UA 1RVKA 3CEPA 5HNTA 2IPGA 2NWRA 4HHLA 1VYPX 4UR9A 1K8YA 5BU9A 4XIMA 4RNIA 2E5BA 1WOAA 1GVSA 5LA1A 3PZQA 4GBUA 3LLFA 2DPEA 3XISA 1PZ3A 1L0PA 1XYLA 4ZA0A 1CGTA 4WZHA 3T2QA 3CHEA 1C8QA 1X6UA 3TDFA 4HCDA 1ECQA 3NDYA 4DBWA 1Q7ZA 4K39A 2FGZA 1AJ2A 1S1PA 1W3IA 1KGXA 3VIFA 1KXTA 1EA0A 1I1XA 1CCWB 4ATDA 1WDWA 4XSLA 4UFIA 1TZ7A 3AMLA 2PU1A 3W23A 3W1PA 1MVYA 4WSKA 3H2FA 4OKDA 2ZUTA 1I2QA 1TJPA 3N4EA 5IDIA 4C7FA 2ZA2A 1XFCA 4I8YA 1IWBA 2OOFA 2QHAA 4PN2A 4MJMA 4CQDA 5AC8A 3LS9A 5E09A 3KL3A 3WQFA 3S1WA 3B8TA 3W2JA 1I2PA 4AH7A 4PMNA 3A4WA 3MC5A 1A3WA 5A2CA 2NX9A 4D6FA 2J7GA 4AWTA 4LY8A 4DPQA 3G2GA 3EXRA 2FH6A 1IT8A 1H62A 3EGJA 3OLEA 5C9WA 4DJEA 5IDZA 3F5JA 3WL1A 4L9ZA 3QR3A 4UFHA 1ELSA 4RE4A 1F7BA 1SQ7A 3PBMA 2J62A 1C9DA 1KBJA 3C8NA 3EAUA 4PMDA 1P0NA 4L6OA 5C71A 3F2CA 2I17A 1EDTA 1UROA 1QHPA 3GNXA 4Q4OA 2Q09A 1A4LA 4GZJA 1XLEA 5JVLA 4MUZA 4DZAA 5EYWA 1AQHA 1M7OA 1NVMA 3IJLA 3KS6A 3LNMA 3CZEA 4HOWA 3LNPA 1CGVA 2WMIB 5EU9A 5D05A 1Q6CA 4E8DA 1S38A 3TE9A 2WC4A 3P60A 4BS0A 1XI3A 1ZGDA 1HKMA 2NX3A 3MUY1 3J7HA 5ABFA 1UPPA 3P67A 4M0XA 3UNDA 1SJAA 1RD6A 4LBUA 4EPDC 1ISXA 3NPWA 2F6UA 4L61A 1JIBA 3AIUA 4ZQOA 1KM5A 1VIWA 1VJSA 3LMYA 4JR5A 4AC1X 4IJBA 3NEHA 3FVDA 3AYVA 2XIOA 5KMYA 5I5RA 4QM1A 3MSGA 8RUCA 2XISA 4NJKA 1JJKA 2J6XA 3M5XA 1QHOA 4XZMX 4AD3A 2VDHA 1WP6A 2PC4A 1MW0A 2YCLA 4PB3A 1E40A 2CIPA 3VMOA 5L9FA 3U2OA 2RHGA 4I7UA 1DOSA 3NQBA 4M6QA 1IIHA 1O12A 1O5RA 4IFKB 3WLRA 5EMUA 2XVLA 2HQAA 2WSRA 3UR8A 1XF0A 5BROA 3SI9A 4GH1A 4ENLA 1UJPA 2WW5A 3HPXA 4ACYA 1J10A 2ZRZA 1NWUA 1PX3A 4MDOA 2BVDA 4PTMA 2BFGA 1R5YA 4EAYA 3WK2A 5JQ9A 1OD8A 2B0MA 3D0CA 3WBXA 5H91A 3CUHA 4AEOA 2PD5A 3AHVA 2BVWA 4A8IA 5HWJA 3NO3A 4S23A 4XG1A 3DDMA 1US2A 1TZZA 2RJHA 1K1DA 1AQFA 4YNGA 1UP2A 4IP4A 1ML1A 2DZTA 4HQVA 2D3LA 4F0LA 1HX0A 1WDRA 4J1OA 1EJVC 3IIZA 2J9XA 3WN6A 1GHSA 2Y7GA 1CXIA 1NOUA 2TYSA 3C0LA 5ENLA 4D6IA 2DSKA 1BWLA 4NI8A 2QEZA 2BOGX 5CBJA 1TTIA 4MNMA 3IS4A 3K5XA 4HK5A 3VO0A 3QY7A 4JCMA 1GVIA 3N2BA 4NXSA 4IIFA 5DANA 2OYLA 2ZCGA 3GAKA 2WYSA 3RO8A 3TN5A 3KCJA 1G6CA 2EPNA 4IH3A 3SN1A 6REQA 5DQPA 1R2RA 3EA2A 4GC4A 2VCAA 4NXKA 5EL1A 1PZ1A 1OHLA 1ZAHA 3CQHA 2X0YA 3SM0A 4F79A 3DERA 3A47A 3EEGA 3HO8A 5LGXA 1CXFA 3O2LA 5CCZA 3T42A 2CLLA 5HOSA 3B0UX 3BLEA 4JX5A 4LNYA 4QE1A 4JQ3A 3AIRA 1RJQA 2E3ZA 1FBAA 4AISA 4X0NA 4WKAA 1FDYA 5PTDA 1KC7A 4B5TA 3FKKA 1DE6A 1J0JA 4AHOA 1XG4A 3OIXA 4M82A 2OU4A 4AY7A 1EZ2A 3LI0A 3VIKA 1PTDA 4YJ5A 1R85A 1JQVA 3QMRA 4H19A 3DCPA 4H9XA 3RRXA 3CASA 4HNOA 3T0CA 5FL1A 4HA0A 1S5TA 5JBFA 4DI9A 4IOTA 1F9CA 3Q37A 5BOOA 3W72A 1ODZA 3GIQA 3VGHA 4XUGA 4EPKA 1W5MA 2ATMA 2GQ9A 3CO8A 4D1JA 2NSXA 1ICQA 1EC8A 3PB2A 4H3DA 3W2UA 1BD0A 2ZUNA 1UJQA 3CTTA 4OBTA 4O50A 5D37A 1ZENA 1D7FA 4HU0A 1NOFA 5JIWA 1PJ9A 4JIRA 2YFOA 3A12A 3BAIA 3WK3A 1ZBCA 1XKYA 3GVGA 4QSHA 3M5YA 4MPQA 3DC0A 3GNDA 3UD6A 4GYFA 3U2EA 2OLAA 5C9ZA 2D22A 4Z2JA 2VZSA 3FFSA 2J24A 4YN5A 4MJ2A 4ZGYA 1HQTA 3FKRA 2WCSA 3LBMA 4Q8MA 3OA3A 1K4HA 4LW7A 3B8UA 3NQCA 3W83A 4GGHA 2QGHA 4QJ1A 1FWJC 1SZNA 1XIGA 4H9TA 3WBYA 5D8WA 3QBUA 4KEZA 4E4PA 4S3DA 3LB0A 3RN6A 1EWEA 2NQ5A 5I3DA 4WJEA 3VC5A 1EJSC 1TZ9A 1EGVA 3BICA 3VD3A 1XYZA 2DZUA 1MO0A 4HNLA 4JNZA 4ACZA 4F48A 1ZSXA 3RUBL 5A94A 3ZWSA 3GDTA 3STPA 4RDWA 1Q66A 1Q4WA 5HWMA 2BVYA 5CPOA 3P0WA 1J2BA 2V68A 2WM1A 2A85A 1GW9A 5REQA 1R6WA 5BOFA 4XKYA 1K7FA 3BG3A 3WK1A 4PA8A 1BVNP 2YL5A 4JD4A 3PJXA 2GFTA 2PZ0A 3WBWA 3TSMA 1TPB1 1WE5A 3MMTA 3FDGA 1XLAA 1FCUA 2UY5A 4Q8TA 1FWEC 5K9DA 5JBDA 3G6LA 4PSPA 3LY0A 3DFTA 1P0BA 4WY0F 3ITTA 4PMZA 1MW2A 4FA3A 4ZODA 2CHNA 2FVMA 5IFPA 4RXFA 2O9TA 4IT1A 1FHVA 1BGAA 2G96A 4Q4RA 3S8HA 2J8TA 3EOOA 2L5HA 2VFIA 2ABAA 2CKRA 4DLMA 2C7FA 5H6HA 3VGDA 1KM0A 3K2GA 3W07A 3CHVA 3Q67A 4FF5A 1HKIA 4CCDA 1NP2A 3AMGA 4TVCA 2MNRA 1VD6A 3VZXA 4FNPA 4DWSA 3OLDA 5A2AA 1W9UA 4PMYA 1GW1A 1YPIA 2YXXA 1CGYA 4J3SA 2W6RA 4W7VA 3GW3A 4F0SA 3SCPA 3VIIA 1G01A 3CK5A 5I77A 3W85A 4GY1A 1EEXA 2EPLX 4TTUA 1ZQ5A 1HXJA 2DUAA 4JYEA 5M1TA 3USZA 1WBHA 1WDSA 1ESWA 3G1VA 4CCCA 4GABA 1H7WA 4GG9A 1ZNNA 3OVPA 4ZQNA 3K1DA 3NZQA 3U3HA 3N9SA 1OK4A 2ISWA 3TQKA 4F3HA 1NFBA 2HVMA 3OZPA 2FPYA 1ZJIA 4W88A 3V16A 3N2XA 2VEPA 3MP3A 1F3EA 4PRWA 2IMRA 3BOXA 4AW7A 3EDDA 3SIZA 3IVUA 1UR0A 3NZPA 3OBEA 1ZJHA 4IFRA 4JN8A 4A3RA 1IWAA 2INFA 3P93A 1KLZA 4GC3A 3UP8A 2Q8ZA 3PJTA 3SUTA 3NYDA 3BK0A 5TIMA 1PUDA 1TE1A 1T99A 1L2QA 3DH7A 3N2MA 4OJYA 4AIBA 2ALDA 4O1AA 1F4HA 1TPWA 1AZ2A 1TUXA 4PUMA 4AZCA 4ADTA 1FOBA 3A4XA 1MDLA 3VNYA 3O6CA 2OQYA 3PWAA 4QFUA 3PR2A 4ERGA 4PMVA 3G18A 3VZYA 1G5AA 5BYWA 2VC9A 1WKDA 1FTXA 4W9TA 3ZJ6A 1E6NA 3DENA 1FWFC 3T05A 3M41A 1FP9A 2XVKA 3ATZA 3L0NA 4NJHA 3UERA 4B4HA 2WMJA 3W1UA 4DX3A 1N8WA 3R8GA 3UWEA 2E8ZA 4FS9A 1A5BA 5HJLA 3MMDA 2VWSA 1H2JA 