2F9SA

2nd crystal structure of a soluble domain of resa in the oxidised form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
138
structure length
138
Chain Sequence
EGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 38
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2f9sA00
4HJMA 2EIOA 4P3YB 5H5RA 5HFKA 3TOUA 2LQQA 5DALB 1EWXA 1FG4A 1GNWA 3RDWA 2HYXA 5DCGA 1AQWA 4CW9A 3ZIVA 3BCIA 4DSQA 4IBPA 4KW6A 2O8VB 1OYJA 2CZ3A 3GTUB 2VD1A 2V32A 1TU7A 2XBIA 3BCKA 1JLWA 3ZITA 3GH9A 3JCML 4I8BA 2PN8A 5AGYA 3WT1A 3IK7A 4J2FA 4NMUA 1Q98A 4IP6A 2H66A 4WBRD 1OKDA 4DVCA 3FKFA 1GWCA 2LS5A 1S3CA 2C0EA 1A2JA 1B8XA 4F9ZA 3DGQA 2I9HA 4TR1B 1PD21 2X8HA 2LRTA 4YQVA 5ECRB 2CQ9A 3UJ1A 5GAND 3ZTLA 5IO0A 1M0UA 1DE2A 5CRWA 3DWVA 16GSA 3EINA 2DIYA 2YANA 2K18A 4ML1A 4ILFA 2H1DA 5F0GA 4OFMA 5IOXA 1NSWA 1R26A 2IMIA 4TR3A 2VO4A 1BX9A 5KN2A 2EIRA 18GSA 4KE3A 1SKWB 2AJQB 3D6IA 3HHVA 1PN9A 2IFQA 4MF6A 2C0GA 3FR3A 4MH3A 1UN2A 1O85A 1GSSA 1UA5A 4ZXGA 5ID2A 3IE3A 2B5XA 3EWLA 2IIYA 2DJ0A 1TDIA 2RUEA 3GN3A 1WE0A 1SYXA 1JZOA 4PQHA 4NWYA 5LD0A 2VCWA 3ZFLA 2MMOA 2GQLA 5H5SA 3C1RA 4HZ2A 5CRGA 3KXOA 5G5EA 3QD9A 4YQMA 3TCOA 4Z7XA 1M9AA 1GLQA 2PBJA 1TRSA 2LTKA 4IN0A 1A24A 2HZEA 1Y6EA 2FUG2 4RI7A 3E3EA 2V41A 5D73A 3BD2A 1O7UA 1EOGA 1OC3A 4HEA2 4GRFA 4N0VA 2CAQA 1KEBA 2WB9A 2H1GA 3MDKA 2HT9A 4K0NA 1WOUA 4ECJA 1AQVA 2RUFA 1G0TA 1BEDA 4IELA 4AJ7A 3D0ZA 1FO5A 1YJ6A 5G5FA 1VGLA 1SENA 2OBIA 1DSBA 5ABRA 3HY2A 2IMFA 2M46A 2IFQB 3APQA 2CZ2A 1HD2A 1NM3A 3Q6OA 1T4YA 2OACA 8GSSA 3IXRA 4MH2A 1I9DA 3LJRA 4AF2A 3HJPA 4EE0A 1ZOFA 3WYWA 3M0FA 4JR6A 2EC4A 1OC9A 1XWKA 1K3YA 4ZILA 5GZZB 1M9BA 1V58A 5IOWA 3SWLA 3F6FA 2NVLA 1CQHA 2C0FA 4IP1A 4EXJA 5D9WA 2H01A 4XS1A 4ZIJA 2I4AA 1G7EA 2GZPA 4KDYA 5IMVA 1M99A 2H74A 2M72A 4TN8A 4PNGA 2FWEA 1NHYA 4L5OA 4WEYA 6GSXA 1GH2A 5FHIA 1EGOA 3QFAC 4WBJA 2LUSA 2RM6A 3QOUA 2VIMA 3F4TA 4GCIA 4BPYA 3VPTA 2DC5A 2DJ3A 3NIVA 1G6YA 5F05A 2CT6A 3L0HA 1XWGA 4JEDA 2AUVA 3O76A 4OCEA 4TW5A 4WXTA 1SL2B 2OADA 4HJ2A 3Q18A 3ERWA 2K8SA 2E2MA 2XPEA 2G0FA 2YV7A 1HNBA 2H75A 4MPFA 2PUKC 3I9V2 4KDXA 5ECQB 5DQSA 3RHCA 3GSTA 2GT6A 2P5RA 2E0QA 4KX4A 3AY8A 4EF0A 3UBLA 5EPFA 4X43A 2CV4A 2LJAA 4HS1A 1Q4JA 3IRAA 2VLTA 2OJLA 2AB6A 3S9FA 2GTUA 3HJMA 3ISOA 4IJ3A 1YEPA 3TJBA 1GSDA 3C73A 1K0BA 3HDCA 4OMVA 4NAXA 2VLUA 2C4JA 1OE8A 5FT3A 2AHEA 2QKEA 1Z7PA 2PVQA 5ELGA 2JU5A 3E9JB 1QUWA 2LEGA 3GKMA 1PMTA 4ACSA 3L9UA 4X0XA 3C8EA 3GSSA 4I97A 3QFBC 3ZZXA 4G9HA 3TJGA 2DMMA 1GNEA 1WPIA 3HVVA 2YPMA 3DRNA 1EZKA 2R6KA 1EEJA 3MAKA 3G9BA 5JWRB 1OE7A 4BVYA 1GULA 4L8EA 1KNGA 2LJKA 1GTIA 4FYBA 5F8BA 1U87A 2PVOC 1V9WA 1PL2A 3ED3A 1YKAA 3P90A 1BAYA 1V57A 1R5PA 2FWFA 3UVTA 3KMOA 5B7CA 5INYA 4KGIA 5ECMB 3P7XA 2JSYA 4KSOA 1FB0A 2L5LA 1X0RA 3CMIA 4K6XA 2HFDA 4GWRA 1F37A 2VM2A 2H70A 2GLRA 2WFCA 4IQAA 1IYHA 6GSSA 3TKSC 1SD8A 14GSA 1JHBA 3BJ5A 3LQ7A 3IC4A 4O32A 4Q5RA 4V1Ag 4MA9A 4JU5A 5D96A 3GKKA 2YOIA 3CTGA 2PMTA 3HKRA 5IO2A 3IAM2 3HYPA 4GQFA 1JZWA 3TKQA 2FNOA 5AIVA 3GV1A 4K7NA 3QAGA 4NPBA 2ES7A 4LA1A 4ID0A 4TR0A 3L78A 3MWHA 3TKSA 4GXZA 5JCUA 4EDYA 5IMZA 1MTCA 2HLSA 2H1BA 2YJHA 1YY7A 2L6CA 4XS4A 1ZGNA 1RW1A 4HDEA 2DSAA 1PA3A 1PX6A 2N5FA 2WZ9A 3K8NA 4AJ8A 3TJJA 5HR3A 2FHEA 5IPHA 2LNTA 5G1LA 1PGTA 4MABA 4KCEA 5IMAA 2MYGA 5B8AA 5L71A 1K0MA 3HZ4A 1FB6A 1TJDA 1K3OA 3VLNA 2F9SA 1TK5B 3BBYA 3DIEA 4X1UA 4LLRA 1A23A 2A2RA 4EUYA 2A4VA 1ZZYA 1ZL9A 2HI7A 2CVKA 4MZCA 1J0FA 2BTOT 4MZWA 5A5KA 3CSJA 3QCPA 2BJXA 4TXOA 1T7PB 4ECCA 3O6TA 2HRFA 1EGRA 2IMKA 4BWQA 1I5GA 1VF2A 1HNAA 2B1LA 1HYUA 4OD7A 3VWWA 2KP2A 2J23A 4MJCA 5JWQB 2YN1A 3KP8A 2DMLA 2C8UA 3TKPA 5FWGA 1XOBA 5ECHB 3G7JA 2IWTA 1TK0B 4DSRA 2H6ZA 3CXGA 1R7HA 4V2NA 3CSIA 2P5QA 3F4SA 2XBQA 2E7PA 3IAS2 3KJYA 4I2TA 1ZCPA 3LEFA 2X8GA 2OE1A 2H76A 5D9XA 2QSIA 5D8IA 1U3AA 1SL1B 4FYUA 2C1YA 1BQ7A 1WJKA 5DDLA 1GUHA 20GSA 3KGKA 2YCDA 4TKYA 2VCXA 5D9TA 2KOKA 1A0RP 5DCHA 1O8XA 4MJBA 3GKXA 2KUCA 4V2MA 3TKRA 1MDIA 1MEKA 2LKUA 1V40A 4OWYA 1AQXA 4RI6A 2YWIA 2V6OA 2H30A 4KDUA 1KTEA 2XC2A 1OAZA 1SK2A 3F8UA 5J5NA 3QAVA 1GL8A 3QDNA 3VWVA 3F6DA 4V2LA 2ZCTA 3HA9A 5DJLA 3RPPA 3H93A 4HOJA 3QAWA 2GSQA 1SYRA 5HR2A 5CAXA 3A2XA 3N5OA 4OFNA 1TRWA 1PKZA 1B48A 1F3BA 2I1UA 1G6WA 2VL2C 3H4KA 1M2AA 2H19A 5IMFA 2X64A 1WMJA 1DE1A 3TOTA 4J57E 4IQ1A 2MBTA 1M2DA 3IV4A 4G19A 2HRNA 3QPMA 3RBTA 5LCZA 4EC0A 1S3AA 3W8JA 2WS2A 2VL2A 5ELAA 3APOA 2LRNA 1XWAA 4BA7A 4HU9A 1TOFA 2AV4A 4BL7A 2N5AA 4F2IA 1GSQA 1WWJA 5ECPB 1Z5YE 1FOVA 3VI7A 4PQ1A 2NPBA 2WJUA 3M3MA 3FEUA 2ON7A 3G7IA 10GSA 4IS0A 2L4QA 1K0CA 2GQMA 1NW2A 3VK9A 2N5BA 3APSA 2VM1A 4PGTA 3VI5A 1AIUA 2L4CA 3WGXA 3EMXA 5B6NA 1XVQA 1MDKA 4ZBAA 1R5AA 1W89A 2PGTA 2GZYA 3D4TA 1J08A 4GTUA 2GT5A 6GSUA 4MJEA 1GTUA 5ID2B 1GSUA 4TR4A 1A2LA 1S3DA 2JSZA 2GQKA 2CVBA 1U6TA 1YZXA 3J7Yb 1T4ZA 1OC8A 2GDRA 1XOAA 2JZTA 3GHAA 3GL3A 5ECSA 2L6DA 1NHOA 3H1NA 5B8BA 4GSNA 5KEJA 3DD3A 2O87A 1ERVA 5JCWA 2HZEB 1XBSA 1SJIA 1QK8A 2VLVA 3U6VA 4WR5A 2ZNMA 4HZ4A 2H6XA 4K8MA 1YDKA 2REMA 3KTLA 2FGXA 5C00A 3UOMA 1GSEA 1B4PA 4MPGA 4O5RA 2DJ1A 3SBCA 3DVWA 3V1WA 1QGVA 3I6AA 1SJZA 3FR9A 2CX4A 3LFLA 3KZQA 1MDJA 3CYNA 3KD0A 4XRDA 1E6BA 2QGVA 2HSHA 3NZNA 5B6MA 1XW6A 2LJRA 1Z6MA 1EP8A 5LNKe 4AGSA 1Y25A 3ZRDA 5GSTA 4HQSA 4KB3A 2DLXA 4ZL7A 3KEBA 2F3MA 3HD5A 2F8AA 3IR4A 4HQZA 1ML6A 2JZRA 3UL3A 5IPGA 4F03A 1YF0A 1EP7A 2FCHA 1GSYA 5CRHA 1OC9B 2V6KA 1GUKA 4PUAA 5EL8A 3CBUA 1GRXA 1TI1A 4WKWA 1ST9A 3P2AA 3GMFA 3KTBA 3VPQA 2B5EA 3GX0A 3US3A 5C04A 4MP4A 4NV2A 1AC1A 1GUMA 3KH9A 4Q5FA 1J9BA 1Z7RA 5J41A 1AAZA 2WGRA 4MF7A 1B9YC 5EVOA 2DJ2A 3KIJA 2PU9C 1XFLA 1GTAA 3UAPA 3ZFBA 4K7OA 2LQOA 1OKTA 3GFKA 1C72A 1FW1A 2K9FA 3C71A 3FR6A 2GVPA 2RLIA 2H6YA 3DKSA 2H72A 3TGZA 3EU3A 3FZ4A 1DBYA 4D73A 1DUGA 2K6VA 4K2DA 4LMWA 3VWUA 2KLXA 1F9MA 1Z3EA 3A5WA 2FA8A 3W8SA 4H86A 1AXDA 4PQIA 2P0GA 4KAEA 4POLA 3RPNA 1FVJA 3UIWA 2H1AA 1ON4A 2GS3A 2MZCA 3QMXA 5J9BA 4TVEA 1ZYQB 2JADA 2P31A 3UVHA 4EKZA 3PINA 4L5LA 4DSSA 2ON5A 3E0UA 2R37A 3MSZA 4KUNA 4EVMA 2IJYA 3WGDA 2YJ7A 3LYKA 1M2BA 4IVFA 4POBA 2RIIA 1H75A 2L5OA 3F9UA 3D4MA 5DALA 5A4WA 1OVNA 3GNJA 3KH7A 4K9ZA 2H0IA 3WT2A 3DMLA 3VWXA 3H8QA 2O85A 4OFTA 4DEJA 4PX1A 3ZMKA 2C3TA 3UBKA 1K0NA 1X5DA 1A8LA 3CRUA 3GTUA 4KCAA 5ECNB 3EURA 1MD4A 2X8CA 2IN3A 1RQMA 4MK3A 4ECIA 3A2WA 1XWCA 5JCGA 2H0GA 1UC7A 6GSVA 4IW9A 4QL9A 4PURA 1XZOA 1FAAA 2TIRA 2MMNA 3FHKA 1A8YA 3IPZA 2GGTA 2YV9A 4XS6A 2G2QA 1F3AA 4TR1A 3G7YA 1PKWA 1Z6NA 1B9XC 5IMDA 3IOSA 4YH2A 1O81A 3I69A 4JRRA 4JR4A 5DJMA 3Q19A 2LNSA 4EL1A 1TTZA 1XXUA 2FY6A 4TRXA 4G2EA 4WF4A 4CHSA 3D5JA 4GSSA 1B4QA 4NHWA 1EV9A 3FYGA 2O89A 5H5QA 3TJKA 2HSYA 3CRTA 2MMAA 4MLYA 3L9SA 3M9JA 2H8LA 2B1KA 2YWNA 1GP1A 2GZZA 3KMNA 2DJJA 4XHMA 5CYYA 4AJ6A 1V2AA 1K0AA 4ZBBA 4O92A 2YZHA 2D2ZA 3LWAA 2FD3A 2H71A 3H79A 1FHEA 4HU7A 3ZMLA 5JWOB 1XPVA 3TUEA 2L57A 3GX8A 4L0UA 3MNGA 1SK1A 2HE3A 4MCUA 1QFNA 2OBKA 3HJOA 3WD6A 5COHA 4KSMA 4XS4B 2VAFA 3HVXA 1TW9A 3ME7A 1MD3A 2L59A 3N9JA 4WR4A 3KCMA 2OKAA 1X9MB 5G2ZA 1CQGA 2R4VA 3L4NA 5E4WA 2CA8A 2PPTA 2H73A 3IBHA 4K1FA 5GSSA 5AN1A 3L9VA 2R2JA 4IKHA 3TKSE 1ERUA 1VF1A 1O6JA 4FIWA 2BMXA 4PNFA 3GL5A 3I43A 1PQNA 5ECLB 3GH6A 2TRCP 4XCSA 1BYEA 4XRAA 1THOA 2E2GA 4K0GA 2B6MA 3LGCA 1G7OA 4EDZA 2KHPA 2B3SA 4OCFA 4TXOB 4F82A 5HFGA 1LJRA 4YAVA 2IPAA 1TKDB 2PWJA 1W4VA 1AW9A 2J9HA 2YWMA 2ALBA 1VF3A 2HZFA 4BVXA 4IJIA 2MMZA 2B7KA 1GTBA 3TJFA 3ZVJD 4ZBDA 4E8HA 1U3IA 4POMA 3TRQA 2DBCA 3O3TA 4KH7A 3FRCA 2LRCA 1SKSB 2NBSA 3GURA 3DEXA 1F2EA 1USBA 4MDCA 3LSZA 2QC7A 1WP0A 2VUPA 1TP9A 3HXSA 1XW5A 1SU9A 3GIXA 13GSA 3VURA 3ERFA 1HQOA 3TRPA 5E59A 2I81A 5DAKA 3C1SA 4LL4B 4GLTA 6GSYA 3LG6A 3EMPA 4N30A 4MMMA 1TRUA 4WETA 2CVDA 1BJXA 4EO3A 1O73A 3ME8A 3ZVJA 2XHFA 17GSA 1WRYA 4LMVA 3P8WA 4F0BA 2IMEA 2IL3A 1SL0B 4RQXA 2VL3A 3FZ9A 4YQUA 3A2VA 3F4RA 3WGEA 4QQ7A 1PRXA 3FW2A 2OE3A 2ZUPA 3EU4A 2DJKA 4O7HA 1FVKA 4OO5A 1SK0A 1YKCA 5AISA 3C7MA 5AIXA 2XPDA 4ZB9A 5ECIB 1R4WA 1TI3A 3IK9A 4Q5QA 5G31A 2AAWA 1SKRB 5F06A 1VRSD 2VD0A 2WRTA 2HXKA 4JBBA 2VCZA 1TXXA 2YWOA 5G1KA 2O7KA 3GUSA 5CO3A 4K7IA 3M8NA 3ZYWA 4QL7A 5CNWA 2WDUA 2OA7A 1QQ2A 5D9VA 5KN3A 2GSRA 1XIYA 2V1MA 5CREA 1M7TA 3LXZA 1TRVA 4GSTA 3PH9A 3VFIA 2EIQA 2F51A 7GSSA 1JZRA 5CP1A 3UMAA 4MF5A 4ULXA 3Q74A 5DAKB 1YEXA 3KM6A 5HQPA 5GAPD 2F8FA 4ZB6A 2M80A 3ZLPA 4KNDA 3R2QA 4NXIA 3LXTA 2AYTA 5J4UA 2Z9SA 4XIHA 5D93A 3OR5A 2LSTA 4ML6A 1SD9A 2VCQA 1XW9A 3CSHA 5DQYA 1ILOA 4POKA 3FZ5A 3DXBA 3UEMA 2H0HA 5ECKB 3U5RE 2B5YA 4NV5A 4IGJA 1JZDA 3FZAA 1PX7A 4JZQA 1E2YA 1EV4A 4NHZA 3QR6A 3UARA 3ERGA 3M9KA 1O8WA 22GSA 12GSA 2K8VA 3TRXA 4ZL9A 3DVXA 2B7JA 5ENUA 1AUCA 2FA4A 2WCIA 2CX3A 1RK4A 2HNLA 3F3QA 4N10A 2C0DA 3D22A 4MZBA 5ECOB 4FO5A 3LYPA 3IHQA 1K0DA 1XCCA 3EVIA 1PSQA 1IYIA 3IA1A 4BWSA 4ISDA 5HR0A 1THXA 3RAZA 4KA0A 19GSA 4I2UA 4N0ZA 1YF1A 2R3XA 2V2GA 4GQCA 2R5GA 3IDVA 4ZB8A 1X9SB 2WULA 1X5EA 1V98A 1HNCA 4E8EA 3HVSA 2DIZA 4GF0A 4OO4A 4TXVA 2JL4A 1ACVA 2KP1A 1T1VA 5G30A 2VL9A 4ZL8A 1YQ1A 1X5CA 3RHBA 5DVBA 2YNXA 5F07A 3EE2A 2CAIA 4XTSA 3ZIJA 6GSTA 3NOFA 1LBKA 5HR1A 2VCVA 4FH8A 4HI7A 4TOPA 2YZUA 4RUVA 5KN0A 6GSWA 4V1Ap 3KP9A 1LU4A 3M1GA 3TDGA 1URMA 2YP6A 1VF4A 3EC3A 1A2MA 3HZ8A 2JZSA 2VCTA 2NDOA 2PERA 4MJAA 4IHUA 1JFUA 3FK8A 5J9CA 2FLSA 3GYKA 1N2AA 5DBQA 1K3LA 2C3NA 3BOAA 5IMCA 3D21A 5CRDA 2FWHA 4ECBA 1UVZA 3EYTA 4WF5A 5A4UA 1GLPA 3LORA 2C3QA 4I6XA 1ERWA 4FYCA 1QMVA 2I3YA 3PGTA 1F6MC 3J7Yk 2X99A 3CTFA 5HFIA 1X9WB 1T3BA 2C80A 1U88A 3GA4A 4CDOA 3HCZA 3PR8A 4PUFC 1BG5A 5IQYA 4N11A 2FWGA 2TRXA 1KBNA 1EOHA 3GRXA 3ZREA 2OE0A 3GKNA 9GSSA 4PXOA 2LV3A 4D73B 3DYRA 3FY7A 4F0CA 1PL1A 1XVWA 3A3TA 1ZYEA 3ZL5A 2GSSA 1WIKA 4J56E 4I5QA 1T8EB 1ABAA 5IM9A 1SJ6A 5J3RA 3F3RA 5KN1A 3F0IA 1ZMAA 2VOCA 4YAPA 3F63A 2IMDA 1N8JA 1ERTA 1K0OA 4RQRA 2MBSA 1TK8B 2A2SA 4HUAA 1TU8A 3TB2A 4Q5NA 1A0FA 2NTOA 4G10A 4DSSB 1EEMA 1GSFA 1QXHA 11GSA 5A4VA 1H4OA 4LL1B 1JLVA 2GSTA 5EY6A 2JACA 2RM5A 4L0WA 1XWBA 5IIZA 3W6GA 1T00A 4JE1A 1Z9HA
