2F9UA

Hcv ns3 protease domain with ns4a peptide and a ketoamide inhibitor with a p2 norborane
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
183
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease/helicase'
publication title Novel Inhibitors of Hepatitis C NS3-NS4A Serine Protease Derived from 2-Aza-bicyclo[2.2.1]heptane-3-carboxylic acid.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 41
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9uA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2f9uA01
2CHAC 2ZG0H 1AUTC 1A0HB 2ZO3H 5C5OA 2Z9KA 5C1UA 1A46H 2OC0A 3R3GB 1TGCA 1AB9B 1SLXB 2AERH 3S0NA 1NFYA 3NWUA 4U32A 1GCTB 4K60A 4O9VA 1WUNH 2NU2E 1ZMNA 4FUGA 6GCHG 2GMTB 1KXAA 2A2QH 5CE1A 4D7FA 1RJXB 1LKAA 2FOCA 1HV7A 3RXEA 1GG6C 2BDHA 4AORA 2R3UA 1SHHB 2WV5A 3LGYA 1C2MA 1SG8B 1C2DA 6ESTA 1TLDA 2QAAA 4ZKSU 4WVPE 2PKSB 2WPJS 3ATLA 3BF6H 1PPBH 1C1UH 3GY5A 4Z0KA 1D6WA 4AOQA 2PWXA 1Y3UA 4Y0YE 2QA9E 3BG8A 3ZZAA 4LOYH 3UWIA 1SGEE 4BAOB 2VIQA 1GMCG 1IQEA 1H9IE 1P2KA 1NESE 2BXUH 3UR9A 4NA7A 1AVWA 2GKVE 3SI3H 2BY8X 1CBWC 2OK5A 3AVZA 1NRSH 2OINA 1NZQH 4MNWA 1G30B 1O5BB 1E38B 1W7GH 2G4UA 1C2LA 2ZP0H 2ZU1A 4BAQB 3SU5A 1KTSB 5GWZA 1A3EH 2ALVA 3LT3A 3TNSA 4X8TH 3A7XA 2SGEE 3T28A 1GI9B 1FIWA 1BRCE 1O2LA 1ZR0A 2BDBA 3A7VA 4ZXXH 2VH6A 3QUMP 5DP8A 1NC6A 2G81E 1O2YA 1TPPA 2GX4A 3NK8A 3RC5A 1TBRH 1Z71A 2EI6A 3RXBA 4ABBA 3TJOA 1SLUB 1GI3A 4VGCC 2FIRH 2VWLA 3S7KB 2J95A 2XTTB 4BXWA 3F1SB 4CHAB 4WXVA 5DP3A 3LC5A 4F49A 3D65E 1FDPA 3T62A 3M7UA 4AFQA 2H9EH 2Y81A 4NZLA 4XBBA 2HPQH 2ZTYA 5TJXA 2FPZA 4CRFA 2STAE 1GMDF 5JYIA 4BTUB 2XC0A 2ZDMA 3RXVA 1SR5C 2G5VA 3HKIB 1A0LA 4JCNA 3RXPA 1OYTH 1ZMLA 3CS7A 1AWHB 3UREA 1GI6A 5J4QA 4FUIA 2OBQA 4IC6A 3ZVAA 3U8RH 4I8JA 1MKWH 1W13U 2ZIQH 4GCHF 2PTNA 1AWFH 1TWXB 2FMJA 3GISB 1C2GA 5DP9A 1WCZA 2Z7FE 4X1QU 1A0JA 2R2MB 8ESTE 1DS2E 1MH0A 1TMBH 1C5TA 1AZZA 4GVUA 2P93A 3FP8E 4LK4A 4TWYA 3SJ9A 2GD4B 8KME2 4JZEH 4TWWA 1IQIA 2C8XB 3E6PH 3UPEA 1DUEA 5JBAS 2Z9IA 3M5MA 3PWCA 1P2NA 4Y8YA 1SHYA 3RXTA 4I32A 1O3JA 1MBQA 3RXIA 2A7HA 5EXMA 3SHAH 1XUIA 3DFJA 1DICA 4J1YA 4CBOA 3P17H 5A0CA 4AG2A 1KXBA 3SJOA 3RXKA 1O5CB 3EDXB 1THSH 4B73A 3TNTA 1BHXB 3OY6U 1BTXA 1YPLH 8GCHG 1RIWC 3P70B 3BTDE 1GJAB 3K2UA 1GHWH 5EQSA 3A82A 1UTJA 3GCOA 1XXFA 1Z6JH 2NU0E 1HFDA 1GI8B 2BLWA 3PTBA 3E16B 4FUFA 1BCUH 1ZRKA 1GBAA 2J9NA 4U01A 3SJIA 1DDJA 1EZQA 1T8OA 3E1XB 3OYPA 3B23B 4AFUA 1MZAA 1TGTA 2AMQA 2F4LA 1N8OB 3E3TA 5FX5A 2Q6DA 2A2XH 1ZPCA 1XM1A 2J2UA 1BDAA 3F68H 3RU4D 3U8TH 3BIVH 2ANYA 3V0XA 5J4SA 5C1XA 1TRMA 2JH5D 1BHXF 1ETSH 2YNAA 1QFKH 1O2KA 2C90B 4GUXA 2OC8A 5E0JA 1MU6B 1DX5M 3SUGA 2Q6FA 4DURA 2Z3EA 3GY3A 3M36A 1V2NT 4ESTE 3FANA 1NROH 3ITIA 2XC4A 2WUCA 1MD8A 3IITA 4CR5A 1GBMA 3C1KA 4JYTA 4MVNA 4X0WU 3KN2A 2I6QA 3VB3A 2C4FH 1GJ6A 1SFIA 4HGCA 1DPOA 5DP4A 1SVPA 1XX9A 2I6SA 5H4IB 4JZ1A 3RXRA 3BTKE 1LPZB 4FU9A 1BTYA 1C1RA 1C5LH 1GBTA 1KLJH 1EXFA 1GCDA 2HRVA 2SGPE 1FAKH 4NFFA 2G52A 1YPJH 1SL3A 4TPIZ 2H6MA 1BBRK 1GL0E 1TX8A 1YLCA 2PW8H 3H7OA 4ZHLU 3TH3H 3KEEA 1QGFA 1MTNB 1NFUA 1AGJA 3PWBA 2A32A 4K8BA 2G00A 4Y10E 1EPTC 1QHRB 1JIRA 5K7RA 1Z1JA 2M5TA 1QURH 1INCA 2XBVA 1TYNA 2VGCB 1WOFA 2FYQA 4D7GA 1GJDB 1YPHC 1C5UA 3SU6A 7KMEH 1TQ0B 3SU3A 1Z8IB 1CSOE 1EZSC 1WU1A 2PHBA 3GYLB 4Q2KA 1TX6A 1N8OC 2ZFQH 1GHVH 4YM9A 2ZHFH 4X6MA 2TGPZ 3A7ZA 1JRTA 1HXFH 2XBYA 1SOTA 1O3HA 1T4VH 4Q7YA 4KTSA 2IN2A 1MQ5A 1D9IA 3JZ2B 1SGFG 5SGAE 2BY9X 3OTJE 1UCYK 2ZQ1A 4IN1A 3K65B 1TABE 4FUCA 1WTHD 3BG4B 3MH4A 1ZGVA 2H5CA 4MNYA 4RSPA 1YBWA 4KGAA 6CHAB 3UY9A 2O8WA 3QLPH 1Q31A 2A0QB 1F0UA 3F9EA 3GY7A 3SU0A 2ANMH 2RCEA 2V0BA 1EB1H 4Y0ZE 3KNXA 3A8DA 3P8FA 1K9OE 3LKWA 4ABGA 3BEIB 3HGNA 3MNCA 4Y8ZA 4AZ2B 3ZZDA 1ETRH 2THFB 3LGWA 1HJAB 1NM6A 1MTNC 2FOHA 1YPGH 3QZRA 2AS9A 1NFXA 3ATIA 1XXDA 3ZZ5A 3QX5H 3DD2H 3SORA 1W11U 1THRH 3EA8A 1C5XB 1U6QA 1O38A 2TGDA 2VVVA 1LVMA 5FPSA 3UNQA 2BD7A 2Z9GA 2BZAA 1BMAA 4Y6DA 1AHTH 2UUYA 4DIHH 1TPAE 1ELFA 3H7TA 3RXLA 1C1WH 1H8DH 2IJD1 1UTKA 1LDTT 3SU4A 3V3MA 3N7OA 2O8UA 1O34A 4IBLH 1H1BA 4B71A 2A7JA 3LONA 5EODA 1OPHB 2BD4A 4LZ1H 4M7GA 1SI5H 5I46H 1EOJA 2A4RA 4E05H 2A4OA 1G2LA 3WY8A 4UFGH 4ABEA 1W0YH 1UVSH 4X6OA 5CHAC 3A8AA 3NXPA 3EQ0H 4WH6A 2SNVA 2A5IA 4NSYA 4I7YH 5LH8A 1EKBB 4NFEA 1P04A 3B8JA 1MKXK 3E8LA 5DP7A 3OSYA 1LVOA 5HYOA 1AO5A 3PB1E 1O3PB 1AVGH 1UHBB 2GVFA 1O2MA 1HAZB 4X1RU 3ZVGA 1YLDA 4DCDA 2DUCA 7GCHF 2IPHA 1NY22 4YT7H 3M5NA 1AFQC 5EQQA 4X1SU 1N1LA 4MLFB 3ZZCA 1V2KT 4ASHA 4K1SA 1XUFA 2ZGXH 1DWCH 1QA0A 2ODPA 4X8VH 1NTPA 4INLA 4DVAU 2VWNA 2SFAA 1O5AB 1W3CA 2ZHDA 2ZU4A 1ZHPA 1V2PT 3ODDA 1OS8A 1J17T 4AYYB 2BQ6B 5GNDA 3ZVEA 3FVFB 2WPKS 4WY3A 4ZHAA 3EE0B 2P95A 4ABFA 4OS2A 5C1YA 1GHBF 2XBWA 3GY6A 1O32A 5K0HA 4Y8XA 3QWCH 2H9TH 3MU0A 1T7CA 2ANWA 3ZVDA 6LPRA 1Y3XA 1C1VH 3OY5U 1YKTA 4YT6H 1TGSZ 4Q80A 1Z1IA 1K1MA 3PYHA 5C20A 1BBRH 5F8ZA 5GXPA 2G5NA 1LHEH 3GOVB 2ZPQA 4NG9H 2F91A 1D3DB 1F0RA 4JYUH 1OYQA 1G2MA 1ACBE 4GCHG 2GCHF 3QGNB 3UOUA 1SGQE 3O8CA 3S7HB 1C4V2 1NU9A 2K1QA 2B7DH 1HNEE 3RXMA 4RI0A 1UTLM 1LHCH 3SV6A 9ESTA 4B6FA 3SGQE 1HAGE 2G4TA 2HNTC 4AN7A 1K1IA 