2F9YA

The crystal structure of the carboxyltransferase subunit of acc from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
316
structure length
301
Chain Sequence
NFLDFEQPIAELEAKIDSDEEVHRLREKSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSADKAPLAAEAMGIIRPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Carboxyltransferase Component of Acetyl-CoA Carboxylase Reveals a Zinc-Binding Motif Unique to the Bacterial Enzyme(,).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Acetyl-CoA carboxylase, Carboxyltransferase alpha chain
total genus 95
structure length 301
sequence length 316
ec nomenclature ec 2.1.3.15: Acetyl-CoA carboxytransferase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03255 ACCA Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2f9yA00
1TG6A 5KJPA 1VRGA 3DJAA 4JCQA 3T89A 2PG8A 4KWBA 1UYSA 1XNYA 3TRRA 2Q2XA 3R9SA 1XNVA 3TV5A 3NJBA 4GM2A 4YLHA 3R9TA 1W2XA 4B3HA 3I47A 3SWXA 2IEXA 1UIYA 1FC6A 1X0UA 4I4ZA 4NEKA 4Q0GA 5INGA 4FNBA 4U0GA 3T3WA 3PE8A 1DUBA 3QXZA 1OD4A 5DTWA 1N6EA 4MI2A 1UYTA 1ON9A 3GKBA 1EF9A 2BZRA 4ELSA 1MJ3A 4JVTA 2Q35A 3IBBA 4WYOB 3STAA 4ELWA 3HP0A 4JYJA 5JBWA 3RSTA 4JFCA 2WTBA 4RYFA 3R6HA 1XO6A 1K39A 4QIIA 3JU1A 4IZDA 5C9GA 3PGQA 2VSSA 1NZYA 1YG8A 3NJDA 2D3TA 4JCRA 3IB9A 3HRXA 1ON3A 2EJ5A 3H0UA 4U1AA 2F9IB 4K29A 3ZW8A 2VSSF 3GLMA 3KTGA 3M6NA 3ST9A 3L3SA 3ZW9A 5KDRA 4JWVA 3KTIA 4F47A 4WCZA 2VSUA 2Q34A 3ZWAA 4L6WA 5DUFA 5FIFA 2J5SA 3QXIA 1SG4A 3TVWA 4ZU2A 3MYBA 3TT6A 4JYLA 4Q1IA 3U9SB 3T8BA 2VSUF 2FW2A 3QMJA 5DZKA 4ELXA 3MOYA 2W3PA 4IZCA 4ZDCA 2GTRA 4B3JA 4KNPA 1HNUA 2ZL3A 2J5GA 3BPPA 3Q1TA 4MXIA 5G1SA 5G1RA 5DUCA 1WDLA 3N6RB 4K2NA 3P5MA 1PIXA 1Y7OA 3TZ3A 4OMRA 3FDUA 3BF0A 2A81A 3LKEA 4OG1A 3MFMA 1YG6A 1PJHA 2DUBA 2VSUC 3TT7A 3BEZA 1HNOA 1TYFA 3H02A 4K3WA 4JCSA 5IKLB 3K50A 4HNKA 2A7KA 2FZSA 2NP9A 2ZL2A 2J5II 2HW5A 4QFEA 2FBMA 5MGBA 3R9QA 1FC7A 5E0SA 4ZDBA 4G2RA 3H0QA 3Q0JA 5CTCA 3HLN1 1EF8A 4MOUA 3H0JA 3V5EA 2PBPA 1Q51A 5DU8A 2F6IA 2A7SA 3KQFA 1UYRA 4JOTA 3GF7A 4FZWA 3QWDA 4FB8A 4B3IA 1J7XA 1JXZA 2C8TA 2J5IA 4QIJA 2F9YB 3FF6A 3U9TB 3M6MA 1OD2A 2DEOA 2F9YA 4JSBA 5KDRB 1N6DA 4ZDDA 1WDKA 3QYRA 3SLLA 5JBXA 