3W22A 4C6DA 2INEA 3NL3A 3GDBA 4MIMA 4ZZ9A 4TIMA 1KM4A 3EX1A 4UC5A 1K77A 4WY0A 5A6JA 1HG3A 2A2IA 1HKJA 4MWAA 1NELA 1R7OA 2ZZ3A 3EWXA 4UFKA 3W75A 2HS8A 1EDGA 5CPNA 1T0OA 1V3JA 4WR3A 3U48A 3WUFA 4RZ4A 3TWBA 2OR2A 4CU6A 4P8UA 3WQCA 4A8LA 1D8WA 4EXQA 1XV8A 3E12A 1J01A 1PWLA 3TJ4A 3SAZA 2A7RA 1J11A 3SN4A 5FKYA 3W88A 5CH9A 1KKRA 1W9PA 1VYSX 2Z1KA 2CZ5A 3STFA 2HV5A 3LPFA 3I6TA 3SFKA 3WNMA 3GX9A 1A0CA 1H4PA 3QR1A 1H7RA 1TV5A 3KCLA 3K30A 2EAWA 1I2RA 1TPUA 3CQ0A 1ZCOA 4S3EA 3KLLA 3BMVA 1GOMA 3CB3A 4RDYA 3UW6A 3TW6A 4QITA 2JF6A 4DJDA 2ISSA 5D9PA 1DJHA 2VHLA 4EACA 3MDWA 1ZZMA 4JIIX 2ISVA 1XQLA 4MF4A 4C6EA 4RW3A 2WSKA 1DP0A 4UNIA 4HA4A 3PWIA 1NEYA 3CXOA 4IX0A 2X1UA 3QXBA 1NOWA 4UFLA 4IXHA 5G2IA 3VAVA 2H9AB 1JI2A 1K9FA 2VEGA 4L1XA 1E4LA 1SR0A 2DH3A 1Q2RA 3REQB 3LHWA 1D3GA 2YDRA 2IKGA 4CD8A 2VEKA 2YDAA 1HP5A 3T2PA 5DT7A 3R13A 2A0NA 2PS2A 1OINA 3IJDA 1J0HA 4LY4A 1ONXA 1YE6A 3THQA 5I3JA 3BLIA 5AECA 4QE4A 4AF0B 3W1TA 2XIBA 4NJJA 3PFRA 4U2ZA 3VXGA 2J7HA 3H7UA 4NSBA 2ZDRA 2NLYA 1QI5A 3E74A 2O56A 3IJ7A 3KHJA 1JZ5A 2NT0A 4GCXA 4ZXOA 3B06A 2BODX 3KTXA 3LXAA 3S5SA 4LUSA 4D8AA 3WLJA 5EKYA 3THUA 3T08A 1F6YA 3M6DA 2JE8A 3DUGA 3VIJA 4KIRA 3HJEA 3HV8A 3RAOA 2J8GA 3BE7A 3OODA 3UJ2A 1YBQA 5I3HA 3BARA 3GHRA 3KZPA 3ZXWA 2PLJA 3NWRA 3OB8A 3TCEA 4IL2A 3W7IA 3HB9A 3A4JA 4QSFA 4O1CA 1R2SA 3V1PA 2V5CA 3LPGA 2ZA1A 1UWSA 3AS1A 3L4ZA 4ORMA 1IEWA 3MT1A 4M80A 3ARQA 4R7WA 4POCA 4AIEA 4P7QA 2EBNA 4CNTA 4L7ZA 4JOMA 4N0RA 4NZCA 3M0ZA 2WC3A 1I2OA 2YCKX 4K1GA 5AYZA 1V7YA 1G4SA 3WD1A 4EKJA 1OFPA 1GGOA 2ZVIA 5AKQA 4YTTA 1LBLA 1T5AA 2ZICA 3QGKC 1NY1A 4IIEA 1EF2A 3FEMA 3V7PA 4GINA 2X09A 3L0KA 4ML4A 1K7XA 4DBSA 2PC8A 1GYNA 5FEZA 5AZ1A 3L5LA 3MI3A 3L4WA 3M5ZA 1V8EA 4TX6A 1LDCA 1TPEA 5AZ0A 3UVAA 1O66A 3R11A 4F8XA 3I4KA 1W6TA 1Q6GA 1BXBA 1D2KA 3GH4A 4H2HA 5CPSA 4YXGA 5F4SA 3DYMA 4JKMA 1TMHA 5GJPA 2XGZA 2QUMA 1TVPA 1X39A 1BKHA 2P3EA 3OLGA 1ALDA 2RUSA 4V27A 2VC6A 1MNSA 1T40A 2QUUA 3AMDA 1ZAIA 4DELA 1GHRA 4J27A 2OEJA 2DT1A 2X05A 5FSDC 2KAUC 2G95A 2H3DA 4Z2IA 3B8VA 3BLKA 3GXDA 3N6JA 2INZA 1B3ZA 4JIHA 1XLMA 1OJXA 1G7UA 4PUJA 5AFDA 4W4QA 2MANA 1VCFA 1DV7A 3GNOA 2VX6A 4QX4A 4R3UA 3UZXA 1TYGA 4O0ZA 3MUIA 1Q6FA 4DNHA 3E0FA 3WLPA 5C9UA 2YCIX 4PBFA 1J96A 1EXBA 4PUUA 4XV0A 3NFUA 3H21A 4YCOA 1XH1A 2BS9A 1SU5A 5HANA 1JDCA 2ZDSA 5LA2A 4YVVA 3W6YA 1A5CA 1K7EA 5G2HA 3ARSA 2EPMX 3S42A 1JCTA 1QOXA 2CWXA 3HQ1A 2Q71A 5CAHA 3Q4DA 4C6NA 5BW6A 3PTMA 1V77A 2D24A 5H1WA 3VD7A 4QTGA 3VNKA 3HPSA 4O1BA 4D71A 1JG9A 2BWGA 4L64A 3KOWA 3E6EA 3PBWA 1DEDA 3CV1A 1OIMA 4CVWA 1TQJA 1OX6A 3DFQA 1CLVA 2PBOA 4B5XA 4A05A 2C6QA 1HNYA 1GVQA 3RLGA 1E1EA 1GJPA 4QJ3B 1GKRA 4KWSA 3T44A 2YL9A 1VKFA 4MB3A 4JHZA 2WNWA 1FH7A 4JEQA 1VB9A 2QXWA 3W7NA 3PZMA 5XIAA 3AYTA 4ACZB 5HQMA 1EBHA 2OT0A 4R9XA 1O5XA 2GGHA 1IXOA 5RUBA 3EWDA 1J0IA 5EBUA 4NASA 3UJFA 4GD0A 3UFYA 3N2OA 2X1SA 4B16A 3ZYZA 3MS8A 4XAYA 4RNHA 3KLKA 1LBFA 4IHCA 4B5WA 1ITQA 4GZ7A 4MHBA 2D2JA 3ABSA 2C91A 3CL6A 1BKSA 2VGIA 3N18A 4JFTA 1FXPA 1PL9A 4DZIA 4KWVA 1Q6DA 2GL5A 4OE7A 2Y5SA 4IPJA 4E8CA 3W28A 4DB7A 1KM3A 4OIFA 1LROA 3DX5A 2GJXA 4PODA 2O7QA 1J0YA 1RZMA 3VDHA 1PX4A 4DVOA 3QV9A 3O07A 2O0TA 3QEZA 1YDVA 4UTWC 1RUSA 1W56A 1BG4A 1QWKA 1BHGA 1Z6KA 4LCQA 5FJTA 3PANA 4A22A 3H7RA 3MI2A 4DXKA 3S5OA 3BOLA 4NILA 3IRDA 4OQVA 1BG9A 3RFAA 3TVAA 3CHCA 1KBIA 1XFBA 3HV9A 3T6CA 3R25A 2OKOA 1XRSA 3NOEA 4XTDA 4HMCA 3MPGA 3S1GA 2GSJA 1FWHC 3UZ5A 1BFNA 4KRUA 1W0MA 3WL0A 1P1XA 2QF7A 3WLKX 1DJNA 3SY8A 4LAKA 4LVBA 5T91A 1OVDA 3T4WA 1RBLA 1JCJA 3SGGA 2I16A 3B8IA 4LU0A 4G6CA 3AZTA 2G50A 4LAUA 3H2MA 1T7LA 4IX2A 3NQFA 3UG8A 3MSRA 1L9WA 2QCNA 4NU7A 2VC5A 4P7RA 2E77A 2CBUA 5D9OA 1U1JA 4E3TA 5C70A 4X63A 7CGTA 2WWDA 1C3FA 4UTIA 1O5KA 3N1AA 2P5NA 2VYOA 3FOKA 2AMXA 3CPUA 1UH4A 3VOFA 1Z44A 4L56A 2O4MA 4ZEPA 3TA9A 2FJUB 4W89A 4NX5A 4GVFA 1O5QA 1XYMA 4I90A 1YQ2A 2HROA 4JTJA 3N17A 4FEZA 3LU2A 4B9YA 1N8IA 1VENA 3L2LA 1K8ZA 2WSYA 2Z1BA 3W7DA 4O28A 1JYNA 1TJ2A 1TV4A 4AHPA 3UF9A 3CLMA 1EO7A 3ZVHB 1B1YA 3AMKA 2BASA 3NR0A 3P7YA 3W7KA 1MW3A 3II1A 2LLEA 1E0TA 4R85A 1LORA 2DH2A 2VR5A 3IV3A 3QH2A 1NDYA 4Q7BA 2YCLB 3HG2A 1I75A 4KWUA 5A8NA 2BX7A 2V82A 4HYWA 3ZMRA 3CHFA 2VMFA 1DKWA 2XN1A 1KR1A 2AQWA 4KFPA 3VKCA 2VZOA 2YCEA 4Z2KA 2E5DA 1P7TA 4JIQA 5AC4A 1BYBA 2CFFA 2VELA 4HCHA 1TELA 5CZ0A 3UA4A 3C2VA 1WDQA 3LCGA 2ZRWA 2QUNA 3K4AA 2PDFA 1GVEA 1XCWA 1AODA 1EYWA 3AI0A 2Y8UA 3VOJA 3GK0A 2PLKA 2WQDA 1EUAA 1J5TA 3B9AA 4O13A 3Q45A 1XBYA 4UMCA 2XDFA 1AL8A 1IXPA 2ZRVA 1X6LA 3WMSA 3S9ZA 3FA5A 4DPPA 3GBDA 1UD5A 2GSHA 3SQMA 5LIXX 2Y5JA 4YYCA 3PM6A 2WAGA 3ITLA 3PBUA 2P8CA 5I00A 2GVLA 3GAYA 5KTLA 2WC7A 1Y0EA 1F61A 3W37A 5DY2A 1CNVA 2DEPA 2NUWA 3WQPA 5JBEA 1EKOA 2J47A 2BP1A 3WEMA 4DJFA 5AC5A 2PP0A 