1C5WB 1BMNH 2FZZA 2OBOA 2TGAA 4DIIH 1QJ6B 3K6ZA 3RU4E 3SNEA 4AFSA 1GBHA 1L1NA 1A3BH 1FZZA 5T6GA 5HGGA 1C5YB 1GJ4H 4NA8A 1CA0B 4Y71A 4R8TB 1S82A 1CT4E 3A83A 1YYY1 4HFPB 1A5IA 3Q00A 5FPYA 3M3SA 1GHAF 4K69A 1C1TA 3AW1A 5A8ZA 1F0TA 1L2EA 4OS1A 1UCYH 1AMHA 3QK1A 2RDLA 3GCNA 3PMJA 1HAIH 3GCHB 1GDNA 3A7WA 3SYJA 1ZSLA 1KXEA 1P9SA 1RS0A 2GCTB 5PTPA 1LQDB 1VITF 3G01A 2R3YA 1IAUA 1MUEB 3SQHE 3ODFA 1FONA 4MNVA 1RRKA 5AVDA 2ZDAH 3ZZ7A 1AU8A 1D6RA 4X2VA 1PJPA 2TPIZ 1NRPH 5C5NA 1O3FA 4THNH 1E0FD 1O3GA 1BTWA 1GBIA 2DE9A 2FI4E 1IQKA 3RC6A 5IYTA 1DWDH 2GZ8A 3RXCA 2VIVA 1RD3B 2ASUB 1FV9A 3ENSB 1C2EA 1CE5A 3BIUH 1S6HA 5TCCA 5GDSH 1ZSKA 1ESBA 1PPHE 2F3CE 2PUQH 1BJUA 1UTMA 1PFXC 5JPMH 2ZFFH 5FCRA 4DW2U 1P2IA 1ELAA 1UTNA 1Y3YA 1S85A 4K8YA 1DT2A 1LMWB 1OX1A 4WJG2 3RXQA 4O3TA 3P95A 2FTLE 1BRAA 1GVZA 5DG6A 1GBCA 4NIWA 1FN6A 2VIOA 2FI3E 1JOUB 5C3NA 1DOJA 1PYTD 3M61U 5AFYH 4B76A 2GV6A 1ARBA 4FVBA 2BLOA 1S81A 1FPCH 4BAHB 1HPGA 2FYRA 1MU8B 4WMFA 3MYWA 4YLUA 2ZI2H 1SQAA 2ZFTA 5E2PA 2WYJA 1O2ZA 2JH6D 1K22H 2W26A 2J38A 4A1TA 5T6DA 5E8EH 5EXLA 4NGAH 1O33A 4ABDA 1J15A 5ESTE 2OQ5A 1K2I1 2QCYA 1LPKB 4FU8A 3QTOH 2G51A 3QO6A 3F6UH 1BMMH 3EA7A 4K1TA 1HB0B 3MU4A 1ZJKA 2A4QA 4XOJA 2Y7ZA 2ODQA 1T31A 2GDEH 3KHVA 2ILNA 3SN8A 4M9FA 4B75A 1JBUH 4NIVA 4H42U 2VU8E 4GHTA 3PV4A 3V13A 4E7RG 1SC8U 4JZIA 3A85A 2TGTA 2WPIS 3SBKA 5HXFA 1LKBA 2O8LA 4TPYA 4DG4A 3GY8A 1ELTA 1ANEA 1AB9C 1UTQA 2BHGA 2XC5A 2D8WA 2VB0A 1C5OH 1BITA 1OWHA 1GCTC 2H5DA 1RTKA 3QZQA 1N6XA 2GMTC 2ZPRA 1CA8B 1UMAH 3L33A 1FY4A 1RTLA 3U9AH 3CP7A 1SGDE 4ZXYH 1TX7A 4ZROA 1TQ7B 3PV2A 1YC0A 3RXGA 1WYKA 1YCPK 4XSKU 1KLIH 1SGIB 4B2AA 2D2DA 3RMNH 1G37A 4CRAA 1P05A 1O2TA 3VFEA 3A8BA 3QN7A 4B6EA 2PKSC 1O3KA 2IJOB 2BD5A 5DK1A 1AE8H 4UE7H 7LPRA 4ZH8A 2BY6X 2UUJB 1RGQA 2V3OH 3LH3A 1C2HA 3MTYA 1O2OA 3QDZB 3EA9A 3RLYH 5C2ZA 4NA9H 4RKJB 4AG1A 3GY4A 2OQUA 5GCHG 3Q3XA 3M37A 3ZV8A 3SV9A 5EU8A 5FCKA 4A7IB 1GDUA 2Y5GA 3F9GA 2CV3A 4OS5A 3FZZA 3AK5A 1EASA 1D3QB 2GT7A 1DXPA 2BD2A 1BTHH 5HM9A 1P02A 5FBIA 1CQQA 2P8OB 3UOPA 4BOHA 1ETTH 2EEKA 1EZXC 2FOEA 4A1XA 2BX3A 5EOKA 1Y5BT 1AN1E 4K2YA 5DJ7A 5BRRE 2PKAA 3A84A 1K1JA 5DP6A 3MU1A 3ATMA 1O3DA 3HGPA 1HUTH 2FM2A 2KAIA 3RXAA 3T2NA 3A87A 3KCGH 2HGTH 1Y5UT 3O8BA 1EATA 1GDQA 1V2QT 4F4OC 1O3NA 1SGYE 4ISIH 1BB0B 3BSQA 2HALA 2QGRA 1IHTH 1QBNA 1V2JT 1YM0A 4J2YB 1PYTC 2AYWA 1K1LA 2BZ6H 4CHAC 1TIOA 1HAYB 2ZTXA 1D3PB 1FI8A 1P06A 2A1DB 1AZ8A 1QQUA 1PPZA 3VGCB 1P3CA 1C5QA 4NSVA 2AGGX 2AMDA 4E06H 3AW0A 5ESBA 1GI4A 3GCTF 1QB9A 3SU2A 3W94A 1BJVA 2W7UA 1NRQH 1EUFA 4MPXA 3PO1B 4WF8A 4B2BA 1C4U2 2CMYA 1S0RA 2R0KA 2RA3A 4XBCA 1HRTH 1IQMA 1VGCB 5EXNA 1DLKB 4INHA 2FOAA 1GGDB 2GT8A 5LPEA 1P0SH 1OP8A 3GDUA 1L0ZA 2WV9A 1C5NH 2FOMB 1GBEA 5EGMA 1GBBA 3LDXH 1BOQA 2BDAA 1OKXA 2ZPSA 5EQRA 1MTUA 3ZYDA 1J8AA 2ZTZA 4O03A 4ABAA 1G3CA 3A88A 4NIYA 2TIOA 4Z6AH 3PLKA 4BANB 3AASA 2FODA 1CT2E 4WMEA 1YP9A 1O5EH 1O0DH 2BDYA 3NCLA 2OC7A 2ZDKA 7ESTE 2NWNA 6GCHF 4NZQA 5A8XA 1V2ST 1EP5A 1Y3WA 1V2WT 1GHBG 1XUJA 4ISOA 3M3TA 4ABHA 1W8BH 2ZCHP 2GGVB 3BEFB 4KTCA 4AGKA 1HJ8A 2OXSA 4AB8A 3ZYEA 1VR1H 1K1PA 1SGCA 2FO9A 2PGQB 3K9XB 2B0FA 4D76A 2BVXH 3A7TA 1NS3A 1TOCB 1ELBA 1O2VA 4FUDA 1EZUC 1UO6A 2Y5FA 2PLXA 4AB9A 4GSOA 1MMJN 1Y59T 2P59A 3MH5A 1MAYA 2BX4A 4RKOB 2ZFSA 4Y11E 1VZQH 1ANDA 1GHZA 1GMCF 3UQVA 4ZHMU 1GJCB 2BVSH 3MWIU 3Q3YA 4BTTB 3D23A 3BTGE 4IMQA 1QL8A 1TGNA 3SI4H 3UIRA 2BMGB 2OC1A 1XVOA 2YNBA 3ESTA 3RP2A 4A6LA 3GYMA 1TALA 1TMTH 1QJ1B 1C5MD 1O39A 1FY8E 1QCPA 4X1NU 1V3XA 2BY5X 3LGTA 4Y76A 1SOZA 1BMLA 1GI0A 4YOIA 3EGKH 3ZV9A 1NO9H 3C27B 2WPHS 1OP0A 3TK9A 2F9VA 2JETB 1S0QA 2UWLA 3K6YA 3M7QA 4YOGA 4MQAA 4CBNA 3U1JB 3JZ1B 2ZWLH 4H6SB 3DA9B 1CGJE 1G3EA 1MZDA 1V2RT 3BTEE 1ZGIA 4MPUA 3TH4H 1VITG 5E2OA 1VCPA 1G3BA 1KSNA 2WINI 1TB6H 1IQFA 1P11E 4B74A 3AAVA 4D9RA 3SUFA 3B9FH 4XBDA 1QRWA 5BPEA 2WZQA 1CHOF 1L1JA 2VGCC 4NWKA 3SW2B 1V6DA 2A5AA 2ZCLP 2ZHWH 3OTPA 4A5TS 3A7YA 3Q77A 1AQ7A 1O3IA 5DPAA 1P03A 1YF4A 4DGJA 9LPRA 2ZDNA 2FOBA 2AMPA 1SQTA 1WBGB 1CGIE 2ZECA 1DWEH 1T8LA 1CHGA 4NWLA 1DY8A 1PPEE 3P8NA 1V2LT 5JB8S 4GLYA 3RXOA 3F9FA 1O5GH 1BTUA 2VBCA 1E34B 3STJA 2UUFB 1GBLA 4KKDA 1XUHA 3T25A 4ZAEA 3O8DA 5A2MH 2J34A 3BG4C 3SU1A 3ZZ8A 1C9PA 4FU7A 2EC9H 1FPHH 3KQCA 1NRNH 5FXLA 3IWMA 5GPIB 6CHAC 2Y82A 5CMXH 1GJ5H 3FP6E 1JXPA 3UTUH 2BLVA 4NIXA 1AFEH 1FXYA 1XMNB 4I33A 3U8OH 1FUJA 3BTME 1TNIA 4ISNA 3BN9A 1LHDH 1ANCA 3PM3A 1D4PB 4UONA 3E91A 2GTBA 5LGOA 3TIUA 2A5KA 4FUJA 1O3BA 4UDWH 1HJAC 1GPZA 2FS9A 2Z3CA 1P2QA 2G8TA 3TVJB 1BTZA 2QXJA 4NCYA 1PQ8A 4X2YA 2RA0A 1LVYA 1YPHE 1MAXA 5ABWA 1F7ZA 3ZZBA 3GDVA 1HBTH 3W95A 2ZA5A 1MCTA 2VWOA 1O3MA 5AHGH 1C2JA 1S6FA 3OX7U 2AIQA 1C1MA 2ZGHA 3EAJA 1Q2WA 1O2IA 2QIQA 2NU1E 1GJ9B 3UNSA 3LGUA 2BXTH 2WV4A 4I8HA 1HAVA 1EB2A 1SBWA 3LPRA 2SNWA 5DKMA 1QY6A 2AFQB 2C93B 1UK3A 2C3SA 1NN6A 3MNXA 1PQ5A 1P09A 3MFJA 3RXUA 2G55A 1XKAC 1IHSH 1O36A 3IG6B 2ZEBA 1GMDG 2ZC9H 2BB4A 4CRGA 2EI8A 4ZKRU 4OGXA 3TJNA 2FESH 4WMDA 5DO4H 3TGKE 2QXIA 4D9QA 2ZQ2A 2H9HA 1FAXA 2HNTF 2PR3A 1C2FA 1ORFA 1AD8H 1T8NA 1ELVA 1EOLA 3V12A 3RXSA 1C1OA 4BNRA 2UWOA 1DM4B 1HAVB 