2F9YB

The crystal structure of the carboxyltransferase subunit of acc from escherichia coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
263
structure length
257
Chain Sequence
b'VWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl-CoA carboxylase, Carboxyltransferase alpha chain
publication title The Structure of the Carboxyltransferase Component of Acetyl-CoA Carboxylase Reveals a Zinc-Binding Motif Unique to the Bacterial Enzyme(,).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 70
structure length 257
sequence length 263
ec nomenclature ec 2.1.3.15: Acetyl-CoA carboxytransferase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
B PF17848 zf-ACC Acetyl-coA carboxylase zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2f9yB00
3TLFA 4Q1IA 5DKPA 3T8AA 2J5SA 3LKEA 3OT6A 3TT6A 3H0JA 4U0HA 4KWBA 3KQFA 5E0NX 4IZDA 1JXZA 3QXIA 5CTCA 1Q52A 4Z0MA 3U9RB 3WG5A 3GF7A 3H02A 4K3WA 4JYJA 1ON9A 5KDRB 3V5EA 2VSUE 4OMRA 4U19A 2F9IA 3GLMA 2BZRA 3H81A 5C90A 3QWDA 2A81A 3ST9A 3TV5A 3FDUA 3MFMA 3T89A 3SWXA 3Q0JA 3HLN1 4DI1A 5DU4A 3V5IA 1J7XA 4RYFA 4WCZA 3KTHA 4MOUA 4HC8A 1PIXA 3P2LA 3GF3A 1FC7A 1TYFA 1XNYA 5DTWA 2X24A 1FC9A 1K32A 3OC7A 3RSIA 4GHNA 2F9YA 2FZSA 3TVWA 3ZW9A 4ZU2A 2EJ5A 5FIFA 1SZOA 3KTKA 4NNQA 3K8XA 4K2NA 1WDLA 2FW2A 1HZDA 1VRGA 3P85A 2FBMA 2F6QA 3GMAA 2Q2XA 3LAOA 2VX2A 4KD6A 3RRVA 3P5MA 3MYBA 2ZQRA 3DJAA 4ELWA 4QIJA 5DZKH 4IZBA 5E0SA 2F9IB 5JBXA 5MGBA 3TZ3A 4FNBA 4MXIA 2C8TA 2IEXA 3PEAA 5DL1A 3U9SB 1RJNA 5KJPA 2WTBA 4JJTA 2W3PA 4JCTA 1FC6A 4QFEA 2ZQQA 4OLQA 1EF9A 4KPKA 1O8UA 4JCQA 2HW5A 3ZW8A 1UIYA 3KTGA 3KTJA 4IZCA 5CTBA 4EMLA 3BEZA 1EF8A 4I42A 4ZDEA 3TRRA 2J5II 1EY3A 2VSUF 2J5IB 4KNPA 3IBBA 4OG1A 3BF0A 3N6RB 5DUFA 4B3HA 4G2RA 1XO6A 4MI2A 3H0QA 1XNWA 4B3JA 3T8BA 3QMJA 3MOYA 3QKAA 2A7SA 2F6IA 4ZDFA 3IB9A 4RCNA 4U0GA 3PE8A 3PZKA 1DCIA 4RYFH 2PPYA 1FCFA 4L6WA 4ASIA 1HNUA 2D3TA 3IAVA 2ZL2A 5JBWA 4ELXA 5KDRA 1HNOA 3Q0GA 4I4ZA 3T3WA 4F47A 3R9TA 4I52A 4ELSA 4FZWA 4JYLA 4U18A 1ON3A 2VSSF 5C9GA 3ZWCA 3QK8A 4FNDA 2PBPA 1Q51A 