chains in the Genus database with same CATH superfamily
4HJMA 2EIOA 4P3YB 5H5RA 5HFKA 3TOUA 2LQQA 5DALB 1EWXA 1FG4A 1GNWA 3RDWA 2HYXA 2HRAA 5DCGA 1AQWA 4CW9A 3ZIVA 3BCIA 4DSQA 4IBPA 4KW6A 2O8VB 1OYJA 2CZ3A 3GTUB 2VD1A 2V32A 2DKHA 1TU7A 2XBIA 3BCKA 1JLWA 3ZITA 3GH9A 3JCML 4I8BA 2PN8A 5AGYA 3WT1A 3IK7A 4J2FA 4NMUA 1Q98A 4K5RA 4IP6A 2H66A 4WBRD 2R0CA 1OKDA 1S3RA 4DVCA 3FKFA 1GWCA 2LS5A 1S3CA 2C0EA 1A2JA 1B8XA 4F9ZA 3DGQA 2I9HA 4TR1B 1PD21 2X8HA 2LRTA 4YQVA 5ECRB 2CQ9A 3UJ1A 5GAND 3ZTLA 5IO0A 1M0UA 1DE2A 5CRWA 3DWVA 16GSA 3EINA 2DIYA 2YANA 2K18A 4ML1A 4ILFA 2H1DA 5F0GA 4OFMA 5IOXA 1NSWA 1R26A 2IMIA 4TR3A 2VO4A 1BX9A 5KN2A 2EIRA 18GSA 4KE3A 1SKWB 2AJQB 3D6IA 3HHVA 1PN9A 2IFQA 4MF6A 2C0GA 3FR3A 4MH3A 1UN2A 1O85A 1GSSA 1UA5A 4ZXGA 5ID2A 3IE3A 2B5XA 3EWLA 2A4HA 2IIYA 2DJ0A 1TDIA 2RUEA 3GN3A 1WE0A 1SYXA 1JZOA 4PQHA 4NWYA 5LD0A 2VCWA 3ZFLA 2MMOA 2GQLA 5H5SA 3C1RA 4HZ2A 5CRGA 3KXOA 5G5EA 3QD9A 4YQMA 3TCOA 4Z7XA 1M9AA 1GLQA 4EIPA 2PBJA 4YKGA 1TRSA 2LTKA 4IN0A 1A24A 2HZEA 1Y6EA 2FUG2 4RI7A 3E3EA 2V41A 5D73A 3BD2A 1O7UA 1EOGA 1OC3A 4HEA2 4GRFA 4N0VA 3MIXA 2CAQA 1KEBA 2WB9A 2H1GA 3MDKA 2HT9A 4K0NA 1WOUA 4ECJA 1AQVA 2RUFA 1G0TA 1BEDA 4IELA 4AJ7A 3D0ZA 1FO5A 1YJ6A 5G5FA 1VGLA 1SENA 1M3JA 2OBIA 1DSBA 5ABRA 3HY2A 2IMFA 2M46A 2IFQB 4BVXB 3APQA 2CZ2A 1HD2A 1NM3A 3Q6OA 1T4YA 2OACA 3IHGA 8GSSA 3IXRA 4MH2A 1I9DA 3LJRA 4AF2A 3HJPA 4EE0A 1ZOFA 3WYWA 3M0FA 4JR6A 2EC4A 1OC9A 1XWKA 1K3YA 4G0LA 4ZILA 5GZZB 1M9BA 1V58A 5IOWA 3SWLA 3F6FA 2NVLA 1CQHA 2C0FA 4IP1A 4EXJA 5D9WA 2H01A 4XS1A 4ZIJA 2I4AA 1G7EA 2GZPA 4KDYA 5IMVA 1M99A 2H74A 2M72A 4TN8A 4PNGA 2FWEA 1NHYA 4L5OA 4WEYA 4K5SA 6GSXA 1GH2A 5FHIA 1EGOA 3QFAC 4WBJA 2LUSA 2RM6A 3QOUA 2VIMA 3F4TA 4GCIA 4BPYA 3VPTA 2DC5A 2DJ3A 3NIVA 1G6YA 5F05A 2CT6A 3L0HA 1XWGA 4JEDA 2AUVA 3O76A 4OCEA 4TW5A 4WXTA 1SL2B 2OADA 4HJ2A 3Q18A 3ERWA 2K8SA 2E2MA 2XPEA 2G0FA 2YV7A 1HNBA 4K2XA 2H75A 4MPFA 2PUKC 3I9V2 4KDXA 5ECQB 5DQSA 3RHCA 3GSTA 2GT6A 2P5RA 2E0QA 4KX4A 3AY8A 4EF0A 3UBLA 4X43A 5EPFA 2CV4A 2LJAA 4HS1A 1Q4JA 3IRAA 2VLTA 2OJLA 2AB6A 3S9FA 2GTUA 3HJMA 3ISOA 4IJ3A 1YEPA 3TJBA 1GSDA 3C73A 1K0BA 3HDCA 4OMVA 4NAXA 2VLUA 2C4JA 1OE8A 5FT3A 2AHEA 2QKEA 1Z7PA 2PVQA 5ELGA 2JU5A 3E9JB 1QUWA 2LEGA 3GKMA 1PMTA 4ACSA 3L9UA 4X0XA 3C8EA 3GSSA 4I97A 3QFBC 3ZZXA 4G9HA 3TJGA 2DMMA 1GNEA 1WPIA 3HVVA 2YPMA 3DRNA 1EZKA 2R6KA 1EEJA 3MAKA 3G9BA 5JWRB 1OE7A 4BVYA 1GULA 4L8EA 1KNGA 2LJKA 1GTIA 4FYBA 5F8BA 4CY8A 1U87A 2PVOC 1V9WA 1PL2A 3ED3A 1YKAA 3P90A 1BAYA 1V57A 1R5PA 2FWFA 3UVTA 3KMOA 5B7CA 5INYA 4KGIA 5ECMB 3P7XA 2JSYA 4KSOA 3LW9A 1FB0A 2L5LA 1X0RA 3CMIA 4K6XA 2HFDA 4GWRA 1F37A 2VM2A 2H70A 2GLRA 2WFCA 4IQAA 1IYHA 6GSSA 3TKSC 1SD8A 14GSA 1JHBA 4G0KA 3BJ5A 3LQ7A 3IC4A 4Q5RA 4O32A 4V1Ag 4MA9A 4JU5A 5D96A 3GKKA 2YOIA 3CTGA 2PMTA 3HKRA 5IO2A 3IAM2 3HYPA 4GQFA 1JZWA 3TKQA 2FNOA 5AIVA 3GV1A 4K7NA 3PPUA 3QAGA 4NPBA 2ES7A 4LA1A 4ID0A 4TR0A 3L78A 3MWHA 3TKSA 4GXZA 5KOXA 5JCUA 4EDYA 5IMZA 1MTCA 2HLSA 2H1BA 2YJHA 1YY7A 3FMWA 2L6CA 4XS4A 1ZGNA 1RW1A 4HDEA 2DSAA 1PA3A 1PX6A 2N5FA 2WZ9A 3K8NA 4AJ8A 3TJJA 5HR3A 2FHEA 5IPHA 2LNTA 2DKIA 5G1LA 1PGTA 1PN0A 4MABA 4KCEA 5IMAA 2MYGA 5B8AA 5L71A 1K0MA 3HZ4A 1FB6A 1ZYPA 4ICYA 1TJDA 1K3OA 3VLNA 2F9SA 1TK5B 3BBYA 3DIEA 4X1UA 4LLRA 1A23A 2A2RA 4EUYA 2A4VA 1ZZYA 1ZL9A 2HI7A 2CVKA 4MZCA 1J0FA 2BTOT 4MZWA 5A5KA 3CSJA 3QCPA 2BJXA 4TXOA 1T7PB 4ECCA 3O6TA 2HRFA 1EGRA 2IMKA 4Z2UA 4BWQA 1I5GA 1VF2A 1HNAA 2B1LA 1HYUA 4OD7A 3VWWA 2KP2A 2J23A 4MJCA 5JWQB 2YN1A 3KP8A 2DMLA 2C8UA 3TKPA 5FWGA 1XOBA 5ECHB 3G7JA 2IWTA 1TK0B 4DSRA 2H6ZA 3CXGA 1R7HA 4V2NA 3CSIA 2P5QA 3F4SA 2XBQA 2E7PA 3IAS2 3KJYA 4I2TA 1ZCPA 3LEFA 2X8GA 2OE1A 4CY6A 2H76A 5D9XA 2QSIA 5D8IA 1U3AA 1SL1B 4FYUA 2C1YA 1BQ7A 1WJKA 5DDLA 1GUHA 20GSA 3KGKA 2YCDA 4TKYA 2VCXA 5D9TA 2KOKA 1A0RP 5DCHA 1O8XA 4MJBA 3GKXA 2KUCA 4V2MA 3TKRA 1MDIA 1MEKA 2LKUA 1V40A 4OWYA 1AQXA 4RI6A 2YWIA 2V6OA 2H30A 4KDUA 1KTEA 2XC2A 1OAZA 1SK2A 1XG8A 3F8UA 5J5NA 3QAVA 1GL8A 3QDNA 3VWVA 3F6DA 4V2LA 2ZCTA 3HA9A 5DJLA 3RPPA 3H93A 4HOJA 3QAWA 2GSQA 1SYRA 5HR2A 5CAXA 3A2XA 3N5OA 4OFNA 1TRWA 1PKZA 1B48A 1F3BA 2I1UA 1G6WA 2VL2C 3H4KA 1M2AA 2H19A 5IMFA 2X64A 1WMJA 1DE1A 3TOTA 4J57E 4IQ1A 2MBTA 1M2DA 3IV4A 4G19A 2HRNA 4Z2RA 3QPMA 3RBTA 4BIKA 5LCZA 5KOWA 4EC0A 1S3AA 3W8JA 2WS2A 2VL2A 5ELAA 3APOA 2LRNA 1XWAA 4BA7A 4HU9A 1TOFA 2AV4A 4BL7A 2N5AA 4F2IA 1GSQA 1WWJA 5ECPB 1Z5YE 1FOVA 3VI7A 4PQ1A 2NPBA 2WJUA 3M3MA 3FEUA 2ON7A 3G7IA 10GSA 5BRTA 4IS0A 2L4QA 1K0CA 2GQMA 1NW2A 3VK9A 2N5BA 3APSA 2VM1A 4PGTA 3VI5A 1AIUA 2L4CA 3WGXA 3EMXA 5B6NA 1XVQA 1MDKA 4ZBAA 1R5AA 1W89A 2PGTA 2GZYA 3D4TA 1J08A 4GTUA 2GT5A 6GSUA 2A2PA 4MJEA 1GTUA 5ID2B 1GSUA 4TR4A 1A2LA 1S3DA 2JSZA 2GQKA 2CVBA 1U6TA 1YZXA 3J7Yb 1T4ZA 1OC8A 2GDRA 1XOAA 2JZTA 3GHAA 3GL3A 5ECSA 2L6DA 1NHOA 3H1NA 5B8BA 4GSNA 5KEJA 3DD3A 3HVNA 2O87A 1ERVA 5JCWA 2HZEB 1XBSA 1M3IA 1SJIA 1QK8A 2VLVA 3U6VA 4WR5A 2ZNMA 4HZ4A 2H6XA 4K8MA 1YDKA 2REMA 4BL7B 3KTLA 2FGXA 5C00A 3UOMA 1GSEA 1B4PA 4MPGA 4O5RA 2DJ1A 3SBCA 3DVWA 3V1WA 1QGVA 2UZ8A 3I6AA 1SJZA 3FR9A 2CX4A 3LFLA 3KZQA 1MDJA 3CYNA 3KD0A 4XRDA 1E6BA 2QGVA 2HSHA 3NZNA 5B6MA 1XW6A 2LJRA 1Z6MA 1EP8A 5LNKe 4AGSA 1Y25A 3ZRDA 5GSTA 4HQSA 4KB3A 2DLXA 4ZL7A 3KEBA 2F3MA 3HD5A 2F8AA 3IR4A 4HQZA 1ML6A 2JZRA 3UL3A 5IPGA 4F03A 1YF0A 3CQFA 1EP7A 2FCHA 1GSYA 5CRHA 2X4AA 1OC9B 2V6KA 1GUKA 4PUAA 5EL8A 3CBUA 1GRXA 1TI1A 4WKWA 1ST9A 3P2AA 3GMFA 3KTBA 3VPQA 2B5EA 3GX0A 3US3A 5C04A 4MP4A 4NV2A 1AC1A 1GUMA 3KH9A 4Q5FA 1J9BA 1Z7RA 5J41A 1AAZA 2WGRA 4MF7A 1B9YC 5EVOA 2DJ2A 3KIJA 2PU9C 1XFLA 1GTAA 3UAPA 3ZFBA 4K7OA 2LQOA 1OKTA 3GFKA 1C72A 1FW1A 2K9FA 3C71A 3FR6A 2GVPA 2RLIA 3A5IA 2H6YA 3DKSA 2H72A 3TGZA 3EU3A 3FZ4A 1DBYA 4D73A 1DUGA 2K6VA 2QA2A 4K2DA 4LMWA 3VWUA 2KLXA 1F9MA 1Z3EA 3A5WA 2FA8A 3W8SA 4H86A 1AXDA 4PQIA 2P0GA 4KAEA 4POLA 3RPNA 1FVJA 3UIWA 2H1AA 1ON4A 2GS3A 2MZCA 3QMXA 5J9BA 4TVEA 1ZYQB 2JADA 2P31A 3UVHA 4EKZA 3PINA 4L5LA 4DSSA 2ON5A 3E0UA 2R37A 3MSZA 4KUNA 4EVMA 2IJYA 3WGDA 2YJ7A 3LYKA 1M2BA 4O5UA 4IVFA 4POBA 2RIIA 4EIQA 1H75A 2L5OA 3F9UA 3D4MA 5DALA 5A4WA 1OVNA 3GNJA 3KH7A 4K9ZA 2R0PA 2H0IA 3WT2A 3DMLA 3VWXA 3H8QA 2O85A 4OFTA 4DEJA 4PX1A 3ZMKA 2C3TA 2HSMA 3UBKA 1K0NA 1X5DA 1A8LA 3CRUA 3GTUA 4KCAA 5ECNB 3EURA 1MD4A 2X8CA 2IN3A 1RQMA 4MK3A 4ECIA 3A2WA 1XWCA 5JCGA 2H0GA 1UC7A 4BVYB 6GSVA 4IW9A 4QL9A 4PURA 1XZOA 1FAAA 2TIRA 2MMNA 3FHKA 1A8YA 3IPZA 2GGTA 2YV9A 4XS6A 2G2QA 1F3AA 4TR1A 3G7YA 1PKWA 1Z6NA 1B9XC 5IMDA 3IOSA 4YH2A 1O81A 3I69A 4USSA 4JRRA 4JR4A 5DJMA 3Q19A 2LNSA 4EL1A 1TTZA 1XXUA 4G0IA 2FY6A 4TRXA 4G2EA 4WF4A 4CHSA 3D5JA 4GSSA 1B4QA 4NHWA 1EV9A 3FYGA 2O89A 5H5QA 3TJKA 2HSYA 3CRTA 2MMAA 4MLYA 3L9SA 3M9JA 2H8LA 2B1KA 1FOHA 2YWNA 1GP1A 2GZZA 3KMNA 2DJJA 4XHMA 4FQUA 5CYYA 4AJ6A 1V2AA 1K0AA 4ZBBA 4O92A 2YZHA 2D2ZA 3LWAA 2FD3A 2H71A 2HRKA 3H79A 1FHEA 4HU7A 3ZMLA 5JWOB 1XPVA 3TUEA 2L57A 3GX8A 4L0UA 3MNGA 1SK1A 2HE3A 4MCUA 1QFNA 2OBKA 3HJOA 3WD6A 5COHA 4KSMA 4XS4B 2VAFA 3HVXA 1TW9A 3ME7A 1MD3A 2L59A 3N9JA 4WR4A 3KCMA 2OKAA 1X9MB 5G2ZA 1CQGA 2R4VA 3L4NA 5E4WA 2CA8A 4A5PA 2PPTA 2H73A 3IBHA 4K1FA 5GSSA 5AN1A 3L9VA 2R2JA 4Z2TA 4IKHA 3TKSE 1ERUA 1VF1A 1O6JA 4FIWA 2BMXA 4PNFA 1ZYNA 3GL5A 3I43A 1PQNA 5ECLB 3GH6A 2TRCP 4XCSA 1BYEA 4XRAA 1THOA 2E2GA 4K0GA 2B6MA 3LGCA 1G7OA 4EDZA 2KHPA 2B3SA 4OCFA 4TXOB 4F82A 5HFGA 1LJRA 4YAVA 2IPAA 1TKDB 2PWJA 1W4VA 1AW9A 2J9HA 2YWMA 2ALBA 1VF3A 2HZFA 4BVXA 4IJIA 2MMZA 2B7KA 1GTBA 3TJFA 3ZVJD 4ZBDA 4E8HA 1U3IA 4POMA 3TRQA 2DBCA 3O3TA 4KH7A 3FRCA 2LRCA 1SKSB 2NBSA 3IC8A 3GURA 3DEXA 1F2EA 1USBA 4MDCA 3LSZA 2QC7A 1WP0A 2VUPA 1TP9A 2R0GA 3HXSA 1XW5A 1SU9A 3GIXA 13GSA 3VURA 3ERFA 1HQOA 3TRPA 5E59A 2I81A 5DAKA 3C1SA 4LL4B 4GLTA 1PFOA 6GSYA 3LG6A 3EMPA 4N30A 4MMMA 1TRUA 4WETA 2CVDA 1BJXA 4EO3A 1O73A 5BMUA 3ME8A 3ZVJA 2XHFA 17GSA 1WRYA 4LMVA 3P8WA 4F0BA 2IMEA 2IL3A 1SL0B 4RQXA 2VL3A 3FZ9A 4YQUA 3A2VA 3F4RA 3WGEA 4QQ7A 1PRXA 3FW2A 2OE3A 2ZUPA 3EU4A 2DJKA 4O7HA 1FVKA 4OO5A 1SK0A 1YKCA 5AISA 3C7MA 5AIXA 2XPDA 4ZB9A 5ECIB 2QA1A 4O5QA 1R4WA 1TI3A 3IK9A 4Q5QA 5G31A 2AAWA 1SKRB 5F06A 1VRSD 2VD0A 2WRTA 2HXKA 4HSCX 4JBBA 2VCZA 1TXXA 2YWOA 5G1KA 2O7KA 3GUSA 5CO3A 4K7IA 3M8NA 3ZYWA 4QL7A 5CNWA 2WDUA 2OA7A 3R3EA 1QQ2A 5D9VA 5KN3A 2GSRA 1XIYA 2V1MA 5CREA 1M7TA 3LXZA 1TRVA 4GSTA 3PH9A 3VFIA 2EIQA 2F51A 7GSSA 1JZRA 5CP1A 3UMAA 4MF5A 4ULXA 3Q74A 5DAKB 1YEXA 3KM6A 5HQPA 5GAPD 2F8FA 4ZB6A 2M80A 3ZLPA 4KNDA 3R2QA 4NXIA 3LXTA 2AYTA 5J4UA 2Z9SA 4XIHA 5D93A 3OR5A 2LSTA 4ML6A 1SD9A 2VCQA 1XW9A 3CSHA 5DQYA 1ILOA 4POKA 3FZ5A 3DXBA 3UEMA 2H0HA 5ECKB 3U5RE 2B5YA 4NV5A 4IGJA 1JZDA 3FZAA 4YKFA 1PX7A 4JZQA 1E2YA 1EV4A 4NHZA 3QR6A 3UARA 3ERGA 3M9KA 1O8WA 22GSA 12GSA 2K8VA 3TRXA 4ZL9A 3DVXA 2B7JA 5ENUA 1AUCA 2FA4A 2WCIA 2CX3A 1RK4A 2HNLA 3F3QA 4N10A 2C0DA 3D22A 4MZBA 5ECOB 4FO5A 3LYPA 3IHQA 1K0DA 1XCCA 3EVIA 1PSQA 1IYIA 3IA1A 4BWSA 3EPTA 4ISDA 5HR0A 1THXA 3RAZA 4KA0A 19GSA 4I2UA 4N0ZA 1YF1A 2R3XA 2V2GA 4GQCA 2R5GA 3IDVA 4ZB8A 1X9SB 2WULA 1X5EA 2X49A 1V98A 4MNNA 1HNCA 4E8EA 3HVSA 2DIZA 4GF0A 4OO4A 4TXVA 2JL4A 1ACVA 2KP1A 1T1VA 5G30A 2VL9A 4ZL8A 1YQ1A 1X5CA 3RHBA 5DVBA 2YNXA 5F07A 3EE2A 4XTSA 2CAIA 3ZIJA 6GSTA 3NOFA 1LBKA 5HR1A 2VCVA 4FH8A 4HI7A 4TOPA 2YZUA 4RUVA 5KN0A 6GSWA 4V1Ap 3KP9A 1LU4A 3M1GA 3TDGA 1URMA 2YP6A 1VF4A 3EC3A 1A2MA 3HZ8A 2JZSA 2VCTA 2NDOA 2PERA 4MJAA 4IHUA 1JFUA 3FK8A 5J9CA 2FLSA 3GYKA 1N2AA 5DBQA 1K3LA 2C3NA 3BOAA 5IMCA 3D21A 5CRDA 2FWHA 4ECBA 1UVZA 3EYTA 4WF5A 5A4UA 1GLPA 3LORA 2C3QA 4I6XA 1ERWA 4FYCA 1QMVA 2I3YA 3PGTA 1F6MC 3J7Yk 2X99A 3CTFA 5HFIA 1X9WB 1T3BA 2C80A 4X4JA 1U88A 3GA4A 4CDOA 3HCZA 3PR8A 4PUFC 1BG5A 5IQYA 4N11A 2FWGA 2TRXA 1KBNA 1EOHA 3GRXA 3ZREA 2OE0A 3GKNA 9GSSA 4PXOA 2LV3A 4D73B 3DYRA 3FY7A 4F0CA 1PL1A 1XVWA 3A3TA 1ZYEA 3ZL5A 2GSSA 1WIKA 4J56E 4I5QA 1T8EB 1ABAA 5IM9A 1SJ6A 5J3RA 3F3RA 5KN1A 4PTSA 3F0IA 1ZMAA 2VOCA 4YAPA 3F63A 2IMDA 1N8JA 1ERTA 1K0OA 4RQRA 2MBSA 1TK8B 2A2SA 4HUAA 1TU8A 3MYDA 3TB2A 4Q5NA 1A0FA 2NTOA 4KF9A 4G10A 4DSSB 1EEMA 1GSFA 1QXHA 11GSA 5A4VA 1H4OA 4LL1B 1JLVA 2GSTA 5EY6A 2JACA 2RM5A 4L0WA 1XWBA 5IIZA 3W6GA 1T00A 4JE1A 1Z9HA