1P3EA 1QR3E 2BD3A 4E7NA 1IQGA 1ARCA 2XNIA 1BBRE 1C1QA 1HAPH 1GVKB 1C5PA 3LGIA 2CN0H 1J14A 1AUJA 1EAXA 1GBDA 5GIBA 1AKSA 2OTVA 4DY7B 4K1EA 1Z8RA 4YZUA 3HK6B 1Z7KA 5TCAA 2VVUA 2LPRA 4OGYA 3RMLH 3VXEH 1P01A 1OOKB 4BXSA 1QIXB 1SB1H 2WPLS 1TPSA 2BOHB 2BDIA 5F6MA 3MO6A 1CU1A 2VIPA 5FPTA 2R2WU 1V2OT 1XUKA 4YOJA 1GG6B 2ZKSA 4SGBE 1C2IA 1G36A 2QV1A 1BTPA 1SPJA 1UTPA 1CGHA 2OP9A 1WTGH 1ZZZA 3FP7E 2O9QA 1KYNA 2BOKA 4H6TA 3S9AA 3SJKA 1TRYA 2F9OA 2VIWA 3M35A 3MO3A 1YCPM 1FLEE 1OWDA 2XRCA 4FUEA 3MNSA 4MDSA 1MTSA 2FTMA 1UCYE 1O2RA 4LXBH 1H8IH 3SOSA 4RN6A 1MTVA 1DANH 3FFGA 3TU7H 2QXHA 2SGQE 2Y7XA 5EPNA 2F9NA 2ZGBH 1TOMH 1A7SA 2ZU2A 1DSUA 1P2JA 1OWKA 1A5HA 1SLWB 3Q76A 5EPYA 1OP2A 1CBWB 3RUOA 2NU4E 4MNXA 1OSSA 1CT0E 1SGPE 3MU5A 5F03A 4YTAA 5E0GA 2CF8H 3UFAA 1RTFB 2FWWA 3ATKA 1A1RA 1CO7E 4GHQA 1C2KA 1HAHH 1UVUH 1V2UT 2V6NA 4AX9H 2FX6A 2O8TA 2W3KA 1QTFA 2SGFE 1C4Y2 5AFZH 2BY7X 4OS6A 4HTCH 3PLBA 1NU7B 2QY0B 4MPVA 1G32B 4GPGA 3UUZA 1CA0C 2JKHA 4VGCB 3M5LA 1OWIA 2Q1JA 1Y3VA 1HIAA 2BTCE 1RFNA 1GI2A 5HMAA 1GBJA 4OM9A 1F92A 1HAOH 1ZRBA 1S5SA 2R9PA 4FXGH 1AIXH 1ZTKA 2AEIH 1TNGA 3CS0A 4IS5A 1BUIA 1ELDE 4DJZB 3SUEA 3KQBA 2FLRH 1O2PA 1O2XA 2EA3A 2BDGA 3GCHC 1C1PA 1G3DA 2HVXA 1QRZA 2IOTA 2GCTC 1EAWA 2D26C 3TK6A 4AFZA 4UEHH 2TBSA 2P94A 1QB6A 2GZ9A 2VIDA 2ZDVH 1FNIA 2OLGA 3GICB 1MKXH 4DOQA 4JMYA 1LVBA 4UFDH 1B7XB 1QB1A 3HKJB 4BAKB 4WXIA 3SUDA 3ZVBA 4MPWA 2AGIX 5G4BA 4CH8B 5DP5A 2OUAA 3VB4A 3SGBE 1VJAU 3RXDA 1HIAB 2OD3B 4Y7BA 3VB6A 2R0LA 2ANKH 2Z3DA 2ZNKH 1E35B 1KTTB 2HNTE 4X2WA 4TY6A 4KP0A 3RXHA 1S84A 3PMHB 1LHFH 1TNHA 2ODYB 3ZZ6A 1BZXE 3RXJA 1QJ7B 2UUKB 3U69H 1UJ1A 2FEQH 2QYIA 3S69A 2TRMA 2GDDA 2PTCE 2SGAA 1GL1A 1K1NA 5EW2H 1K1OA 3E0NB 4I8LA 2P3TB 3SGAE 3ZZ4A 1UTOA 1O3CA 2W3IA 3ATWA 3SZNA 2B8OH 3FZDA 4X2XA 3VEQB 5IDKA 3S9CA 2ZGCA 5F8XA 2A7CA 4IN2A 3S9BA 2HWLB 1AY6H 1EJAA 2AIPA 1KLTA 2QC2A 1QNJA 3O8RA 1RIWB 1X7AC 3QTVH 4ZUHA 1P9UA 4JK6A 2F9PA 1HCGA 3VB5A 1VCQA 2B5TB 1NT1A 1CHOG 1W12U 1OXGA 1JMOH 3BTFE 4XE4A 1UVOA 5A0AE 2ZZUH 2STBE 3GY2A 4OS7A 5L6NH 4A1VA 1GMHF 1K28D 2FOFA 4ZKNU 3RXFA 3TGJE 1Z8JB 2Z6BD 2V3HH 4IGDA 3A86A 4Y7AA 1L4ZA 1J16A 2BQWB 2FX4A 1GWAA 3SNAA 1ABIH 2AGEX 4CH2B 3KGPA 1KIGH 1EPTA 1MTWA 4QT8C 5JDUB 1A5GH 1ANBA 1TAWA 4JZDH 4X1PU 4YO9A 3TJVA 1VITH 1GBKA 3KF2A 1J9CH 2F83A 3SQEE 3LH1A 3RM2H 4I8GA 4SGAE 1TGBA 3BTTE 2OCVB 1ELEE 1FJSA 1P2OA 2LNCA 2FS8A 5I25A 5JBCS 1BA8B 1UK4A 1YPEH 2WUBA 1DUAA 1O3AA 1XUGA 2PSXA 1IQNA 1F5LA 2FP7B 2PV9B 3TLOA 1FMGA 1TBQH 3URDA 1SGNE 2BDCA 4GAWA 1FY5A 2VINA 1DLEA 4IMZA 4CRBA 1L4DA 4Q7ZA 1XVMA 2PKAB 2QXGA 1DXWA 1TPOA 2PGBB 1HXEH 2KAIB 1KXDA 2W7SA 1EPTB 1NPMA 1ABJH 2HLCA 7GCHG 3I78A 3Q3KA 2VWMA 1LHGH 3P8OA 4BTIB 2Z9LA 5FX6A 3E0PB 3RDZA 5ETXA 1LCYA 2HOBA 1ZMJA 1O3OA 4H4FA 3HPTB 2F9UA 1HJ9A 2P8OC 2QF0A 2J92A 3SO3A 1JWTA 1V2TT 2O8MA 4X8UH 1QBOA 2SGDE 4IC5A 1D3TB 1N6YA 3PV5A 3SZEA 3H5CB 4CRDA 4YESB 5EG4A 1EP6A 2ZU3A 1F2SE 4FVDA 1VJ9U 2C8WB 3BV9B 5LPFA 1O30A 1H4WA 4ISHH 2PUXB 1HAXB 3FAOA 1ZSJA 2Y5HA 4WWYA 3NPSA 1P8VC 3RMMH 3TH2H 1ZYOA 4HI3A 3SNCA 2JH0D 3MH6A 5DGJA 3PMAB 2BYAX 3LIWA 5L30H 3ZZ3A 3F9HA 1A61H 3VXFH 1O2SA 1QQ4A 3PLPA 3BTQE 4MG3A 2ZU5A 3MMGA 5A8YA 3AAUA 1A2CH 1V2VT 4K3JA 1MQ6A 3D62A 1ZPBA 1SSXA 2BLQA 1IQJA 1PPCE 3VGCC 1WQVH 5T3HA 3NUMA 1H9HE 2BQ7B 3I77A 3M5OA 1A4WH 3P8GA 2CXVA 1QRXA 4FUHA 5AF9H 2GCHG 4D8NA 1TA6A 1ZPZA 1SMFE 2GP9B 3PO1C 1PPFE 3SV2H 3TJUA 1O2GH 2WHXA 1M9UA 1O3EA 1VGCC 1O5DH 1W10U 3A80A 3SNBA 1GGDC 1Q3XA 2BM2A 3VPKA 2J94A 4R0IA 1GI1A 3BTHE 4U30A 4Y79A 1P12E 1QBVH 3UNRA 4ZKOU 2BD9A 3DHKH 3D49H 3LOXA 2QN5T 1EJMA 1HYLA 1GHAG 3I29A 2FOGA 1C1SA 3T29A 1QA7A 2GZ7A 2XWBI 4UFFH 2W5EA 2ZF0H 1WAYB 2CGAA 1W2KH 4JYVH 1BIOA 1B0EA 1UVPA 5LPRA 1Z6EA 1PPGE 1W14U 3KQEA 2C8YB 1EX3A 2B9LA 1THPB 1KY9A 1O2WA 1LQEA 2GV7A 1YCPH 1ESAA 5CHAB 3M3VA 2J4IA 1WQSA 1PQ7A 1RXPA 1SGTA 5T6FA 1MBMA 1K21H 1B5GH 1LO6A 1FQ3A 4Q7XA 1E37B 2XBXA 4WH8A 1H9LB 1ELCA 4AGJA 3LC3A 3OU0A 3SHCH 3KL6A 8LPRA 2EI7A 1TMUH 1AI8H 1JIMA 4CRCA 1P2MA 1NRRH 3DUXH 4B1TA 5C67A 1XKBC 4ABJA 5GCHF 3VB7A 2H1UA 1ZTJA 2ZHQH 4BAMB 5JBBS 3L3TA 1AFQB 1SQOA 4K5ZA 1O2NA 1PQAA 1DSTA 3MU8A 2CJIA 2XCFA 3E90B 1Y8TA 5JB9S 1O5FH 1DE7H 4KELA 2P3UB 1GVLA 1LPGB 5A0BA 1TRNA 1HDTH 1F5RA 2VNTA 2Y80A 1GI5A 1DFPA 4JZFH 1LTOA 1YPMH 1CVWH 2Z94A 1P57B 1SGRE 3HK3B 5B6LA 5A09A 1Y5AT 3L6PA 1UHBA 2BVRH 1EQ9A 5E0HA 2F9BH 2D1JA 2JETC 3U98H 1C5ZB 4X6NA 5FHTA 2XYAA 1GHXH 1C5RA 1C5SA 1E36B 1O31A 3EYDA 3CENA 4X8SH 1F5KU 3RC4A 1KXFA 2QF3A 4ZMAH 1SFQB 3ZVCA 1SLVB 1P10A 1TNKA 2VJ1A 1QL7A 1FN8A 3M7TA 3SJ8A 2XWAA 4CREA 8GCHF 1FIZA 1IQLA 1GBFA 5T1VA 3T26A 2FXRA 4O97A 3ZZ9A 3UWJH 1L1GA 1UVTH 1AVXA 5FBEA 4ABIA 1DWBH 3V7TA 2NU3E 3LJOA 1KDQA 2ULLA 4LZ4B 1NFWA 1V2MT 3LU9B 4INKA 2VH0A 2ZHEH 1ZLRA 3TK5A 1WSSH 1O2JA 1EJNA 2AH4X 1O37A 2CF9H 5HM2A 4A92A 5L2ZH 3MH7A 1TA2A 2ZCKP 1BRBE 1ZHRA 2Z9JA 3DT0H 3NKKA 3P92A 3ELAH 2HPPH 3U1IB 1EAUA 1ZHMA 4X6PA 4XDEA 2XXLA 3A8CA 1SGFA 3MOCA 2ZFRH 1OWJA 2FDAA 3T27A 4ISLA 1QL9A 3HATH 4MTBA 1GI7B 1FY3A 3RMOH 2ZFPH 1ID5H 2Q6GA 5JBTA 1O3LA 4HZHA 5FAHA 1O2UA 1C5VA 1YPKH 4YLQH 3KQDA 5B6OA 