2PG8A 4JSBA 3Q7HA 5INIA 2J5GD 2ZL3A 4L8KA 5G1SA 3PGQA 3I47A 5DU6A 1UYRA 4WZ8B 5IKLB 3JU1A 2Q35A 4YLHA 4EMPA 3KTIA 3K50A 2VREA 4QIIA 5E0SH 4JWVA 4JCRA 3HINA 2Q34A 4ZDDA 4WYOB 5G1QA 4FZWC 1WZ8A 3DORA 3NJDA 3R0OA 3MT6A 1W2XA 3ZWBA 4JCSA 1UYSA 2J5GA 3ZWAA 2ZL0A 1N6FA 5DU8A 3QYRA 1X0UA 3R6HA 1Y7OA 3TDCA 1TG6A 1XNVA 2F9YB 4FJWD 4LK5A 3HRXA 3H0SA 2VSUC 3TVUA 3G64A 1NZYA 5INGA 1MJ3A 3STAA 3BPPA 3M6NA 2GTRA 4JOTA 4JFCA 3ISAA 4NEKA 3U9TB 5INFA 5G1RA 2A7KA 2DEOA 1N6EA 1DUBA 3FF6A 2VSSA 3R9SA 1YG6A 2X58A 4ZDCA 1XX4A 1SG4A 2NP9A 3GKBA 3Q1TA 3OMEA 4ZDBA 1PJHA 4U0GH 1K39A 4HNKA 2CBYA 2CE3A 3HP0A 1RJMA 2QQ3A 3T88A 4FN7A 2J5IA 3QREA 4EMMA 3H0UA 3SLLA 3QXZA 2DUBA 2UZFA 2ZL4A 1WDMA 4B3IA 3R9QA 4GM2A 1N6DA 5DZKA 3L3SA 3RSTA 4FB8A 1UYTA 2VSSE 5FUSA 5DTPA 3VIVA 4K29A 1UYVA 2VSUA 1NZYB 1OD2A 1YG8A 4JVTA 4FN8A 3NJBA 1WDKA 3TT7A 4Q0GA 3HE2A 4U1AA 5DUCA 1OD4A 3M6MA
chains in the Genus database with same CATH superfamily
3TLFA 4Q1IA 5DKPA 3T8AA 2J5SA 3LKEA 3OT6A 2YJGA 3TT6A 3H0JA 4U0HA 4KWBA 3KQFA 5E0NX 4IZDA 1JXZA 3QXIA 5CTCA 1Q52A 4Z0MA 3U9RB 3WG5A 3GF7A 3H02A 4K3WA 4JYJA 1ON9A 5KDRB 3V5EA 2VSUE 4OMRA 4U19A 2F9IA 3GLMA 2BZRA 3H81A 5C90A 3QWDA 2A81A 3ST9A 3TV5A 3FDUA 3MFMA 3T89A 3SWXA 3Q0JA 3HLN1 4DI1A 5DU4A 3V5IA 1J7XA 4RYFA 4WCZA 3KTHA 4MOUA 4HC8A 1PIXA 3P2LA 3GF3A 4J2UA 1FC7A 1TYFA 1XNYA 5DTWA 2X24A 1FC9A 1K32A 3OC7A 3RSIA 4GHNA 2F9YA 2FZSA 3TVWA 3ZW9A 4ZU2A 2EJ5A 5FIFA 1SZOA 3KTKA 4NNQA 3K8XA 4K2NA 1WDLA 2FW2A 1HZDA 1VRGA 3P85A 2FBMA 2F6QA 3GMAA 2Q2XA 3LAOA 2VX2A 4KD6A 3RRVA 3P5MA 3MYBA 2ZQRA 3DJAA 4ELWA 4QIJA 5DZKH 4IZBA 5E0SA 2F9IB 5JBXA 5MGBA 3TZ3A 4FNBA 4MXIA 2C8TA 2IEXA 3PEAA 5DL1A 3U9SB 1RJNA 5KJPA 2WTBA 4JJTA 2W3PA 4JCTA 1FC6A 4QFEA 2ZQQA 4OLQA 1EF9A 4KPKA 1O8UA 4JCQA 2HW5A 3ZW8A 1UIYA 3KTGA 3KTJA 4IZCA 5CTBA 4EMLA 3BEZA 1EF8A 4I42A 4ZDEA 3TRRA 2J5II 1EY3A 2VSUF 2J5IB 4KNPA 3IBBA 4OG1A 3BF0A 3N6RB 5DUFA 4B3HA 4G2RA 1XO6A 4MI2A 3H0QA 1XNWA 4B3JA 3T8BA 3QMJA 3MOYA 3QKAA 2A7SA 2F6IA 4ZDFA 3IB9A 4RCNA 4U0GA 3PE8A 3PZKA 1DCIA 4RYFH 2PPYA 1FCFA 4L6WA 4ASIA 