chains in the Genus database with same CATH topology
4HJMA 2EIOA 4P3YB 5H5RA 5HFKA 3TOUA 2LQQA 5DALB 1EWXA 1FG4A 1GNWA 3RDWA 2HYXA 2HRAA 5DCGA 1AQWA 4CW9A 3ZIVA 3BCIA 4DSQA 4IBPA 4KW6A 2O8VB 1OYJA 2CZ3A 3GTUB 2VD1A 2V32A 2DKHA 1TU7A 2XBIA 3BCKA 1JLWA 3ZITA 3GH9A 3JCML 4I8BA 2PN8A 5AGYA 3WT1A 3IK7A 4J2FA 4NMUA 1Q98A 4K5RA 4IP6A 2H66A 4WBRD 2R0CA 1OKDA 4DVCA 3FKFA 1GWCA 2LS5A 1S3CA 2C0EA 1A2JA 1B8XA 4F9ZA 3DGQA 2I9HA 4TR1B 1PD21 2X8HA 2LRTA 4YQVA 5ECRB 2CQ9A 3UJ1A 5GAND 3ZTLA 5IO0A 1M0UA 1DE2A 5CRWA 3DWVA 16GSA 3EINA 2DIYA 2YANA 2K18A 4ML1A 4ILFA 2H1DA 5F0GA 4OFMA 5IOXA 1NSWA 1R26A 2IMIA 4TR3A 2VO4A 1BX9A 5KN2A 2EIRA 18GSA 4KE3A 1SKWB 2AJQB 3D6IA 3HHVA 1PN9A 2IFQA 4MF6A 2C0GA 3FR3A 4MH3A 1UN2A 1O85A 1GSSA 1UA5A 4ZXGA 5ID2A 3IE3A 2B5XA 3EWLA 2A4HA 2IIYA 2DJ0A 1TDIA 2RUEA 3GN3A 1WE0A 1SYXA 1JZOA 4PQHA 4NWYA 5LD0A 2VCWA 3ZFLA 2MMOA 2GQLA 5H5SA 3C1RA 4HZ2A 5CRGA 3KXOA 5G5EA 3QD9A 4YQMA 3TCOA 4Z7XA 1M9AA 1GLQA 4EIPA 2PBJA 4YKGA 1TRSA 2LTKA 4IN0A 1A24A 2HZEA 1Y6EA 2FUG2 4RI7A 3E3EA 2V41A 5D73A 3BD2A 1O7UA 1EOGA 1OC3A 4HEA2 4GRFA 4N0VA 3MIXA 2CAQA 1KEBA 2WB9A 2H1GA 3MDKA 2HT9A 4K0NA 1WOUA 4ECJA 1AQVA 2RUFA 1G0TA 1BEDA 4IELA 4AJ7A 3D0ZA 1FO5A 1YJ6A 5G5FA 1VGLA 1SENA 2OBIA 1DSBA 5ABRA 3HY2A 2IMFA 2M46A 2IFQB 4BVXB 3APQA 2CZ2A 1HD2A 1NM3A 3Q6OA 1T4YA 2OACA 3IHGA 8GSSA 3IXRA 4MH2A 1I9DA 3LJRA 4AF2A 3HJPA 4EE0A 1ZOFA 3WYWA 3M0FA 4JR6A 2EC4A 1OC9A 1XWKA 1K3YA 4G0LA 4ZILA 5GZZB 1M9BA 1V58A 5IOWA 3SWLA 3F6FA 2NVLA 1CQHA 2C0FA 4IP1A 4EXJA 5D9WA 2H01A 4XS1A 4ZIJA 2I4AA 1G7EA 2GZPA 4KDYA 5IMVA 1M99A 2H74A 2M72A 4TN8A 4PNGA 2FWEA 1NHYA 4L5OA 4WEYA 4K5SA 6GSXA 1GH2A 5FHIA 1EGOA 3QFAC 4WBJA 2LUSA 2RM6A 3QOUA 2VIMA 3F4TA 4GCIA 4BPYA 3VPTA 2DC5A 2DJ3A 3NIVA 1G6YA 5F05A 2CT6A 3L0HA 1XWGA 4JEDA 2AUVA 3O76A 4OCEA 4TW5A 4WXTA 1SL2B 2OADA 4HJ2A 3Q18A 3ERWA 2K8SA 2E2MA 2XPEA 2G0FA 2YV7A 1HNBA 4K2XA 2H75A 4MPFA 2PUKC 3I9V2 4KDXA 5ECQB 5DQSA 3RHCA 3GSTA 2GT6A 2P5RA 2E0QA 4KX4A 3AY8A 4EF0A 3UBLA 4X43A 5EPFA 2CV4A 2LJAA 4HS1A 1Q4JA 3IRAA 2VLTA 2OJLA 2AB6A 3S9FA 2GTUA 3HJMA 3ISOA 4IJ3A 1YEPA 3TJBA 1GSDA 3C73A 1K0BA 3HDCA 4OMVA 4NAXA 2VLUA 2C4JA 1OE8A 5FT3A 2AHEA 2QKEA 1Z7PA 2PVQA 5ELGA 2JU5A 3E9JB 1QUWA 2LEGA 3GKMA 1PMTA 4ACSA 3L9UA 4X0XA 3C8EA 3GSSA 4I97A 3QFBC 3ZZXA 4G9HA 3TJGA 2DMMA 1GNEA 1WPIA 3HVVA 2YPMA 3DRNA 1EZKA 2R6KA 1EEJA 3MAKA 3G9BA 5JWRB 1OE7A 4BVYA 1GULA 4L8EA 1KNGA 2LJKA 1GTIA 4FYBA 5F8BA 4CY8A 1U87A 2PVOC 1V9WA 1PL2A 3ED3A 1YKAA 3P90A 1BAYA 1V57A 1R5PA 2FWFA 3UVTA 3KMOA 5B7CA 5INYA 4KGIA 5ECMB 3P7XA 2JSYA 4KSOA 3LW9A 1FB0A 2L5LA 1X0RA 3CMIA 4K6XA 2HFDA 4GWRA 1F37A 2VM2A 2H70A 2GLRA 2WFCA 4IQAA 1IYHA 6GSSA 3TKSC 1SD8A 14GSA 1JHBA 4G0KA 3BJ5A 3LQ7A 3IC4A 4Q5RA 4O32A 4V1Ag 4MA9A 4JU5A 5D96A 3GKKA 2YOIA 3CTGA 2PMTA 3HKRA 5IO2A 3IAM2 3HYPA 4GQFA 1JZWA 3TKQA 2FNOA 5AIVA 3GV1A 4K7NA 3PPUA 3QAGA 4NPBA 2ES7A 4LA1A 4ID0A 4TR0A 3L78A 3MWHA 3TKSA 4GXZA 5KOXA 5JCUA 4EDYA 5IMZA 1MTCA 2HLSA 2H1BA 2YJHA 1YY7A 3FMWA 2L6CA 4XS4A 1ZGNA 1RW1A 4HDEA 2DSAA 1PA3A 1PX6A 2N5FA 2WZ9A 3K8NA 4AJ8A 3TJJA 5HR3A 2FHEA 5IPHA 2LNTA 2DKIA 5G1LA 1PGTA 1PN0A 4MABA 4KCEA 5IMAA 2MYGA 5B8AA 5L71A 1K0MA 3HZ4A 1FB6A 1ZYPA 4ICYA 1TJDA 1K3OA 3VLNA 2F9SA 1TK5B 3BBYA 3DIEA 4X1UA 4LLRA 1A23A 2A2RA 4EUYA 2A4VA 1ZZYA 1ZL9A 2HI7A 2CVKA 4MZCA 1J0FA 2BTOT 4MZWA 5A5KA 3CSJA 3QCPA 2BJXA 4TXOA 1T7PB 4ECCA 3O6TA 2HRFA 1EGRA 2IMKA 4Z2UA 4BWQA 1I5GA 1VF2A 1HNAA 2B1LA 1HYUA 4OD7A 3VWWA 2KP2A 2J23A 4MJCA 5JWQB 2YN1A 3KP8A 2DMLA 2C8UA 3TKPA 5FWGA 1XOBA 5ECHB 3G7JA 2IWTA 1TK0B 4DSRA 2H6ZA 3CXGA 1R7HA 4V2NA 3CSIA 2P5QA 3F4SA 2XBQA 2E7PA 3IAS2 3KJYA 4I2TA 1ZCPA 3LEFA 2X8GA 2OE1A 4CY6A 2H76A 5D9XA 2QSIA 5D8IA 1U3AA 1SL1B 4FYUA 2C1YA 1BQ7A 1WJKA 5DDLA 1GUHA 20GSA 3KGKA 2YCDA 4TKYA 2VCXA 5D9TA 2KOKA 1A0RP 5DCHA 1O8XA 4MJBA 3GKXA 2KUCA 4V2MA 3TKRA 1MDIA 1MEKA 2LKUA 1V40A 4OWYA 1AQXA 4RI6A 2YWIA 2V6OA 2H30A 4KDUA 1KTEA 2XC2A 1OAZA 1SK2A 3F8UA 5J5NA 3QAVA 1GL8A 3QDNA 3VWVA 3F6DA 4V2LA 2ZCTA 3HA9A 5DJLA 3RPPA 3H93A 4HOJA 3QAWA 2GSQA 1SYRA 5HR2A 5CAXA 3A2XA 3N5OA 4OFNA 1TRWA 1PKZA 1B48A 1F3BA 2I1UA 1G6WA 2VL2C 3H4KA 1M2AA 2H19A 5IMFA 2X64A 1WMJA 1DE1A 3TOTA 4J57E 4IQ1A 2MBTA 1M2DA 3IV4A 4G19A 2HRNA 4Z2RA 3QPMA 3RBTA 5LCZA 5KOWA 4EC0A 1S3AA 3W8JA 2WS2A 2VL2A 5ELAA 3APOA 2LRNA 1XWAA 4BA7A 4HU9A 1TOFA 2AV4A 4BL7A 2N5AA 4F2IA 1GSQA 1WWJA 5ECPB 1Z5YE 1FOVA 3VI7A 4PQ1A 2NPBA 2WJUA 3M3MA 3FEUA 2ON7A 3G7IA 10GSA 5BRTA 4IS0A 2L4QA 1K0CA 2GQMA 1NW2A 3VK9A 2N5BA 3APSA 2VM1A 4PGTA 3VI5A 1AIUA 2L4CA 3WGXA 3EMXA 5B6NA 1XVQA 1MDKA 4ZBAA 1R5AA 1W89A 2PGTA 2GZYA 3D4TA 1J08A 4GTUA 2GT5A 6GSUA 2A2PA 4MJEA 1GTUA 5ID2B 1GSUA 4TR4A 1A2LA 1S3DA 2JSZA 2GQKA 2CVBA 1U6TA 1YZXA 3J7Yb 1T4ZA 1OC8A 2GDRA 1XOAA 2JZTA 3GHAA 3GL3A 5ECSA 2L6DA 1NHOA 3H1NA 5B8BA 4GSNA 5KEJA 3DD3A 2O87A 1ERVA 5JCWA 2HZEB 1XBSA 1SJIA 1QK8A 2VLVA 3U6VA 4WR5A 2ZNMA 4HZ4A 2H6XA 4K8MA 1YDKA 2REMA 4BL7B 3KTLA 2FGXA 5C00A 3UOMA 1GSEA 1B4PA 4MPGA 4O5RA 2DJ1A 3SBCA 3DVWA 3V1WA 1QGVA 2UZ8A 3I6AA 1SJZA 3FR9A 2CX4A 3LFLA 3KZQA 1MDJA 3CYNA 3KD0A 4XRDA 1E6BA 2QGVA 2HSHA 3NZNA 5B6MA 1XW6A 2LJRA 1Z6MA 1EP8A 5LNKe 4AGSA 1Y25A 3ZRDA 5GSTA 4HQSA 4KB3A 2DLXA 4ZL7A 3KEBA 2F3MA 3HD5A 2F8AA 3IR4A 4HQZA 1ML6A 2JZRA 3UL3A 5IPGA 4F03A 1YF0A 1EP7A 2FCHA 1GSYA 5CRHA 2X4AA 1OC9B 2V6KA 1GUKA 4PUAA 5EL8A 3CBUA 1GRXA 1TI1A 4WKWA 1ST9A 3P2AA 3GMFA 3KTBA 3VPQA 2B5EA 3GX0A 3US3A 5C04A 4MP4A 4NV2A 1AC1A 1GUMA 3KH9A 4Q5FA 1J9BA 1Z7RA 5J41A 1AAZA 2WGRA 4MF7A 1B9YC 5EVOA 2DJ2A 3KIJA 2PU9C 1XFLA 1GTAA 3UAPA 3ZFBA 4K7OA 2LQOA 1OKTA 3GFKA 1C72A 1FW1A 2K9FA 3C71A 3FR6A 2GVPA 2RLIA 3A5IA 2H6YA 3DKSA 2H72A 3TGZA 3EU3A 3FZ4A 1DBYA 4D73A 1DUGA 2K6VA 2QA2A 4K2DA 4LMWA 3VWUA 2KLXA 1F9MA 1Z3EA 3A5WA 2FA8A 3W8SA 4H86A 1AXDA 4PQIA 2P0GA 4KAEA 4POLA 3RPNA 1FVJA 3UIWA 2H1AA 1ON4A 2GS3A 2MZCA 3QMXA 5J9BA 4TVEA 1ZYQB 2JADA 2P31A 3UVHA 4EKZA 3PINA 4L5LA 4DSSA 2ON5A 3E0UA 2R37A 3MSZA 4KUNA 4EVMA 2IJYA 3WGDA 2YJ7A 3LYKA 1M2BA 4O5UA 4IVFA 4POBA 2RIIA 4EIQA 1H75A 2L5OA 3F9UA 3D4MA 5DALA 5A4WA 1OVNA 3GNJA 3KH7A 4K9ZA 2R0PA 2H0IA 3WT2A 3DMLA 3VWXA 3H8QA 2O85A 4OFTA 4DEJA 4PX1A 3ZMKA 2C3TA 2HSMA 3UBKA 1K0NA 1X5DA 1A8LA 3CRUA 3GTUA 4KCAA 5ECNB 3EURA 1MD4A 2X8CA 2IN3A 1RQMA 4MK3A 4ECIA 3A2WA 1XWCA 5JCGA 2H0GA 1UC7A 4BVYB 6GSVA 4IW9A 4QL9A 4PURA 1XZOA 1FAAA 2TIRA 2MMNA 3FHKA 1A8YA 3IPZA 2GGTA 2YV9A 4XS6A 2G2QA 1F3AA 4TR1A 3G7YA 1PKWA 1Z6NA 1B9XC 5IMDA 3IOSA 4YH2A 1O81A 3I69A 4USSA 4JRRA 4JR4A 5DJMA 3Q19A 2LNSA 4EL1A 1TTZA 1XXUA 4G0IA 2FY6A 4TRXA 4G2EA 4WF4A 4CHSA 3D5JA 4GSSA 1B4QA 4NHWA 1EV9A 3FYGA 2O89A 5H5QA 3TJKA 2HSYA 3CRTA 2MMAA 4MLYA 3L9SA 3M9JA 2H8LA 2B1KA 1FOHA 2YWNA 1GP1A 2GZZA 3KMNA 2DJJA 4XHMA 4FQUA 5CYYA 4AJ6A 1V2AA 1K0AA 4ZBBA 4O92A 2YZHA 2D2ZA 3LWAA 2FD3A 2H71A 2HRKA 3H79A 1FHEA 4HU7A 3ZMLA 5JWOB 1XPVA 3TUEA 2L57A 3GX8A 4L0UA 3MNGA 1SK1A 2HE3A 4MCUA 1QFNA 2OBKA 3HJOA 3WD6A 5COHA 4KSMA 4XS4B 2VAFA 3HVXA 1TW9A 3ME7A 1MD3A 2L59A 3N9JA 4WR4A 3KCMA 2OKAA 1X9MB 5G2ZA 1CQGA 2R4VA 3L4NA 5E4WA 2CA8A 4A5PA 2PPTA 2H73A 3IBHA 4K1FA 5GSSA 5AN1A 3L9VA 2R2JA 4Z2TA 4IKHA 3TKSE 1ERUA 1VF1A 1O6JA 4FIWA 2BMXA 4PNFA 1ZYNA 3GL5A 3I43A 1PQNA 5ECLB 3GH6A 2TRCP 4XCSA 1BYEA 4XRAA 1THOA 2E2GA 4K0GA 2B6MA 3LGCA 1G7OA 4EDZA 2KHPA 2B3SA 4OCFA 4TXOB 4F82A 5HFGA 1LJRA 4YAVA 2IPAA 1TKDB 2PWJA 1W4VA 1AW9A 2J9HA 2YWMA 2ALBA 1VF3A 2HZFA 4BVXA 4IJIA 2MMZA 2B7KA 1GTBA 3TJFA 3ZVJD 4ZBDA 4E8HA 1U3IA 4POMA 3TRQA 2DBCA 3O3TA 4KH7A 3FRCA 2LRCA 1SKSB 2NBSA 3IC8A 3GURA 3DEXA 1F2EA 1USBA 4MDCA 3LSZA 2QC7A 1WP0A 2VUPA 1TP9A 2R0GA 3HXSA 1XW5A 1SU9A 3GIXA 13GSA 3VURA 3ERFA 1HQOA 3TRPA 5E59A 2I81A 5DAKA 3C1SA 4LL4B 4GLTA 6GSYA 3LG6A 3EMPA 4N30A 4MMMA 1TRUA 4WETA 2CVDA 1BJXA 4EO3A 1O73A 5BMUA 3ME8A 3ZVJA 2XHFA 17GSA 1WRYA 4LMVA 3P8WA 4F0BA 2IMEA 2IL3A 1SL0B 4RQXA 2VL3A 3FZ9A 4YQUA 3A2VA 3F4RA 3WGEA 4QQ7A 1PRXA 3FW2A 2OE3A 2ZUPA 3EU4A 2DJKA 4O7HA 1FVKA 4OO5A 1SK0A 1YKCA 5AISA 3C7MA 5AIXA 2XPDA 4ZB9A 5ECIB 2QA1A 4O5QA 1R4WA 1TI3A 3IK9A 4Q5QA 5G31A 