3HINA 3RSIA 3GMAA 3ISAA 2UZFA 1DCIA 4FJWD 4U0HA 3KTJA 5DU4A 3V5IA 3OMEA 2VX2A 4U0GH 2VSUE 1NZYB 3K8XA 4KPKA 5E0NX 3R0OA 2PPYA 3QREA 4U18A 3G64A 4NNQA 4FN7A 5E0SH 2ZL4A 4I52A 3ZWBA 4FZWC 2ZQQA 3RRVA 3P2LA 3KTKA 4EMLA 4KD6A 3T88A 4ASIA 4EMMA 4HC8A 1N6FA 4JJTA 4ZDFA 1K32A 3ZWCA 4GHNA 4EMPA 1XNWA 2F6QA 2VSSE 5DL1A 1EY3A 3KTHA 1WZ8A 3MT6A 1FCFA 1SZOA 4FNDA 2VREA 3T8AA 2CE3A 4DI1A 1HZDA 3PEAA 3PZKA 2X24A 5DTPA 3H81A 3IAVA 4RYFH 4U19A 2F9IA 3VIVA 5INIA 4WZ8B 3DORA 3OC7A 3TDCA 3QKAA 3LAOA 5DU6A 4OLQA 3WG5A 3P85A 1UYVA 3U9RB 5DZKH 4LK5A 3TLFA 5INFA 5FUSA 4Z0MA 3H0SA 4L8KA 3QK8A 2J5IB 5CTBA 1XX4A 2ZL0A 2J5GD 3GF3A 5C90A 1O8UA 1RJNA 3Q7HA 1RJMA 4RCNA 4JCTA 1FC9A 2CBYA 2ZQRA 4FN8A 3OT6A 3Q0GA 3TVUA 2QQ3A 1Q52A 3HE2A 1WDMA 2X58A 5DKPA 4IZBA 4ZDEA 4I42A 5G1QA
chains in the Genus database with same CATH superfamily
1TG6A 5KJPA 1VRGA 3DJAA 4JCQA 3T89A 2PG8A 4KWBA 1UYSA 1XNYA 3TRRA 2Q2XA 3R9SA 1XNVA 3TV5A 3NJBA 4GM2A 4YLHA 3R9TA 1W2XA 4B3HA 3I47A 3SWXA 2IEXA 1UIYA 1FC6A 1X0UA 4I4ZA 4NEKA 4Q0GA 5INGA 4FNBA 4U0GA 3T3WA 3PE8A 1DUBA 3QXZA 1OD4A 5DTWA 1N6EA 4MI2A 1UYTA 1ON9A 3GKBA 1EF9A 2BZRA 4ELSA 1MJ3A 4JVTA 2Q35A 3IBBA 4WYOB 3STAA 4ELWA 3HP0A 4JYJA 5JBWA 3RSTA 4JFCA 2WTBA 4RYFA 3R6HA 1XO6A 1K39A 4QIIA 3JU1A 4IZDA 5C9GA 3PGQA 2VSSA 1NZYA 1YG8A 3NJDA 2D3TA 4JCRA 3IB9A 3HRXA 1ON3A 2EJ5A 4HDTA 3H0UA 4U1AA 2F9IB 4K29A 3ZW8A 2VSSF 3GLMA 3KTGA 3M6NA 3ST9A 3L3SA 3ZW9A 5KDRA 4JWVA 3KTIA 4F47A 4WCZA 2VSUA 2Q34A 3ZWAA 4L6WA 5DUFA 5FIFA 2YJGA 2J5SA 3QXIA 1SG4A 3TVWA 4ZU2A 3MYBA 3TT6A 4JYLA 4Q1IA 3U9SB 3T8BA 2VSUF 2FW2A 3QMJA 5DZKA 4ELXA 3MOYA 2W3PA 4IZCA 4ZDCA 2GTRA 4B3JA 4KNPA 1HNUA 2ZL3A 2J5GA 3BPPA 3Q1TA 4MXIA 5G1SA 5G1RA 5DUCA 1WDLA 3N6RB 4K2NA 3P5MA 1PIXA 1Y7OA 3TZ3A 4OMRA 3FDUA 3BF0A 4J2UA 2A81A 4NARA 3LKEA 4OG1A 3MFMA 1YG6A 1PJHA 2DUBA 2VSUC 3TT7A 3BEZA 1HNOA 1TYFA 3H02A 4K3WA 4JCSA 5IKLB 3K50A 4HNKA 2A7KA 2FZSA 2NP9A 2ZL2A 2J5II 2HW5A 4QFEA 2FBMA 5MGBA 3R9QA 1FC7A 5E0SA 4ZDBA 4G2RA 3H0QA 3Q0JA 5CTCA 3HLN1 1EF8A 4MOUA 3H0JA 5HUQA 3V5EA 2PBPA 1Q51A 5DU8A 2F6IA 2A7SA 3KQFA 1UYRA 4JOTA 3GF7A 4FZWA 3QWDA 4FB8A 4B3IA 1J7XA 1JXZA 2C8TA 2J5IA 4QIJA 2F9YB 3FF6A 3U9TB 3M6MA 1OD2A 2DEOA 