1HNUA 2D3TA 3IAVA 2ZL2A 5JBWA 4ELXA 5KDRA 1HNOA 3Q0GA 4I4ZA 3T3WA 4F47A 3R9TA 4I52A 4ELSA 4FZWA 4JYLA 4U18A 1ON3A 2VSSF 5C9GA 3ZWCA 3QK8A 4FNDA 2PBPA 1Q51A 2PG8A 4JSBA 3Q7HA 5INIA 2J5GD 2ZL3A 4L8KA 5G1SA 3PGQA 3I47A 5DU6A 1UYRA 4WZ8B 5IKLB 3JU1A 2Q35A 4YLHA 4EMPA 3KTIA 4HDTA 3K50A 2VREA 4QIIA 5E0SH 4JWVA 4JCRA 3HINA 2Q34A 4ZDDA 4WYOB 5G1QA 4FZWC 1WZ8A 3DORA 3NJDA 3R0OA 3MT6A 1W2XA 3ZWBA 4JCSA 1UYSA 2J5GA 3ZWAA 2ZL0A 1N6FA 5DU8A 3QYRA 1X0UA 3R6HA 3BPTA 1Y7OA 3TDCA 1TG6A 1XNVA 2F9YB 4FJWD 4LK5A 3HRXA 3H0SA 2VSUC 3TVUA 3G64A 1NZYA 5INGA 1MJ3A 3STAA 3BPPA 3M6NA 2GTRA 4JOTA 4JFCA 3ISAA 4NEKA 3U9TB 5INFA 5G1RA 2A7KA 2DEOA 1N6EA 1DUBA 3FF6A 2VSSA 3R9SA 1YG6A 2X58A 4ZDCA 1XX4A 1SG4A 2NP9A 5HUQA 3GKBA 3Q1TA 3OMEA 4ZDBA 1PJHA 4U0GH 1K39A 4HNKA 2CBYA 2CE3A 3HP0A 1RJMA 2QQ3A 3T88A 4FN7A 2J5IA 3QREA 4EMMA 3H0UA 3SLLA 3QXZA 2DUBA 2UZFA 2ZL4A 1WDMA 4B3IA 3R9QA 4GM2A 1N6DA 5DZKA 3L3SA 3RSTA 4FB8A 4NARA 1UYTA 2VSSE 5FUSA 5DTPA 3VIVA 4K29A 1UYVA 2VSUA 1NZYB 1OD2A 1YG8A 4JVTA 4FN8A 3NJBA 1WDKA 3TT7A 4Q0GA 3HE2A 4U1AA 5DUCA 1OD4A 3M6MA
chains in the Genus database with same CATH topology
3TLFA 4Q1IA 5DKPA 3T8AA 2J5SA 3LKEA 3OT6A 2YJGA 3TT6A 3H0JA 4U0HA 4KWBA 3KQFA 5E0NX 4IZDA 1JXZA 3QXIA 5CTCA 1Q52A 4Z0MA 3U9RB 3WG5A 3GF7A 3H02A 4K3WA 4JYJA 1ON9A 5KDRB 3V5EA 2VSUE 4OMRA 4U19A 2F9IA 3GLMA 2BZRA 3H81A 5C90A 3QWDA 2A81A 3ST9A 3TV5A 3FDUA 3MFMA 3T89A 3SWXA 3Q0JA 3HLN1 4DI1A 5DU4A 3V5IA 1J7XA 4RYFA 4WCZA 3KTHA 4MOUA 4HC8A 1PIXA 3P2LA 3GF3A 4J2UA 1FC7A 1TYFA 1XNYA 5DTWA 2X24A 1FC9A 1K32A 3OC7A 3RSIA 4GHNA 2F9YA 2FZSA 3TVWA 3ZW9A 4ZU2A 2EJ5A 5FIFA 1SZOA 3KTKA 4NNQA 3K8XA 4K2NA 1WDLA 2FW2A 1HZDA 1VRGA 3P85A 2FBMA 2F6QA 3GMAA 2Q2XA 3LAOA 2VX2A 4KD6A 3RRVA 3P5MA 3MYBA 2ZQRA 3DJAA 4ELWA 4QIJA 5DZKH 4IZBA 5E0SA 2F9IB 5JBXA 5MGBA 3TZ3A 4FNBA 4MXIA 2C8TA 2IEXA 3PEAA 5DL1A 3U9SB 1RJNA 5KJPA 2WTBA 4JJTA 2W3PA 4JCTA 1FC6A 4QFEA 2ZQQA 4OLQA 1EF9A 4KPKA 1O8UA 4JCQA 2HW5A 3ZW8A 1UIYA 3KTGA 3KTJA 4IZCA 5CTBA 4EMLA 3BEZA 1EF8A 4I42A 4ZDEA 3TRRA 2J5II 1EY3A 2VSUF 2J5IB 4KNPA 