2AAWA 1SKRB 5F06A 1VRSD 2VD0A 2WRTA 2HXKA 4JBBA 2VCZA 1TXXA 2YWOA 5G1KA 2O7KA 3GUSA 5CO3A 4K7IA 3M8NA 3ZYWA 4QL7A 5CNWA 2WDUA 2OA7A 3R3EA 1QQ2A 5D9VA 5KN3A 2GSRA 1XIYA 2V1MA 5CREA 1M7TA 3LXZA 1TRVA 4GSTA 3PH9A 3VFIA 2EIQA 2F51A 7GSSA 1JZRA 5CP1A 3UMAA 4MF5A 4ULXA 3Q74A 5DAKB 1YEXA 3KM6A 5HQPA 5GAPD 2F8FA 4ZB6A 2M80A 3ZLPA 4KNDA 3R2QA 4NXIA 3LXTA 2AYTA 5J4UA 2Z9SA 4XIHA 5D93A 3OR5A 2LSTA 4ML6A 1SD9A 2VCQA 1XW9A 3CSHA 5DQYA 1ILOA 4POKA 3FZ5A 3DXBA 3UEMA 2H0HA 5ECKB 3U5RE 2B5YA 4NV5A 4IGJA 1JZDA 3FZAA 4YKFA 1PX7A 4JZQA 1E2YA 1EV4A 4NHZA 3QR6A 3UARA 3ERGA 3M9KA 1O8WA 22GSA 12GSA 2K8VA 3TRXA 4ZL9A 3DVXA 2B7JA 5ENUA 1AUCA 2FA4A 2WCIA 2CX3A 1RK4A 2HNLA 3F3QA 4N10A 2C0DA 3D22A 4MZBA 5ECOB 4FO5A 3LYPA 3IHQA 1K0DA 1XCCA 3EVIA 1PSQA 1IYIA 3IA1A 4BWSA 3EPTA 4ISDA 5HR0A 1THXA 3RAZA 4KA0A 19GSA 4I2UA 4N0ZA 1YF1A 2R3XA 2V2GA 4GQCA 2R5GA 3IDVA 4ZB8A 1X9SB 2WULA 1X5EA 2X49A 1V98A 4MNNA 1HNCA 4E8EA 3HVSA 2DIZA 4GF0A 4OO4A 4TXVA 2JL4A 1ACVA 2KP1A 1T1VA 5G30A 2VL9A 4ZL8A 1YQ1A 1X5CA 3RHBA 5DVBA 2YNXA 5F07A 3EE2A 4XTSA 2CAIA 3ZIJA 6GSTA 3NOFA 1LBKA 5HR1A 2VCVA 4FH8A 4HI7A 4TOPA 2YZUA 4RUVA 5KN0A 6GSWA 4V1Ap 3KP9A 1LU4A 3M1GA 3TDGA 1URMA 2YP6A 1VF4A 3EC3A 1A2MA 3HZ8A 2JZSA 2VCTA 2NDOA 2PERA 4MJAA 4IHUA 1JFUA 3FK8A 5J9CA 2FLSA 3GYKA 1N2AA 5DBQA 1K3LA 2C3NA 3BOAA 5IMCA 3D21A 5CRDA 2FWHA 4ECBA 1UVZA 3EYTA 4WF5A 5A4UA 1GLPA 3LORA 2C3QA 4I6XA 1ERWA 4FYCA 1QMVA 2I3YA 3PGTA 1F6MC 3J7Yk 2X99A 3CTFA 5HFIA 1X9WB 1T3BA 2C80A 4X4JA 1U88A 3GA4A 4CDOA 3HCZA 3PR8A 4PUFC 1BG5A 5IQYA 4N11A 2FWGA 2TRXA 1KBNA 1EOHA 3GRXA 3ZREA 2OE0A 3GKNA 9GSSA 4PXOA 2LV3A 4D73B 3DYRA 3FY7A 4F0CA 1PL1A 1XVWA 3A3TA 1ZYEA 3ZL5A 2GSSA 1WIKA 4J56E 4I5QA 1T8EB 1ABAA 5IM9A 1SJ6A 5J3RA 3F3RA 5KN1A 4PTSA 3F0IA 1ZMAA 2VOCA 4YAPA 3F63A 2IMDA 1N8JA 1ERTA 1K0OA 4RQRA 2MBSA 1TK8B 2A2SA 4HUAA 1TU8A 3MYDA 3TB2A 4Q5NA 1A0FA 2NTOA 4KF9A 4G10A 4DSSB 1EEMA 1GSFA 1QXHA 11GSA 5A4VA 1H4OA 4LL1B 1JLVA 2GSTA 5EY6A 2JACA 2RM5A 4L0WA 1XWBA 5IIZA 3W6GA 1T00A 4JE1A 1Z9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJM A;  2EIO A;  4P3Y B;  5H5R A;  5HFK A;  3TOU A;  2LQQ A;  5DAL B;  1EWX A;  1FG4 A;  1GNW A;  3RDW A;  2HYX A;  5DCG A;  1AQW A;  4CW9 A;  3ZIV A;  3BCI A;  4DSQ A;  4IBP A;  4KW6 A;  2O8V B;  1OYJ A;  2CZ3 A;  3GTU B;  2VD1 A;  2V32 A;  1TU7 A;  2XBI A;  3BCK A;  1JLW A;  3ZIT A;  3GH9 A;  3JCM L;  4I8B A;  2PN8 A;  5AGY A;  3WT1 A;  3IK7 A;  4J2F A;  4NMU A;  1Q98 A;  4IP6 A;  2H66 A;  4WBR D;  1OKD A;  4DVC A;  3FKF A;  1GWC A;  2LS5 A;  1S3C A;  2C0E A;  1A2J A;  1B8X A;  4F9Z A;  3DGQ A;  2I9H A;  4TR1 B;  1PD2 1;  2X8H A;  2LRT A;  4YQV A;  5ECR B;  2CQ9 A;  3UJ1 A;  5GAN D;  3ZTL A;  5IO0 A;  1M0U A;  1DE2 A;  5CRW A;  3DWV A;  16GS A;  3EIN A;  2DIY A;  2YAN A;  2K18 A;  4ML1 A;  4ILF A;  2H1D A;  5F0G A;  4OFM A;  5IOX A;  1NSW A;  1R26 A;  2IMI A;  4TR3 A;  2VO4 A;  1BX9 A;  5KN2 A;  2EIR A;  18GS A;  4KE3 A;  1SKW B;  2AJQ B;  3D6I A;  3HHV A;  1PN9 A;  2IFQ A;  4MF6 A;  2C0G A;  3FR3 A;  4MH3 A;  1UN2 A;  1O85 A;  1GSS A;  1UA5 A;  4ZXG A;  5ID2 A;  3IE3 A;  2B5X A;  3EWL A;  2IIY A;  2DJ0 A;  1TDI A;  2RUE A;  3GN3 A;  1WE0 A;  1SYX A;  1JZO A;  4PQH A;  4NWY A;  5LD0 A;  2VCW A;  3ZFL A;  2MMO A;  2GQL A;  5H5S A;  3C1R A;  4HZ2 A;  5CRG A;  3KXO A;  5G5E A;  3QD9 A;  4YQM A;  3TCO A;  4Z7X A;  1M9A A;  1GLQ A;  2PBJ A;  1TRS A;  2LTK A;  4IN0 A;  1A24 A;  2HZE A;  1Y6E A;  2FUG 2;  4RI7 A;  3E3E A;  2V41 A;  5D73 A;  3BD2 A;  1O7U A;  1EOG A;  1OC3 A;  4HEA 2;  4GRF A;  4N0V A;  2CAQ A;  1KEB A;  2WB9 A;  2H1G A;  3MDK A;  2HT9 A;  4K0N A;  1WOU A;  4ECJ A;  1AQV A;  2RUF A;  1G0T A;  1BED A;  4IEL A;  4AJ7 A;  3D0Z A;  1FO5 A;  1YJ6 A;  5G5F A;  1VGL A;  1SEN A;  2OBI A;  1DSB A;  5ABR A;  3HY2 A;  2IMF A;  2M46 A;  2IFQ B;  3APQ A;  2CZ2 A;  1HD2 A;  1NM3 A;  3Q6O A;  1T4Y A;  2OAC A;  8GSS A;  3IXR A;  4MH2 A;  1I9D A;  3LJR A;  4AF2 A;  3HJP A;  4EE0 A;  1ZOF A;  3WYW A;  3M0F A;  4JR6 A;  2EC4 A;  1OC9 A;  1XWK A;  1K3Y A;  4ZIL A;  5GZZ B;  1M9B A;  1V58 A;  5IOW A;  3SWL A;  3F6F A;  2NVL A;  1CQH A;  2C0F A;  4IP1 A;  4EXJ A;  5D9W A;  2H01 A;  4XS1 A;  4ZIJ A;  2I4A A;  1G7E A;  2GZP A;  4KDY A;  5IMV A;  1M99 A;  2H74 A;  2M72 A;  4TN8 A;  4PNG A;  2FWE A;  1NHY A;  4L5O A;  4WEY A;  6GSX A;  1GH2 A;  5FHI A;  1EGO A;  3QFA C;  4WBJ A;  2LUS A;  2RM6 A;  3QOU A;  2VIM A;  3F4T A;  4GCI A;  4BPY A;  3VPT A;  2DC5 A;  2DJ3 A;  3NIV A;  1G6Y A;  5F05 A;  2CT6 A;  3L0H A;  1XWG A;  4JED A;  2AUV A;  3O76 A;  4OCE A;  4TW5 A;  4WXT A;  1SL2 B;  2OAD A;  4HJ2 A;  3Q18 A;  3ERW A;  2K8S A;  2E2M A;  2XPE A;  2G0F A;  2YV7 A;  1HNB A;  2H75 A;  4MPF A;  2PUK C;  3I9V 2;  4KDX A;  5ECQ B;  5DQS A;  3RHC A;  3GST A;  2GT6 A;  2P5R A;  2E0Q A;  4KX4 A;  3AY8 A;  4EF0 A;  3UBL A;  5EPF A;  4X43 A;  2CV4 A;  2LJA A;  4HS1 A;  1Q4J A;  3IRA A;  2VLT A;  2OJL A;  2AB6 A;  3S9F A;  2GTU A;  3HJM A;  3ISO A;  4IJ3 A;  1YEP A;  3TJB A;  1GSD A;  3C73 A;  1K0B A;  3HDC A;  4OMV A;  4NAX A;  2VLU A;  2C4J A;  1OE8 A;  5FT3 A;  2AHE A;  2QKE A;  1Z7P A;  2PVQ A;  5ELG A;  2JU5 A;  3E9J B;  1QUW A;  2LEG A;  3GKM A;  1PMT A;  4ACS A;  3L9U A;  4X0X A;  3C8E A;  3GSS A;  4I97 A;  3QFB C;  3ZZX A;  4G9H A;  3TJG A;  2DMM A;  1GNE A;  1WPI A;  3HVV A;  2YPM A;  3DRN A;  1EZK A;  2R6K A;  1EEJ A;  3MAK A;  3G9B A;  5JWR B;  1OE7 A;  4BVY A;  1GUL A;  4L8E A;  1KNG A;  2LJK A;  1GTI A;  4FYB A;  5F8B A;  1U87 A;  2PVO C;  1V9W A;  1PL2 A;  3ED3 A;  1YKA A;  3P90 A;  1BAY A;  1V57 A;  1R5P A;  2FWF A;  3UVT A;  3KMO A;  5B7C A;  5INY A;  4KGI A;  5ECM B;  3P7X A;  2JSY A;  4KSO A;  1FB0 A;  2L5L A;  1X0R A;  3CMI A;  4K6X A;  2HFD A;  4GWR A;  1F37 A;  2VM2 A;  2H70 A;  2GLR A;  2WFC A;  4IQA A;  1IYH A;  6GSS A;  3TKS C;  1SD8 A;  14GS A;  1JHB A;  3BJ5 A;  3LQ7 A;  3IC4 A;  4O32 A;  4Q5R A;  4V1A g;  4MA9 A;  4JU5 A;  5D96 A;  3GKK A;  2YOI A;  3CTG A;  2PMT A;  3HKR A;  5IO2 A;  3IAM 2;  3HYP A;  4GQF A;  1JZW A;  3TKQ A;  2FNO A;  5AIV A;  3GV1 A;  4K7N A;  3QAG A;  4NPB A;  2ES7 A;  4LA1 A;  4ID0 A;  4TR0 A;  3L78 A;  3MWH A;  3TKS A;  4GXZ A;  5JCU A;  4EDY A;  5IMZ A;  1MTC A;  2HLS A;  2H1B A;  2YJH A;  1YY7 A;  2L6C A;  4XS4 A;  1ZGN A;  1RW1 A;  4HDE A;  2DSA A;  1PA3 A;  1PX6 A;  2N5F A;  2WZ9 A;  3K8N A;  4AJ8 A;  3TJJ A;  5HR3 A;  2FHE A;  5IPH A;  2LNT A;  5G1L A;  1PGT A;  4MAB A;  4KCE A;  5IMA A;  2MYG A;  5B8A A;  5L71 A;  1K0M A;  3HZ4 A;  1FB6 A;  1TJD A;  1K3O A;  3VLN A;  2F9S A;  1TK5 B;  3BBY A;  3DIE A;  4X1U A;  4LLR A;  1A23 A;  2A2R A;  4EUY A;  2A4V A;  1ZZY A;  1ZL9 A;  2HI7 A;  2CVK A;  4MZC A;  1J0F A;  2BTO T;  4MZW A;  5A5K A;  3CSJ A;  3QCP A;  2BJX A;  4TXO A;  1T7P B;  4ECC A;  3O6T A;  2HRF A;  1EGR A;  2IMK A;  4BWQ A;  1I5G A;  1VF2 A;  1HNA A;  2B1L A;  1HYU A;  4OD7 A;  3VWW A;  2KP2 A;  2J23 A;  4MJC A;  5JWQ B;  2YN1 A;  3KP8 A;  2DML A;  2C8U A;  3TKP A;  5FWG A;  1XOB A;  5ECH B;  3G7J A;  2IWT A;  1TK0 B;  4DSR A;  2H6Z A;  3CXG A;  1R7H A;  4V2N A;  3CSI A;  2P5Q A;  3F4S A;  2XBQ A;  2E7P A;  3IAS 2;  3KJY A;  4I2T A;  1ZCP A;  3LEF A;  2X8G A;  2OE1 A;  2H76 A;  5D9X A;  2QSI A;  5D8I A;  1U3A A;  1SL1 B;  4FYU A;  2C1Y A;  1BQ7 A;  1WJK A;  5DDL A;  1GUH A;  20GS A;  3KGK A;  2YCD A;  4TKY A;  2VCX A;  5D9T A;  2KOK A;  1A0R P;  5DCH A;  1O8X A;  4MJB A;  3GKX A;  2KUC A;  4V2M A;  3TKR A;  1MDI A;  1MEK A;  2LKU A;  1V40 A;  4OWY A;  1AQX A;  4RI6 A;  2YWI A;  2V6O A;  2H30 A;  4KDU A;  1KTE A;  2XC2 A;  1OAZ A;  1SK2 A;  3F8U A;  5J5N A;  3QAV A;  1GL8 A;  3QDN A;  3VWV A;  3F6D A;  4V2L A;  2ZCT A;  3HA9 A;  5DJL A;  3RPP A;  3H93 A;  4HOJ A;  3QAW A;  2GSQ A;  1SYR A;  5HR2 A;  5CAX A;  3A2X A;  3N5O A;  4OFN A;  1TRW A;  1PKZ A;  1B48 A;  1F3B A;  2I1U A;  1G6W A;  2VL2 C;  3H4K A;  1M2A A;  2H19 A;  5IMF A;  2X64 A;  1WMJ A;  1DE1 A;  3TOT A;  4J57 E;  4IQ1 A;  2MBT A;  1M2D A;  3IV4 A;  4G19 A;  2HRN A;  3QPM A;  3RBT A;  5LCZ A;  4EC0 A;  1S3A A;  3W8J A;  2WS2 A;  2VL2 A;  5ELA A;  3APO A;  2LRN A;  1XWA A;  4BA7 A;  4HU9 A;  1TOF A;  2AV4 A;  4BL7 A;  2N5A A;  4F2I A;  1GSQ A;  1WWJ A;  5ECP B;  1Z5Y E;  1FOV A;  3VI7 A;  4PQ1 A;  2NPB A;  2WJU A;  3M3M A;  3FEU A;  2ON7 A;  3G7I A;  10GS A;  4IS0 A;  2L4Q A;  1K0C A;  2GQM A;  1NW2 A;  3VK9 A;  2N5B A;  3APS A;  2VM1 A;  4PGT A;  3VI5 A;  1AIU A;  2L4C A;  3WGX A;  3EMX A;  5B6N A;  1XVQ A;  1MDK A;  4ZBA A;  1R5A A;  1W89 A;  2PGT A;  2GZY A;  3D4T A;  1J08 A;  4GTU A;  2GT5 A;  6GSU A;  4MJE A;  1GTU A;  5ID2 B;  1GSU A;  4TR4 A;  1A2L A;  1S3D A;  2JSZ A;  2GQK A;  2CVB A;  1U6T A;  1YZX A;  3J7Y b;  1T4Z A;  1OC8 A;  2GDR A;  1XOA A;  2JZT A;  3GHA A;  3GL3 A;  5ECS A;  2L6D A;  1NHO A;  3H1N A;  5B8B A;  4GSN A;  5KEJ A;  3DD3 A;  2O87 A;  1ERV A;  5JCW A;  2HZE B;  1XBS A;  1SJI A;  1QK8 A;  2VLV A;  3U6V A;  4WR5 A;  2ZNM A;  4HZ4 A;  2H6X A;  4K8M A;  1YDK A;  2REM A;  3KTL A;  2FGX A;  5C00 A;  3UOM A;  1GSE A;  1B4P A;  4MPG A;  4O5R A;  2DJ1 A;  3SBC A;  3DVW A;  3V1W A;  1QGV A;  3I6A A;  1SJZ A;  3FR9 A;  2CX4 A;  3LFL A;  3KZQ A;  1MDJ A;  3CYN A;  3KD0 A;  4XRD A;  1E6B A;  2QGV A;  