2F9YA 4JSBA 5KDRB 1N6DA 4ZDDA 1WDKA 3QYRA 3SLLA 5JBXA 3HINA 3RSIA 3GMAA 3ISAA 2UZFA 1DCIA 4FJWD 4U0HA 3KTJA 5DU4A 3V5IA 3OMEA 2VX2A 4U0GH 2VSUE 1NZYB 3K8XA 4KPKA 5E0NX 3R0OA 2PPYA 3QREA 4U18A 3G64A 4NNQA 4FN7A 5E0SH 2ZL4A 4I52A 3ZWBA 4FZWC 2ZQQA 3RRVA 3P2LA 3KTKA 4EMLA 4KD6A 3T88A 4ASIA 4EMMA 4HC8A 1N6FA 4JJTA 4ZDFA 1K32A 3ZWCA 4GHNA 4EMPA 1XNWA 2F6QA 2VSSE 5DL1A 1EY3A 3KTHA 1WZ8A 3MT6A 1FCFA 1SZOA 4FNDA 2VREA 3BPTA 3T8AA 2CE3A 4DI1A 1HZDA 3PEAA 3PZKA 2X24A 5DTPA 3H81A 3IAVA 4RYFH 4U19A 2F9IA 3VIVA 5INIA 4WZ8B 3DORA 3OC7A 3TDCA 3QKAA 3LAOA 5DU6A 4OLQA 3WG5A 3P85A 1UYVA 3U9RB 5DZKH 4LK5A 3TLFA 5INFA 5FUSA 4Z0MA 3H0SA 4L8KA 3QK8A 2J5IB 5CTBA 1XX4A 2ZL0A 2J5GD 3GF3A 5C90A 1O8UA 1RJNA 3Q7HA 1RJMA 4RCNA 4JCTA 1FC9A 2CBYA 2ZQRA 4FN8A 3OT6A 3Q0GA 3TVUA 2QQ3A 1Q52A 3HE2A 1WDMA 2X58A 5DKPA 4IZBA 4ZDEA 4I42A 5G1QA
chains in the Genus database with same CATH topology
1TG6A 5KJPA 1VRGA 3DJAA 4JCQA 3T89A 2PG8A 4KWBA 1UYSA 1XNYA 3TRRA 2Q2XA 3R9SA 1XNVA 3TV5A 3NJBA 4GM2A 4YLHA 3R9TA 1W2XA 4B3HA 3I47A 3SWXA 2IEXA 1UIYA 1FC6A 1X0UA 4I4ZA 4NEKA 4Q0GA 5INGA 4FNBA 4U0GA 3T3WA 3PE8A 1DUBA 3QXZA 1OD4A 5DTWA 1N6EA 4MI2A 1UYTA 1ON9A 3GKBA 1EF9A 2BZRA 4ELSA 1MJ3A 4JVTA 2Q35A 3IBBA 4WYOB 3STAA 4ELWA 3HP0A 4JYJA 5JBWA 3RSTA 4JFCA 2WTBA 4RYFA 3R6HA 1XO6A 1K39A 4QIIA 3JU1A 4IZDA 5C9GA 3PGQA 2VSSA 1NZYA 1YG8A 3NJDA 2D3TA 4JCRA 3IB9A 3HRXA 1ON3A 2EJ5A 4HDTA 3H0UA 4U1AA 2F9IB 4K29A 3ZW8A 2VSSF 3GLMA 3KTGA 3M6NA 3ST9A 3L3SA 3ZW9A 5KDRA 4JWVA 3KTIA 4F47A 4WCZA 2VSUA 2Q34A 3ZWAA 4L6WA 5DUFA 5FIFA 2YJGA 2J5SA 3QXIA 1SG4A 3TVWA 4ZU2A 3MYBA 3TT6A 4JYLA 4Q1IA 3U9SB 3T8BA 2VSUF 2FW2A 3QMJA 5DZKA 4ELXA 3MOYA 2W3PA 4IZCA 4ZDCA 2GTRA 4B3JA 4KNPA 1HNUA 2ZL3A 2J5GA 3BPPA 3Q1TA 4MXIA 5G1SA 5G1RA 5DUCA 1WDLA 3N6RB 4K2NA 3P5MA 1PIXA 1Y7OA 3TZ3A 4OMRA 3FDUA 3BF0A 4J2UA 2A81A 4NARA 3LKEA 4OG1A 3MFMA 1YG6A 1PJHA 2DUBA 2VSUC 3TT7A 3BEZA 1HNOA 1TYFA 3H02A 4K3WA 4JCSA 5IKLB 3K50A 4HNKA 2A7KA 2FZSA 2NP9A 2ZL2A 2J5II 2HW5A 4QFEA 2FBMA 5MGBA 3R9QA 1FC7A 5E0SA 4ZDBA 4G2RA 3H0QA 3Q0JA 5CTCA 3HLN1 1EF8A 4MOUA 3H0JA 5HUQA 3V5EA 2PBPA 1Q51A 5DU8A 2F6IA 2A7SA 3KQFA 1UYRA 4JOTA 3GF7A 4FZWA 3QWDA 4FB8A 4B3IA 1J7XA 1JXZA 