3IBBA 4OG1A 3BF0A 3N6RB 5DUFA 4B3HA 4G2RA 1XO6A 4MI2A 3H0QA 1XNWA 4B3JA 3T8BA 3QMJA 3MOYA 3QKAA 2A7SA 2F6IA 4ZDFA 3IB9A 4RCNA 4U0GA 3PE8A 3PZKA 1DCIA 4RYFH 2PPYA 1FCFA 4L6WA 4ASIA 1HNUA 2D3TA 3IAVA 2ZL2A 5JBWA 4ELXA 5KDRA 1HNOA 3Q0GA 4I4ZA 3T3WA 4F47A 3R9TA 4I52A 4ELSA 4FZWA 4JYLA 4U18A 1ON3A 2VSSF 5C9GA 3ZWCA 3QK8A 4FNDA 2PBPA 1Q51A 2PG8A 4JSBA 3Q7HA 5INIA 2J5GD 2ZL3A 4L8KA 5G1SA 3PGQA 3I47A 5DU6A 1UYRA 4WZ8B 5IKLB 3JU1A 2Q35A 4YLHA 4EMPA 3KTIA 4HDTA 3K50A 2VREA 4QIIA 5E0SH 4JWVA 4JCRA 3HINA 2Q34A 4ZDDA 4WYOB 5G1QA 4FZWC 1WZ8A 3DORA 3NJDA 3R0OA 3MT6A 1W2XA 3ZWBA 4JCSA 1UYSA 2J5GA 3ZWAA 2ZL0A 1N6FA 5DU8A 3QYRA 1X0UA 3R6HA 3BPTA 1Y7OA 3TDCA 1TG6A 1XNVA 2F9YB 4FJWD 4LK5A 3HRXA 3H0SA 2VSUC 3TVUA 3G64A 1NZYA 5INGA 1MJ3A 3STAA 3BPPA 3M6NA 2GTRA 4JOTA 4JFCA 3ISAA 4NEKA 3U9TB 5INFA 5G1RA 2A7KA 2DEOA 1N6EA 1DUBA 3FF6A 2VSSA 3R9SA 1YG6A 2X58A 4ZDCA 1XX4A 1SG4A 2NP9A 5HUQA 3GKBA 3Q1TA 3OMEA 4ZDBA 1PJHA 4U0GH 1K39A 4HNKA 2CBYA 2CE3A 3HP0A 1RJMA 2QQ3A 3T88A 4FN7A 2J5IA 3QREA 4EMMA 3H0UA 3SLLA 3QXZA 2DUBA 2UZFA 2ZL4A 1WDMA 4B3IA 3R9QA 4GM2A 1N6DA 5DZKA 3L3SA 3RSTA 4FB8A 4NARA 1UYTA 2VSSE 5FUSA 5DTPA 3VIVA 4K29A 1UYVA 2VSUA 1NZYB 1OD2A 1YG8A 4JVTA 4FN8A 3NJBA 1WDKA 3TT7A 4Q0GA 3HE2A 4U1AA 5DUCA 1OD4A 3M6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLF A;  4Q1I A;  5DKP A;  3T8A A;  2J5S A;  3LKE A;  3OT6 A;  3TT6 A;  3H0J A;  4U0H A;  4KWB A;  3KQF A;  5E0N X;  4IZD A;  1JXZ A;  3QXI A;  5CTC A;  1Q52 A;  4Z0M A;  3U9R B;  3WG5 A;  3GF7 A;  3H02 A;  4K3W A;  4JYJ A;  1ON9 A;  5KDR B;  3V5E A;  2VSU E;  4OMR A;  4U19 A;  2F9I A;  3GLM A;  2BZR A;  3H81 A;  5C90 A;  3QWD A;  2A81 A;  3ST9 A;  3TV5 A;  3FDU A;  3MFM A;  3T89 A;  3SWX A;  3Q0J A;  3HLN 1;  4DI1 A;  5DU4 A;  3V5I A;  1J7X A;  4RYF A;  4WCZ A;  3KTH A;  4MOU A;  4HC8 A;  1PIX A;  3P2L A;  3GF3 A;  1FC7 A;  1TYF A;  1XNY A;  5DTW A;  2X24 A;  1FC9 A;  1K32 A;  3OC7 A;  3RSI A;  4GHN A;  2F9Y A;  2FZS A;  3TVW A;  3ZW9 A;  4ZU2 A;  2EJ5 A;  5FIF A;  1SZO A;  3KTK A;  4NNQ A;  3K8X