2V69A 3TH6A 2OX4A 4B5SA 1F05A 1Z42A 1V02E 4TQTA 1IT7A 3EX3A 1UD8A 2YGYA 4QBXA 3UJRA 4NYYA 3GDRA 1X38A 3Q65A 2WQPA 1JZ8A 3GR8A 5DX7A 3BWWA 4GIAA 3KWSA 3LV6A 1XL9A 1B3VA 3QQ1A 3W7PA 1DPMA 4XD4A 4Z0SA 1JFHA 1NDVA 2OZTA 1NSJA 4ZOEA 1ITUA 1Z3NA 2IUZA 3GIYA 4UTLA 1QNQA 2V8ZA 1TA3B 1S2CA 5D9MA 5TQLA 2Y0FA 4WXZA 4YMZA 5KINA 3A5VA 3DFPA 2PUZA 3PTKA 5B7YA 1F3TA 4JTGA 2WCGA 2XH7A 4Q33A 4GYJA 3W38A 3S9YA 4HHHA 4A2SA 3RX2A 1XIEA 3M07A 4YVXA 2QAFA 4FNQA 3WYZA 2GDQA 2CZFA 4REQA 3S5ZA 3VX0A 3GLCA 1SSGA 1KFEA 1B57A 4HSNA 2ZTJA 4TV6A 1W1YA 1WXZA 2A5HA 3M9YA 5DO8A 4H4IA 1E4NA 3RCNA 1ZPTA 1LTDA 3BCDA 4IQDA 1VGAA 3WDHA 4QQUA 2V0TA 5DXYA 2O9PA 4AZBA 1RCXB 1VHCA 4IXXA 4E0CA 4Q4MA 3EPMA 3WH9A 5DN1A 3D5HA 3TIMA 5BCAA 4I9AA 1NQ6A 3U57A 5HINA 4D2JA 2BGQA 1E6PA 4O12A 1E72M 1XLDA 3R4IA 5E1QA 2NXHA 1G4TA 3RRAA 1GJUA 3T07A 4JTRA 1KCZA 4HPGA 1G0CA 1MEIA 4LX4A 5CC5A 3QQ0A 5TBOA 3FA4A 2PLCA 3U2ZA 4DN1A 4UMAA 2GUYA 3RU6A 3L9CA 4HOXA 3RCMA 2F61A 3CMJA 4AMAA 2Q3RA 3LERA 4MWAC 4JIEA 2YB1A 3AHZA 3O3RA 2HPMA 1P5BA 3WMBA 5A6SA 4U5KA 2I5QA 4RCXA 1AZ1A 4JTKA 2NV9A 3IV8A 1QNPA 3K4DA 3U0HA 1XC6A 1IZJA 1P6WA 4FALA 1NF0A 4Q4KA 3W7CA 2W61A 1R7AA 1AUSL 5REQB 2FZ8A 3PULA 4H8HA 3N2CA 3GDKA 3NPUA 1TWIA 4G7FA 3G77A 3DG7A 3BW2A 2WMKA 2DP3A 1L6SA 2YXGA 1QJWA 3MHGA 4GUHA 1Q8JA 2VR2A 4NNBA 3KS5A 1EXPA 3OPSA 4MM1A 1GG0A 4LYQA 3FGCA 2AKMA 4Z08A 3M64A 1WYIA 4KBXA 3CYJA 2XFRA 3GE7A 4WRHA 3DU0A 3EOUA 3K8KA 2DU2A 2QV5A 5GJMA 2ZBTA 3HPZA 3GXMA 1S1RA 1EGMA 2Y6ZA 2PDBA 3EKGA 3E5BA 3EX2A 4IM4A 3BAXA 5T26A 3LN3A 4B4FA 4J3XA 4UQ9A 3WQEA 4DJDC 3KBJA 3E49A 3QOMA 2PTWA 3TZFA 3OO2A 1SW3A 4S3AA 1IEVA 3L23A 5AVHA 2YDSA 3ZT6A 4BEQA 1GOKA 4W84A 5DELA 4LAZA 1IEXA 2IKJA 2D0FA 5BRPA 4IFOA 1HFBA 1UUQA 3QW4B 5IXEA 2JF7A 2BDQA 1Y5XA 2ZZ2A 3GTXA 3KUMA 2EPHA 1OZQA 2CERA 1E9YB 2VENA 4XZNX 4AYSA 4NHVA 1C7SA 3W0KA 5FJIA 2QVNA 2ZX7A 4AXNA 5BXPA 1VBJA 4EAMA 4UCFA 3U5UA 1CLKA 3MQTA 4TVDA 1VFMA 1NU5A 1PKYA 3UVIA 1WDDA 2ZVRA 4FPSA 4OU1A 3VCNA 1W3NA 1OG6A 2Y61A 1QRQA 3BSMA 2WJFA 1IZKA 1PIIA 4LT9A 4H04A 1ITCA 3RF9A 1XGZA 3N73A 3E9AA 3DHDA 4WKFA 1JZ7A 1DQWA 4BQ4A 4CU7A 4CGTA 2GQ3A 3LSCA 1UR4A 4MWAD 4F2BA 1R46A 1VCGA 4PULA 2BY0A 1DWFM 4LAOA 2CC0A 4Y9PA 5I24A 3BG5A 4MFDA 5D38A 2WVUA 3EWZA 3RXZA 3O6YX 1DXIA 3WDQA 2VURA 3IGSA 2J9ZA 5K9XA 4M3PA 2R9RA 1K8CA 3QKEA 3BAWA 3WCZA 1CXHA 1XUZA 1P1MA 3ARUA 1PS9A 1J93A 3UY8A 3UXIA 1J0ZA 4A8RA 2GGGA 4QNEA 1S5WA 1MRQA 1CI1A 3EKLA 3M1ZA 4LVGA 4FK9A 1MYRA 3LZ5A 2WMGA 2Q8LA 1S5NA 3KTCA 1FUYA 1MFUA 3U9IA 1C90A 4US6A 4WLCA 5H8UA 1R30A 2PGWA 3A5FA 3VCCA 4WOQA 2VNCA 3NQ6A 1S5VA 3AHTA 3KZSA 5EGRA 3DHPA 3NGFA 3FYOA 3IGHX 1CB2A 3UYCA 1RQBA 3MBDA 3OZOA 4IMDA 3TOYA 4QEEA 4LVFA 5CZKA 2XM1A 3URBA 3M46A 4XWUA 1JF6A 3SADA 4PTDA 5C8BB 5ABEA 4A3HA 4Q8PA 2Q02A 3UWVA 5AN7A 1DYSA 3CT2A 4BWLA 3W1QA 3ANVA 2A7NA 4UTTA 2NZLA 4KEUA 3ZWTA 1MQPA 4HHPA 4S3KA 5E70A 2WMIA 4CVUA 1F5ZA 2TRSA 1OEPA 3GO2A 2F38A 2Y2WA 1LCOA 3EWYA 1CX9A 5KZMA 3M5VA 4C6FA 3W6LA 3LCFA 1YW1A 2VVNA 3HFTA 1EQCA 3EKZA 1ADOA 3S47A 3PZOA 2QJHA 1YYAA 3NM1A 2PDPA 1PIGA 4OZOA 2E9LA 1V6WA 3WDRA 3KX6A 3UPWA 5D8ZA 3GDMA 1E6RA 3GHUA 2FGBA 4N6FA 5HNNA 3KOZA 2PURA 4FAMA 4JFSA 2XSXA 5MKGB 1KNWA 4PEKA 1XM3A 3F4CA 3G1SA 3N04A 1N7KA 4P8VA 3WD2A 1JAEA 1G67A 1LT7A 1LRTA 2J74A 3TYZA 2XH0A 5C9RA 3B04A 1TWWA 4Q32A 1A3HA 1VPYA 1OGSA 3NVDA 2C0AA 3AALA 4OUEA 3A23A 4LBSA 1SFLA 1EJ7L 5J04A 2YIHA 4IPIA 5D9NA 3EXSA 4Q8VA 4QJ5B 3M44A 4MUPA 3I7SA 1CGWA 2I56A 4E8GA 1UH2A 5D4YA 3QZEA 2GJXB 5D32A 4R27A 3VOCA 4RKAA 2VRKA 4Z1AA 3M4HA 4GVHA 4KEVA 3AU6A 5E0FA 5U7SA 4H7ZA 3JU2A 3S5YA 1PO9A 3W87A 2XN2A 2NW0A 2C18A 2V2DA 5A3HA 1QCWA 4UOJA 4JXCA 4INFA 4H6QA 4D6GA 3DHUA 1YKWA 2ANUA 2E5CA 4A3QA 3B4UA 4QCEA 4AHQA 1O94A 3SIMA 3CJPA 4NZ4A 1J9YA 3MKCA 4HNVA 5E6YA 3SCSA 4MNJA 4I6KA 3W02A 5C5YA 4IQEA 1TV7A 2FFCA 1K70A 2ZA3A 3E0IA 4WDTA 3NQGA 4PE8A 4FIQA 1XLCA 1XGEA 1KM1A 3R89A 4IISA 3P8IA 4RE3A 2B7NA 4GIYA 3U6WA 4NX0A 1OY0A 4B3LA 1BF2A 3AIEA 3QVQA 1XSKA 3CAKA 3L4VA 1VFOA 2GOUA 1DIDA 5EBAA 1E0VA 3G3DA 4CNSA 5D33A 3UQNA 1EF3A 1UHVA 3I6EA 1UD2A 4NAEB 3LCLA 1H5VA 1GYLA 4GRSA 2PODA 2Q3OA 4IGNA 1CZ1A 3OZMA 4LANA 2CCRA 2ZXDA 3T0BA 4C6PA 2XSAA 4UTWA 4ZO6A 2ZYFA 2NVCA 3WBEA 2DT0A 4MG4A 3GU1A 4RLIA 3TLLA 4AX6A 5FF0A 1LLZA 3UNTA 2WJZA 2CEQA 5K4XA 3BJSA 1NJJA 4NZ1A 3OYZA 5FCZA 1B3WA 3ANUA 3HQNA 3ZR4A 1KBBA 4TMCA 3T1GA 3FJ6A 2JK2A 3PZTA 2XG9A 4IIDA 3ZJ8A 1PCKA 2CLFA 3ARPA 1LJYA 1VIZA 4L4PA 4A29A 3UPBA 3E0WA 3VOHA 3GC2A 4UUIA 1W9DM 3TN4A 5I6SA 4HK7A 2A3BA 2J13A 4RPPA 1TKKA 1OADA 2ZX6A 3N34A 3L2IA 1CXLA 3PUGA 1Q6QA 4W93A 4XVEA 3FYYA 1ZU8A 1B3XA 4YTUA 2D23A 4H2CA 4CQAA 3UG5A 1V0KA 3UXLA 1E73M 3AXKA 3W7GA 2IKHA 1X96A 4AVOA 4BK9A 3W25A 3T0TA 1QVBA 3VIGA 3RO6A 