2C8TA 2J5IA 4QIJA 2F9YB 3FF6A 3U9TB 3M6MA 1OD2A 2DEOA 2F9YA 4JSBA 5KDRB 1N6DA 4ZDDA 1WDKA 3QYRA 3SLLA 5JBXA 3HINA 3RSIA 3GMAA 3ISAA 2UZFA 1DCIA 4FJWD 4U0HA 3KTJA 5DU4A 3V5IA 3OMEA 2VX2A 4U0GH 2VSUE 1NZYB 3K8XA 4KPKA 5E0NX 3R0OA 2PPYA 3QREA 4U18A 3G64A 4NNQA 4FN7A 5E0SH 2ZL4A 4I52A 3ZWBA 4FZWC 2ZQQA 3RRVA 3P2LA 3KTKA 4EMLA 4KD6A 3T88A 4ASIA 4EMMA 4HC8A 1N6FA 4JJTA 4ZDFA 1K32A 3ZWCA 4GHNA 4EMPA 1XNWA 2F6QA 2VSSE 5DL1A 1EY3A 3KTHA 1WZ8A 3MT6A 1FCFA 1SZOA 4FNDA 2VREA 3BPTA 3T8AA 2CE3A 4DI1A 1HZDA 3PEAA 3PZKA 2X24A 5DTPA 3H81A 3IAVA 4RYFH 4U19A 2F9IA 3VIVA 5INIA 4WZ8B 3DORA 3OC7A 3TDCA 3QKAA 3LAOA 5DU6A 4OLQA 3WG5A 3P85A 1UYVA 3U9RB 5DZKH 4LK5A 3TLFA 5INFA 5FUSA 4Z0MA 3H0SA 4L8KA 3QK8A 2J5IB 5CTBA 1XX4A 2ZL0A 2J5GD 3GF3A 5C90A 1O8UA 1RJNA 3Q7HA 1RJMA 4RCNA 4JCTA 1FC9A 2CBYA 2ZQRA 4FN8A 3OT6A 3Q0GA 3TVUA 2QQ3A 1Q52A 3HE2A 1WDMA 2X58A 5DKPA 4IZBA 4ZDEA 4I42A 5G1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TG6 A;  5KJP A;  1VRG A;  3DJA A;  4JCQ A;  3T89 A;  2PG8 A;  4KWB A;  1UYS A;  1XNY A;  3TRR A;  2Q2X A;  3R9S A;  1XNV A;  3TV5 A;  3NJB A;  4GM2 A;  4YLH A;  3R9T A;  1W2X A;  4B3H A;  3I47 A;  3SWX A;  2IEX A;  1UIY A;  1FC6 A;  1X0U A;  4I4Z A;  4NEK A;  4Q0G A;  5ING A;  4FNB A;  4U0G A;  3T3W A;  3PE8 A;  1DUB A;  3QXZ A;  1OD4 A;  5DTW A;  1N6E A;  4MI2 A;  1UYT A;  1ON9 A;  3GKB A;  1EF9 A;  2BZR A;  4ELS A;  1MJ3 A;  4JVT A;  2Q35 A;  3IBB A;  4WYO B;  3STA A;  4ELW A;  3HP0 A;  4JYJ A;  5JBW A;  3RST A;  4JFC A;  2WTB A;  4RYF A;  3R6H A;  1XO6 A;  1K39 A;  4QII A;  3JU1 A;  4IZD A;  5C9G A;  3PGQ A;  2VSS A;  1NZY A;  1YG8 A;  3NJD A;  2D3T A;  4JCR A;  3IB9 A;  3HRX A;  1ON3 A;  2EJ5 A;  3H0U A;  4U1A A;  2F9I B;  4K29 A;  3ZW8 A;  2VSS F;  3GLM A;  3KTG A;  3M6N A;  3ST9 A;  3L3S A;  3ZW9 A;  5KDR A;  4JWV A;  3KTI A;  4F47 A;  4WCZ A;  2VSU A;  2Q34 A;  3ZWA A;  4L6W A;  5DUF A;  5FIF A;  2J5S A;  3QXI A;  1SG4 A;  3TVW A;  4ZU2 A;  3MYB A;  3TT6 A;  4JYL A;  4Q1I A;  3U9S B;  3T8B A;  2VSU F;  2FW2 A;  3QMJ A;  5DZK A;  4ELX A;  3MOY A;  2W3P A;  4IZC A;  4ZDC A;  2GTR A;  4B3J A;  4KNP A;  1HNU A;  2ZL3 A;  2J5G A;  3BPP A;  3Q1T A;  