2HSH A;  3NZN A;  5B6M A;  1XW6 A;  2LJR A;  1Z6M A;  1EP8 A;  5LNK e;  4AGS A;  1Y25 A;  3ZRD A;  5GST A;  4HQS A;  4KB3 A;  2DLX A;  4ZL7 A;  3KEB A;  2F3M A;  3HD5 A;  2F8A A;  3IR4 A;  4HQZ A;  1ML6 A;  2JZR A;  3UL3 A;  5IPG A;  4F03 A;  1YF0 A;  1EP7 A;  2FCH A;  1GSY A;  5CRH A;  1OC9 B;  2V6K A;  1GUK A;  4PUA A;  5EL8 A;  3CBU A;  1GRX A;  1TI1 A;  4WKW A;  1ST9 A;  3P2A A;  3GMF A;  3KTB A;  3VPQ A;  2B5E A;  3GX0 A;  3US3 A;  5C04 A;  4MP4 A;  4NV2 A;  1AC1 A;  1GUM A;  3KH9 A;  4Q5F A;  1J9B A;  1Z7R A;  5J41 A;  1AAZ A;  2WGR A;  4MF7 A;  1B9Y C;  5EVO A;  2DJ2 A;  3KIJ A;  2PU9 C;  1XFL A;  1GTA A;  3UAP A;  3ZFB A;  4K7O A;  2LQO A;  1OKT A;  3GFK A;  1C72 A;  1FW1 A;  2K9F A;  3C71 A;  3FR6 A;  2GVP A;  2RLI A;  2H6Y A;  3DKS A;  2H72 A;  3TGZ A;  3EU3 A;  3FZ4 A;  1DBY A;  4D73 A;  1DUG A;  2K6V A;  4K2D A;  4LMW A;  3VWU A;  2KLX A;  1F9M A;  1Z3E A;  3A5W A;  2FA8 A;  3W8S A;  4H86 A;  1AXD A;  4PQI A;  2P0G A;  4KAE A;  4POL A;  3RPN A;  1FVJ A;  3UIW A;  2H1A A;  1ON4 A;  2GS3 A;  2MZC A;  3QMX A;  5J9B A;  4TVE A;  1ZYQ B;  2JAD A;  2P31 A;  3UVH A;  4EKZ A;  3PIN A;  4L5L A;  4DSS A;  2ON5 A;  3E0U A;  2R37 A;  3MSZ A;  4KUN A;  4EVM A;  2IJY A;  3WGD A;  2YJ7 A;  3LYK A;  1M2B A;  4IVF A;  4POB A;  2RII A;  1H75 A;  2L5O A;  3F9U A;  3D4M A;  5DAL A;  5A4W A;  1OVN A;  3GNJ A;  3KH7 A;  4K9Z A;  2H0I A;  3WT2 A;  3DML A;  3VWX A;  3H8Q A;  2O85 A;  4OFT A;  4DEJ A;  4PX1 A;  3ZMK A;  2C3T A;  3UBK A;  1K0N A;  1X5D A;  1A8L A;  3CRU A;  3GTU A;  4KCA A;  5ECN B;  3EUR A;  1MD4 A;  2X8C A;  2IN3 A;  1RQM A;  4MK3 A;  4ECI A;  3A2W A;  1XWC A;  5JCG A;  2H0G A;  1UC7 A;  6GSV A;  4IW9 A;  4QL9 A;  4PUR A;  1XZO A;  1FAA A;  2TIR A;  2MMN A;  3FHK A;  1A8Y A;  3IPZ A;  2GGT A;  2YV9 A;  4XS6 A;  2G2Q A;  1F3A A;  4TR1 A;  3G7Y A;  1PKW A;  1Z6N A;  1B9X C;  5IMD A;  3IOS A;  4YH2 A;  1O81 A;  3I69 A;  4JRR A;  4JR4 A;  5DJM A;  3Q19 A;  2LNS A;  4EL1 A;  1TTZ A;  1XXU A;  2FY6 A;  4TRX A;  4G2E A;  4WF4 A;  4CHS A;  3D5J A;  4GSS A;  1B4Q A;  4NHW A;  1EV9 A;  3FYG A;  2O89 A;  5H5Q A;  3TJK A;  2HSY A;  3CRT A;  2MMA A;  4MLY A;  3L9S A;  3M9J A;  2H8L A;  2B1K A;  2YWN A;  1GP1 A;  2GZZ A;  3KMN A;  2DJJ A;  4XHM A;  5CYY A;  4AJ6 A;  1V2A A;  1K0A A;  4ZBB A;  4O92 A;  2YZH A;  2D2Z A;  3LWA A;  2FD3 A;  2H71 A;  3H79 A;  1FHE A;  4HU7 A;  3ZML A;  5JWO B;  1XPV A;  3TUE A;  2L57 A;  3GX8 A;  4L0U A;  3MNG A;  1SK1 A;  2HE3 A;  4MCU A;  1QFN A;  2OBK A;  3HJO A;  3WD6 A;  5COH A;  4KSM A;  4XS4 B;  2VAF A;  3HVX A;  1TW9 A;  3ME7 A;  1MD3 A;  2L59 A;  3N9J A;  4WR4 A;  3KCM A;  2OKA A;  1X9M B;  5G2Z A;  1CQG A;  2R4V A;  3L4N A;  5E4W A;  2CA8 A;  2PPT A;  2H73 A;  3IBH A;  4K1F A;  5GSS A;  5AN1 A;  3L9V A;  2R2J A;  4IKH A;  3TKS E;  1ERU A;  1VF1 A;  1O6J A;  4FIW A;  2BMX A;  4PNF A;  3GL5 A;  3I43 A;  1PQN A;  5ECL B;  3GH6 A;  2TRC P;  4XCS A;  1BYE A;  4XRA A;  1THO A;  2E2G A;  4K0G A;  2B6M A;  3LGC A;  1G7O A;  4EDZ A;  2KHP A;  2B3S A;  4OCF A;  4TXO B;  4F82 A;  5HFG A;  1LJR A;  4YAV A;  2IPA A;  1TKD B;  2PWJ A;  1W4V A;  1AW9 A;  2J9H A;  2YWM A;  2ALB A;  1VF3 A;  2HZF A;  4BVX A;  4IJI A;  2MMZ A;  2B7K A;  1GTB A;  3TJF A;  3ZVJ D;  4ZBD A;  4E8H A;  1U3I A;  4POM A;  3TRQ A;  2DBC A;  3O3T A;  4KH7 A;  3FRC A;  2LRC A;  1SKS B;  2NBS A;  3GUR A;  3DEX A;  1F2E A;  1USB A;  4MDC A;  3LSZ A;  2QC7 A;  1WP0 A;  2VUP A;  1TP9 A;  3HXS A;  1XW5 A;  1SU9 A;  3GIX A;  13GS A;  3VUR A;  3ERF A;  1HQO A;  3TRP A;  5E59 A;  2I81 A;  5DAK A;  3C1S A;  4LL4 B;  4GLT A;  6GSY A;  3LG6 A;  3EMP A;  4N30 A;  4MMM A;  1TRU A;  4WET A;  2CVD A;  1BJX A;  4EO3 A;  1O73 A;  3ME8 A;  3ZVJ A;  2XHF A;  17GS A;  1WRY A;  4LMV A;  3P8W A;  4F0B A;  2IME A;  2IL3 A;  1SL0 B;  4RQX A;  2VL3 A;  3FZ9 A;  4YQU A;  3A2V A;  3F4R A;  3WGE A;  4QQ7 A;  1PRX A;  3FW2 A;  2OE3 A;  2ZUP A;  3EU4 A;  2DJK A;  4O7H A;  1FVK A;  4OO5 A;  1SK0 A;  1YKC A;  5AIS A;  3C7M A;  5AIX A;  2XPD A;  4ZB9 A;  5ECI B;  1R4W A;  1TI3 A;  3IK9 A;  4Q5Q A;  5G31 A;  2AAW A;  1SKR B;  5F06 A;  1VRS D;  2VD0 A;  2WRT A;  2HXK A;  4JBB A;  2VCZ A;  1TXX A;  2YWO A;  5G1K A;  2O7K A;  3GUS A;  5CO3 A;  4K7I A;  3M8N A;  3ZYW A;  4QL7 A;  5CNW A;  2WDU A;  2OA7 A;  1QQ2 A;  5D9V A;  5KN3 A;  2GSR A;  1XIY A;  2V1M A;  5CRE A;  1M7T A;  3LXZ A;  1TRV A;  4GST A;  3PH9 A;  3VFI A;  2EIQ A;  2F51 A;  7GSS A;  1JZR A;  5CP1 A;  3UMA A;  4MF5 A;  4ULX A;  3Q74 A;  5DAK B;  1YEX A;  3KM6 A;  5HQP A;  5GAP D;  2F8F A;  4ZB6 A;  2M80 A;  3ZLP A;  4KND A;  3R2Q A;  4NXI A;  3LXT A;  2AYT A;  5J4U A;  2Z9S A;  4XIH A;  5D93 A;  3OR5 A;  2LST A;  4ML6 A;  1SD9 A;  2VCQ A;  1XW9 A;  3CSH A;  5DQY A;  1ILO A;  4POK A;  3FZ5 A;  3DXB A;  3UEM A;  2H0H A;  5ECK B;  3U5R E;  2B5Y A;  4NV5 A;  4IGJ A;  1JZD A;  3FZA A;  1PX7 A;  4JZQ A;  1E2Y A;  1EV4 A;  4NHZ A;  3QR6 A;  3UAR A;  3ERG A;  3M9K A;  1O8W A;  22GS A;  12GS A;  2K8V A;  3TRX A;  4ZL9 A;  3DVX A;  2B7J A;  5ENU A;  1AUC A;  2FA4 A;  2WCI A;  2CX3 A;  1RK4 A;  2HNL A;  3F3Q A;  4N10 A;  2C0D A;  3D22 A;  4MZB A;  5ECO B;  4FO5 A;  3LYP A;  3IHQ A;  1K0D A;  1XCC A;  3EVI A;  1PSQ A;  1IYI A;  3IA1 A;  4BWS A;  4ISD A;  5HR0 A;  1THX A;  3RAZ A;  4KA0 A;  19GS A;  4I2U A;  4N0Z A;  1YF1 A;  2R3X A;  2V2G A;  4GQC A;  2R5G A;  3IDV A;  4ZB8 A;  1X9S B;  2WUL A;  1X5E A;  1V98 A;  1HNC A;  4E8E A;  3HVS A;  2DIZ A;  4GF0 A;  4OO4 A;  4TXV A;  2JL4 A;  1ACV A;  2KP1 A;  1T1V A;  5G30 A;  2VL9 A;  4ZL8 A;  1YQ1 A;  1X5C A;  3RHB A;  5DVB A;  2YNX A;  5F07 A;  3EE2 A;  2CAI A;  4XTS A;  3ZIJ A;  6GST A;  3NOF A;  1LBK A;  5HR1 A;  2VCV A;  4FH8 A;  4HI7 A;  4TOP A;  2YZU A;  4RUV A;  5KN0 A;  6GSW A;  4V1A p;  3KP9 A;  1LU4 A;  3M1G A;  3TDG A;  1URM A;  2YP6 A;  1VF4 A;  3EC3 A;  1A2M A;  3HZ8 A;  2JZS A;  2VCT A;  2NDO A;  2PER A;  4MJA A;  4IHU A;  1JFU A;  3FK8 A;  5J9C A;  2FLS A;  3GYK A;  1N2A A;  5DBQ A;  1K3L A;  2C3N A;  3BOA A;  5IMC A;  3D21 A;  5CRD A;  2FWH A;  4ECB A;  1UVZ A;  3EYT A;  4WF5 A;  5A4U A;  1GLP A;  3LOR A;  2C3Q A;  4I6X A;  1ERW A;  4FYC A;  1QMV A;  2I3Y A;  3PGT A;  1F6M C;  3J7Y k;  2X99 A;  3CTF A;  5HFI A;  1X9W B;  1T3B A;  2C80 A;  1U88 A;  3GA4 A;  4CDO A;  3HCZ A;  3PR8 A;  4PUF C;  1BG5 A;  5IQY A;  4N11 A;  2FWG A;  2TRX A;  1KBN A;  1EOH A;  3GRX A;  3ZRE A;  2OE0 A;  3GKN A;  9GSS A;  4PXO A;  2LV3 A;  4D73 B;  3DYR A;  3FY7 A;  4F0C A;  1PL1 A;  1XVW A;  3A3T A;  1ZYE A;  3ZL5 A;  2GSS A;  1WIK A;  4J56 E;  4I5Q A;  1T8E B;  1ABA A;  5IM9 A;  1SJ6 A;  5J3R A;  3F3R A;  5KN1 A;  3F0I A;  1ZMA A;  2VOC A;  4YAP A;  3F63 A;  2IMD A;  1N8J A;  1ERT A;  1K0O A;  4RQR A;  2MBS A;  1TK8 B;  2A2S A;  4HUA A;  1TU8 A;  3TB2 A;  4Q5N A;  1A0F A;  2NTO A;  4G10 A;  4DSS B;  1EEM A;  1GSF A;  1QXH A;  11GS A;  5A4V A;  1H4O A;  4LL1 B;  1JLV A;  2GST A;  5EY6 A;  2JAC A;  2RM5 A;  4L0W A;  1XWB A;  5IIZ A;  3W6G A;  1T00 A;  4JE1 A;  1Z9H A; 
#chains in the Genus database with same CATH topology
 4HJM A;  2EIO A;  4P3Y B;  5H5R A;  5HFK A;  3TOU A;  2LQQ A;  5DAL B;  1EWX A;  1FG4 A;  1GNW A;  3RDW A;  2HYX A;  2HRA A;  5DCG A;  1AQW A;  4CW9 A;  3ZIV A;  3BCI A;  4DSQ A;  4IBP A;  4KW6 A;  2O8V B;  1OYJ A;  2CZ3 A;  3GTU B;  2VD1 A;  2V32 A;  2DKH A;  1TU7 A;  2XBI A;  3BCK A;  1JLW A;  3ZIT A;  3GH9 A;  3JCM L;  4I8B A;  2PN8 A;  5AGY A;  3WT1 A;  3IK7 A;  4J2F A;  4NMU A;  1Q98 A;  4K5R A;  4IP6 A;  2H66 A;  4WBR D;  2R0C A;  1OKD A;  1S3R A;  4DVC A;  3FKF A;  1GWC A;  2LS5 A;  1S3C A;  2C0E A;  1A2J A;  1B8X A;  4F9Z A;  3DGQ A;  2I9H A;  4TR1 B;  1PD2 1;  2X8H A;  2LRT A;  4YQV A;  5ECR B;  2CQ9 A;  3UJ1 A;  5GAN D;  3ZTL A;  5IO0 A;  1M0U A;  1DE2 A;  5CRW A;  3DWV A;  16GS A;  3EIN A;  2DIY A;  2YAN A;  2K18 A;  4ML1 A;  4ILF A;  2H1D A;  5F0G A;  4OFM A;  5IOX A;  1NSW A;  1R26 A;  2IMI A;  4TR3 A;  2VO4 A;  1BX9 A;  5KN2 A;  2EIR A;  18GS A;  4KE3 A;  1SKW B;  2AJQ B;  3D6I A;  3HHV A;  1PN9 A;  2IFQ A;  4MF6 A;  2C0G A;  3FR3 A;  4MH3 A;  1UN2 A;  1O85 A;  1GSS A;  1UA5 A;  4ZXG A;  5ID2 A;  3IE3 A;  2B5X A;  3EWL A;  2A4H A;  2IIY A;  2DJ0 A;  1TDI A;  2RUE A;  3GN3 A;  1WE0 A;  1SYX A;  1JZO A;  4PQH A;  4NWY A;  5LD0 A;  2VCW A;  3ZFL A;  2MMO A;  2GQL A;  5H5S A;  3C1R A;  4HZ2 A;  5CRG A;  3KXO A;  5G5E A;  3QD9 A;  4YQM A;  3TCO A;  4Z7X A;  1M9A A;  1GLQ A;  4EIP A;  2PBJ A;  4YKG A;  1TRS A;  2LTK A;  4IN0 A;  1A24 A;  2HZE A;  1Y6E A;  2FUG 2;  4RI7 A;  3E3E A;  2V41 A;  5D73 A;  3BD2 A;  1O7U A;  1EOG A;  1OC3 A;  4HEA 2;  4GRF A;  4N0V A;  3MIX A;  2CAQ A;  1KEB A;  2WB9 A;  2H1G A;  3MDK A;  2HT9 A;  4K0N A;  1WOU A;  4ECJ A;  1AQV A;  2RUF A;  1G0T A;  1BED A;  4IEL A;  4AJ7 A;  3D0Z A;  1FO5 A;  1YJ6 A;  5G5F A;  1VGL A;  1SEN A;  1M3J A;  2OBI A;  1DSB A;  5ABR A;  3HY2 A;  2IMF A;  2M46 A;  2IFQ B;  4BVX B;  3APQ A;  2CZ2 A;  1HD2 A;  1NM3 A;  3Q6O A;  1T4Y A;  2OAC A;  3IHG A;  8GSS A;  3IXR A;  4MH2 A;  1I9D A;  3LJR A;  4AF2 A;  3HJP A;  4EE0 A;  1ZOF A;  3WYW A;  3M0F A;  4JR6 A;  2EC4 A;  1OC9 A;  1XWK A;  1K3Y A;  4G0L A;  4ZIL A;  5GZZ B;  