1RD5A 3CLWA 5HUOA 4Q22A 1N8FA 4Z42C 1BYDA 3WF1A 3N6HA 4AQLA 4P7LA 1SO6A 3KVJA 4XZ9A 1UQYA 2OO6A 3APGA 1JXJA 2DZPA 3TMQA 3AAMA 4DBEA 4LALA 2ON3A 1M6JA 4GJ1A 2YA0A 4XZLX 3W7OA 2JGYA 1QXLA 4QG9A 3WEOA 3HOJA 5C6MA 1GOXA 3H4WA 1WNOA 7PTDA 1FDJA 3NQ7A 2F2KA 1N2VA 4JX6A 3N13A 3WD3A 1KCXA 2OO0A 1LBMA 3R8RA 1JYVA 1HL2A 3ITCA 1IXQA 2J88A 4PUWA 2X40A 1EJUC 1UW9A 4ZVJA 4B2DD 4XAZA 4IGSA 4LS0A 1GUVA 2PDQA 2J8FA 4XBKA 3TFCA 1FWGC 5KSWA 4Y9OA 4O1FA 3B9EA 3DN5A 4R9OA 3WNKA 2GVYA 3SSJA 2DW6A 3PBYA 4Q6JA 3W6MA 4YYFA 4HB7A 4FLRA 3KWXA 1UMLA 5MKGA 7A3HA 4UTFA 1QASA 4Y8FA 1THFD 4MKNA 3EDJA 2X2YA 3VDBA 4RPQA 1UQZA 4Y6GA 4QLJA 1FWTA 3STEA 1S5MA 2V3GA 1GCYA 4Q3MA 3M0KA 3N4AA 4CN4A 4MB1A 3ZZ1A 1RH9A 1FHUA 2W66A 3O05A 3ZO9A 5D04C 1AQ0A 2GGIA 4ZB5A 3LBOA 2R1LA 3FNDA 3ERPA 4ROPA 3O6AA 1MI3A 3I68A 5FAJA 3SCTA 2JIWA 1S2UA 2D2HA 4RDZA 2ACUA 4MADA 3OQ8A 2X0HA 1NWRA 2YBUA 3CH9A 4L4LA 4XBJA 2OJPA 4O19A 3GR7A 1DJGA 3MUXA 3WH5A 4BI6A 4DJFC 4LXFA 1V3HA 4RXGA 2JEQA 4M5PA 3VX1A 3UWZA 1NM9A 1W1B1 2HEJA 4ATWA 3SCNA 3AICA 1AH0A 1EJWC 3GVVA 5LHFA 4U10A 1OFOA 4QG8A 1E4MM 2AGKA 1ZP4A 3K1GA 4HNNA 1F07A 3PZ9A 2WLYA 5CLTA 3K46A 1BSIA 1ZP3A 1QO5A 4ZBCA 2R94A 1NIUA 2OZ0A 4QDWA 1NAL1 2PLMA 4G56A 4R33A 4DAFA 2QDHA 4MOZA 1XLBA 2CNCA 3DKJA 1RPKA 1V4YA 2PDLA 3WLIA 1H51A 3VGEA 4RUBA 4X9YA 3EX6A 4DO5A 2V81A 1QNSA 3AIBA 2BOFX 3GNPA 4G2DA 3G1YA 5TNVA 3UY7A 4BQ2A 1TTJA 1FKWA 2J78A 3SUWA 4U33A 5I07A 2J66A 3FHAA 2EG8A 1SZFA 3WF4A 1NFGA 2PD9A 2WPGA 1QBBA 2P88A 3MTWA 4A8NA 2PRMA 3NPVA 1POKA 5KZEA 3RM4A 3T0AA 1W1PA 1JDEA 3VUPA 3C0SA 1P0DA 3S6TA 1VEOA 5AC6A 1M7PA 4QRNA 5CBIA 2D0GA 4L9XA 4ZFMA 3UBPC 4F9JA 3V3WA 3C56A 2QJMA 3FX4A 1P0KA 3CS2A 3CEUA 4U3CA 3HBLA 3CUXA 3LHUA 1Z89A 4PMOA 1GZGA 1KWKA 3S83A 1KFCA 4PTWA 1SFJA 3NQEA 3N25A 2CHOA 3K13A 5HQEA 9RUBA 3QR0A 2ZE3A 5AVNA 3SCRA 3JZUA 1JGIA 1A5LC 3BLOA 1AFSA 1GTHA 4GKTA 3PNUA 1K9EA 3KL0A 3F2BA 3KXQA 3B8DA 1DJQA 3OP2A 4IMAA 1RY0A 4U3AA 1DHPA 2Y70A 1YDNA 2CXEA 3ONBA 5DBTA 4HU4A 4C91A 2VZTA 3S1UA 2NQZA 2R14A 4WY0B 3IUDA 3A64A 4GACA 4KQNA 4Y9NA 1JZ2A 3A3HA 4NIRA 1P6BA 1BXCA 1RSCA 1O1ZA 4NKCA 4EIVA 3STCA 2GZXA 1QPQA 1XDLA 2ISFA 3GTHA 2Y7FA 4UTHA 3C3UA 3VCRA 1OBAA 1QI3A 5CBBA 4N4QA 3LXCA 3AUJA 1EEPA 3GDLA 2ZRUA 4E4FA 1E6QM 1R3VA 2YX0A 4PUDA 3DFHA 3LM3A 1DIKA 2OZ8A 3POCA 5CG7A 4D8LA 3FAWA 3OZYA 2ZWZA 4CD4A 3PJUA 2BNJA 4CD6A 4EWND 1YRRA 3RM9A 4JYDA 3VTRA 4A3YA 2AAAA 2VM8A 4ZR8A 1K3UA 1AD4A 4KIEA 1LL7A 1EHAA 1PBGA 3V5CA 1W2PA 3ARRA 3N4FA 4NNCA 4O1DA 4S3GA 4DM2A 3WNPA 1DXEA 2WHMA 3IJ8A 3MSDA 3IARA 4C1NB 2V67A 1UC4A 2V3DA 1XKJA 1ZBVA 4IUOA 4RX0A 3WDJA 4QQ3A 5LNVA 1GK8A 3KRBA 2Z24A 4HPJA 3NL2A 2QYGA 4J4KA 2PTDA 2AOSA 1Z8AA 3PAOA 3S2JA 3NZGA 2VZUA 3EWCA 1FCVA 2OGYA 3WUEA 2PTYA 3CO4A 4LUYA 1LQ2A 2QCCA 3C3NA 3FCPA 1DJXA 1K02A 4CN1A 3MHFA 2JGQA 2GQAA 1SMAA 2R6OA 3TTEA 3INPA 2YJQA 3O0FA 5F4XA 4DYEA 1BQGA 9XIAA 1XRFA 2FPTA 2A3CA 2PRHA 1E43A 3HF3A 3W1LA 2UY2A 3YPIA 5A6BD 2ZX8A 1KTCA 1YNPA 3OG3A 4KH2A 1GOWA 4J3WA 1ZJBA 4IG2B 1TE6A 4GHRA 3TJIA 1LM1A 1QI0A 1WB0A 2J77A 3CUJA 4S39A 5EMYA 1R87A 4XZBA 3UZZA 2BXZA 1T41A 1UP0A 2YBTA 2YOCA 3C6CA 3LA4A 4C6JA 2OZ3A 1WCGA 5G1TA 1UC5A 2WZTA 3K8LA 1TSIA 3UYIA 1DTNA 1PE1A 4TX8A 3L7RA 2PDHA 1B4KA 2DZAA 3ZOAA 3QV8A 1TV8A 2O92A 4C5ZA 3POHA 2ZUMA 4OV4A 3TX9A 5EFFA 3LCXA 2BMBA 2PGEA 2UY3A 3R12A 3R7MA 4DWSC 1GG1A 3Q2DA 2DSZA 2EG6A 5A6LA 1JAKA 4F2TA 3SCQA 3W9ZA 1V6XA 5F2IA 2GLKA 3QLDA 5L6UA 3L0GA 4LYPA 1NDWA 2GK1B 2OXNA 2V5JA 1WQ5A 3G24A 4NJGA 4XKMA 5DBUA 4YIWA 5AB3A 3UCCA 1TR9A 3W1NA 5CQ1A 4NUWA 3UEQA 1E0XA 3SZ8A 5U4NA 5AYBA 4IF2A 2RDXA 3MI6A 5GNYA 5DFAA 2H8XA 4ZQMA 2WCAA 1Z41A 3SCWA 3MWAA 4O0QA 2VUNA 3UZYA 2A3AA 4GE8A 5I3KA 3TV8A 3MB9A 1E9ZB 3SGZA 4DYKA 1W17A 4E38A 2NX1A 1XGDA 2XIIA 1E0WA 1YE4A 4BWLC 1OC5A 4O8AA 3WZ0E 2GWNA 5FJJA 4HYVA 7REQA 1IGWA 3F4VA 1QATA 4MB5A 1W1IE 3RCYA 4DBDA 4CNNA 3WELA 3MJMA 1UMYA 3HJZA 2WHLA 3LGDA 4B2DA 1X1OA 4GKLA 4ZMGA 3GIPA 3PAJA 4G7EA 2VJXA 4ZFCA 1L8NA 1UZ4A 2XU2A 4RZBA 1VH7A 5JMUA 3OEXA 2TAAA 2H6RA 4QS5A 3IPWA 4ZSTA 3QFWA 2BGSA 3IIPA 2R24A 4V2XA 4ZOBA 1H0GA 3E5PA 1VBRA 2ACSA 2YW3A 3NNTA 2E6AA 2KZHA 2WVTA 4O8RA 3HA1A 2HK0A 3SB0A 1OYCA 2G3IA 3O9NA 3QV6A 3MV11 4Q8OA 4NAFA 2YYUA 3UWWA 5C0QA 2OGJA 1PKNA 4DWSB 1WAWA 3WMLA 4URIA 3LLXA 3C2OA 4X22A 4LC8A 8A3HA 1XLJA 1XCFA 3W1MA 3EB2A 2ISDA 1KCKA 1JPHA 1IZCA 3VIOA 5EA9A 3CBWA 2Z0IA 3ABRA 1PB0A 3PPHA 2ZXQA 2GK1A 4J3VA 2YSWA 4OV9A 1I45A 1UB3A 3BZJA 4HD5A 4DUOA 2NT1A 3PZVA 4C6BA 1UR3M 1QK2A 2CZVA 5EMMA 1U30A 2X1RA 3PBVA 4L4MA 1TTPA 2XIMA 6XIMA 3ARTA 3JVAA 4TO8A 2Y8VA 2XWDA 3WK0A 2E9BA 2XFWA 3U7VA 1HVQA 1Q65A 3R2GA 2WJDA 6A3HA 1QT1A 5ABHA 4YHGA 4C1NA 1XIFA 4MDPA 3AIQA 1GNXA 2PDKA 5M5DA 5CLWA 4FIRA 2WSPA 1T8XA 1YTEA 2WPBA 