1KDQB 1O35A 1TONA 2PSYA 1TFXA 1GJBB 2RG3A 4UD9H 3TGIE 1T32A 3A81A 5GJ4B 2WYGA 3R0FA 4JK5A 2P3FH 2ALPA 1IOEA 3PROA 4FUBA 1EAIA 2A45B 2BD8A 2ZDLA 3SNDA 4I31A 1MKWK 4XFQA 1TE0A 2DE8A 1BRUP 1VCWA 1O2QA 1GMHG 1MD7A 3BEUA 3MHWU 1ZOMA 3URCA 2UWPA 3P6ZB 3GDSA 3LJJA 2CHAB 1OWEA 1DVAH 1JRSA 4CR9A 1ZTLA 1MCVA 2P16A 1W7XH 4OS4A 3MNBA 5EW1H 3PTNA 4KTUA 5L2YH 1AE5A 1F0SA 3LGVA 1YGCH 3TPIZ 2ESTE 2VVCA 3QGJA 2FLBH 2XCNA 2PFEA 3H09A 1BQYA 3TITA 1UK2A 2H2ZA 3MO9A 1T8MA 3BTWE 1GJ8B 3SV8A 3T5FH 1DY9A 4U2WA 2C8ZB 1GHYH 4O3UA 1C1NA 1KXCA 1GJ7B 4B2CA 1B0FA 1ZJDA 3A89A 1IQHA 1HLTH 3RLWH 2YOLA 3PMBB 4I8KA 1WV7H 3SV7A 4TY7A 3DFLA 1S83A 1BT7A 3RU4T 2FI5E 4PROA 2XW9A 1ELGA 4AYVB 3STIA 3NZIA 1TNLA 2ZGJA 2V35A 1AKSB 1WXRA 1Z8GA 3GCTG 4TYDA 1T4UH 3UR6A 1DITH 4IW4E 1G9IE 4UFEH 1TNJA 2WPMS 3UQOA 3ZVFA 2Y6TA 3MI4A 1W0ZU 1ESTA 1HGTH 2A4GA 3KIDU 4DT7B 3RM0H 1C9TA 5F8TA 1O2HA 1FY1A 2A31A 1TBZH
chains in the Genus database with same CATH superfamily
2CHAC 2ZG0H 1AUTC 1A0HB 2ZO3H 5C5OA 2Z9KA 5C1UA 1A46H 2OC0A 3R3GB 1TGCA 1AB9B 1SLXB 2AERH 3S0NA 1NFYA 3NWUA 4U32A 1GCTB 4K60A 4O9VA 1WUNH 2AHME 2NU2E 1ZMNA 4FUGA 6GCHG 2GMTB 1KXAA 2YMSD 2A2QH 5CE1A 4D7FA 1RJXB 1LKAA 2FOCA 1HV7A 3RXEA 1GG6C 2BDHA 4AORA 2R3UA 1SHHB 2WV5A 3LGYA 1C2MA 1SG8B 1C2DA 6ESTA 1TLDA 2QAAA 4ZKSU 4WVPE 2PKSB 2WPJS 3ATLA 3BF6H 1PPBH 1C1UH 3GY5A 4Z0KA 1D6WA 4AOQA 2PWXA 1Y3UA 4Y0YE 2QA9E 4HG6A 3BG8A 3ZZAA 4LOYH 3UWIA 3F0OA 1SGEE 4BAOB 2LELA 2VIQA 1GMCG 1IQEA 1H9IE 5EIYA 3CNRA 1P2KA 1NESE 2BXUH 3UR9A 4NA7A 1AVWA 2GKVE 3SI3H 2BY8X 4ASUD 1CBWC 2OK5A 3AVZA 1NRSH 2OINA 1NZQH 2EY4C 4MNWA 2XNDD 1G30B 1O5BB 1E38B 1W7GH 2G4UA 1C2LA 2ZP0H 2ZU1A 4BAQB 3SU5A 1KTSB 5GWZA 1A3EH 2ALVA 3LT3A 3TNSA 4X8TH 3A7XA 2SGEE 3T28A 1GI9B 1FIWA 1BRCE 1O2LA 1ZR0A 2BDBA 3A7VA 4ZXXH 2VH6A 3QUMP 5DP8A 1NC6A 2G81E 1O2YA 1TPPA 2GX4A 3NK8A 3RC5A 1TBRH 1Z71A 2EI6A 3RXBA 4ABBA 3TJOA 3U28C 1SLUB 1GI3A 4VGCC 2FIRH 2VWLA 3S7KB 2J95A 2XTTB 4BXWA 3F1SB 4CHAB 4WXVA 5DP3A 3LC5A 4F49A 3D65E 1FDPA 3T62A 3M7UA 4AFQA 2H9EH 2Y81A 4NZLA 4XBBA 2HPQH 2ZTYA 5TJXA 2FPZA 4CRFA 2STAE 5C0UA 1GMDF 5JYIA 4BTUB 2XC0A 2ZDMA 3RXVA 1SR5C 2G5VA 3HKIB 1A0LA 4JCNA 3RXPA 1OYTH 1ZMLA 3CS7A 1AWHB 3DSGA 3UREA 1GI6A 5J4QA 3KYGA 4FUIA 2V7QD 2OBQA 4IC6A 3ZVAA 3U8RH 4I8JA 1MKWH 1W13U 2ZIQH 4GCHF 2PTNA 1AWFH 1TWXB 2FMJA 3GISB 1C2GA 5DP9A 1WCZA 2Z7FE 4X1QU 1A0JA 2R2MB 8ESTE 3DSOA 3F3BA 1DS2E 1MH0A 1TMBH 1C5TA 1AZZA 4GVUA 2P93A 3FP8E 4LK4A 4TWYA 3SJ9A 2GD4B 8KME2 4JZEH 4TWWA 1IQIA 2C8XB 3E6PH 3UPEA 1DUEA 5JBAS 2Z9IA 3M5MA 3PWCA 1P2NA 4Y8YA 1SHYA 3RXTA 4I32A 2YMSC 1O3JA 1MBQA 1SKYE 3RXIA 2A7HA 5EXMA 2W6JD 3NRLA 3SHAH 1XUIA 3DFJA 3N7EA 1DICA 4J1YA 4CBOA 3P17H 5A0CA 4AG2A 1KXBA 3SJOA 3RXKA 1O5CB 3EDXB 1THSH 4B73A 3TNTA 1BHXB 3OY6U 1BTXA 1YPLH 8GCHG 1RIWC 3P70B 3BTDE 1GJAB 3K2UA 1GHWH 5EQSA 3A82A 1UTJA 3GCOA 1XXFA 1Z6JH 1HFDA 2NU0E 1GI8B 2BLWA 3PTBA 3E16B 4FUFA 1BCUH 1ZRKA 1GBAA 2J9NA 4U01A 3SJIA 1DDJA 1EZQA 1T8OA 3E1XB 3OYPA 3B23B 4AFUA 1MZAA 1TGTA 2AMQA 2F4LA 1N8OB 3E3TA 5FX5A 2Q6DA 2A2XH 1ZPCA 1XM1A 2J2UA 1BDAA 3F0PA 3F68H 3RU4D 3U8TH 3BIVH 2ANYA 3UB0A 3V0XA 5J4SA 5C1XA 1TRMA 2JH5D 1BHXF 1ETSH 5EJZA 2YNAA 1QFKH 1O2KA 2C90B 4GUXA 2OC8A 5E0JA 1MU6B 1DX5M 3SUGA 2Q6FA 4DURA 5HIZA 2Z3EA 3GY3A 3M36A 1V2NT 4ESTE 3FANA 1NROH 3ITIA 2XC4A 2WUCA 1MD8A 3IITA 4CR5A 1GBMA 3C1KA 4JYTA 4MVNA 4X0WU 3KN2A 2I6QA 3VB3A 2C4FH 1GJ6A 1SFIA 4HGCA 1DPOA 5DP4A 1SVPA 1XX9A 2I6SA 5H4IB 4JZ1A 3RXRA 3BTKE 1LPZB 4FU9A 1BTYA 1C1RA 1C5LH 1GBTA 1KLJH 1EXFA 1GCDA 2HRVA 2SGPE 1FAKH 2J98A 2G52A 1YPJH 1SL3A 4NFFA 4TPIZ 2H6MA 1BBRK 1GL0E 1TX8A 1YLCA 2PW8H 3H7OA 4ZHLU 3TH3H 3KEEA 1QGFA 1MTNB 1NFUA 1AGJA 3PWBA 2A32A 4K8BA 2G00A 4Y10E 1EPTC 1QHRB 1JIRA 5K7RA 1Z1JA 2M5TA 1QURH 1INCA 2XBVA 1H8ED 1TYNA 2VGCB 1WOFA 2FYQA 4D7GA 1GJDB 1YPHC 1C5UA 3SU6A 1E1QD 7KMEH 1TQ0B 3SU3A 1Z8IB 1CSOE 1EZSC 1WU1A 2PHBA 3GYLB 4FETA 2CK3D 4Q2KA 1TX6A 1N8OC 2ZFQH 1GHVH 4YM9A 2ZHFH 4X6MA 2TGPZ 3A7ZA 1JRTA 2J98B 1HXFH 2XBYA 1SOTA 1O3HA 1T4VH 4Q7YA 4KTSA 2IN2A 1MQ5A 1D9IA 3JZ2B 1SGFG 3FN8A 5SGAE 2BY9X 3OTJE 1UCYK 2ZQ1A 4IN1A 3K65B 1TABE 4FUCA 1WTHD 3BG4B 3MH4A 1ZGVA 2H5CA 4MNYA 4RSPA 1YBWA 4KGAA 6CHAB 3UY9A 2O8WA 3QLPH 1Q31A 2A0QB 1F0UA 3F9EA 3GY7A 3SU0A 2ANMH 2RCEA 2V3MA 2V0BA 1EB1H 4Y0ZE 3KNXA 3A8DA 3P8FA 1K9OE 3LKWA 4ABGA 3BEIB 3HGNA 3MNCA 4Y8ZA 4AZ2B 3ZZDA 1ETRH 2F43B 4Q4LA 2THFB 3LGWA 1HJAB 1NM6A 1MTNC 2FOHA 1YPGH 3QZRA 2AS9A 1NFXA 3ATIA 1XXDA 3ZZ5A 3QX5H 3DD2H 3SORA 1W11U 1THRH 3EA8A 1C5XB 1U6QA 1O38A 2TGDA 2KCOA 2VVVA 1LVMA 5FPSA 3UNQA 2BD7A 2Z9GA 1UW7A 2BZAA 1BMAA 4Y6DA 1AHTH 2UUYA 4DIHH 1TPAE 1ELFA 3H7TA 3RXLA 1C1WH 1H8DH 2IJD1 1UTKA 5HKKD 1LDTT 3SU4A 3V3MA 3N7OA 2O8UA 1O34A 4IBLH 1H1BA 4B71A 3WWBA 2A7JA 3LONA 5EODA 1OPHB 2BD4A 4LZ1H 4M7GA 1SI5H 3F2GA 5I46H 1EOJA 4RT1A 2A4RA 4E05H 2A4OA 1G2LA 5EJLA 3WY8A 4UFGH 4ABEA 1W0YH 4ACAA 1UVSH 4X6OA 1SQRA 3A8AA 5CHAC 3NXPA 3EQ0H 4WH6A 2SNVA 2A5IA 4NSYA 4I7YH 5LH8A 1EKBB 2JIZD 4NFEA 1P04A 3B8JA 1MKXK 3E8LA 5DP7A 2QF4A 3OSYA 1LVOA 5HYOA 1AO5A 3PB1E 1O3PB 1AVGH 1E1RD 1UHBB 2GVFA 1O2MA 1HAZB 4X1RU 3ZVGA 