1M9B A;  1V58 A;  5IOW A;  3SWL A;  3F6F A;  2NVL A;  1CQH A;  2C0F A;  4IP1 A;  4EXJ A;  5D9W A;  2H01 A;  4XS1 A;  4ZIJ A;  2I4A A;  1G7E A;  2GZP A;  4KDY A;  5IMV A;  1M99 A;  2H74 A;  2M72 A;  4TN8 A;  4PNG A;  2FWE A;  1NHY A;  4L5O A;  4WEY A;  4K5S A;  6GSX A;  1GH2 A;  5FHI A;  1EGO A;  3QFA C;  4WBJ A;  2LUS A;  2RM6 A;  3QOU A;  2VIM A;  3F4T A;  4GCI A;  4BPY A;  3VPT A;  2DC5 A;  2DJ3 A;  3NIV A;  1G6Y A;  5F05 A;  2CT6 A;  3L0H A;  1XWG A;  4JED A;  2AUV A;  3O76 A;  4OCE A;  4TW5 A;  4WXT A;  1SL2 B;  2OAD A;  4HJ2 A;  3Q18 A;  3ERW A;  2K8S A;  2E2M A;  2XPE A;  2G0F A;  2YV7 A;  1HNB A;  4K2X A;  2H75 A;  4MPF A;  2PUK C;  3I9V 2;  4KDX A;  5ECQ B;  5DQS A;  3RHC A;  3GST A;  2GT6 A;  2P5R A;  2E0Q A;  4KX4 A;  3AY8 A;  4EF0 A;  3UBL A;  4X43 A;  5EPF A;  2CV4 A;  2LJA A;  4HS1 A;  1Q4J A;  3IRA A;  2VLT A;  2OJL A;  2AB6 A;  3S9F A;  2GTU A;  3HJM A;  3ISO A;  4IJ3 A;  1YEP A;  3TJB A;  1GSD A;  3C73 A;  1K0B A;  3HDC A;  4OMV A;  4NAX A;  2VLU A;  2C4J A;  1OE8 A;  5FT3 A;  2AHE A;  2QKE A;  1Z7P A;  2PVQ A;  5ELG A;  2JU5 A;  3E9J B;  1QUW A;  2LEG A;  3GKM A;  1PMT A;  4ACS A;  3L9U A;  4X0X A;  3C8E A;  3GSS A;  4I97 A;  3QFB C;  3ZZX A;  4G9H A;  3TJG A;  2DMM A;  1GNE A;  1WPI A;  3HVV A;  2YPM A;  3DRN A;  1EZK A;  2R6K A;  1EEJ A;  3MAK A;  3G9B A;  5JWR B;  1OE7 A;  4BVY A;  1GUL A;  4L8E A;  1KNG A;  2LJK A;  1GTI A;  4FYB A;  5F8B A;  4CY8 A;  1U87 A;  2PVO C;  1V9W A;  1PL2 A;  3ED3 A;  1YKA A;  3P90 A;  1BAY A;  1V57 A;  1R5P A;  2FWF A;  3UVT A;  3KMO A;  5B7C A;  5INY A;  4KGI A;  5ECM B;  3P7X A;  2JSY A;  4KSO A;  3LW9 A;  1FB0 A;  2L5L A;  1X0R A;  3CMI A;  4K6X A;  2HFD A;  4GWR A;  1F37 A;  2VM2 A;  2H70 A;  2GLR A;  2WFC A;  4IQA A;  1IYH A;  6GSS A;  3TKS C;  1SD8 A;  14GS A;  1JHB A;  4G0K A;  3BJ5 A;  3LQ7 A;  3IC4 A;  4Q5R A;  4O32 A;  4V1A g;  4MA9 A;  4JU5 A;  5D96 A;  3GKK A;  2YOI A;  3CTG A;  2PMT A;  3HKR A;  5IO2 A;  3IAM 2;  3HYP A;  4GQF A;  1JZW A;  3TKQ A;  2FNO A;  5AIV A;  3GV1 A;  4K7N A;  3PPU A;  3QAG A;  4NPB A;  2ES7 A;  4LA1 A;  4ID0 A;  4TR0 A;  3L78 A;  3MWH A;  3TKS A;  4GXZ A;  5KOX A;  5JCU A;  4EDY A;  5IMZ A;  1MTC A;  2HLS A;  2H1B A;  2YJH A;  1YY7 A;  3FMW A;  2L6C A;  4XS4 A;  1ZGN A;  1RW1 A;  4HDE A;  2DSA A;  1PA3 A;  1PX6 A;  2N5F A;  2WZ9 A;  3K8N A;  4AJ8 A;  3TJJ A;  5HR3 A;  2FHE A;  5IPH A;  2LNT A;  2DKI A;  5G1L A;  1PGT A;  1PN0 A;  4MAB A;  4KCE A;  5IMA A;  2MYG A;  5B8A A;  5L71 A;  1K0M A;  3HZ4 A;  1FB6 A;  1ZYP A;  4ICY A;  1TJD A;  1K3O A;  3VLN A;  2F9S A;  1TK5 B;  3BBY A;  3DIE A;  4X1U A;  4LLR A;  1A23 A;  2A2R A;  4EUY A;  2A4V A;  1ZZY A;  1ZL9 A;  2HI7 A;  2CVK A;  4MZC A;  1J0F A;  2BTO T;  4MZW A;  5A5K A;  3CSJ A;  3QCP A;  2BJX A;  4TXO A;  1T7P B;  4ECC A;  3O6T A;  2HRF A;  1EGR A;  2IMK A;  4Z2U A;  4BWQ A;  1I5G A;  1VF2 A;  1HNA A;  2B1L A;  1HYU A;  4OD7 A;  3VWW A;  2KP2 A;  2J23 A;  4MJC A;  5JWQ B;  2YN1 A;  3KP8 A;  2DML A;  2C8U A;  3TKP A;  5FWG A;  1XOB A;  5ECH B;  3G7J A;  2IWT A;  1TK0 B;  4DSR A;  2H6Z A;  3CXG A;  1R7H A;  4V2N A;  3CSI A;  2P5Q A;  3F4S A;  2XBQ A;  2E7P A;  3IAS 2;  3KJY A;  4I2T A;  1ZCP A;  3LEF A;  2X8G A;  2OE1 A;  4CY6 A;  2H76 A;  5D9X A;  2QSI A;  5D8I A;  1U3A A;  1SL1 B;  4FYU A;  2C1Y A;  1BQ7 A;  1WJK A;  5DDL A;  1GUH A;  20GS A;  3KGK A;  2YCD A;  4TKY A;  2VCX A;  5D9T A;  2KOK A;  1A0R P;  5DCH A;  1O8X A;  4MJB A;  3GKX A;  2KUC A;  4V2M A;  3TKR A;  1MDI A;  1MEK A;  2LKU A;  1V40 A;  4OWY A;  1AQX A;  4RI6 A;  2YWI A;  2V6O A;  2H30 A;  4KDU A;  1KTE A;  2XC2 A;  1OAZ A;  1SK2 A;  1XG8 A;  3F8U A;  5J5N A;  3QAV A;  1GL8 A;  3QDN A;  3VWV A;  3F6D A;  4V2L A;  2ZCT A;  3HA9 A;  5DJL A;  3RPP A;  3H93 A;  4HOJ A;  3QAW A;  2GSQ A;  1SYR A;  5HR2 A;  5CAX A;  3A2X A;  3N5O A;  4OFN A;  1TRW A;  1PKZ A;  1B48 A;  1F3B A;  2I1U A;  1G6W A;  2VL2 C;  3H4K A;  1M2A A;  2H19 A;  5IMF A;  2X64 A;  1WMJ A;  1DE1 A;  3TOT A;  4J57 E;  4IQ1 A;  2MBT A;  1M2D A;  3IV4 A;  4G19 A;  2HRN A;  4Z2R A;  3QPM A;  3RBT A;  4BIK A;  5LCZ A;  5KOW A;  4EC0 A;  1S3A A;  3W8J A;  2WS2 A;  2VL2 A;  5ELA A;  3APO A;  2LRN A;  1XWA A;  4BA7 A;  4HU9 A;  1TOF A;  2AV4 A;  4BL7 A;  2N5A A;  4F2I A;  1GSQ A;  1WWJ A;  5ECP B;  1Z5Y E;  1FOV A;  3VI7 A;  4PQ1 A;  2NPB A;  2WJU A;  3M3M A;  3FEU A;  2ON7 A;  3G7I A;  10GS A;  5BRT A;  4IS0 A;  2L4Q A;  1K0C A;  2GQM A;  1NW2 A;  3VK9 A;  2N5B A;  3APS A;  2VM1 A;  4PGT A;  3VI5 A;  1AIU A;  2L4C A;  3WGX A;  3EMX A;  5B6N A;  1XVQ A;  1MDK A;  4ZBA A;  1R5A A;  1W89 A;  2PGT A;  2GZY A;  3D4T A;  1J08 A;  4GTU A;  2GT5 A;  6GSU A;  2A2P A;  4MJE A;  1GTU A;  5ID2 B;  1GSU A;  4TR4 A;  1A2L A;  1S3D A;  2JSZ A;  2GQK A;  2CVB A;  1U6T A;  1YZX A;  3J7Y b;  1T4Z A;  1OC8 A;  2GDR A;  1XOA A;  2JZT A;  3GHA A;  3GL3 A;  5ECS A;  2L6D A;  1NHO A;  3H1N A;  5B8B A;  4GSN A;  5KEJ A;  3DD3 A;  3HVN A;  2O87 A;  1ERV A;  5JCW A;  2HZE B;  1XBS A;  1M3I A;  1SJI A;  1QK8 A;  2VLV A;  3U6V A;  4WR5 A;  2ZNM A;  4HZ4 A;  2H6X A;  4K8M A;  1YDK A;  2REM A;  4BL7 B;  3KTL A;  2FGX A;  5C00 A;  3UOM A;  1GSE A;  1B4P A;  4MPG A;  4O5R A;  2DJ1 A;  3SBC A;  3DVW A;  3V1W A;  1QGV A;  2UZ8 A;  3I6A A;  1SJZ A;  3FR9 A;  2CX4 A;  3LFL A;  3KZQ A;  1MDJ A;  3CYN A;  3KD0 A;  4XRD A;  1E6B A;  2QGV A;  2HSH A;  3NZN A;  5B6M A;  1XW6 A;  2LJR A;  1Z6M A;  1EP8 A;  5LNK e;  4AGS A;  1Y25 A;  3ZRD A;  5GST A;  4HQS A;  4KB3 A;  2DLX A;  4ZL7 A;  3KEB A;  2F3M A;  3HD5 A;  2F8A A;  3IR4 A;  4HQZ A;  1ML6 A;  2JZR A;  3UL3 A;  5IPG A;  4F03 A;  1YF0 A;  3CQF A;  1EP7 A;  2FCH A;  1GSY A;  5CRH A;  2X4A A;  1OC9 B;  2V6K A;  1GUK A;  4PUA A;  5EL8 A;  3CBU A;  1GRX A;  1TI1 A;  4WKW A;  1ST9 A;  3P2A A;  3GMF A;  3KTB A;  3VPQ A;  2B5E A;  3GX0 A;  3US3 A;  5C04 A;  4MP4 A;  4NV2 A;  1AC1 A;  1GUM A;  3KH9 A;  4Q5F A;  1J9B A;  1Z7R A;  5J41 A;  1AAZ A;  2WGR A;  4MF7 A;  1B9Y C;  5EVO A;  2DJ2 A;  3KIJ A;  2PU9 C;  1XFL A;  1GTA A;  3UAP A;  3ZFB A;  4K7O A;  2LQO A;  1OKT A;  3GFK A;  1C72 A;  1FW1 A;  2K9F A;  3C71 A;  3FR6 A;  2GVP A;  2RLI A;  3A5I A;  2H6Y A;  3DKS A;  2H72 A;  3TGZ A;  3EU3 A;  3FZ4 A;  1DBY A;  4D73 A;  1DUG A;  2K6V A;  2QA2 A;  4K2D A;  4LMW A;  3VWU A;  2KLX A;  1F9M A;  1Z3E A;  3A5W A;  2FA8 A;  3W8S A;  4H86 A;  1AXD A;  4PQI A;  2P0G A;  4KAE A;  4POL A;  3RPN A;  1FVJ A;  3UIW A;  2H1A A;  1ON4 A;  2GS3 A;  2MZC A;  3QMX A;  5J9B A;  4TVE A;  1ZYQ B;  2JAD A;  2P31 A;  3UVH A;  4EKZ A;  3PIN A;  4L5L A;  4DSS A;  2ON5 A;  3E0U A;  2R37 A;  3MSZ A;  4KUN A;  4EVM A;  2IJY A;  3WGD A;  2YJ7 A;  3LYK A;  1M2B A;  4O5U A;  4IVF A;  4POB A;  2RII A;  4EIQ A;  1H75 A;  2L5O A;  3F9U A;  3D4M A;  5DAL A;  5A4W A;  1OVN A;  3GNJ A;  3KH7 A;  4K9Z A;  2R0P A;  2H0I A;  3WT2 A;  3DML A;  3VWX A;  3H8Q A;  2O85 A;  4OFT A;  4DEJ A;  4PX1 A;  3ZMK A;  2C3T A;  2HSM A;  3UBK A;  1K0N A;  1X5D A;  1A8L A;  3CRU A;  3GTU A;  4KCA A;  5ECN B;  3EUR A;  1MD4 A;  2X8C A;  2IN3 A;  1RQM A;  4MK3 A;  4ECI A;  3A2W A;  1XWC A;  5JCG A;  2H0G A;  1UC7 A;  4BVY B;  6GSV A;  4IW9 A;  4QL9 A;  4PUR A;  1XZO A;  1FAA A;  2TIR A;  2MMN A;  3FHK A;  1A8Y A;  3IPZ A;  2GGT A;  2YV9 A;  4XS6 A;  2G2Q A;  1F3A A;  4TR1 A;  3G7Y A;  1PKW A;  1Z6N A;  1B9X C;  5IMD A;  3IOS A;  4YH2 A;  1O81 A;  3I69 A;  4USS A;  4JRR A;  4JR4 A;  5DJM A;  3Q19 A;  2LNS A;  4EL1 A;  1TTZ A;  1XXU A;  4G0I A;  2FY6 A;  4TRX A;  4G2E A;  4WF4 A;  4CHS A;  3D5J A;  4GSS A;  1B4Q A;  4NHW A;  1EV9 A;  3FYG A;  2O89 A;  5H5Q A;  3TJK A;  2HSY A;  3CRT A;  2MMA A;  4MLY A;  3L9S A;  3M9J A;  2H8L A;  2B1K A;  1FOH A;  2YWN A;  1GP1 A;  2GZZ A;  3KMN A;  2DJJ A;  4XHM A;  4FQU A;  5CYY A;  4AJ6 A;  1V2A A;  1K0A A;  4ZBB A;  4O92 A;  2YZH A;  2D2Z A;  3LWA A;  2FD3 A;  2H71 A;  2HRK A;  3H79 A;  1FHE A;  4HU7 A;  3ZML A;  5JWO B;  1XPV A;  3TUE A;  2L57 A;  3GX8 A;  4L0U A;  3MNG A;  1SK1 A;  2HE3 A;  4MCU A;  1QFN A;  2OBK A;  3HJO A;  3WD6 A;  5COH A;  4KSM A;  4XS4 B;  2VAF A;  3HVX A;  1TW9 A;  3ME7 A;  1MD3 A;  2L59 A;  3N9J A;  4WR4 A;  3KCM A;  2OKA A;  1X9M B;  5G2Z A;  1CQG A;  2R4V A;  3L4N A;  5E4W A;  2CA8 A;  4A5P A;  2PPT A;  2H73 A;  3IBH A;  4K1F A;  5GSS A;  5AN1 A;  3L9V A;  2R2J A;  4Z2T A;  4IKH A;  3TKS E;  1ERU A;  1VF1 A;  1O6J A;  4FIW A;  2BMX A;  4PNF A;  1ZYN A;  3GL5 A;  3I43 A;  1PQN A;  5ECL B;  3GH6 A;  2TRC P;  4XCS A;  1BYE A;  4XRA A;  1THO A;  2E2G A;  4K0G A;  2B6M A;  3LGC A;  1G7O A;  4EDZ A;  2KHP A;  2B3S A;  4OCF A;  4TXO B;  4F82 A;  5HFG A;  1LJR A;  4YAV A;  2IPA A;  1TKD B;  2PWJ A;  1W4V A;  1AW9 A;  2J9H A;  2YWM A;  2ALB A;  1VF3 A;  2HZF A;  4BVX A;  4IJI A;  2MMZ A;  2B7K A;  1GTB A;  3TJF A;  3ZVJ D;  4ZBD A;  4E8H A;  1U3I A;  4POM A;  3TRQ A;  2DBC A;  3O3T A;  4KH7 A;  3FRC A;  2LRC A;  1SKS B;  2NBS A;  3IC8 A;  3GUR A;  3DEX A;  1F2E A;  1USB A;  4MDC A;  3LSZ A;  2QC7 A;  1WP0 A;  2VUP A;  1TP9 A;  2R0G A;  3HXS A;  1XW5 A;  1SU9 A;  3GIX A;  13GS A;  3VUR A;  3ERF A;  1HQO A;  3TRP A;  5E59 A;  2I81 A;  5DAK A;  3C1S A;  4LL4 B;  4GLT A;  1PFO A;  