4MXI A;  5G1S A;  5G1R A;  5DUC A;  1WDL A;  3N6R B;  4K2N A;  3P5M A;  1PIX A;  1Y7O A;  3TZ3 A;  4OMR A;  3FDU A;  3BF0 A;  2A81 A;  3LKE A;  4OG1 A;  3MFM A;  1YG6 A;  1PJH A;  2DUB A;  2VSU C;  3TT7 A;  3BEZ A;  1HNO A;  1TYF A;  3H02 A;  4K3W A;  4JCS A;  5IKL B;  3K50 A;  4HNK A;  2A7K A;  2FZS A;  2NP9 A;  2ZL2 A;  2J5I I;  2HW5 A;  4QFE A;  2FBM A;  5MGB A;  3R9Q A;  1FC7 A;  5E0S A;  4ZDB A;  4G2R A;  3H0Q A;  3Q0J A;  5CTC A;  3HLN 1;  1EF8 A;  4MOU A;  3H0J A;  3V5E A;  2PBP A;  1Q51 A;  5DU8 A;  2F6I A;  2A7S A;  3KQF A;  1UYR A;  4JOT A;  3GF7 A;  4FZW A;  3QWD A;  4FB8 A;  4B3I A;  1J7X A;  1JXZ A;  2C8T A;  2J5I A;  4QIJ A;  2F9Y B;  3FF6 A;  3U9T B;  3M6M A;  1OD2 A;  2DEO A;  2F9Y A;  4JSB A;  5KDR B;  1N6D A;  4ZDD A;  1WDK A;  3QYR A;  3SLL A;  5JBX A;  3HIN A;  3RSI A;  3GMA A;  3ISA A;  2UZF A;  1DCI A;  4FJW D;  4U0H A;  3KTJ A;  5DU4 A;  3V5I A;  3OME A;  2VX2 A;  4U0G H;  2VSU E;  1NZY B;  3K8X A;  4KPK A;  5E0N X;  3R0O A;  2PPY A;  3QRE A;  4U18 A;  3G64 A;  4NNQ A;  4FN7 A;  5E0S H;  2ZL4 A;  4I52 A;  3ZWB A;  4FZW C;  2ZQQ A;  3RRV A;  3P2L A;  3KTK A;  4EML A;  4KD6 A;  3T88 A;  4ASI A;  4EMM A;  4HC8 A;  1N6F A;  4JJT A;  4ZDF A;  1K32 A;  3ZWC A;  4GHN A;  4EMP A;  1XNW A;  2F6Q A;  2VSS E;  5DL1 A;  1EY3 A;  3KTH A;  1WZ8 A;  3MT6 A;  1FCF A;  1SZO A;  4FND A;  2VRE A;  3T8A A;  2CE3 A;  4DI1 A;  1HZD A;  3PEA A;  3PZK A;  2X24 A;  5DTP A;  3H81 A;  3IAV A;  4RYF H;  4U19 A;  2F9I A;  3VIV A;  5INI A;  4WZ8 B;  3DOR A;  3OC7 A;  3TDC A;  3QKA A;  3LAO A;  5DU6 A;  4OLQ A;  3WG5 A;  3P85 A;  1UYV A;  3U9R B;  5DZK H;  4LK5 A;  3TLF A;  5INF A;  5FUS A;  4Z0M A;  3H0S A;  4L8K A;  3QK8 A;  2J5I B;  5CTB A;  1XX4 A;  2ZL0 A;  2J5G D;  3GF3 A;  5C90 A;  1O8U A;  1RJN A;  3Q7H A;  1RJM A;  4RCN A;  4JCT A;  1FC9 A;  2CBY A;  2ZQR A;  4FN8 A;  3OT6 A;  3Q0G A;  3TVU A;  2QQ3 A;  1Q52 A;  3HE2 A;  1WDM A;  2X58 A;  5DKP A;  4IZB A;  4ZDE A;  4I42 A;  5G1Q A; 
#chains in the Genus database with same CATH topology