1YLDA 4DCDA 2DUCA 7GCHF 2IPHA 1NY22 4YT7H 3M5NA 1AFQC 5EQQA 4X1SU 1N1LA 4MLFB 3ZZCA 1V2KT 4ASHA 4K1SA 1XUFA 2ZGXH 1DWCH 3DSPA 1QA0A 2ODPA 4X8VH 1NTPA 4INLA 4DVAU 2VWNA 2SFAA 1O5AB 1W3CA 2ZHDA 2ZU4A 1ZHPA 1V2PT 3ODDA 1OS8A 1J17T 5GNDA 2BQ6B 5HIYA 4AYYB 3ZVEA 3FVFB 2WPKS 3OEED 4WY3A 4ZHAA 3EE0B 2P95A 2HLDD 4ABFA 4OS2A 5C1YA 1GHBF 2XBWA 3GY6A 1O32A 5FL7D 5K0HA 4Y8XA 3DCLA 3QWCH 2H9TH 3MU0A 1T7CA 2ANWA 3ZVDA 6LPRA 1Y3XA 1C1VH 1WDIA 3OY5U 1YKTA 4YT6H 1TGSZ 4Q80A 2JJ2D 1Z1IA 1K1MA 3PYHA 5C20A 1BBRH 5F8ZA 4P02A 5GXPA 2G5NA 1LHEH 3GOVB 2ZPQA 4NG9H 2F91A 1D3DB 1F0RA 4JYUH 1OYQA 1G2MA 1ACBE 4GCHG 2GCHF 3QGNB 3UOUA 1SGQE 3O8CA 3S7HB 1C4V2 1NU9A 2K1QA 2B7DH 1HNEE 3RXMA 4I86A 4RI0A 2K8IA 1UTLM 1LHCH 3SV6A 9ESTA 4B6FA 3SGQE 1HAGE 2G4TA 2HNTC 4AN7A 1K1IA 1C5WB 1BMNH 2FZZA 2OBOA 2TGAA 4DIIH 1QJ6B 3K6ZA 3RU4E 3SNEA 4AFSA 1GBHA 1L1NA 1A3BH 1FZZA 3FKSD 5T6GA 5HGGA 1C5YB 1GJ4H 4NA8A 1CA0B 4Y71A 4R8TB 1S82A 1CT4E 3A83A 1YYY1 4HFPB 1A5IA 3Q00A 5FPYA 3M3SA 1GHAF 4K69A 1C1TA 3AW1A 5A8ZA 1F0TA 1L2EA 4OS1A 1UCYH 1AMHA 3QK1A 2RDLA 3GCNA 3PMJA 1HAIH 3GCHB 1GDNA 3A7WA 3SYJA 1ZSLA 1KXEA 1P9SA 1RS0A 2GCTB 5PTPA 1LQDB 1VITF 3G01A 2R3YA 1IAUA 1MUEB 3SQHE 3ODFA 1FONA 4MNVA 1RRKA 5AVDA 2ZDAH 3ZZ7A 1AU8A 1D6RA 5CDFE 2KCAA 1PJPA 4X2VA 2TPIZ 1NRPH 5C5NA 1O3FA 4THNH 1E0FD 1O3GA 1BTWA 1GBIA 2DE9A 2FI4E 1IQKA 3WWFA 3RC6A 5IYTA 1DWDH 2GZ8A 3RXCA 2VIVA 1RD3B 2ASUB 1FV9A 3ENSB 1C2EA 1CE5A 3BIUH 1S6HA 5TCCA 5GDSH 1ZSKA 1ESBA 1PPHE 2F3CE 2PUQH 1BJUA 1UTMA 1PFXC 5JPMH 2ZFFH 5FCRA 4TSFD 4DW2U 1P2IA 1ELAA 1UTNA 1Y3YA 1S85A 4K8YA 1DT2A 1LMWB 1OX1A 4WJG2 3RXQA 4O3TA 3P95A 2FTLE 1BRAA 1GVZA 5DG6A 1GBCA 4NIWA 1FN6A 2VIOA 2FI3E 1JOUB 5C3NA 1DOJA 1PYTD 3M61U 3PRDA 5AFYH 2GV6A 1ARBA 4FVBA 4B76A 2BLOA 1S81A 1FPCH 4BAHB 1HPGA 2FYRA 1MU8B 4WMFA 3MYWA 4YLUA 2ZI2H 1SQAA 2ZFTA 5E2PA 2WYJA 1O2ZA 2JH6D 1K22H 2W26A 2J38A 4A1TA 5T6DA 5E8EH 5EXLA 2PP6A 1O33A 4NGAH 4ABDA 1J15A 5ESTE 2OQ5A 1K2I1 2QCYA 1LPKB 4FU8A 3QTOH 2G51A 3QO6A 3F6UH 1BMMH 3EA7A 4K1TA 1HB0B 3MU4A 1ZJKA 2A4QA 4XOJA 2Y7ZA 1T31A 2GDEH 2ODQA 3KHVA 2ILNA 4M9FA 3SN8A 4B75A 1JBUH 4NIVA 4H42U 2VU8E 4GHTA 3PV4A 3V13A 4E7RG 1SC8U 1E79D 4JZIA 3A85A 2TGTA 2WPIS 3SBKA 5HXFA 1LKBA 2O8LA 4TPYA 4DG4A 3GY8A 1ELTA 1ANEA 1AB9C 1UTQA 2BHGA 2XC5A 2D8WA 2VB0A 1C5OH 1BITA 1OWHA 1GCTC 2H5DA 1RTKA 3QZQA 1N6XA 2GMTC 2ZPRA 1CA8B 1UMAH 3L33A 1FY4A 1RTLA 3U9AH 3CP7A 1SGDE 4ZXYH 1TX7A 4ZROA 1TQ7B 3PV2A 1YC0A 3RXGA 1WYKA 1YCPK 4XSKU 1KLIH 1SGIB 4B2AA 2D2DA 3RMNH 1G37A 4CRAA 1S6LA 1P05A 1O2TA 3VFEA 3A8BA 3QN7A 4B6EA 2PKSC 1O3KA 2IJOB 2BD5A 5DK1A 1AE8H 4UE7H 7LPRA 4ZH8A 2BY6X 2UUJB 3EE7A 1RGQA 2V3OH 3LH3A 1C2HA 3MTYA 1O2OA 3QDZB 3EA9A 3RLYH 5C2ZA 4NA9H 4RKJB 4AG1A 3GY4A 2OQUA 5GCHG 3Q3XA 3M37A 3ZV8A 3SV9A 5EU8A 5FCKA 4A7IB 1GDUA 2Y5GA 3F9GA 2CV3A 4OS5A 3FZZA 3AK5A 1EASA 1D3QB 2GT7A 1DXPA 2BD2A 1BTHH 5HM9A 1P02A 5FBIA 1CQQA 2P8OB 3UOPA 4BOHA 1ETTH 2EEKA 1EZXC 2RFKC 2FOEA 4A1XA 2BX3A 5EOKA 3PRBA 1Y5BT 1AN1E 4K2YA 5DJ7A 5BRRE 2PKAA 3A84A 1K1JA 5DP6A 3MU1A 3ATMA 1O3DA 3HGPA 1HUTH 2FM2A 2KAIA 3RXAA 3T2NA 3A87A 3KCGH 2HGTH 1Y5UT 3O8BA 1EATA 1GDQA 1V2QT 4F4OC 1O3NA 1SGYE 2XOKD 4ISIH 1BB0B 3BSQA 2HALA 2QGRA 1IHTH 1QBNA 1V2JT 1YM0A 4J2YB 1PYTC 2AYWA 4DT4A 1K1LA 2BZ6H 4CHAC 1TIOA 1HAYB 2ZTXA 1D3PB 1FI8A 1P06A 2A1DB 1AZ8A 1QQUA 1PPZA 3VGCB 1P3CA 1C5QA 4NSVA 2AGGX 2AMDA 4E06H 3AW0A 5ESBA 1GI4A 4RT0A 5IK2D 3GCTF 1QB9A 3SU2A 3W94A 1BJVA 2W7UA 1NRQH 1EUFA 4MPXA 3PO1B 4WF8A 1MABB 4B2BA 1C4U2 2CMYA 1S0RA 2R0KA 2RA3A 4XBCA 1HRTH 1IQMA 1VGCB 5EXNA 1DLKB 4INHA 2FOAA 1GGDB 2GT8A 5LPEA 1P0SH 1OP8A 3GDUA 4F55A 1L0ZA 2WV9A 1C5NH 2FOMB 1GBEA 5EGMA 1GBBA 3LDXH 1BOQA 2BDAA 1OKXA 2ZPSA 5EQRA 1MTUA 3ZYDA 2HVYB 3KQ5A 3FO8D 1J8AA 2ZTZA 4O03A 4ABAA 1G3CA 3A88A 4NIYA 2TIOA 4Z6AH 3PLKA 4BANB 3AASA 2FODA 1CT2E 4WMEA 1YP9A 1O5EH 1O0DH 2BDYA 3NCLA 2OC7A 2ZDKA 7ESTE 2NWNA 6GCHF 4NZQA 5A8XA 1V2ST 1EP5A 1Y3WA 1V2WT 1GHBG 1XUJA 3N99A 4ISOA 3M3TA 4ABHA 1W8BH 2ZCHP 2GGVB 3BEFB 4KTCA 4AGKA 1HJ8A 2OXSA 4AB8A 3ZYEA 1VR1H 1K1PA 1SGCA 2FO9A 2PGQB 3K9XB 2B0FA 4D76A 2BVXH 3A7TA 1NS3A 1TOCB 1ELBA 1O2VA 4FUDA 1EZUC 1UO6A 2Y5FA 2PLXA 4AB9A 4GSOA 1MMJN 1Y59T 2P59A 3MH5A 1MAYA 2BX4A 4RKOB 2ZFSA 4Y11E 1VZQH 2M2AA 1ANDA 1GHZA 1GMCF 3UQVA 4ZHMU 1GJCB 2BVSH 3MWIU 3Q3YA 4BTTB 3D23A 3BTGE 4IMQA 1QL8A 1TGNA 3SI4H 3UIRA 2BMGB 2OC1A 1XVOA 2YNBA 3ESTA 3RP2A 4A6LA 3GYMA 1TALA 1TMTH 3W1EA 1QJ1B 1C5MD 1O39A 1FY8E 1QCPA 4X1NU 1V3XA 2BY5X 3LGTA 4Y76A 1SOZA 1BMLA 1GI0A 4YOIA 3EGKH 3ZV9A 1NO9H 3C27B 2WPHS 1OP0A 3TK9A 2F9VA 2JETB 1S0QA 1H8HD 2UWLA 5KGOA 3K6YA 3M7QA 4YOGA 4MQAA 4CBNA 3U1JB 5KECA 3JZ1B 2ZWLH 4H6SB 3DA9B 1CGJE 1G3EA 1MZDA 1V2RT 3BTEE 1ZGIA 4MPUA 3TH4H 1VITG 5E2OA 1VCPA 1G3BA 1KSNA 2WINI 1TB6H 1IQFA 1P11E 4B74A 3AAVA 4D9RA 3SUFA 3B9FH 4XBDA 1QRWA 5BPEA 2WZQA 1CHOF 1L1JA 2VGCC 4NWKA 3SW2B 1V6DA 2A5AA 2ZCLP 1W0KD 2ZHWH 3OTPA 4A5TS 3A7YA 3Q77A 1AQ7A 1O3IA 5DPAA 1P03A 1YF4A 4DGJA 9LPRA 2ZDNA 2FOBA 2AMPA 1SQTA 1WBGB 1CGIE 2ZECA 1DWEH 1T8LA 1CHGA 4NWLA 1DY8A 1PPEE 2KCYA 3P8NA 1V2LT 5JB8S 4GLYA 3RXOA 3F9FA 1O5GH 1BTUA 2VBCA 