6GSY A;  3LG6 A;  3EMP A;  4N30 A;  4MMM A;  1TRU A;  4WET A;  2CVD A;  1BJX A;  4EO3 A;  1O73 A;  5BMU A;  3ME8 A;  3ZVJ A;  2XHF A;  17GS A;  1WRY A;  4LMV A;  3P8W A;  4F0B A;  2IME A;  2IL3 A;  1SL0 B;  4RQX A;  2VL3 A;  3FZ9 A;  4YQU A;  3A2V A;  3F4R A;  3WGE A;  4QQ7 A;  1PRX A;  3FW2 A;  2OE3 A;  2ZUP A;  3EU4 A;  2DJK A;  4O7H A;  1FVK A;  4OO5 A;  1SK0 A;  1YKC A;  5AIS A;  3C7M A;  5AIX A;  2XPD A;  4ZB9 A;  5ECI B;  2QA1 A;  4O5Q A;  1R4W A;  1TI3 A;  3IK9 A;  4Q5Q A;  5G31 A;  2AAW A;  1SKR B;  5F06 A;  1VRS D;  2VD0 A;  2WRT A;  2HXK A;  4HSC X;  4JBB A;  2VCZ A;  1TXX A;  2YWO A;  5G1K A;  2O7K A;  3GUS A;  5CO3 A;  4K7I A;  3M8N A;  3ZYW A;  4QL7 A;  5CNW A;  2WDU A;  2OA7 A;  3R3E A;  1QQ2 A;  5D9V A;  5KN3 A;  2GSR A;  1XIY A;  2V1M A;  5CRE A;  1M7T A;  3LXZ A;  1TRV A;  4GST A;  3PH9 A;  3VFI A;  2EIQ A;  2F51 A;  7GSS A;  1JZR A;  5CP1 A;  3UMA A;  4MF5 A;  4ULX A;  3Q74 A;  5DAK B;  1YEX A;  3KM6 A;  5HQP A;  5GAP D;  2F8F A;  4ZB6 A;  2M80 A;  3ZLP A;  4KND A;  3R2Q A;  4NXI A;  3LXT A;  2AYT A;  5J4U A;  2Z9S A;  4XIH A;  5D93 A;  3OR5 A;  2LST A;  4ML6 A;  1SD9 A;  2VCQ A;  1XW9 A;  3CSH A;  5DQY A;  1ILO A;  4POK A;  3FZ5 A;  3DXB A;  3UEM A;  2H0H A;  5ECK B;  3U5R E;  2B5Y A;  4NV5 A;  4IGJ A;  1JZD A;  3FZA A;  4YKF A;  1PX7 A;  4JZQ A;  1E2Y A;  1EV4 A;  4NHZ A;  3QR6 A;  3UAR A;  3ERG A;  3M9K A;  1O8W A;  22GS A;  12GS A;  2K8V A;  3TRX A;  4ZL9 A;  3DVX A;  2B7J A;  5ENU A;  1AUC A;  2FA4 A;  2WCI A;  2CX3 A;  1RK4 A;  2HNL A;  3F3Q A;  4N10 A;  2C0D A;  3D22 A;  4MZB A;  5ECO B;  4FO5 A;  3LYP A;  3IHQ A;  1K0D A;  1XCC A;  3EVI A;  1PSQ A;  1IYI A;  3IA1 A;  4BWS A;  3EPT A;  4ISD A;  5HR0 A;  1THX A;  3RAZ A;  4KA0 A;  19GS A;  4I2U A;  4N0Z A;  1YF1 A;  2R3X A;  2V2G A;  4GQC A;  2R5G A;  3IDV A;  4ZB8 A;  1X9S B;  2WUL A;  1X5E A;  2X49 A;  1V98 A;  4MNN A;  1HNC A;  4E8E A;  3HVS A;  2DIZ A;  4GF0 A;  4OO4 A;  4TXV A;  2JL4 A;  1ACV A;  2KP1 A;  1T1V A;  5G30 A;  2VL9 A;  4ZL8 A;  1YQ1 A;  1X5C A;  3RHB A;  5DVB A;  2YNX A;  5F07 A;  3EE2 A;  4XTS A;  2CAI A;  3ZIJ A;  6GST A;  3NOF A;  1LBK A;  5HR1 A;  2VCV A;  4FH8 A;  4HI7 A;  4TOP A;  2YZU A;  4RUV A;  5KN0 A;  6GSW A;  4V1A p;  3KP9 A;  1LU4 A;  3M1G A;  3TDG A;  1URM A;  2YP6 A;  1VF4 A;  3EC3 A;  1A2M A;  3HZ8 A;  2JZS A;  2VCT A;  2NDO A;  2PER A;  4MJA A;  4IHU A;  1JFU A;  3FK8 A;  5J9C A;  2FLS A;  3GYK A;  1N2A A;  5DBQ A;  1K3L A;  2C3N A;  3BOA A;  5IMC A;  3D21 A;  5CRD A;  2FWH A;  4ECB A;  1UVZ A;  3EYT A;  4WF5 A;  5A4U A;  1GLP A;  3LOR A;  2C3Q A;  4I6X A;  1ERW A;  4FYC A;  1QMV A;  2I3Y A;  3PGT A;  1F6M C;  3J7Y k;  2X99 A;  3CTF A;  5HFI A;  1X9W B;  1T3B A;  2C80 A;  4X4J A;  1U88 A;  3GA4 A;  4CDO A;  3HCZ A;  3PR8 A;  4PUF C;  1BG5 A;  5IQY A;  4N11 A;  2FWG A;  2TRX A;  1KBN A;  1EOH A;  3GRX A;  3ZRE A;  2OE0 A;  3GKN A;  9GSS A;  4PXO A;  2LV3 A;  4D73 B;  3DYR A;  3FY7 A;  4F0C A;  1PL1 A;  1XVW A;  3A3T A;  1ZYE A;  3ZL5 A;  2GSS A;  1WIK A;  4J56 E;  4I5Q A;  1T8E B;  1ABA A;  5IM9 A;  1SJ6 A;  5J3R A;  3F3R A;  5KN1 A;  4PTS A;  3F0I A;  1ZMA A;  2VOC A;  4YAP A;  3F63 A;  2IMD A;  1N8J A;  1ERT A;  1K0O A;  4RQR A;  2MBS A;  1TK8 B;  2A2S A;  4HUA A;  1TU8 A;  3MYD A;  3TB2 A;  4Q5N A;  1A0F A;  2NTO A;  4KF9 A;  4G10 A;  4DSS B;  1EEM A;  1GSF A;  1QXH A;  11GS A;  5A4V A;  1H4O A;  4LL1 B;  1JLV A;  2GST A;  5EY6 A;  2JAC A;  2RM5 A;  4L0W A;  1XWB A;  5IIZ A;  3W6G A;  1T00 A;  4JE1 A;  1Z9H A; 
#chains in the Genus database with same CATH homology
 4HJM A;  2EIO A;  4P3Y B;  5H5R A;  5HFK A;  3TOU A;  2LQQ A;  5DAL B;  1EWX A;  1FG4 A;  1GNW A;  3RDW A;  2HYX A;  2HRA A;  5DCG A;  1AQW A;  4CW9 A;  3ZIV A;  3BCI A;  4DSQ A;  4IBP A;  4KW6 A;  2O8V B;  1OYJ A;  2CZ3 A;  3GTU B;  2VD1 A;  2V32 A;  2DKH A;  1TU7 A;  2XBI A;  3BCK A;  1JLW A;  3ZIT A;  3GH9 A;  3JCM L;  4I8B A;  2PN8 A;  5AGY A;  3WT1 A;  3IK7 A;  4J2F A;  4NMU A;  1Q98 A;  4K5R A;  4IP6 A;  2H66 A;  4WBR D;  2R0C A;  1OKD A;  4DVC A;  3FKF A;  1GWC A;  2LS5 A;  1S3C A;  2C0E A;  1A2J A;  1B8X A;  4F9Z A;  3DGQ A;  2I9H A;  4TR1 B;  1PD2 1;  2X8H A;  2LRT A;  4YQV A;  5ECR B;  2CQ9 A;  3UJ1 A;  5GAN D;  3ZTL A;  5IO0 A;  1M0U A;  1DE2 A;  5CRW A;  3DWV A;  16GS A;  3EIN A;  2DIY A;  2YAN A;  2K18 A;  4ML1 A;  4ILF A;  2H1D A;  5F0G A;  4OFM A;  5IOX A;  1NSW A;  1R26 A;  2IMI A;  4TR3 A;  2VO4 A;  1BX9 A;  5KN2 A;  2EIR A;  18GS A;  4KE3 A;  1SKW B;  2AJQ B;  3D6I A;  3HHV A;  1PN9 A;  2IFQ A;  4MF6 A;  2C0G A;  3FR3 A;  4MH3 A;  1UN2 A;  1O85 A;  1GSS A;  1UA5 A;  4ZXG A;  5ID2 A;  3IE3 A;  2B5X A;  3EWL A;  2A4H A;  2IIY A;  2DJ0 A;  1TDI A;  2RUE A;  3GN3 A;  1WE0 A;  1SYX A;  1JZO A;  4PQH A;  4NWY A;  5LD0 A;  2VCW A;  3ZFL A;  2MMO A;  2GQL A;  5H5S A;  3C1R A;  4HZ2 A;  5CRG A;  3KXO A;  5G5E A;  3QD9 A;  4YQM A;  3TCO A;  4Z7X A;  1M9A A;  1GLQ A;  4EIP A;  2PBJ A;  4YKG A;  1TRS A;  2LTK A;  4IN0 A;  1A24 A;  2HZE A;  1Y6E A;  2FUG 2;  4RI7 A;  3E3E A;  2V41 A;  5D73 A;  3BD2 A;  1O7U A;  1EOG A;  1OC3 A;  4HEA 2;  4GRF A;  4N0V A;  3MIX A;  2CAQ A;  1KEB A;  2WB9 A;  2H1G A;  3MDK A;  2HT9 A;  4K0N A;  1WOU A;  4ECJ A;  1AQV A;  2RUF A;  1G0T A;  1BED A;  4IEL A;  4AJ7 A;  3D0Z A;  1FO5 A;  1YJ6 A;  5G5F A;  1VGL A;  1SEN A;  2OBI A;  1DSB A;  5ABR A;  3HY2 A;  2IMF A;  2M46 A;  2IFQ B;  4BVX B;  3APQ A;  2CZ2 A;  1HD2 A;  1NM3 A;  3Q6O A;  1T4Y A;  2OAC A;  3IHG A;  8GSS A;  3IXR A;  4MH2 A;  1I9D A;  3LJR A;  4AF2 A;  3HJP A;  4EE0 A;  1ZOF A;  3WYW A;  3M0F A;  4JR6 A;  2EC4 A;  1OC9 A;  1XWK A;  1K3Y A;  4G0L A;  4ZIL A;  5GZZ B;  1M9B A;  1V58 A;  5IOW A;  3SWL A;  3F6F A;  2NVL A;  1CQH A;  2C0F A;  4IP1 A;  4EXJ A;  5D9W A;  2H01 A;  4XS1 A;  4ZIJ A;  2I4A A;  1G7E A;  2GZP A;  4KDY A;  5IMV A;  1M99 A;  2H74 A;  2M72 A;  4TN8 A;  4PNG A;  2FWE A;  1NHY A;  4L5O A;  4WEY A;  4K5S A;  6GSX A;  1GH2 A;  5FHI A;  1EGO A;  3QFA C;  4WBJ A;  2LUS A;  2RM6 A;  3QOU A;  2VIM A;  3F4T A;  4GCI A;  4BPY A;  3VPT A;  2DC5 A;  2DJ3 A;  3NIV A;  1G6Y A;  5F05 A;  2CT6 A;  3L0H A;  1XWG A;  4JED A;  2AUV A;  3O76 A;  4OCE A;  4TW5 A;  4WXT A;  1SL2 B;  2OAD A;  4HJ2 A;  3Q18 A;  3ERW A;  2K8S A;  2E2M A;  2XPE A;  2G0F A;  2YV7 A;  1HNB A;  4K2X A;  2H75 A;  4MPF A;  2PUK C;  3I9V 2;  4KDX A;  5ECQ B;  5DQS A;  3RHC A;  3GST A;  2GT6 A;  2P5R A;  2E0Q A;  4KX4 A;  3AY8 A;  4EF0 A;  3UBL A;  4X43 A;  5EPF A;  2CV4 A;  2LJA A;  4HS1 A;  1Q4J A;  3IRA A;  2VLT A;  2OJL A;  2AB6 A;  3S9F A;  2GTU A;  3HJM A;  3ISO A;  4IJ3 A;  1YEP A;  3TJB A;  1GSD A;  3C73 A;  1K0B A;  3HDC A;  4OMV A;  4NAX A;  2VLU A;  2C4J A;  1OE8 A;  5FT3 A;  2AHE A;  2QKE A;  1Z7P A;  2PVQ A;  5ELG A;  2JU5 A;  3E9J B;  1QUW A;  2LEG A;  3GKM A;  1PMT A;  4ACS A;  3L9U A;  4X0X A;  3C8E A;  3GSS A;  4I97 A;  3QFB C;  3ZZX A;  4G9H A;  3TJG A;  2DMM A;  1GNE A;  1WPI A;  3HVV A;  2YPM A;  3DRN A;  1EZK A;  2R6K A;  1EEJ A;  3MAK A;  3G9B A;  5JWR B;  1OE7 A;  4BVY A;  1GUL A;  4L8E A;  1KNG A;  2LJK A;  1GTI A;  4FYB A;  5F8B A;  4CY8 A;  1U87 A;  2PVO C;  1V9W A;  1PL2 A;  3ED3 A;  1YKA A;  3P90 A;  1BAY A;  1V57 A;  1R5P A;  2FWF A;  3UVT A;  3KMO A;  5B7C A;  5INY A;  4KGI A;  5ECM B;  3P7X A;  2JSY A;  4KSO A;  3LW9 A;  1FB0 A;  2L5L A;  1X0R A;  3CMI A;  4K6X A;  2HFD A;  4GWR A;  1F37 A;  2VM2 A;  2H70 A;  2GLR A;  2WFC A;  4IQA A;  1IYH A;  6GSS A;  3TKS C;  1SD8 A;  14GS A;  1JHB A;  4G0K A;  3BJ5 A;  3LQ7 A;  3IC4 A;  4Q5R A;  4O32 A;  4V1A g;  4MA9 A;  4JU5 A;  5D96 A;  3GKK A;  2YOI A;  3CTG A;  2PMT A;  3HKR A;  5IO2 A;  3IAM 2;  3HYP A;  4GQF A;  1JZW A;  3TKQ A;  2FNO A;  5AIV A;  3GV1 A;  4K7N A;  3PPU A;  3QAG A;  4NPB A;  2ES7 A;  4LA1 A;  4ID0 A;  4TR0 A;  3L78 A;  3MWH A;  3TKS A;  4GXZ A;  5KOX A;  5JCU A;  4EDY A;  5IMZ A;  1MTC A;  2HLS A;  2H1B A;  2YJH A;  1YY7 A;  3FMW A;  2L6C A;  4XS4 A;  1ZGN A;  1RW1 A;  4HDE A;  2DSA A;  1PA3 A;  1PX6 A;  2N5F A;  2WZ9 A;  3K8N A;  4AJ8 A;  3TJJ A;  5HR3 A;  2FHE A;  5IPH A;  2LNT A;  2DKI A;  5G1L A;  1PGT A;  1PN0 A;  4MAB A;  4KCE A;  5IMA A;  2MYG A;  5B8A A;  5L71 A;  1K0M A;  3HZ4 A;  1FB6 A;  1ZYP A;  4ICY A;  1TJD A;  1K3O A;  3VLN A;  2F9S A;  1TK5 B;  3BBY A;  3DIE A;  4X1U A;  4LLR A;  1A23 A;  2A2R A;  4EUY A;  2A4V A;  1ZZY A;  1ZL9 A;  2HI7 A;  2CVK A;  4MZC A;  1J0F A;  2BTO T;  4MZW A;  5A5K A;  3CSJ A;  3QCP A;  2BJX A;  4TXO A;  1T7P B;  4ECC A;  3O6T A;  2HRF A;  1EGR A;  2IMK A;  4Z2U A;  4BWQ A;  1I5G A;  1VF2 A;  1HNA A;  2B1L A;  1HYU A;  4OD7 A;  3VWW A;  2KP2 A;  2J23 A;  4MJC A;  5JWQ B;  2YN1 A;  3KP8 A;  2DML A;  2C8U A;  3TKP A;  5FWG A;  1XOB A;  5ECH B;  3G7J A;  2IWT A;  1TK0 B;  4DSR A;  2H6Z A;  3CXG A;  1R7H A;  4V2N A;  3CSI A;  2P5Q A;  3F4S A;  2XBQ A;  2E7P A;  3IAS 2;  3KJY A;  4I2T A;  1ZCP A;  3LEF A;  2X8G A;  2OE1 A;  4CY6 A;  2H76 A;  5D9X A;  2QSI A;  5D8I A;  1U3A A;  1SL1 B;  4FYU A;  2C1Y A;  1BQ7 A;  1WJK A;  5DDL A;  1GUH A;  20GS A;  3KGK A;  2YCD A;  4TKY A;  2VCX A;  5D9T A;  2KOK A;  1A0R P;  5DCH A;  1O8X A;  4MJB A;  3GKX A;  2KUC A;  4V2M A;  3TKR A;  1MDI