 1TG6 A;  5KJP A;  1VRG A;  3DJA A;  4JCQ A;  3T89 A;  2PG8 A;  4KWB A;  1UYS A;  1XNY A;  3TRR A;  2Q2X A;  3R9S A;  1XNV A;  3TV5 A;  3NJB A;  4GM2 A;  4YLH A;  3R9T A;  1W2X A;  4B3H A;  3I47 A;  3SWX A;  2IEX A;  1UIY A;  1FC6 A;  1X0U A;  4I4Z A;  4NEK A;  4Q0G A;  5ING A;  4FNB A;  4U0G A;  3T3W A;  3PE8 A;  1DUB A;  3QXZ A;  1OD4 A;  5DTW A;  1N6E A;  4MI2 A;  1UYT A;  1ON9 A;  3GKB A;  1EF9 A;  2BZR A;  4ELS A;  1MJ3 A;  4JVT A;  2Q35 A;  3IBB A;  4WYO B;  3STA A;  4ELW A;  3HP0 A;  4JYJ A;  5JBW A;  3RST A;  4JFC A;  2WTB A;  4RYF A;  3R6H A;  1XO6 A;  1K39 A;  4QII A;  3JU1 A;  4IZD A;  5C9G A;  3PGQ A;  2VSS A;  1NZY A;  1YG8 A;  3NJD A;  2D3T A;  4JCR A;  3IB9 A;  3HRX A;  1ON3 A;  2EJ5 A;  4HDT A;  3H0U A;  4U1A A;  2F9I B;  4K29 A;  3ZW8 A;  2VSS F;  3GLM A;  3KTG A;  3M6N A;  3ST9 A;  3L3S A;  3ZW9 A;  5KDR A;  4JWV A;  3KTI A;  4F47 A;  4WCZ A;  2VSU A;  2Q34 A;  3ZWA A;  4L6W A;  5DUF A;  5FIF A;  2YJG A;  2J5S A;  3QXI A;  1SG4 A;  3TVW A;  4ZU2 A;  3MYB A;  3TT6 A;  4JYL A;  4Q1I A;  3U9S B;  3T8B A;  2VSU F;  2FW2 A;  3QMJ A;  5DZK A;  4ELX A;  3MOY A;  2W3P A;  4IZC A;  4ZDC A;  2GTR A;  4B3J A;  4KNP A;  1HNU A;  2ZL3 A;  2J5G A;  3BPP A;  3Q1T A;  4MXI A;  5G1S A;  5G1R A;  5DUC A;  1WDL A;  3N6R B;  4K2N A;  3P5M A;  1PIX A;  1Y7O A;  3TZ3 A;  4OMR A;  3FDU A;  3BF0 A;  4J2U A;  2A81 A;  4NAR A;  3LKE A;  4OG1 A;  3MFM A;  1YG6 A;  1PJH A;  2DUB A;  2VSU C;  3TT7 A;  3BEZ A;  1HNO A;  1TYF A;  3H02 A;  4K3W A;  4JCS A;  5IKL B;  3K50 A;  4HNK A;  2A7K A;  2FZS A;  2NP9 A;  2ZL2 A;  2J5I I;  2HW5 A;  4QFE A;  2FBM A;  5MGB A;  3R9Q A;  1FC7 A;  5E0S A;  4ZDB A;  4G2R A;  3H0Q A;  3Q0J A;  5CTC A;  3HLN 1;  1EF8 A;  4MOU A;  3H0J A;  5HUQ A;  3V5E A;  2PBP A;  1Q51 A;  5DU8 A;  2F6I A;  2A7S A;  3KQF A;  1UYR A;  4JOT A;  3GF7 A;  4FZW A;  3QWD A;  4FB8 A;  4B3I A;  1J7X A;  1JXZ A;  2C8T A;  2J5I A;  4QIJ A;  2F9Y B;  3FF6 A;  3U9T B;  3M6M A;  1OD2 A;  2DEO A;  2F9Y A;  4JSB A;  5KDR B;  1N6D A;  4ZDD A;  1WDK A;  3QYR A;  3SLL A;  5JBX A;  3HIN A;  3RSI A;  3GMA A;  3ISA A;  2UZF A;  1DCI A;  4FJW D;  4U0H A;  3KTJ A;  5DU4 A;  3V5I A;  3OME A;  2VX2 A;  4U0G H;  2VSU E;  1NZY B;  3K8X A;  4KPK A;  5E0N X;  3R0O A;  2PPY A;  3QRE A;  4U18 A;  