1E34B 3STJA 2UUFB 1GBLA 4KKDA 1XUHA 3MQKC 3T25A 4ZAEA 3O8DA 5A2MH 2J34A 3BG4C 3SU1A 3ZZ8A 1C9PA 3OE7D 4FU7A 2EC9H 1FPHH 3KQCA 1NRNH 5FXLA 3IWMA 5GPIB 6CHAC 2Y82A 5CMXH 1GJ5H 3FP6E 1JXPA 3KYFA 2QF5A 3UTUH 2BLVA 4NIXA 1AFEH 1FXYA 1XMNB 4I33A 3U8OH 1FUJA 3BTME 1TNIA 4ISNA 3BN9A 1LHDH 1ANCA 3PM3A 1D4PB 4UONA 3E91A 2GTBA 5LGOA 3TIUA 2A5KA 4FUJA 1O3BA 4UDWH 1HJAC 1GPZA 2FS9A 2Z3CA 1P2QA 2G8TA 3TVJB 1BTZA 2QXJA 4NCYA 1PQ8A 4X2YA 2RA0A 1LVYA 1YPHE 1MAXA 5ABWA 1F7ZA 3ZZBA 5DN6D 3GDVA 1HBTH 3W95A 2ZA5A 1MCTA 2VWOA 1O3MA 5AHGH 1C2JA 1S6FA 3OX7U 2AIQA 2EQNA 1C1MA 2ZGHA 3EAJA 1Q2WA 1O2IA 2QIQA 2NU1E 1GJ9B 3UNSA 3LGUA 2BXTH 2WV4A 4I8HA 1HAVA 1EB2A 1SBWA 3LPRA 2SNWA 5DKMA 1QY6A 2AFQB 2C93B 1UK3A 2C3SA 1NN6A 3MNXA 1PQ5A 1P09A 3MFJA 3RXUA 2G55A 1XKAC 1IHSH 1O36A 3IG6B 2ZEBA 1GMDG 2ZC9H 2BB4A 4CRGA 2EI8A 4ZKRU 4OGXA 3TJNA 2FESH 4WMDA 5DO4H 1W0JD 3TGKE 2QXIA 4D9QA 2ZQ2A 2H9HA 1FAXA 2HNTF 2PR3A 1C2FA 1ORFA 1AD8H 1T8NA 4ACBA 5C94A 1ELVA 1EOLA 3V12A 3RXSA 1C1OA 4BNRA 2UWOA 2GJGA 1DM4B 1HAVB 1P3EA 1QR3E 2BD3A 4E7NA 1IQGA 1ARCA 2KCPA 1BBRE 2XNIA 1C1QA 1HAPH 1GVKB 1C5PA 3LGIA 2CN0H 1J14A 1AUJA 1EAXA 1GBDA 5GIBA 3ZIAD 1AKSA 2OTVA 4DY7B 4K1EA 1Z8RA 4YZUA 3HK6B 1Z7KA 5TCAA 2VVUA 2LPRA 4OGYA 3RMLH 3VXEH 1P01A 1OOKB 4BXSA 1QIXB 1SB1H 2WPLS 1TPSA 2BOHB 2BDIA 5F6MA 3MO6A 1CU1A 2VIPA 5FPTA 2R2WU 1V2OT 1XUKA 4YOJA 1GG6B 2ZKSA 4SGBE 1C2IA 1G36A 2QV1A 1BTPA 1SPJA 1UTPA 1CGHA 2OP9A 1WTGH 1KMHB 1ZZZA 3F2HA 3FP7E 3UAIC 2BOKA 1KYNA 2O9QA 4H6TA 3S9AA 3SJKA 1TRYA 2F9OA 2VIWA 3M35A 3MO3A 1YCPM 1FLEE 1OWDA 2XRCA 4FUEA 3MNSA 4MDSA 1MTSA 2FTMA 1UCYE 1O2RA 4LXBH 1H8IH 3SOSA 4RN6A 1MTVA 1DANH 3FFGA 3TU7H 2QXHA 2SGQE 2Y7XA 5EPNA 2F9NA 2ZGBH 1TOMH 1A7SA 2ZU2A 1DSUA 1P2JA 4XD7D 1OWKA 1A5HA 5C17A 1SLWB 3Q76A 5EPYA 1OP2A 1CBWB 3RUOA 1OHHD 2NU4E 1YLNA 4MNXA 1OSSA 1CT0E 1SGPE 3MU5A 5F03A 4YTAA 5E0GA 2CF8H 3UFAA 1RTFB 2FWWA 4FOUC 3ATKA 1A1RA 1CO7E 4GHQA 1C2KA 1HAHH 1UVUH 1V2UT 2V6NA 4AX9H 2FX6A 2O8TA 2W3KA 1QTFA 2SGFE 1C4Y2 5AFZH 2BY7X 4OS6A 4HTCH 3PLBA 3GS9A 1NU7B 2QY0B 4MPVA 1G32B 4GPGA 3UUZA 1CA0C 2JKHA 4VGCB 3M5LA 1OWIA 2Q1JA 1Y3VA 1HIAA 2BTCE 1RFNA 1GI2A 5HMAA 1GBJA 4OM9A 1F92A 1HAOH 1ZRBA 1S5SA 2R9PA 4FXGH 1AIXH 1ZTKA 2AEIH 1TNGA 2KX4A 3CS0A 1BUIA 1ELDE 4IS5A 4DJZB 3SUEA 3KQBA 2FLRH 1O2PA 1O2XA 2EA3A 2BDGA 3GCHC 1C1PA 1G3DA 2HVXA 1QRZA 2IOTA 2GCTC 4F48B 1EAWA 2D26C 3TK6A 4AFZA 4UEHH 1EFRD 2P94A 2TBSA 1QB6A 2GZ9A 2VIDA 2J5UA 2ZDVH 1FNIA 2OLGA 5EJ1A 3GICB 1MKXH 4DOQA 3OAAD 4JMYA 1LVBA 4UFDH 1B7XB 1QB1A 3HKJB 4BAKB 4WXIA 3SUDA 3ZVBA 4MPWA 2AGIX 5G4BA 4CH8B 5DP5A 2OUAA 3VB4A 3SGBE 1VJAU 3RXDA 1HIAB 2OD3B 4Y7BA 3VB6A 2R0LA 2ANKH 2Z3DA 2ZNKH 1E35B 1KTTB 2HNTE 4X2WA 4TY6A 4KP0A 3RXHA 1S84A 3PMHB 2WSSD 1LHFH 1TNHA 2ODYB 3ZZ6A 1BZXE 3RXJA 2YMSB 1QJ7B 2UUKB 3U69H 1UJ1A 2FEQH 2QYIA 3S69A 2TRMA 2GDDA 2PTCE 2SGAA 1GL1A 1K1NA 5EW2H 5CHBA 1K1OA 3E0NB 4I8LA 2P3TB 3SGAE 3ZZ4A 1UTOA 1O3CA 2W3IA 3ATWA 3SZNA 2B8OH 3FZDA 4X2XA 3VEQB 3N7DA 5IDKA 3S9CA 2ZGCA 5F8XA 2A7CA 4IN2A 3S9BA 2HWLB 1AY6H 1EJAA 2AIPA 1KLTA 2QC2A 1QNJA 3O8RA 1RIWB 1X7AC 3QTVH 4ZUHA 1P9UA 4JK6A 2IPQX 2F9PA 1HCGA 3VB5A 1VCQA 2B5TB 1NT1A 2KR7A 1CHOG 1W12U 1OXGA 1JMOH 3BTFE 4XE4A 1UVOA 5A0AE 2ZZUH 2STBE 3GY2A 4OS7A 5L6NH 4A1VA 1GMHF 1K28D 2FOFA 4ZKNU 3RXFA 3TGJE 1Z8JB 2JJ1D 2Z6BD 2V3HH 4IGDA 3A86A 4Y7AA 1L4ZA 1J16A 2BQWB 2FX4A 1GWAA 3SNAA 1ABIH 2AGEX 4CH2B 3KGPA 1KIGH 1EPTA 1MTWA 4QT8C 5JDUB 1A5GH 1ANBA 1TAWA 4JZDH 4X1PU 4YO9A 3TJVA 1VITH 1GBKA 3KF2A 1J9CH 2F83A 3SQEE 4P00A 3LH1A 3RM2H 4I8GA 4SGAE 1TGBA 3BTTE 2J97A 2OCVB 1ELEE 1FJSA 1P2OA 2LNCA 2KZ4A 2FS8A 5I25A 5JBCS 1BA8B 1UK4A 1YPEH 2WUBA 1DUAA 1O3AA 2K0QA 1XUGA 2PSXA 1IQNA 1F5LA 1QZ8A 2FP7B 2PV9B 3TLOA 1FMGA 1TBQH 3URDA 1SGNE 2BDCA 4GAWA 1FY5A 2VINA 1DLEA 4IMZA 4CRBA 1L4DA 4Q7ZA 1XVMA 2PKAB 2QXGA 4TT3D 1DXWA 1TPOA 2PGBB 1HXEH 2KAIB 1KXDA 2W7SA 1EPTB 5F53A 1NPMA 1ABJH 2HLCA 7GCHG 3I78A 3Q3KA 2VWMA 4ZCNA 1LHGH 3P8OA 4BTIB 2Z9LA 5FX6A 3E0PB 3RDZA 5ETXA 1LCYA 2HOBA 1ZMJA 1O3OA 4H4FA 3HPTB 2F9UA 1HJ9A 2P8OC 2QF0A 2J92A 3SO3A 1JWTA 1V2TT 2O8MA 4X8UH 1QBOA 2SGDE 4IC5A 1D3TB 1N6YA 3PV5A 3SZEA 3H5CB 4CRDA 4YESB 5EG4A 3F2FA 1EP6A 2ZU3A 1F2SE 4FVDA 1VJ9U 2C8WB 3BV9B 5LPFA 1COWD 1O30A 1H4WA 4ISHH 2PUXB 1HAXB 3FAOA 1ZSJA 2Y5HA 4WWYA 3NPSA 1P8VC 3RMMH 5C0TA 3TH2H 1ZYOA 4HI3A 3SNCA 2JH0D 5DSFA 3MH6A 5DGJA 3PMAB 2BYAX 3LIWA 5L30H 3ZZ3A 3F9HA 2QE7D 1A61H 3VXFH 1O2SA 1QQ4A 3PLPA 3BTQE 4MG3A 2ZU5A 3MMGA 5A8YA 3AAUA 1A2CH 1V2VT 4K3JA 1MQ6A 3D62A 1ZPBA 1SSXA 2BLQA 1IQJA 1PPCE 3VGCC 1WQVH 1NBMD 5T3HA 3NUMA 1H9HE 2BQ7B 3I77A 3M5OA 1A4WH 3P8GA 2CXVA 1QRXA 4FUHA 5AF9H 2GCHG 4D8NA 1TA6A 4Q63A 1ZPZA 1SMFE 2GP9B 3PO1C 1PPFE 3SV2H 3TJUA 1O2GH 2WHXA 1M9UA 1O3EA 1VGCC 1O5DH 1W10U 3A80A 3SNBA 1GGDC 5KEDA 1Q3XA 3VG8A 2BM2A 3VPKA 2L74A 2J94A 4R0IA 1GI1A 3BTHE 4U30A 4Y79A 1P12E 1QBVH 3UNRA 4ZKOU 2BD9A 3DHKH 3D49H 3LOXA 2QN5T 1EJMA 1HYLA 1GHAG 3I29A 2FOGA 1C1SA 3T29A 1QA7A 3OEHD 2GZ7A 2XWBI 4UFFH 2W5EA 2ZF0H 1WAYB 2CGAA 1W2KH 4JYVH 1BIOA 1B0EA 1UVPA 5LPRA 1Z6EA 1PPGE 1W14U 3KQEA 2C8YB 1EX3A 2B9LA 1THPB 1KY9A 1O2WA 