1TIWA 3ELFA 3QYSA 1IT0A 4AWEA 2DUZA 2NSOA 1UD6A 2DDXA 2ZZ1A 1W1VA 1J8VA 2QF8A 3JR2A 1HT6A 2PF0A 3TXZA 5D2TA 1XD1A 4XAGA 1DIEA 1I0DA 3I6RA 1M7XA 1Q2SA 4W5UA 2KX9A 3WQ8A 3PZUA 4LFYA 2HTMA 3UGVA 3WF0A 5JUVA 1BGGA 2QJNA 3DI1A 3OLIA 3L5AA 3VK5A 5HQLA 4JIPA 3VKJA 4PTVA 3NQ2A 3BCJA 5HMEA 4O4VA 2CU0A 4H41A 2ODOA 1T8QA 1BWKA 2MUCA 1S3HA 3AYSA 3CC1A 4JNMA 4MJ4A 1TVNA 1ZL1A 1DE5A 1JUEA 1SYTA 3CUIA 4JFWA 3OW1A 2Y24A 2XN0A 3DYOA 3PG9A 1VZWA 5HAOA 5CC7A 1A5KC 4P5UA 2D0HA 1B4EA 1JQXA 4LSBA 2WZMA 3GXNA 3PPFA 2D2GA 4RZ5A 3D3AA 2CBVA 5FJRA 4Z17A 2OB3A 1CLXA 1VEPA 2B7PA 1POJA 3C0JA 4H9VA 1C7TA 4ZCWA 5DEZA 2E6YA 2V5BA 3WNOA 2VOTA 4Q7IA 1UA7A 2YCJA 1NDZA 3E0VA 4L65A 1WXJA 1TREA 3GVQA 3RK8A 1YXCA 2WVVB 3UR2A 2IQ0A 1GONA 4KGLA 1VJIA 4HYRA 2PDWA 2PDCA 5DMLA 4YPJA 4N02A 1V93A 2HNHA 3E02A 1I8JA 3QZAA 5FF2A 3IUHA 1CT5A 4GUIA 5CSSA 1GKPA 2GJLA 1F8IA 4ZO9A 1SO3A 4UR7A 4QR6A 4Q4QA 3WDPP 3LK6A 1RV8A 3LHVA 7REQB 4LF2A 2X41A 1LG2A 1U5VA 1UKSA 1OFEA 4WIWA 3NSMA 1B5TA 1TJRA 4MJZA 1ZBKA 2IPJA 3KBVA 1ADDA 1DXFA 1JVNA 5CPQA 4F2UA 1Q6RA 3AROA 3AHXA 1HKVA 4BF9A 5DCBA 2V2CA 4EANA 1V03A 1DJYA 2X42A 3D3FA 4XTIA 2F7FA 4Y9AA 2XGBA 1UPMB 4UOZA 1ICSA 3LRMA 4TR9A 5F2GA 3DGBA 4M81A 1UZHA 3EA3A 1SMDA 2A21A 2FZBA 1TPFA 3HG3A 2X2GA 3KFTA 3QM3A 1J6OA 2ZZ4A 4MFEA 4AXKA 2FHCA 1OT1A 1CWYA 2VUYA 3FW6A 2FFIA 3WQGA 1QNVA 1N55A 1VLWA 3P5ZA 4AWUA 2E67A 2Z2AA 3DI0A 4GYKA 5T8GA 3NZ1A 3NEVA 2CITA 3LYEA 4I7WA 1V3MA 3QJAA 1Q7QA 3KRSA 1HF6A 2IPWA 4KCTA 4PMJA 3V36A 2W5FA 3MVIA 1IV8A 1DWJM 2E1WA 1W5QA 1OCJA 3MUAA 4WF7A 1KBKA 3AJ7A 4D6CA 3WQWA 5FAGA 1MSSA 1Z48A 3Q94A 3ANYA 5K7JA 3GXPA 1U83A 5AHIA 5I09A 1UZ1A 4FO4A 3T78A 4GJJA 3GQYA 3DBPA 2X7VA 1VFUA 5K9CA 5HR6A 1QTWA 2J7CA 1KFLA 3KVMA 4B3ZA 3N19B 3S9IA 1E9LA 1BSLA 3DEQA 5XIMA 1G69A 3GNNA 3EWBX 3E2VA 4QS6A 1ECEA 2UWFA 4XQ6A 1KXHA 1A5NC 1QR7A 2W63A 4JKLA 2RGLA 5G4WA 2DZSA 3KBWA 4PTNA 4PSRA 1JCYA 3KEHA 1GPWA 4P7NA 4AB4A 1V6TA 4R5EA 3ABZA 1JPMA 3B9DA 5GJNA 1TPVA 2W4XA 1H60A 1F73A 2ZRXA 4DM1A 1LT8A 3P0XA 1Z9AA 4IP5A 3QMTA 2PSNA 4EXBA 2ZUUA 2BZNA 2D3NA 4J7RA 4PR4A 4E4UA 2YLAA 2FYMA 3EX4A 3CHDA 3VPLA 4PMXA 3B97A 4GQGA 1V51A 2CLEA 2BXYA 1YADA 4GYPA 4A3UA 1B31A 7TIMA 1JXKA 3ENLA 3TYUA 3IACA 5LYRA 1AJ0A 3KRUA 1UUMA 1GZ1A 3VNDA 3GYEA 1C93A 4N9EA 2V5KA 3M0MA 4MWAE 3TTOA 3FYPA 3M0XA 1JNEA 3CZJA 4KW2A 4LUSB 3IK4A 4JEJA 2VWTA 1E55A 1KKOA 2VQUA 4A2RA 1WUFA 3GG7A 3ZM8A 3GFYA 4HZ8A 3BGGA 1FWIC 1XIHA 3CV2A 4H6RA 1Z7AA 3GU9A 1TUFA 4RNJA 2W27A 3NAVA 4XISA 3FLUA 3AISA 2BOEX 4QDMA 5I03A 3WX7A 1TFVA 4UNLA 1MQRA 4NY2A 4J35A 4UBPC 5CGQA 4B5NA 3WLOA 5CJ5A 1K9DA 1UH3A 4J2PA 4Z1YA 2ZUWA 5DMMA 4JTLA 3S1VA 2WKGA 3VNLA 3DBNA 1XPGA 2RDWA 4CD7A 3E2RA 4UZSA 5CSUA 5I3FA 1YMYA 4WEVX 4H8NA 2F6XA 2Z1WA 1AL7A 1WZMA 2FDSA 4AD1A 2NV2A 4V28A 4LVAA 2DUXA 1H1ZA 4JTUA 5FACA 3OGVA 1CB7B 3SBFA 5LXEA 4PBEA 3AHYA 1K4GA 3TU9A 2EGZA 1GVRA 4UCGA 2CLMA 3R5EA 4W86A 1RJRA 2JALA 2IXVA 4GNJA 1REQA 2FTPA 3A9BA 4YWSA 1TJ1A 4N6EA 3SCUA 2YL6A 2QCDB 2Z2UA 1JEZA 3UCDA 3R79A 2D73A 1OB0A 1L8PA 3THAA 1C8XA 1VF8A 2GUUA 4G7EB 4UQDA 3H53A 3PUEA 3WFAA 1H7XA 2ESCA 5FOOA 3MYOA 4MWAB 1W3HA 3SECA 4FX7A 4W7UA 3IAPA 1RQEA 1HO1A 4AX7A 4GOAA 1XIDA 4M51A 2VKZG 1EO5A 1FRBA 1XC4A 1W9VA 4R34A 3SY1A 3FSUA 1TQXA 4M1BA 3ABXA 2QCFA 2JKEA 3OTRA 3NO1A 4QHRA 4HOZA 4LUIA 3P84A 3USBA 1XLGA 5B7ZA 1WZLA 1TMLA 2PBGA 4OHQA 4JTIA 3AYRA 3EEZA 4DZ5A 1JYWA 1UKOA 2HK1A 1EIBA 1XWYA 4RE0A 4E3VA 2J79A 3ZIZA 3A6OA 1HJUA 1RR2A 1K8XA 3BURA 2YLLA 4RNFA 3VNMA 1EA9C 3WH7A 1C92A 1KV8A 4X2RA 3B0XA 2OYMA 1L2UA 1SW0A 2OPJA 3B0YA 3ES8A 2QQ6A 4CEXC 5D09A 3RU8X 5C7VA 4LRSA 2QCMA 1VS1A 4IIHA 4U5IA 4JZ5A 2B4GA 3P6LA 3BO9A 1MEHA 2DW7A 1RK6A 2FZMA 4I9JA 4J2MA 3RJYA 3QN3A 5BMXA 1DJZA 3QC3A 3HIJA 3VMNA 2Z25A 2RH9A 2PP1A 2WJEA 3R8HA 4V15A 4LEQA 3I10A 4PL1A 3CMFA 2XIJA 3L67A 1ZLPA 1QAPA 3PVFA 3MCOA 4GISA 4HPXA 5H8PA 2CBIA 1QMLA 3I3EA 4N9DA 4F4RA 1OYBA 2IS7A 1Z32X 3WY1A 3QPZA 2VGFA 4CN6A 4DJFD 3UZJA 3PSVA 1YXYA 1EP1A 1X1ZA 3QHNA 3MA8A 3H2OA 3MO7A 1O4UA 5CEWA 1MQQA 1DORA 4XSMA 3XINA 3IRSA 4LJ3A 5LIUX 2QIWA 1XLKA 2P0OA 1RY8A 1XRTA 1HJXA 2G41A 4S3FA 3O06A 3CZKA 3F5KA 3T81A 2P10A 1M1BA 1XX1A 1HGYA 1NTHA 4JY9A 3B03A 2Q01A 3T7VA 2VRJA 2OSWA 1PX8A 4TOQA 3ZLHA 7TAAA 1Y7VA 4DZHA 1CXKA 3NTYA 1TR1A 5A8QA 3C52A 4WDUA 1KXQA 4B91A 1WPCA 4NAFB 4GUFA 1RQHA 5EY5A 1UD3A 3L12A 3UXDA 3WSUA 1EC7A 5DRIA 4B5UA 3AS3A 1FFRA 3BUVA 3SUVA 2NQJA 1HKWA 2D69A 4D6DA 4K7YA 1EUNA 2WHKA 4Z2GA 2WM0A 4EVZA 1J12A 3TYBA 5DXXA 1DJIA 5BZAA 1PDYA 2VCBA 3V1HA 2CLPA 1KRMA 3DFNA 2OSXA 5BWAA 2XM2A 5HMSA 4PFMA 2OG9A 3LQGA 1H3GA 4NYUA 3A4AA 3M0LA 1KM6A 2C14A 2PWHA 3LTYA 4JHOA 3P3BA 3TONA 3KOXA 5I79A 3V35A 2WO5A 4GNKB 1YIXA 2RDUA 1UBPC 4KETA 2QV4A 1XS2A 3DG6A 3BL3A 1GQKA 