3G64 A;  4NNQ A;  4FN7 A;  5E0S H;  2ZL4 A;  4I52 A;  3ZWB A;  4FZW C;  2ZQQ A;  3RRV A;  3P2L A;  3KTK A;  4EML A;  4KD6 A;  3T88 A;  4ASI A;  4EMM A;  4HC8 A;  1N6F A;  4JJT A;  4ZDF A;  1K32 A;  3ZWC A;  4GHN A;  4EMP A;  1XNW A;  2F6Q A;  2VSS E;  5DL1 A;  1EY3 A;  3KTH A;  1WZ8 A;  3MT6 A;  1FCF A;  1SZO A;  4FND A;  2VRE A;  3BPT A;  3T8A A;  2CE3 A;  4DI1 A;  1HZD A;  3PEA A;  3PZK A;  2X24 A;  5DTP A;  3H81 A;  3IAV A;  4RYF H;  4U19 A;  2F9I A;  3VIV A;  5INI A;  4WZ8 B;  3DOR A;  3OC7 A;  3TDC A;  3QKA A;  3LAO A;  5DU6 A;  4OLQ A;  3WG5 A;  3P85 A;  1UYV A;  3U9R B;  5DZK H;  4LK5 A;  3TLF A;  5INF A;  5FUS A;  4Z0M A;  3H0S A;  4L8K A;  3QK8 A;  2J5I B;  5CTB A;  1XX4 A;  2ZL0 A;  2J5G D;  3GF3 A;  5C90 A;  1O8U A;  1RJN A;  3Q7H A;  1RJM A;  4RCN A;  4JCT A;  1FC9 A;  2CBY A;  2ZQR A;  4FN8 A;  3OT6 A;  3Q0G A;  3TVU A;  2QQ3 A;  1Q52 A;  3HE2 A;  1WDM A;  2X58 A;  5DKP A;  4IZB A;  4ZDE A;  4I42 A;  5G1Q A; 
#chains in the Genus database with same CATH homology
 1TG6 A;  5KJP A;  1VRG A;  3DJA A;  4JCQ A;  3T89 A;  2PG8 A;  4KWB A;  1UYS A;  1XNY A;  3TRR A;  2Q2X A;  3R9S A;  1XNV A;  3TV5 A;  3NJB A;  4GM2 A;  4YLH A;  3R9T A;  1W2X A;  4B3H A;  3I47 A;  3SWX A;  2IEX A;  1UIY A;  1FC6 A;  1X0U A;  4I4Z A;  4NEK A;  4Q0G A;  5ING A;  4FNB A;  4U0G A;  3T3W A;  3PE8 A;  1DUB A;  3QXZ A;  1OD4 A;  5DTW A;  1N6E A;  4MI2 A;  1UYT A;  1ON9 A;  3GKB A;  1EF9 A;  2BZR A;  4ELS A;  1MJ3 A;  4JVT A;  2Q35 A;  3IBB A;  4WYO B;  3STA A;  4ELW A;  3HP0 A;  4JYJ A;  5JBW A;  3RST A;  4JFC A;  2WTB A;  4RYF A;  3R6H A;  1XO6 A;  1K39 A;  4QII A;  3JU1 A;  4IZD A;  5C9G A;  3PGQ A;  2VSS A;  1NZY A;  1YG8 A;  3NJD A;  2D3T A;  4JCR A;  3IB9 A;  3HRX A;  1ON3 A;  2EJ5 A;  4HDT A;  3H0U A;  4U1A A;  2F9I B;  4K29 A;  3ZW8 A;  2VSS F;  3GLM A;  3KTG A;  3M6N A;  3ST9 A;  3L3S A;  3ZW9 A;  5KDR A;  4JWV A;  3KTI A;  4F47 A;  4WCZ A;  2VSU A;  2Q34 A;  3ZWA A;  4L6W A;  5DUF A;  5FIF A;  2YJG A;  2J5S A;  3QXI A;  1SG4 A;  3TVW A;  4ZU2 A;  3MYB A;  3TT6 A;  4JYL A;  4Q1I A;  3U9S B;  3T8B A;  2VSU F;  2FW2 A;  3QMJ A;  5DZK A;  4ELX A;  3MOY A;  2W3P A;  4IZC