1LQEA 2GV7A 2RDEA 1YCPH 1ESAA 5CHAB 3M3VA 2J4IA 1WQSA 1PQ7A 1RXPA 1SGTA 5T6FA 1MBMA 1K21H 1B5GH 1LO6A 1FQ3A 4Q7XA 1E37B 2XBXA 4WH8A 1H9LB 1ELCA 4AGJA 3LC3A 3OU0A 3SHCH 3KL6A 8LPRA 2EI7A 4AC9A 1TMUH 1AI8H 1JIMA 4CRCA 1P2MA 1NRRH 1VKYA 3DUXH 4B1TA 5C67A 1XKBC 4ABJA 5GCHF 3VB7A 2H1UA 1ZTJA 2ZHQH 4BAMB 5JBBS 3L3TA 1AFQB 1SQOA 4K5ZA 1O2NA 1PQAA 1DSTA 3MU8A 2CJIA 2XCFA 3E90B 1Y8TA 5JB9S 1O5FH 1DE7H 4KELA 2P3UB 2W6ID 1GVLA 1LPGB 5A0BA 1TRNA 1HDTH 4YXWD 1F5RA 2VNTA 2Y80A 1GI5A 1DFPA 4JZFH 1LTOA 1YPMH 1CVWH 2Z94A 1P57B 1SGRE 3HK3B 5B6LA 5A09A 1Y5AT 3L6PA 1UHBA 2BVRH 1EQ9A 5E0HA 2F9BH 2D1JA 2JETC 3U98H 1C5ZB 4X6NA 5FHTA 2XYAA 1GHXH 1C5RA 1C5SA 1E36B 1O31A 3EYDA 4Z1MD 3CENA 4X8SH 1F5KU 3RC4A 1KXFA 2QF3A 4ZMAH 1SFQB 3ZVCA 1BMFD 1SLVB 1P10A 1TNKA 2VJ1A 1QL7A 1FN8A 1YY3A 3M7TA 2XWAA 3SJ8A 4CREA 1FIZA 1IQLA 8GCHF 1GBFA 5T1VA 3T26A 2FXRA 4O97A 3ZZ9A 3UWJH 1L1GA 1UVTH 1AVXA 5FBEA 4ABIA 1DWBH 3V7TA 2NU3E 3LJOA 1KDQA 2ULLA 4LZ4B 3FOAA 1NFWA 1V2MT 3LU9B 4INKA 2VH0A 2ZHEH 1ZLRA 3TK5A 1WSSH 1O2JA 2LP6A 1EJNA 2AH4X 1O37A 3WW7A 4XRNA 2CF9H 5HM2A 4A92A 5L2ZH 3MH7A 2KM0A 1TA2A 2ZCKP 1BRBE 1ZHRA 2Z9JA 3DT0H 3NKKA 3OFND 3P92A 3ELAH 2HPPH 3U1IB 1EAUA 1ZHMA 4X6PA 4XDEA 2XXLA 3A8CA 1SGFA 3MOCA 2ZFRH 1OWJA 2FDAA 3T27A 4ISLA 1QL9A 3HATH 4MTBA 1GI7B 1FY3A 3RMOH 2ZFPH 1ID5H 2Q6GA 5JBTA 1O3LA 4HZHA 5FAHA 1O2UA 1C5VA 1YPKH 4YLQH 3KQDA 5B6OA 1KDQB 1O35A 1TONA 2PSYA 1TFXA 1GJBB 2RG3A 4UD9H 3TGIE 1T32A 3A81A 5GJ4B 2JDID 2WYGA 3R0FA 4JK5A 2P3FH 2ALPA 1IOEA 3PROA 4FUBA 1EAIA 2WPDD 2A45B 2BD8A 2ZDLA 3SNDA 4I31A 1MKWK 4XFQA 1TE0A 1YWUA 1BRUP 2DE8A 1VCWA 1O2QA 1GMHG 1MD7A 3BEUA 3MHWU 1ZOMA 3URCA 2UWPA 3P6ZB 3GDSA 3LJJA 2CHAB 1OWEA 1DVAH 1JRSA 4CR9A 1ZTLA 1MCVA 2P16A 1W7XH 4OS4A 3MNBA 5EW1H 3PTNA 4KTUA 2KFWA 5L2YH 1AE5A 1F0SA 3LGVA 1YGCH 3TPIZ 2ESTE 2VVCA 3QGJA 2FLBH 2XCNA 2PFEA 3H09A 1BQYA 3TITA 1FX0B 1UK2A 2H2ZA 3MO9A 1T8MA 3BTWE 1GJ8B 3SV8A 3T5FH 1K0HA 1DY9A 4U2WA 2C8ZB 1GHYH 4O3UA 1C1NA 1KXCA 1GJ7B 4B2CA 1B0FA 1ZJDA 3A89A 1IQHA 1HLTH 3RLWH 2YOLA 3PMBB 4I8KA 1WV7H 3SV7A 4TY7A 3DFLA 1S83A 1BT7A 3RU4T 2FI5E 4PROA 2XW9A 1ELGA 4AYVB 3STIA 3NZIA 1TNLA 2ZGJA 2V35A 1AKSB 1WXRA 1Z8GA 3GCTG 4TYDA 1T4UH 3UR6A 1DITH 4IW4E 1G9IE 4UFEH 1TNJA 2WPMS 3UQOA 3ZVFA 2Y6TA 3MI4A 1W0ZU 2L6OA 1ESTA 1HGTH 2A4GA 3KIDU 4DT7B 3RM0H 1C9TA 5F8TA 1O2HA 1NBME 1FY1A 2A31A 1TBZH
chains in the Genus database with same CATH topology
2CHAC 2ZG0H 1AUTC 1A0HB 2ZO3H 5C5OA 2Z9KA 5C1UA 1A46H 2OC0A 3R3GB 1TGCA 1AB9B 1SLXB 2AERH 3S0NA 1NFYA 3NWUA 4U32A 1GCTB 4K60A 4O9VA 1WUNH 2NU2E 2AHME 1ZMNA 4FUGA 6GCHG 2GMTB 1KXAA 2YMSD 2A2QH 5CE1A 4D7FA 1RJXB 1LKAA 2FOCA 1HV7A 3RXEA 1GG6C 2BDHA 4AORA 2R3UA 1SHHB 2WV5A 3LGYA 1C2MA 1SG8B 1C2DA 6ESTA 1TLDA 2QAAA 4ZKSU 4WVPE 2PKSB 2WPJS 3ATLA 3BF6H 1PPBH 1C1UH 3GY5A 4Z0KA 1D6WA 4AOQA 2PWXA 1Y3UA 4Y0YE 2QA9E 3BG8A 3ZZAA 4LOYH 3UWIA 3F0OA 1SGEE 4BAOB 2LELA 2VIQA 1GMCG 1IQEA 1H9IE 1P2KA 1NESE 2BXUH 3UR9A 4NA7A 1AVWA 2GKVE 3SI3H 2BY8X 4ASUD 1CBWC 2OK5A 3AVZA 1NRSH 2OINA 1NZQH 4MNWA 2XNDD 1G30B 1O5BB 1E38B 1W7GH 2G4UA 1C2LA 2ZP0H 2ZU1A 4BAQB 3SU5A 1KTSB 5GWZA 1A3EH 2ALVA 3LT3A 3TNSA 4X8TH 3A7XA 2SGEE 3T28A 1GI9B 1FIWA 1BRCE 1O2LA 1ZR0A 2BDBA 3A7VA 4ZXXH 2VH6A 3QUMP 5DP8A 1NC6A 2G81E 1O2YA 1TPPA 2GX4A 3NK8A 3RC5A 1TBRH 1Z71A 2EI6A 3RXBA 4ABBA 3TJOA 1SLUB 1GI3A 4VGCC 2FIRH 2VWLA 3S7KB 2J95A 2XTTB 4BXWA 3F1SB 4CHAB 4WXVA 5DP3A 3LC5A 4F49A 3D65E 1FDPA 3T62A 3M7UA 4AFQA 2H9EH 2Y81A 4NZLA 4XBBA 2HPQH 2ZTYA 5TJXA 2FPZA 4CRFA 2STAE 5C0UA 1GMDF 5JYIA 4BTUB 2XC0A 2ZDMA 3RXVA 1SR5C 2G5VA 3HKIB 1A0LA 4JCNA 3RXPA 1OYTH 1ZMLA 3CS7A 1AWHB 3UREA 1GI6A 5J4QA 4FUIA 2V7QD 2OBQA 4IC6A 3ZVAA 3U8RH 4I8JA 1MKWH 1W13U 2ZIQH 4GCHF 2PTNA 1AWFH 1TWXB 2FMJA 3GISB 1C2GA 5DP9A 1WCZA 2Z7FE 4X1QU 1A0JA 2R2MB 8ESTE 3DSOA 3F3BA 1DS2E 1MH0A 1TMBH 1C5TA 1AZZA 4GVUA 2P93A 3FP8E 4LK4A 4TWYA 3SJ9A 2GD4B 8KME2 4JZEH 4TWWA 1IQIA 2C8XB 3E6PH 3UPEA 1DUEA 5JBAS 2Z9IA 3M5MA 3PWCA 1P2NA 4Y8YA 1SHYA 3RXTA 4I32A 2YMSC 1O3JA 1MBQA 1SKYE 3RXIA 2A7HA 5EXMA 2W6JD 3NRLA 3SHAH 1XUIA 3DFJA 3N7EA 1DICA 4J1YA 4CBOA 3P17H 5A0CA 4AG2A 1KXBA 3SJOA 3RXKA 1O5CB 3EDXB 1THSH 4B73A 3TNTA 1BHXB 3OY6U 1BTXA 1YPLH 8GCHG 1RIWC 3P70B 3BTDE 1GJAB 3K2UA 1GHWH 5EQSA 3A82A 1UTJA 3GCOA 1XXFA 1Z6JH 2NU0E 1HFDA 1GI8B 2BLWA 3PTBA 3E16B 4FUFA 1BCUH 1ZRKA 1GBAA 2J9NA 4U01A 3SJIA 1DDJA 1EZQA 1T8OA 3E1XB 3OYPA 3B23B 4AFUA 1MZAA 1TGTA 2AMQA 2F4LA 1N8OB 3E3TA 5FX5A 2Q6DA 2A2XH 1ZPCA 1XM1A 2J2UA 1BDAA 3F68H 3RU4D 3U8TH 3F0PA 3BIVH 2ANYA 3UB0A 3V0XA 5J4SA 5C1XA 1TRMA 2JH5D 1BHXF 1ETSH 2YNAA 1QFKH 1O2KA 2C90B 4GUXA 2OC8A 5E0JA 1MU6B 1DX5M 3SUGA 2Q6FA 4DURA 2Z3EA 3GY3A 3M36A 1V2NT 4ESTE 3FANA 1NROH 3ITIA 2XC4A 2WUCA 1MD8A 3IITA 4CR5A 1GBMA 3C1KA 4JYTA 4MVNA 4X0WU 3KN2A 2I6QA 3VB3A 2C4FH 1GJ6A 1SFIA 4HGCA 1DPOA 5DP4A 1SVPA 1XX9A 2I6SA 5H4IB 4JZ1A 3RXRA 3BTKE 1LPZB 4FU9A 1BTYA 1C1RA 1C5LH 1GBTA 1KLJH 1EXFA 1GCDA 2HRVA 2SGPE 1FAKH 4NFFA 2G52A 1YPJH 1SL3A 4TPIZ 2H6MA 1BBRK 1GL0E 1TX8A 1YLCA 2PW8H 3H7OA 4ZHLU 3TH3H 3KEEA 1QGFA 1MTNB 1NFUA 1AGJA 3PWBA 2A32A 4K8BA 2G00A 4Y10E 1EPTC 