4JTEA 2PPGA 3W81A 5FL0A 2ACQA 4QGCA 3EPOA 4GYPC 3W1RA 5CAKA 4EK7A 1XBXA 4MAVA 2QUVA 2BHYA 3CIVA 5CZJA 4DNMA 4TU1A 2J7BA 3ID7A 1KD0A 2WBGA 5DRCA 4KEMA 3IK2A 5HMFA 2VVSA 4M7TA 4QP0A 2PDIA 1GEHA 1E6XM 4RZ6A 1VFTA 2QKFA 1ZAJA 4HN8A 1LP6A 1VPQA 5C2GA 2HBVA 5DF0A 3NQDA 2VO5A 3LQLA 3CV7A 1V3LA 1WDPA 3C0QA 1QW9A 4JL1A 3NGJA 2PE4A 3TFXA 1W9XA 3BV4A 4NJIA 3NVTA 2REQA 2C1HA 1AK5A 5M17A 2IQDA 4L6DA 1UASA 1H49A 1TCMA 5JIPA 5FJOA 4LUJA 4LTSA 1FCQA 1M03A 2A6LA 4HSHA 4PTXA 2PRLA 1KWGA 4AEEA 5B80A 1PYMA 1XPYA 1WUEA 4JTTA 3PPCA 3M6YA 4MYAA 2CWNA 4W7WA 1EP3A 3A13A 4M1RA 2PA6A 2RJGA 3UWYA 3WLHA 3W53A 3AIVA 2G4FA 5BXSA 4UR8A 1ONEA 3SW6A 1TWZA 3K4WA 3A22A 2QMJA 1IE7C 3BSHA 4XZWA 1KFJA 1HN1A 1TO3A 2UZ9A 5DCDA 4JDBA 2ZWYA 3FJLA 1XYFA 4YLWA 3PG8A 1PVNA 5IHSA 3W27A 1FWWA 3KM8A 4IQJA 1QPNA 2HVOA 3HQOA 1IF2A 1R9YA 3MW7A 4JDYA 2AMGA 3EZ4A 3H2AA 3CYVA 1DWGM 3O63A 4WOZA 1W9BM 3PFMA 4IIGA 4JTAA 3CZ8A 2DQXA 1UOZA 1BTCA 1ISYA 1FWAC 2VEFA 1W1A1 1AH3A 1GORA 3GH5A 2XGIA 3MZ2A 4LH8A 1RP9A 3IJIA 3IJ9A 1OQFA 3VMPA 2ZX9A 2NUXA 2W0UA 3WUGA 1VFFA 1BEUA 2XFFA 2WXDM 1BWVA 2PAJA 4F0RA 1N82A 5AY7A 2ZXBA 3WQOA 2QGYA 1C29A 4DY1A 4R88A 1E3ZA 2P1FA 4RW5A 4FOUA 3URQA 1H7OA 4GQBA 4ZQRA 2A4AA 2EO7A 4W8AA 4DQWA 4AZIA 5M03A 3AOFA 4RL3A 4NG3A 3VU2A 3M0IA 2CLHA 2IKIA 3ITYA 2ZZ6A 1UWUA 3GSMA 3VDCA 1WA3A 3UU0A 4QAWA 3TTSA 1E5NA 4ONVA 2ZRYA 5HULA 3DC8A 3AUOA 5F4WA 5K2ZA 3EYPA 3UR5A 5A2BA 4K8GA 2BTMA 3H70A 4TX9A 5AHMA 3EMCA 1RJPA 4EF9A 1R0MA 3NA8A 3QGAC 4C6LA 5DMNA 2OWXA 4GXWA 1CBGA 1HO4A 3QTGA 2VEMA 2F2HA 1FWNA 4KESA 1XIJA 1P43A 3WKZA 4J5NA 4ZSUA 2DT2A 2X30A 1F3XA 4Z2LA 4F0MA 1XH2A 5F2LA 2I57A 3FGCB 4BA0A 1B3OA 4MYXA 4Z1BA 1ENUA 3KVLA 2YA1A 3G1AA 1MW1A 4AU0A 1KGUA 1LL6A 4ZTXA 3M0HA 4AFYA 2V3EA 4FOKA 3FS2A 3UWUA 1E5JA 1YBQB 1SUXA 1QOQA 1TTQA 3SRDA 3UGRA 1BPLB 5TD4A 1SJCA 5CC6A 2DZWA 2QIIA 5SWUA 1OFAA 4FZIA 4K6AA 4XD5A 3W4RA 2NXGA 3KBSA 2PGRA 2WZEA 4JTHA 1EH9A 2FVKA 3EWWA 3RITA 5MF5A 5T9BG 3F4DA 1ISZA 3DG3A 3QTPA 3G22A 2DV0A 1OC6A 3CIWA 3C2EA 3VKAA 3R58A 4LGXA 3SN0A 1Q85A 1H41A 3H55A 1P6CA 1MZRA 3RNDA 2QJIA 1REQB 3N9KA 3BQ5A 4YWIA 3NDZA 3TKFA 2DVTA 2OLHA 1V79A 3VGFA 5M3WA 3TW9A 4ZE4A 3WLNA 3KHDA 1TMQA 3NYZA 3T40A 1T96A 3NQVA 2W62A 2JBMA 2H3BA 1MUWA 3QQWA 4S3BA 2QPSA 1CGUA 3L65A 4O4WA 4UQAA 2X8RA 4JY8A 4GGBA 2WLZA 2J75A 2B7OA 2R1KA 3S0CA 1EX1A 3RX4A 5C55A 3AZRA 3CL8A 1FFQA 5BU6A 3PZNA 5I3GA 1RK5A 3G1HA 2QCHA 2VC7A 3LHTA 3P61A 1OF6A 4KGJA 1FX6A 3BJFA 3M16A 4ZB0A 4CCZA 2BY1A 3SY5A 1H11A 3PC0A 1D3HA 1LWHA 1OIFA 1D7KA 1SSDA 3THDA 3DHFA 4ZE5A 3V0SA 2A1YA 2SFPA 4PCTA 4H9ZA 2W9MA 3RHGA 2XFYA 4FXFA 5HNUA 5FJPA 4H9MA 1ISWA 1PAMA 5C2CA 4IWWA 1QPRA 3GKAA 5A69A 1QFEA 1A0DA 3BTNA 1QI4A 2RKXA 3VNJA 3V4BA 4C60A 4GIEA 3BH4A 1GJWA 1A0EA 4AEFA 1H7PA 3EDEA 1TJ0A 2PCQA 1TCDA 3PUDA 3DFYA 1SO5A 4EPEC 1TV2A 1I6NA 4HCLA 4LVDA 1TWSA 3OVGA 2VDIA 4AZ6A 4D6HA 4PC8A 2R8WA 1DBTA 4IMCA 1ITXA 2FIQA 5F2MA 1X98A 4S38A 3QV7A 3G0SA 1Q6EA 3LPOA 4ICCX 1SVDA 1UG6A 4ZXLA 2EHHA 3PF3A 4G5DA 1RBOB 4JGDA 4O1EA 2ZUSA 2PWUA 4C6OA 6PTDA 4J3UA 1H50A 5FA5A 4ERAA 5LHEA 2WVSA 3T8QA 2WKLA 3IGXA 1W3KA 4C6IA 3OJGA 2ZX5A 1HJVA 3NJ3A 3S2CA 1WKYA 5CPLA 2JIEA 1HIZA 4K38A 3QY6A 4AG0A 4GX8A 1WAUA 1AQMA 1FWDC 3ZVHA 4WXYA 5BOEA 5G4EA 3GM8A 3L66A 3ABQA 4D6EA 4PH6A 2C15A 2FJKA 4CU8A 5GQBA 2GVGA 3C2RA 1FHDA 4QXIA 2PTZA 1K03A 4RE2A 1RPXA 5AOUA 4Z1CA 4JFVA 3G1DA 3W1XA 4LS1A 1O7AA 1UWIA 1LOQA 4AWSA 3SO7A 4PL2A 2YXOA 4LUTB 1D9EA 3H4XA 1KRBC 5E9XA 3UPMA 3KCOA 4IJCA 1UWAA 2O55A 3E2SA 4L1WA 1VC4A 3H24A 1VHNA 5A8GA 5CC3A 1AW2A 4I7VA 1DWHM 1AW1A 3R6IA 3W2KA 1BYAA 3WF2A 4C6MA 4HBKA 9CGTA 2DIKA 1ZTVA 1NF7A 5ABGA 3KBNA 3IEBA 4KMQA 4HZ7A 2VD8A 1OFDA 3OGSA 4B15A 4LB4A 5AHLA 2R1PA 1GVYA 1WOBA 1VQTA 3TUUA 5AC7A 4P8WA 1AMKA 3N6QA 2VX4A 1HGWA 1X7IA 1UKTA 3T4CA 1CDGA 4FR6A 2QNEA 4NT0A 1F2JA 3H22A 3VM7A 3PNZA 2Y62A 4GVIA 3VKDA 2A6NA 4QAIA 3DFSA 2FLIA 2G0WA 4F0KA 4KRTA 4Q8QA 4DXVA 5CGMA 1GEQA 1G94A 2UBPC 4IMEA 5JH1A 3WH6A 4DRSA 4PCFA 2ZQ0A 3W3OA 4GNVA 4DUXA 1A5UA 3ITGA 1JRCA 1J79A 4V1YA 2ABBA 1W54A 3VNIA 2VD9A 4K37A 2WKJA 3F7JA 4BF5A 3E96A 3CIXA 3SDOA 4MKSA 4NF7A 2NVDA 3IVSA 4JQAA 1CENA 3TN6A 1JPIA 4CNOA 1U5JA 3CH0A 1LWIA 3BCFA 1GZJA 1MXDA 1J4EA 1XIBA 4DF0A 3OQEA 4AZHA 3TC3A 1LUCA 3W7MA 5LNWA 5FI8A 3TJXA 3GTFA 4GMEA 1JRBA 3EMZA 3MANA 1YXDA 4Z1DA 2DJLA 3BPWA 3BLFA 4K2SA 3CPGA 2I1OA 3MBFA 2C79A 3HQPA 2BB0A 1TX0A 2BHUA 2Z00A 2W3ZA 1YPFA 1H7NA 4OFCA 1ZY9A 1V0LA 1RCOB 3P74A 1A5MC 3NZRA 1V5XA 5J5DA 1YNQA 1C91A 4HT3A 3WQ6A 3BVJA 2A79A 2EQDA 1OWQA 3TK7A 2OYKA 4O52A 4Q6XA 3TSBA 3M7WA 1OFRA 2QJJA 3CT7A 5CXPA 2VCCA 1TB3A 1IHIA 4MZYA 1TPDA 2WZIA 4PMQA 3GXIA 1F6KA 1XQKA 1W32A 3CZGA 1LL4A 5JXQA 4ZOCA 3RIKA 4EOUA 2POZA 1P7TB 3OHIA 1XDJA 