A;  1MEK A;  2LKU A;  1V40 A;  4OWY A;  1AQX A;  4RI6 A;  2YWI A;  2V6O A;  2H30 A;  4KDU A;  1KTE A;  2XC2 A;  1OAZ A;  1SK2 A;  3F8U A;  5J5N A;  3QAV A;  1GL8 A;  3QDN A;  3VWV A;  3F6D A;  4V2L A;  2ZCT A;  3HA9 A;  5DJL A;  3RPP A;  3H93 A;  4HOJ A;  3QAW A;  2GSQ A;  1SYR A;  5HR2 A;  5CAX A;  3A2X A;  3N5O A;  4OFN A;  1TRW A;  1PKZ A;  1B48 A;  1F3B A;  2I1U A;  1G6W A;  2VL2 C;  3H4K A;  1M2A A;  2H19 A;  5IMF A;  2X64 A;  1WMJ A;  1DE1 A;  3TOT A;  4J57 E;  4IQ1 A;  2MBT A;  1M2D A;  3IV4 A;  4G19 A;  2HRN A;  4Z2R A;  3QPM A;  3RBT A;  5LCZ A;  5KOW A;  4EC0 A;  1S3A A;  3W8J A;  2WS2 A;  2VL2 A;  5ELA A;  3APO A;  2LRN A;  1XWA A;  4BA7 A;  4HU9 A;  1TOF A;  2AV4 A;  4BL7 A;  2N5A A;  4F2I A;  1GSQ A;  1WWJ A;  5ECP B;  1Z5Y E;  1FOV A;  3VI7 A;  4PQ1 A;  2NPB A;  2WJU A;  3M3M A;  3FEU A;  2ON7 A;  3G7I A;  10GS A;  5BRT A;  4IS0 A;  2L4Q A;  1K0C A;  2GQM A;  1NW2 A;  3VK9 A;  2N5B A;  3APS A;  2VM1 A;  4PGT A;  3VI5 A;  1AIU A;  2L4C A;  3WGX A;  3EMX A;  5B6N A;  1XVQ A;  1MDK A;  4ZBA A;  1R5A A;  1W89 A;  2PGT A;  2GZY A;  3D4T A;  1J08 A;  4GTU A;  2GT5 A;  6GSU A;  2A2P A;  4MJE A;  1GTU A;  5ID2 B;  1GSU A;  4TR4 A;  1A2L A;  1S3D A;  2JSZ A;  2GQK A;  2CVB A;  1U6T A;  1YZX A;  3J7Y b;  1T4Z A;  1OC8 A;  2GDR A;  1XOA A;  2JZT A;  3GHA A;  3GL3 A;  5ECS A;  2L6D A;  1NHO A;  3H1N A;  5B8B A;  4GSN A;  5KEJ A;  3DD3 A;  2O87 A;  1ERV A;  5JCW A;  2HZE B;  1XBS A;  1SJI A;  1QK8 A;  2VLV A;  3U6V A;  4WR5 A;  2ZNM A;  4HZ4 A;  2H6X A;  4K8M A;  1YDK A;  2REM A;  4BL7 B;  3KTL A;  2FGX A;  5C00 A;  3UOM A;  1GSE A;  1B4P A;  4MPG A;  4O5R A;  2DJ1 A;  3SBC A;  3DVW A;  3V1W A;  1QGV A;  2UZ8 A;  3I6A A;  1SJZ A;  3FR9 A;  2CX4 A;  3LFL A;  3KZQ A;  1MDJ A;  3CYN A;  3KD0 A;  4XRD A;  1E6B A;  2QGV A;  2HSH A;  3NZN A;  5B6M A;  1XW6 A;  2LJR A;  1Z6M A;  1EP8 A;  5LNK e;  4AGS A;  1Y25 A;  3ZRD A;  5GST A;  4HQS A;  4KB3 A;  2DLX A;  4ZL7 A;  3KEB A;  2F3M A;  3HD5 A;  2F8A A;  3IR4 A;  4HQZ A;  1ML6 A;  2JZR A;  3UL3 A;  5IPG A;  4F03 A;  1YF0 A;  1EP7 A;  2FCH A;  1GSY A;  5CRH A;  2X4A A;  1OC9 B;  2V6K A;  1GUK A;  4PUA A;  5EL8 A;  3CBU A;  1GRX A;  1TI1 A;  4WKW A;  1ST9 A;  3P2A A;  3GMF A;  3KTB A;  3VPQ A;  2B5E A;  3GX0 A;  3US3 A;  5C04 A;  4MP4 A;  4NV2 A;  1AC1 A;  1GUM A;  3KH9 A;  4Q5F A;  1J9B A;  1Z7R A;  5J41 A;  1AAZ A;  2WGR A;  4MF7 A;  1B9Y C;  5EVO A;  2DJ2 A;  3KIJ A;  2PU9 C;  1XFL A;  1GTA A;  3UAP A;  3ZFB A;  4K7O A;  2LQO A;  1OKT A;  3GFK A;  1C72 A;  1FW1 A;  2K9F A;  3C71 A;  3FR6 A;  2GVP A;  2RLI A;  3A5I A;  2H6Y A;  3DKS A;  2H72 A;  3TGZ A;  3EU3 A;  3FZ4 A;  1DBY A;  4D73 A;  1DUG A;  2K6V A;  2QA2 A;  4K2D A;  4LMW A;  3VWU A;  2KLX A;  1F9M A;  1Z3E A;  3A5W A;  2FA8 A;  3W8S A;  4H86 A;  1AXD A;  4PQI A;  2P0G A;  4KAE A;  4POL A;  3RPN A;  1FVJ A;  3UIW A;  2H1A A;  1ON4 A;  2GS3 A;  2MZC A;  3QMX A;  5J9B A;  4TVE A;  1ZYQ B;  2JAD A;  2P31 A;  3UVH A;  4EKZ A;  3PIN A;  4L5L A;  4DSS A;  2ON5 A;  3E0U A;  2R37 A;  3MSZ A;  4KUN A;  4EVM A;  2IJY A;  3WGD A;  2YJ7 A;  3LYK A;  1M2B A;  4O5U A;  4IVF A;  4POB A;  2RII A;  4EIQ A;  1H75 A;  2L5O A;  3F9U A;  3D4M A;  5DAL A;  5A4W A;  1OVN A;  3GNJ A;  3KH7 A;  4K9Z A;  2R0P A;  2H0I A;  3WT2 A;  3DML A;  3VWX A;  3H8Q A;  2O85 A;  4OFT A;  4DEJ A;  4PX1 A;  3ZMK A;  2C3T A;  2HSM A;  3UBK A;  1K0N A;  1X5D A;  1A8L A;  3CRU A;  3GTU A;  4KCA A;  5ECN B;  3EUR A;  1MD4 A;  2X8C A;  2IN3 A;  1RQM A;  4MK3 A;  4ECI A;  3A2W A;  1XWC A;  5JCG A;  2H0G A;  1UC7 A;  4BVY B;  6GSV A;  4IW9 A;  4QL9 A;  4PUR A;  1XZO A;  1FAA A;  2TIR A;  2MMN A;  3FHK A;  1A8Y A;  3IPZ A;  2GGT A;  2YV9 A;  4XS6 A;  2G2Q A;  1F3A A;  4TR1 A;  3G7Y A;  1PKW A;  1Z6N A;  1B9X C;  5IMD A;  3IOS A;  4YH2 A;  1O81 A;  3I69 A;  4USS A;  4JRR A;  4JR4 A;  5DJM A;  3Q19 A;  2LNS A;  4EL1 A;  1TTZ A;  1XXU A;  4G0I A;  2FY6 A;  4TRX A;  4G2E A;  4WF4 A;  4CHS A;  3D5J A;  4GSS A;  1B4Q A;  4NHW A;  1EV9 A;  3FYG A;  2O89 A;  5H5Q A;  3TJK A;  2HSY A;  3CRT A;  2MMA A;  4MLY A;  3L9S A;  3M9J A;  2H8L A;  2B1K A;  1FOH A;  2YWN A;  1GP1 A;  2GZZ A;  3KMN A;  2DJJ A;  4XHM A;  4FQU A;  5CYY A;  4AJ6 A;  1V2A A;  1K0A A;  4ZBB A;  4O92 A;  2YZH A;  2D2Z A;  3LWA A;  2FD3 A;  2H71 A;  2HRK A;  3H79 A;  1FHE A;  4HU7 A;  3ZML A;  5JWO B;  1XPV A;  3TUE A;  2L57 A;  3GX8 A;  4L0U A;  3MNG A;  1SK1 A;  2HE3 A;  4MCU A;  1QFN A;  2OBK A;  3HJO A;  3WD6 A;  5COH A;  4KSM A;  4XS4 B;  2VAF A;  3HVX A;  1TW9 A;  3ME7 A;  1MD3 A;  2L59 A;  3N9J A;  4WR4 A;  3KCM A;  2OKA A;  1X9M B;  5G2Z A;  1CQG A;  2R4V A;  3L4N A;  5E4W A;  2CA8 A;  4A5P A;  2PPT A;  2H73 A;  3IBH A;  4K1F A;  5GSS A;  5AN1 A;  3L9V A;  2R2J A;  4Z2T A;  4IKH A;  3TKS E;  1ERU A;  1VF1 A;  1O6J A;  4FIW A;  2BMX A;  4PNF A;  1ZYN A;  3GL5 A;  3I43 A;  1PQN A;  5ECL B;  3GH6 A;  2TRC P;  4XCS A;  1BYE A;  4XRA A;  1THO A;  2E2G A;  4K0G A;  2B6M A;  3LGC A;  1G7O A;  4EDZ A;  2KHP A;  2B3S A;  4OCF A;  4TXO B;  4F82 A;  5HFG A;  1LJR A;  4YAV A;  2IPA A;  1TKD B;  2PWJ A;  1W4V A;  1AW9 A;  2J9H A;  2YWM A;  2ALB A;  1VF3 A;  2HZF A;  4BVX A;  4IJI A;  2MMZ A;  2B7K A;  1GTB A;  3TJF A;  3ZVJ D;  4ZBD A;  4E8H A;  1U3I A;  4POM A;  3TRQ A;  2DBC A;  3O3T A;  4KH7 A;  3FRC A;  2LRC A;  1SKS B;  2NBS A;  3IC8 A;  3GUR A;  3DEX A;  1F2E A;  1USB A;  4MDC A;  3LSZ A;  2QC7 A;  1WP0 A;  2VUP A;  1TP9 A;  2R0G A;  3HXS A;  1XW5 A;  1SU9 A;  3GIX A;  13GS A;  3VUR A;  3ERF A;  1HQO A;  3TRP A;  5E59 A;  2I81 A;  5DAK A;  3C1S A;  4LL4 B;  4GLT A;  6GSY A;  3LG6 A;  3EMP A;  4N30 A;  4MMM A;  1TRU A;  4WET A;  2CVD A;  1BJX A;  4EO3 A;  1O73 A;  5BMU A;  3ME8 A;  3ZVJ A;  2XHF A;  17GS A;  1WRY A;  4LMV A;  3P8W A;  4F0B A;  2IME A;  2IL3 A;  1SL0 B;  4RQX A;  2VL3 A;  3FZ9 A;  4YQU A;  3A2V A;  3F4R A;  3WGE A;  4QQ7 A;  1PRX A;  3FW2 A;  2OE3 A;  2ZUP A;  3EU4 A;  2DJK A;  4O7H A;  1FVK A;  4OO5 A;  1SK0 A;  1YKC A;  5AIS A;  3C7M A;  5AIX A;  2XPD A;  4ZB9 A;  5ECI B;  2QA1 A;  4O5Q A;  1R4W A;  1TI3 A;  3IK9 A;  4Q5Q A;  5G31 A;  2AAW A;  1SKR B;  5F06 A;  1VRS D;  2VD0 A;  2WRT A;  2HXK A;  4JBB A;  2VCZ A;  1TXX A;  2YWO A;  5G1K A;  2O7K A;  3GUS A;  5CO3 A;  4K7I A;  3M8N A;  3ZYW A;  4QL7 A;  5CNW A;  2WDU A;  2OA7 A;  3R3E A;  1QQ2 A;  5D9V A;  5KN3 A;  2GSR A;  1XIY A;  2V1M A;  5CRE A;  1M7T A;  3LXZ A;  1TRV A;  4GST A;  3PH9 A;  3VFI A;  2EIQ A;  2F51 A;  7GSS A;  1JZR A;  5CP1 A;  3UMA A;  4MF5 A;  4ULX A;  3Q74 A;  5DAK B;  1YEX A;  3KM6 A;  5HQP A;  5GAP D;  2F8F A;  4ZB6 A;  2M80 A;  3ZLP A;  4KND A;  3R2Q A;  4NXI A;  3LXT A;  2AYT A;  5J4U A;  2Z9S A;  4XIH A;  5D93 A;  3OR5 A;  2LST A;  4ML6 A;  1SD9 A;  2VCQ A;  1XW9 A;  3CSH A;  5DQY A;  1ILO A;  4POK A;  3FZ5 A;  3DXB A;  3UEM A;  2H0H A;  5ECK B;  3U5R E;  2B5Y A;  4NV5 A;  4IGJ A;  1JZD A;  3FZA A;  4YKF A;  1PX7 A;  4JZQ A;  1E2Y A;  1EV4 A;  4NHZ A;  3QR6 A;  3UAR A;  3ERG A;  3M9K A;  1O8W A;  22GS A;  12GS A;  2K8V A;  3TRX A;  4ZL9 A;  3DVX A;  2B7J A;  5ENU A;  1AUC A;  2FA4 A;  2WCI A;  2CX3 A;  1RK4 A;  2HNL A;  3F3Q A;  4N10 A;  2C0D A;  3D22 A;  4MZB A;  5ECO B;  4FO5 A;  3LYP A;  3IHQ A;  1K0D A;  1XCC A;  3EVI A;  1PSQ A;  1IYI A;  3IA1 A;  4BWS A;  3EPT A;  4ISD A;  5HR0 A;  1THX A;  3RAZ A;  4KA0 A;  19GS A;  4I2U A;  4N0Z A;  1YF1 A;  2R3X A;  2V2G A;  4GQC A;  2R5G A;  3IDV A;  4ZB8 A;  1X9S B;  2WUL A;  1X5E A;  2X49 A;  1V98 A;  4MNN A;  1HNC A;  4E8E A;  3HVS A;  2DIZ A;  4GF0 A;  4OO4 A;  4TXV A;  2JL4 A;  1ACV A;  2KP1 A;  1T1V A;  5G30 A;  2VL9 A;  4ZL8 A;  1YQ1 A;  1X5C A;  3RHB A;  5DVB A;  2YNX A;  5F07 A;  3EE2 A;  4XTS A;  2CAI A;  3ZIJ A;  6GST A;  3NOF A;  1LBK A;  5HR1 A;  2VCV A;  4FH8 A;  4HI7 A;  4TOP A;  2YZU A;  4RUV A;  5KN0 A;  6GSW A;  4V1A p;  3KP9 A;  1LU4 A;  3M1G A;  3TDG A;  1URM A;  2YP6 A;  1VF4 A;  3EC3 A;  1A2M A;  3HZ8 A;  2JZS A;  2VCT A;  2NDO A;  2PER A;  4MJA A;  4IHU A;  1JFU A;  3FK8 A;  5J9C A;  2FLS A;  3GYK A;  1N2A A;  5DBQ A;  1K3L A;  2C3N A;  3BOA A;  5IMC A;  3D21 A;  5CRD A;  2FWH A;  4ECB A;  1UVZ A;  3EYT A;  4WF5 A;  5A4U A;  1GLP A;  3LOR A;  2C3Q A;  4I6X A;  1ERW A;  4FYC A;  1QMV A;  2I3Y A;  3PGT A;  1F6M C;  3J7Y k;  2X99 A;  3CTF A;  5HFI A;  1X9W B;  1T3B A;  2C80 A;  4X4J A;  1U88 A;  3GA4 A;  4CDO A;  3HCZ A;  3PR8 A;  4PUF C;  1BG5 A;  5IQY A;  4N11 A;  2FWG A;  2TRX A;  1KBN A;  1EOH A;  3GRX A;  3ZRE A;  2OE0 A;  3GKN A;  9GSS A;  4PXO A;  2LV3 A;  4D73 B;  3DYR A;  3FY7 A;  4F0C A;  1PL1 A;  1XVW A;  3A3T A;  1ZYE A;  3ZL5 A;  2GSS A;  1WIK A;  4J56 E;  4I5Q A;  1T8E B;  1ABA A;  5IM9 A;  1SJ6 A;  5J3R A;  3F3R A;  5KN1 A;  4PTS A;  3F0I A;  1ZMA A;  2VOC A;  4YAP A;  3F63 A;  2IMD A;  1N8J A;  1ERT A;  1K0O A;  4RQR A;  2MBS A;  1TK8 B;  2A2S A;  4HUA A;  1TU8 A;  3MYD A;  3TB2 A;  4Q5N A;  1A0F A;  2NTO A;  4KF9 A;  4G10 A;  4DSS B;  1EEM A;  1GSF A;  1QXH A;  11GS A;  5A4V A;  1H4O A;  4LL1 B;  1JLV A;  2GST A;  5EY6 A;  2JAC A;  2RM5 A;  4L0W A;  1XWB A;  5IIZ A;  3W6G A;  1T00 A;  4JE1 A;  1Z9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...