1QHRB 1JIRA 5K7RA 1Z1JA 2M5TA 1QURH 1INCA 2XBVA 1H8ED 1TYNA 2VGCB 1WOFA 2FYQA 4D7GA 1GJDB 1YPHC 1C5UA 3SU6A 1E1QD 7KMEH 1TQ0B 3SU3A 1Z8IB 1CSOE 1EZSC 1WU1A 2PHBA 3GYLB 4FETA 2CK3D 4Q2KA 1TX6A 1N8OC 2ZFQH 1GHVH 4YM9A 2ZHFH 4X6MA 2TGPZ 3A7ZA 1JRTA 1HXFH 2XBYA 1SOTA 1O3HA 1T4VH 4Q7YA 4KTSA 2IN2A 1MQ5A 1D9IA 3JZ2B 1SGFG 3FN8A 5SGAE 2BY9X 3OTJE 1UCYK 2ZQ1A 4IN1A 3K65B 1TABE 4FUCA 1WTHD 3BG4B 3MH4A 1ZGVA 2H5CA 4MNYA 4RSPA 1YBWA 4KGAA 6CHAB 3UY9A 2O8WA 3QLPH 1Q31A 2A0QB 1F0UA 3F9EA 3GY7A 3SU0A 2ANMH 2RCEA 2V0BA 1EB1H 4Y0ZE 3KNXA 3A8DA 3P8FA 1K9OE 3LKWA 4ABGA 3BEIB 3HGNA 3MNCA 4Y8ZA 4AZ2B 3ZZDA 1ETRH 2F43B 4Q4LA 2THFB 3LGWA 1HJAB 1NM6A 1MTNC 2FOHA 1YPGH 3QZRA 2AS9A 1NFXA 3ATIA 1XXDA 3ZZ5A 3QX5H 3DD2H 3SORA 1W11U 1THRH 3EA8A 1C5XB 1U6QA 1O38A 2TGDA 2KCOA 2VVVA 1LVMA 5FPSA 3UNQA 2BD7A 2Z9GA 2BZAA 1BMAA 4Y6DA 1AHTH 2UUYA 4DIHH 1TPAE 1ELFA 3H7TA 3RXLA 1C1WH 1H8DH 2IJD1 1UTKA 5HKKD 1LDTT 3SU4A 3V3MA 3N7OA 2O8UA 1O34A 4IBLH 1H1BA 4B71A 3WWBA 2A7JA 3LONA 5EODA 1OPHB 2BD4A 4LZ1H 4M7GA 1SI5H 5I46H 3F2GA 1EOJA 2A4RA 4E05H 2A4OA 1G2LA 3WY8A 4UFGH 4ABEA 1W0YH 1UVSH 4X6OA 5CHAC 3A8AA 3NXPA 3EQ0H 4WH6A 2SNVA 2A5IA 4NSYA 4I7YH 5LH8A 1EKBB 2JIZD 4NFEA 1P04A 3B8JA 1MKXK 3E8LA 5DP7A 2QF4A 3OSYA 1LVOA 5HYOA 1AO5A 3PB1E 1O3PB 1AVGH 1E1RD 1UHBB 2GVFA 1O2MA 1HAZB 4X1RU 3ZVGA 1YLDA 4DCDA 2DUCA 7GCHF 2IPHA 1NY22 4YT7H 3M5NA 1AFQC 5EQQA 4X1SU 1N1LA 4MLFB 3ZZCA 1V2KT 4ASHA 4K1SA 1XUFA 2ZGXH 1DWCH 3DSPA 1QA0A 2ODPA 4X8VH 1NTPA 4INLA 4DVAU 2VWNA 2SFAA 1O5AB 1W3CA 2ZHDA 2ZU4A 1ZHPA 1V2PT 3ODDA 1OS8A 1J17T 4AYYB 2BQ6B 5GNDA 3ZVEA 3FVFB 2WPKS 4WY3A 4ZHAA 3OEED 3EE0B 2P95A 2HLDD 4ABFA 4OS2A 5C1YA 1GHBF 2XBWA 3GY6A 1O32A 5FL7D 5K0HA 4Y8XA 3QWCH 3DCLA 2H9TH 3MU0A 1T7CA 2ANWA 3ZVDA 6LPRA 1Y3XA 1C1VH 3OY5U 1YKTA 4YT6H 1TGSZ 4Q80A 2JJ2D 1Z1IA 1K1MA 3PYHA 5C20A 1BBRH 5F8ZA 5GXPA 2G5NA 1LHEH 3GOVB 2ZPQA 4NG9H 2F91A 1D3DB 1F0RA 4JYUH 1OYQA 1G2MA 1ACBE 4GCHG 2GCHF 3QGNB 3UOUA 1SGQE 3O8CA 3S7HB 1C4V2 1NU9A 2K1QA 2B7DH 1HNEE 3RXMA 4RI0A 2K8IA 1UTLM 1LHCH 3SV6A 9ESTA 4B6FA 3SGQE 1HAGE 2G4TA 2HNTC 4AN7A 1K1IA 1C5WB 1BMNH 2FZZA 2OBOA 2TGAA 4DIIH 1QJ6B 3K6ZA 3RU4E 3SNEA 4AFSA 1GBHA 1L1NA 1A3BH 1FZZA 3FKSD 5T6GA 5HGGA 1C5YB 1GJ4H 4NA8A 1CA0B 4Y71A 4R8TB 1S82A 1CT4E 3A83A 1YYY1 4HFPB 1A5IA 3Q00A 5FPYA 3M3SA 1GHAF 4K69A 1C1TA 3AW1A 5A8ZA 1F0TA 1L2EA 4OS1A 1UCYH 1AMHA 3QK1A 2RDLA 3GCNA 3PMJA 1HAIH 3GCHB 1GDNA 3A7WA 3SYJA 1ZSLA 1KXEA 1P9SA 1RS0A 2GCTB 5PTPA 1LQDB 1VITF 3G01A 2R3YA 1IAUA 1MUEB 3SQHE 3ODFA 1FONA 4MNVA 1RRKA 5AVDA 2ZDAH 3ZZ7A 1AU8A 1D6RA 5CDFE 4X2VA 1PJPA 2KCAA 2TPIZ 1NRPH 5C5NA 1O3FA 4THNH 1E0FD 1O3GA 1BTWA 1GBIA 2DE9A 2FI4E 1IQKA 3WWFA 3RC6A 5IYTA 1DWDH 2GZ8A 3RXCA 2VIVA 1RD3B 2ASUB 1FV9A 3ENSB 1C2EA 1CE5A 3BIUH 1S6HA 5TCCA 5GDSH 1ZSKA 1ESBA 1PPHE 2F3CE 2PUQH 1BJUA 1UTMA 1PFXC 5JPMH 2ZFFH 5FCRA 4TSFD 4DW2U 1P2IA 1ELAA 1UTNA 1Y3YA 1S85A 4K8YA 1DT2A 1LMWB 1OX1A 4WJG2 3RXQA 4O3TA 3P95A 2FTLE 1BRAA 1GVZA 5DG6A 1GBCA 4NIWA 1FN6A 2VIOA 2FI3E 1JOUB 5C3NA 1DOJA 1PYTD 3M61U 5AFYH 4B76A 2GV6A 1ARBA 4FVBA 3PRDA 2BLOA 1S81A 1FPCH 4BAHB 1HPGA 2FYRA 1MU8B 4WMFA 3MYWA 4YLUA 2ZI2H 1SQAA 2ZFTA 5E2PA 2WYJA 1O2ZA 2JH6D 1K22H 2W26A 2J38A 4A1TA 5T6DA 5E8EH 5EXLA 4NGAH 1O33A 4ABDA 1J15A 5ESTE 2OQ5A 1K2I1 2QCYA 1LPKB 4FU8A 3QTOH 2G51A 3QO6A 3F6UH 1BMMH 3EA7A 4K1TA 1HB0B 3MU4A 1ZJKA 2A4QA 4XOJA 2Y7ZA 2ODQA 1T31A 2GDEH 3KHVA 2ILNA 3SN8A 4M9FA 4B75A 1JBUH 4NIVA 4H42U 2VU8E 4GHTA 3PV4A 3V13A 4E7RG 1SC8U 4JZIA 1E79D 3A85A 2TGTA 2WPIS 3SBKA 5HXFA 1LKBA 2O8LA 4TPYA 4DG4A 3GY8A 1ELTA 1ANEA 1AB9C 1UTQA 2BHGA 2XC5A 2D8WA 2VB0A 1C5OH 1BITA 1OWHA 1GCTC 2H5DA 1RTKA 3QZQA 1N6XA 2GMTC 2ZPRA 1CA8B 1UMAH 3L33A 1FY4A 1RTLA 3U9AH 3CP7A 1SGDE 4ZXYH 1TX7A 4ZROA 1TQ7B 3PV2A 1YC0A 3RXGA 1WYKA 1YCPK 4XSKU 1KLIH 1SGIB 4B2AA 2D2DA 3RMNH 1G37A 4CRAA 1S6LA 1P05A 1O2TA 3VFEA 3A8BA 3QN7A 4B6EA 2PKSC 1O3KA 2IJOB 2BD5A 5DK1A 1AE8H 4UE7H 7LPRA 4ZH8A 2BY6X 2UUJB 1RGQA 2V3OH 3LH3A 1C2HA 3MTYA 1O2OA 3QDZB 3EA9A 3RLYH 5C2ZA 4NA9H 4RKJB 4AG1A 3GY4A 2OQUA 5GCHG 3Q3XA 3M37A 3ZV8A 3SV9A 5EU8A 5FCKA 4A7IB 1GDUA 2Y5GA 3F9GA 2CV3A 4OS5A 3FZZA 3AK5A 1EASA 1D3QB 2GT7A 1DXPA 2BD2A 1BTHH 5HM9A 1P02A 5FBIA 1CQQA 2P8OB 3UOPA 4BOHA 1ETTH 2EEKA 1EZXC 2FOEA 4A1XA 2BX3A 5EOKA 3PRBA 1Y5BT 1AN1E 4K2YA 5DJ7A 5BRRE 2PKAA 3A84A 1K1JA 5DP6A 3MU1A 3ATMA 1O3DA 3HGPA 1HUTH 2FM2A 2KAIA 3RXAA 3T2NA 3A87A 3KCGH 2HGTH 1Y5UT 3O8BA 1EATA 1GDQA 1V2QT 4F4OC 1O3NA 1SGYE 2XOKD 4ISIH 1BB0B 3BSQA 2HALA 2QGRA 1IHTH 1QBNA 1V2JT 1YM0A 4J2YB 1PYTC 2AYWA 4DT4A 1K1LA 2BZ6H 4CHAC 1TIOA 1HAYB 2ZTXA 1D3PB 1FI8A 1P06A 2A1DB 1AZ8A 1QQUA 1PPZA 3VGCB 1P3CA 1C5QA 4NSVA 2AGGX 2AMDA 4E06H 3AW0A 5ESBA 1GI4A 5IK2D 3GCTF 1QB9A 3SU2A 3W94A 1BJVA 2W7UA 1NRQH 1EUFA 4MPXA 3PO1B 4WF8A 1MABB 4B2BA 1C4U2 2CMYA 1S0RA 2R0KA 2RA3A 4XBCA 1HRTH 1IQMA 1VGCB 5EXNA 1DLKB 4INHA 2FOAA 1GGDB 2GT8A 5LPEA 1P0SH 1OP8A 3GDUA 4F55A 1L0ZA 2WV9A 1C5NH 2FOMB 1GBEA 5EGMA 1GBBA 3LDXH 1BOQA 2BDAA 1OKXA 2ZPSA 5EQRA 1MTUA 3ZYDA 3FO8D 1J8AA 2ZTZA 4O03A 4ABAA 1G3CA 3A88A 4NIYA 2TIOA 4Z6AH 3PLKA 4BANB 3AASA 2FODA 1CT2E