5A6AA 4CLMA 2NUYA 4Z0JA 3KVKA 2XH4A 3CAVA 4PMUA 3CB8A 4WJ8A 4TTGA 2E4TA 3CWHA 3QW3A 1VRDA 4OOZA 3GY1A 2OOGA 4WHBA 4US5A 3WQVA 3AWNA 3LCIA 4B92A 1U1UA 1H63A 2XYLA 3FK4A 3WLTA 2O9RA 4FNUA 4GVGA 2XZ7A 4JFUA 4D1IA 5D2VA 1F3WA 1KV5A 1Q8AA 3TJLA 2VFHA 3P81A 3G8RA 1W5OA 2Q8XA 1JZ4A 5F7UA 2H8ZA 4I5RA 3MP4A 1Q6OA 1B3YA 3LZ3A 2WK2A 3GTIA 3W71A 4ROQA 3H8AA 4KWOA 1WKEA 2QT3A 4J3TA 4AIUA 2Z28A 4BJHA 2REQB 3C5QA 3JW7A 5FEWA 1XICA 2O7SA 3QHOA 3W84A 4GIRA 1R9ZA 1EJRC 3T2OA 4AY8A 3CWOX 3U7BA 3DESA 4NP7A 1EX5A 1GT8A 5FF4A 1FCBA 4FI4A 5KZ6A 4K68A 3W70A 1E0UA 3LEPA 3HGRA 4AVNA 3NIYA 1F6PA 1GOOA 2WANA 4FP1A 3UXAA 3VIHA 3QRHA 3ZSSA 2JKAA 3FDKA 3FXGA 2YDQA 5JU6A 4JN7A 1M7JA 4FNSA 1F74A 4R53A 1KLYA 1S2AA 3FXYA 2DGAA 2IPFA 4GXMA 4C90A 4H8VA 3V75A 3AXMA 3HURA 3WUBA 4N9CA 4AD0A 3HMCA 5BWFA 2XH2A 1RAKA 1JD9A 4H1ZA 1XYCA 1FP8A 4KCUA 4L1GA 2G8ZA 3HPAA 1TRIA 4GJIA 3IIXA 4HA1A 3VD5A 1DJWA 1JYXA 3SURA 3PTDA 2Y5EA 3FJNA 5TF0A 4QJ4B 3S2NA 2EEXA 2V2HA 3GB6A 5CSRA 1ZB5A 1XXXA 2FHBA 4AZ7A 4OTKA 3TXVA 2QDGA 3SCOA 1FXQA 3BMXA 5CG0A 3BG9A 1PPIA 3KDNA 1XBZA 2GDUA 4ZO7A 2UV8G 2YL8A 4OBRA 1KFKA 3UCQA 5K3VA 3TQVA 1U2YA 5JH2A 3N15A 4IP7A 4BF7A 3L68A 2ONEA 4H01A 4AZGA 2ZZ5A 4NZFA 3WD0A 4GFIA 3W2NA 3F4NA 3L4YA 4XAPA 5LIYX 4JS3A 2AKZA 3S4TA 5LNUA 2P76A 1CPUA 1R47A 4LOCA 2Y89A 5BXTA 5D02A 1RVGA 3QYQA 1FHLA 2Z1VA 3R0UA 3P82A 1RP8A 2VT0A 1KTBA 3LRLA 3F5LA 4WQ6A 3AFBA 1R9XA 2C19A 3T09A 1K6AA 4WGXA 2FZ9A 4Y9MA 2Y8KA 3COTA 3TCSA 1U5HA 1MWOA 3WQDA 2W92A 1PCWA 2NQHA 1C9WA 4GCAA 3SJ3A 1J2WA 5HDRA 4YCPA 4FX8A 1VPXA 1A80A 4BFAA 4E6MA 2WZHA 4UIOA 5G4HC 1S2TA 3CV6A 3QF0A 2I5GA 4DAIA 3ZVIA 3I65A 3JS3A 5GNXA 2QUTA 4BQ5A 3UT0A 4FLOA 1IEQA 1UR9A 3CL7A 3SQSA 2V30A 1I0BA 1IEIA 2G3NA 4NZ5A 3HG4A 4XZIA 3WDIA 1LOSA 3TC6A 1LZOA 1Y65A 3ALGA 4WVXA 3V5OA 4NZ3A 3BMWA 1DIOA 1VLIA 1KFBA 4W85A 2A7PA 1JCXA 5D2XA 3W2MA 2A3LA 3RYSA 1LOLA 2J25A 3EOEA 4ADUA 3M43A 5HATA 5FF7A 4GUGA 1X97A 3BAJA 3TEVA 1IIGA 3DIPA 5I7GA 1RLDA 2QMKA 4CQ8A 1XSIA 3T55A 4M56A 5D30A 1XW8A 3GNRA 2BGNE 1VP5A 5IRPA 3TQPA 4PRTA 1W1ZA 3NCOA 1OYAA 3LD5A 2VR4A 4EPBC 2YPIA 2QDDA 4CNUA 4UWMA 4PUEA 2PDMA 4ZQCA 3T8LA 1FA2A 1HL9A 4H7VA 3WJZA 4QE5A 1UWTA 4HJFA 5EMLA 4PFHA 1V0NA 4IGMA 3N3TA 3WFZA 4AY1A 1M41A 3AXXA 3PY2A 5G1MA 2GOKA 1A49A 1KCLA 2J9YA 2C3ZA 5I0DA 2ASHA 3TAKA 5LIWX 2R1NA 4HZMA 4GUJA 2Z6IA 4IJRA 1LF1A 2ZFAA 4H9YA 4J3ZA 1E6ZA 3RLUA 1BVWA 4M24A 5EFDA 4CD5A 1A47A 4NZJA 1DWIM 6ENLA 3O7UA 2PMQA 1ONRA 3MKKA 2DFAA 2XWEA 4EXAA 4BR1A 1C8YA 3CPRA 3STGA 4B5VA 1MUCA 1E51A 2CETA 4PCPA 4ADSA 1EIXA 3CTLA 1SZEA 3VOGA 3NQ8A 3BQ6A 2Z27A 4A35A 3QMSA 4LBRA 1YHTA 2NV1A 1PEZA 3BV7A 3U4FA 2VZVA 4F66A 4PRRA 3WFLA 4JHMA 3URAA 1R86A 5CZSA 4BI5A 4IICA 4XD6A 3SUUA 3EOSA 4W8BA 3GHSA 4AD5A 4EP8C 3BAKA 2TODA 1US3A 3C4UA 3U5YA 4HU8A 2D20A 3SCVA 1SR9A 3LGGA 1R3SA 4TXEA 2PFHA 3N12A 5EPDA 1HJWA 3TP4A 3SUSA 3M0YA 4N7QA 1AVAA 1WX0A 4H00A 5A8MA 5G5IA 3GVWA 2E68A 4S2CA 4O15A 5H2ZA 1B2YA 3H26A 4LS2A 3WENA 4HP5A 3R94A 4TV5A 3B9OA 2DT3A 4PCNA 1W5PA 2O9OA 1X8CA 3MUZ1 2OCZA 3GYCA 4IPPA 2YKKA 1Q6LA 1KQZA 2PWDA 4U31A 2PDUA 2OX1A 2JQXA 5IBXA 1E1FA 3RILA 2WMHA 1QI2A 1RALA 3I3DA 3QC0A 1OD0A 3D47A 4M8UA 4F0HA 4BCEA 1G4PA 1L6GA 2FHFA 4HNTA 4HK6A 3N3MA 2X16A 1HW6A 5K4ZA 2GJRA 4RR4A 3ZS4A 1DQUA 1XUUA 1UUOA 4XX6A 4CQBA 4GQ0A 4GY7A 4I3GA 1CW2A 3DKLA 4FLQA 5C9XA 3R1ZA 4WCJA 3PBGA 1JPDX 2X7WA 4GZEA 3RMJA 4N9BA 4GI9A 6CGTA 1XDMA 3DFOA 1VFHA 1SGJA 2ZOXA 4IPLA 3E0LA 1MDRA 2BY3A 1OCNA 4NRRA 1E9IA 1EGZA 4JQ1A 2DSVA 2VI0A 1F76A 4LCRA 1I60A 3FY1A 1UCWA 2HXUA 2QZRA 3TC7A 1EWDA 3SQLA 3V18A 1VYRA 3MP5A 4O11A 3UXKA 1A3XA 1MXGA 1LYXA 3H2EA 5D03A 1XH0A 1ZJAA 3BZGA 2I14A 1VAHA 4PB4A 2X1TA 1ZBWA 3RG6A 4E2DA 5LKYA 4FMVA 1G4EA 3W1AA 3NG3A 3PZIA 3URNA 1D8CA 3TAOA 2NVAA 2G4JA 2EF9A 4HSOA 1RLCL 1JD7A 3TTYA 2QPXA 2OWCA 4HMDA 1A53A 1IXNA 2FDMA 2FMOA 1ZFJA 3MY9A 1A5AA 1BAGA 4YL2A 3AIWA 4KKXA 3LENA 4HKPA 2XVNA 1ZUAX 4ZB2A 2WHJA 4CCEA 2CZEA 3M47A 1Q13A 2AL2A 2FTYA 4O16A 3O16A 1KXVA 1W2VA 4GX9A 2QDEA 4D72A 2BBFA 5AYYA 2QAPA 1SJBA 2V3FA 4ERIA 3S6DA 3LSBA 3OG2A 5HR7A 2O4QA 3GR4A 4QCFA 5CJNA 1E1CB 2YA2A 1BRLA 1Y8BA 2GGEA 3BANA 2PEVA 1EPVA 2EPKX 5J8LA 2BLEA 3I7RA 3SGUA 5GPRA 3W7EA 3AU2A 1SPQA 2GJPA 4IG2A 4IGHA 4K3ZA 2VTFA 1SZGA 1WZAA 3QPYA 2Z4GA 1E56A 3QHMA 2Z1XA 2RDTA 3GXTA 4Y2WA 1YDOA 1SW7A 1LLWA 4LCSA 3KOFA 3WQ5A 4O53A 3OBKA 3O0KA 3QY8A 3UA3A 2CLKA 1UR2A 2OMAA 2E28A 1FWSA 2GQ8A 3FA3A 4E2BA 4MGGA 3BGJA 1GQLA 2HE8A 4UOQA 3L5MA 3EB3A 4MZ1A 4WSHA 3MHUA 4ATLA 4G1NA 2VDGA 4QEHA 4S3JA 3WO8A 1CEOA 4GQQA 1LUCB 1HTIA 3WJYA 1CGXA 4BY3A 3ARWA 3VILA 4FX6M 4NAEA 5HJYA 1H61A 3ZJ7A 5ABFB 4H9UA 4D8ZA 1RBAA 1TV3A 3SRKA 4W5ZA 4H6EA 1ADSA 3BJTA 4ICNA 4DXXA 4ES4A 4YTQA 5XINA 3ZR6A 5HJXA 3BXWA 