A;  4ZDC A;  2GTR A;  4B3J A;  4KNP A;  1HNU A;  2ZL3 A;  2J5G A;  3BPP A;  3Q1T A;  4MXI A;  5G1S A;  5G1R A;  5DUC A;  1WDL A;  3N6R B;  4K2N A;  3P5M A;  1PIX A;  1Y7O A;  3TZ3 A;  4OMR A;  3FDU A;  3BF0 A;  4J2U A;  2A81 A;  4NAR A;  3LKE A;  4OG1 A;  3MFM A;  1YG6 A;  1PJH A;  2DUB A;  2VSU C;  3TT7 A;  3BEZ A;  1HNO A;  1TYF A;  3H02 A;  4K3W A;  4JCS A;  5IKL B;  3K50 A;  4HNK A;  2A7K A;  2FZS A;  2NP9 A;  2ZL2 A;  2J5I I;  2HW5 A;  4QFE A;  2FBM A;  5MGB A;  3R9Q A;  1FC7 A;  5E0S A;  4ZDB A;  4G2R A;  3H0Q A;  3Q0J A;  5CTC A;  3HLN 1;  1EF8 A;  4MOU A;  3H0J A;  5HUQ A;  3V5E A;  2PBP A;  1Q51 A;  5DU8 A;  2F6I A;  2A7S A;  3KQF A;  1UYR A;  4JOT A;  3GF7 A;  4FZW A;  3QWD A;  4FB8 A;  4B3I A;  1J7X A;  1JXZ A;  2C8T A;  2J5I A;  4QIJ A;  2F9Y B;  3FF6 A;  3U9T B;  3M6M A;  1OD2 A;  2DEO A;  2F9Y A;  4JSB A;  5KDR B;  1N6D A;  4ZDD A;  1WDK A;  3QYR A;  3SLL A;  5JBX A;  3HIN A;  3RSI A;  3GMA A;  3ISA A;  2UZF A;  1DCI A;  4FJW D;  4U0H A;  3KTJ A;  5DU4 A;  3V5I A;  3OME A;  2VX2 A;  4U0G H;  2VSU E;  1NZY B;  3K8X A;  4KPK A;  5E0N X;  3R0O A;  2PPY A;  3QRE A;  4U18 A;  3G64 A;  4NNQ A;  4FN7 A;  5E0S H;  2ZL4 A;  4I52 A;  3ZWB A;  4FZW C;  2ZQQ A;  3RRV A;  3P2L A;  3KTK A;  4EML A;  4KD6 A;  3T88 A;  4ASI A;  4EMM A;  4HC8 A;  1N6F A;  4JJT A;  4ZDF A;  1K32 A;  3ZWC A;  4GHN A;  4EMP A;  1XNW A;  2F6Q A;  2VSS E;  5DL1 A;  1EY3 A;  3KTH A;  1WZ8 A;  3MT6 A;  1FCF A;  1SZO A;  4FND A;  2VRE A;  3BPT A;  3T8A A;  2CE3 A;  4DI1 A;  1HZD A;  3PEA A;  3PZK A;  2X24 A;  5DTP A;  3H81 A;  3IAV A;  4RYF H;  4U19 A;  2F9I A;  3VIV A;  5INI A;  4WZ8 B;  3DOR A;  3OC7 A;  3TDC A;  3QKA A;  3LAO A;  5DU6 A;  4OLQ A;  3WG5 A;  3P85 A;  1UYV A;  3U9R B;  5DZK H;  4LK5 A;  3TLF A;  5INF A;  5FUS A;  4Z0M A;  3H0S A;  4L8K A;  3QK8 A;  2J5I B;  5CTB A;  1XX4 A;  2ZL0 A;  2J5G D;  3GF3 A;  5C90 A;  1O8U A;  1RJN A;  3Q7H A;  1RJM A;  4RCN A;  4JCT A;  1FC9 A;  2CBY A;  2ZQR A;  4FN8 A;  3OT6 A;  3Q0G A;  3TVU A;  2QQ3 A;  1Q52 A;  3HE2 A;  1WDM A;  2X58 A;  5DKP A;  4IZB A;  4ZDE A;  4I42 A;  5G1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...