4OVXA 1OGGA 2V5LA 4K8EA 4YU1A 3ALFA 3LUTA 2Z2BA 3LCWA 4O17A 3TQ0A 4O54A 4R7JA 3B3DA 3D46A 4X2PA 1MFVA 5LZLA 2J6VA 4JKKA 4GI4A 1PHWA 1JZ3A 4GI8A 1GPFA 1JI1A 3NQAA 1AD1A 3TROA 1DVJA 1YLVA 3M0VA 1NARA 4OECA 3ZFHA 5AHNA 1M65A 3IWPA 3GXFA 3LXBA 4RV8A 4DO7A 5A5WA 4JL2A 1V0MA 2HSAA 1RA5A 3CZLA 1UIOA 2ZXAA 3FVMA 3PSWA 3MMUA 3A3XA 3VZZA 3APTA 2EXOA 4UXDA 1TG7A 2J7EA 3MSYA 4XZHA 5HUPA 3R43A 3TYEA 1XISA 1CECA 3H12A 3ONCA 1M68A 1H5YA 3IUIA 2PDGA 4IQLA 6TAAA 1U33A 2BY2A 2FB2A 4M6PA 4N4PA 4GBDA 5FF3A 4L5ZA 2OODA 3HFYA 4ZO8A 2NQ9A 4X61A 2CKSA 2WNZA 1V08A 4FF7A 2PWEA 2GDVA 2HZGA 1EL3A 3WJSA 4QIUA 3MWCA 4GXPA 1TPC1 4GA8A 2EKCA 5E0KA 1NP0A 2WVVA 1QDSA 2C1IA 1J0KA 5FIPA 4QDPA 2YW4A 3P5YA 3W00A 2YB4A 3FHQA 4RJEA 3TYCA 1I4NA 3T9PA 2PWFA 2DVUA 4KRZA 2E8YA 4JTDA 5IBXC 3WD4A 4KCVA 3ARZA 3GG8A 3IJ6A 2CPUA 4UFMA 3N14A 2QVHA 4XD3A 2FMNA 3TWAA 5KITA 1DWAM 1QHZA 3IIOA 3R0DA 2F6KA 1HP4A 4LWWA 3LCHA 5AYIA 3AQUA 4JQ2A 4A6GA 4DO6A 4UZUA 1C8VA 5FESA 1U1HA 1NQKA 4TVUA 4GH3A 3WMCA 3BW4A 2DY3A 4GO9A 2PDXA 4C1LA 1M01A 3UJEA 2V63A 4L6HA 1TX2A 3UG4A 3Q58A 4UTKA 3BSGA 1IYXA 5A1AA 3VKBA 1Y5WA 3H7VA 1V02A 1X6NA 3ICJA 2WNQA 5A6MA 5D2WA 2G97A 1KM2A 2W91A 2ZTKA 3KAOA 1EFZA 4DJDD 3WNLA 1V6UA 3CM4A 4FNTA 4DJED 1H1NA 2PWVA 4AMCA 5D2YA 3ARXA 2CESA 2OLSA 1FKXA 3NL6A 3RX3A 5A6BA 1QW8A 2EKGA 1WO2A 3W82A 2XJ7A 1UKQA 1O95A 1ME7A 3BLDA 1B90A 2JFEX 4Y90A 5IFTA 3G6MA 2GVEA 3LM7A 5E6ZA 4LF1A 4C5YA 3WLMA 1E1CA 3PB0A 1XD0A 3S5NA 4C6QA 4FXSA 2R1MA 3MO4A 1VCVA 1ME9A 1GQJA 3OIHA 1YTKA 4AD2A 4DYJA 2F9RA 3ZLFA 4LUTA 4REQB 2AQOA 2QPUA 5LSMA 3EA1A 1KTNA 4M7SA 2VOMA 3O6DA 1KR0A 3VA8A 3B8SA 1HVXA 1BLIA 3AXIA 3I4EA 4XKYB 2WBKA 2CXGA 1BXNA 3A3WA 5T9CE 4YTSA 1US0A 3B9NA 1U22A 3R0KA 1E71M 1PDZA 1E6SM 2RAGA 2GYIA 3JRKA 4H8UA 5KZDA 1HKKA 4GZIA 4LPCA 1LWJA 4CQCA 3EOLA 3PTQA 3GRIA 1Q4NX 4OGZA 4WX2A 3F2DA 1WBJA 1JFXA 3CWNA 4JNYA 5GVJA 2BG5A 4W8LA 1R3WA 1IGSA 3W01A 1QPKA 2AL1A 2DORA 4NL1A 1R38A 1FH9A 1ME8A 1E3XA 2V5DA 3GD6A 6TIMA 3HMJG 4FSAA 1QBAA 2PP3A 1FWBC 3PPGA 1ZRQA 4K1WA 2POTA 2XIQA 4B3KA 5BRBA 4PBGA 1FDZA 2Y88A 2E40A 3UG3A 3ES7A 1M04A 2Y4SA 4FXJA 3L4XA 2Z7KA 4XO6A 3FJ4A 7ENLA 2JEPA 4D6JA 3PUOA 1G7VA 3W76A 3ZT5A 4O18A 2ZZ7A 3PHAA 3JUGA 1XSJA 3LX9A 4XVDA 4QG6A 1X7FA 3O8AA 4K8HA 1UOKA 1GVFA 3VGGA 4I9MA 3C8FA 3G5EA 3RR1A 4MNLA 2VX5A 1BYCA 4XBSA 4K36A 2WOQA 5AHEA 1IQ8A 1JR1A 3I7QA 3W26A 8TIMA 1OX5A 1SJDA 4HNCA 1OF8A 4GK8A 4E2VA 4A21A 4OWGA 2OELA 5I78A 2CYGA 5I02A 3G3MA 3AMCA 2NXIA 3OGRA 4AVFA 1M9HA 1EJTC 4MKVA 5CGTA 2G37A 1LG1A 1JDAA 1GQNA 1NH6A 5BRQA 1MNZA 1A4MA 1PWMA 5E5CA 1L6FA 2E6DA 2PZNA 4QROA 3TR2A 4QLKA 4G9PA 3GBEA 5BMWA 1O6IA 1OCBA 1NFPA 2P53A 1YPXA 4KWWA 3SEPA 4Y8EA 5CKSA 4Q8UA 4KPLA 4BHYA 3W74A 1FY6A 1PXGA 3SSZA 4MY9A 1W8SA 4HTBA 3U8GA 1L6YA 2DZXA 1QU4A 3GZAA 4CEUC 3F1QA 1IR1A 2P3ZA 1OZMA 4PZVA 3W24A 4WGHA 5DMYA 1JULA 3SR7A 1OX4B 4JPGA 4DF1A 3TN3A 4Q8WA 5H8MA 2QJGA 2CHRA 3NL5A 1BF6A 3RPMA 3TR9A 1G1YA 1YEYA 2VL4A 2HDJA 3V5FA 1JCMP 4GQRA 2QW5A 3GZ3A 3OVQA 3BOFA 4LQ1A 3TNBA 2GGJA 2CZDA 3P80A 4UTUA 3BW3A 5LXXA 4WDWA 1WV2A 3IIVA 3VFLA 2TPSA 4BKNA 2VP8A 3LHYA 3UR7A 1LRQA 2E09A 5G2WA 1O60A 3P2VA 1CIUA 4XIAA 3PJWA 2HE5A 3N11A 3DOPA 3VKKA 4NI3A 1EP2A 3ZSTA 1XBVA 3LRKA 4PUKA 2F8QA 3GW0A 3GS6A 3DECA 1VFLA 7ODCA 4ORIA 5HA7A 4LC6A 4HPNA 3HGSA 5KETA 3C86A 3VDGA 3AC0A 4DF2A 2B31A 3VUSA 2J7FA 1AMYA 3ATYA 5ECVA 4JAWA 5CPMA 3GG1A 1KFWA 4GLEA 1Q5MA 1FWCC 2C13A 1SZRA 4MY1A 1MZHA 3VC6A 3ECQA 3RPTA 4WK9A 2VFEA 1EBGA 3NUKA 3MKVA 3CU2A 2QCDA 2VEIA 1TWDA 3WBAA 1QNRA 3O15A 3VYLA 4M19A 1KGWA 2YFNA 1XLFA 2P0IA 3RPDA 3JZEA 3QSTA 1JNDA 2G3JA 9XIMA 1XP3A 4IIBA 2XPKA 3TTQA 2IW0A 1PSCA 4HVXA 5HXMA 4DHGA 2E9MA 2PWGA 4BEUA 2W67A 4EX4A 1ONWA 2OVLA 3NSNA 3N9RA 2E7FA 3MDUA 3W73A 2FTWA 2DJXA 3UWQA 2DQWA 5LNRA 2HWGA 1OX4A 3W7QA 3BDKA 4E2OA 4NVTA 3GU2A 3W7JA 1QW7A 4FB7A 1YDYA 3FV9A 2XINA 2Y1HA 1O68A 4LRTA 1AA1B 2R91A 3OBAA 6ALDA 1HL8A 2WV8A 4LNCA 1Y5VA 3S2LA 3D6NA 4QISA 1J5SA 1S46A 4BI7A 6REQB 4LB3A 4GY0A 3B40A 4EF8A 3LBCA 2EPOA 2HS6A 3RMEA 4Q8NA 4UTJA 3THCA 3EDFA 1UZDA 1AW5A 1OFQA 3DAQA 1DQXA 4X3ZA 1RHCA 3OU8A 4X60A 4S3CA 1I1WA 3KE0A 4L80A 3CGTA 3KTSA 4JTCA 4WD0A 1R8LA 3WLLA 3HPFA 4ZENA 2H9AA 4MLJA 5AHFA 1VBHA 5EMKA 1KW1A 2HRWA 3VM5A 4HJWA 2GUBA 2OWWA 5A8OA 3L4UA 5IM51 3CUZA 3O1NA 4XAFA 3SRHA 1XCXA 1F4AA 3EMQA 4LEFA 1GOQA 2GPTA 3CQKA 3RM8A 4KFOA 3M0JA 1VR6A 2Z26A 5A95A 5IOBA 1EZWA 2G3MA 3CAQA 3NURA 4O14A 4ILSA 3NOYA 1V3KA 1B0IA 1QWGA 4J9JA 3H23A 1FH8A 4MVAA 2ALRA 1MEWA 1PV8A 5G1YA 1LLOA 2E25A 3F03K 1UWRA 3SJNA 1KBLA 4S2BA 2ZIDA 3REQA 4HU3A 4YTRA 1BQCA 8XIAA 3W7RA 4Y7EA 3LV5A 4U4MA 1JCNA 3IAQA 2C0HA 1ZS2A 5IHRA 3WNNA 1W1TA 2BV9A 5HPCA 2FPVA 1UR8A 1JDDA 5M2FX 5I23A 1TA3A 4WDXA 3HU7A 3VINA