A;  4K2N A;  1WDL A;  2FW2 A;  1HZD A;  1VRG A;  3P85 A;  2FBM A;  2F6Q A;  3GMA A;  2Q2X A;  3LAO A;  2VX2 A;  4KD6 A;  3RRV A;  3P5M A;  3MYB A;  2ZQR A;  3DJA A;  4ELW A;  4QIJ A;  5DZK H;  4IZB A;  5E0S A;  2F9I B;  5JBX A;  5MGB A;  3TZ3 A;  4FNB A;  4MXI A;  2C8T A;  2IEX A;  3PEA A;  5DL1 A;  3U9S B;  1RJN A;  5KJP A;  2WTB A;  4JJT A;  2W3P A;  4JCT A;  1FC6 A;  4QFE A;  2ZQQ A;  4OLQ A;  1EF9 A;  4KPK A;  1O8U A;  4JCQ A;  2HW5 A;  3ZW8 A;  1UIY A;  3KTG A;  3KTJ A;  4IZC A;  5CTB A;  4EML A;  3BEZ A;  1EF8 A;  4I42 A;  4ZDE A;  3TRR A;  2J5I I;  1EY3 A;  2VSU F;  2J5I B;  4KNP A;  3IBB A;  4OG1 A;  3BF0 A;  3N6R B;  5DUF A;  4B3H A;  4G2R A;  1XO6 A;  4MI2 A;  3H0Q A;  1XNW A;  4B3J A;  3T8B A;  3QMJ A;  3MOY A;  3QKA A;  2A7S A;  2F6I A;  4ZDF A;  3IB9 A;  4RCN A;  4U0G A;  3PE8 A;  3PZK A;  1DCI A;  4RYF H;  2PPY A;  1FCF A;  4L6W A;  4ASI A;  1HNU A;  2D3T A;  3IAV A;  2ZL2 A;  5JBW A;  4ELX A;  5KDR A;  1HNO A;  3Q0G A;  4I4Z A;  3T3W A;  4F47 A;  3R9T A;  4I52 A;  4ELS A;  4FZW A;  4JYL A;  4U18 A;  1ON3 A;  2VSS F;  5C9G A;  3ZWC A;  3QK8 A;  4FND A;  2PBP A;  1Q51 A;  2PG8 A;  4JSB A;  3Q7H A;  5INI A;  2J5G D;  2ZL3 A;  4L8K A;  5G1S A;  3PGQ A;  3I47 A;  5DU6 A;  1UYR A;  4WZ8 B;  5IKL B;  3JU1 A;  2Q35 A;  4YLH A;  4EMP A;  3KTI A;  3K50 A;  2VRE A;  4QII A;  5E0S H;  4JWV A;  4JCR A;  3HIN A;  2Q34 A;  4ZDD A;  4WYO B;  5G1Q A;  4FZW C;  1WZ8 A;  3DOR A;  3NJD A;  3R0O A;  3MT6 A;  1W2X A;  3ZWB A;  4JCS A;  1UYS A;  2J5G A;  3ZWA A;  2ZL0 A;  1N6F A;  5DU8 A;  3QYR A;  1X0U A;  3R6H A;  1Y7O A;  3TDC A;  1TG6 A;  1XNV A;  2F9Y B;  4FJW D;  4LK5 A;  3HRX A;  3H0S A;  2VSU C;  3TVU A;  3G64 A;  1NZY A;  5ING A;  1MJ3 A;  3STA A;  3BPP A;  3M6N A;  2GTR A;  4JOT A;  4JFC A;  3ISA A;  4NEK A;  3U9T B;  5INF A;  5G1R A;  2A7K A;  2DEO A;  1N6E A;  1DUB A;  3FF6 A;  2VSS A;  3R9S A;  1YG6 A;  2X58 A;  4ZDC A;  1XX4 A;  1SG4 A;  2NP9 A;  3GKB A;  3Q1T A;  3OME A;  4ZDB A;  1PJH A;  4U0G H;  1K39 A;  4HNK A;  2CBY A;  2CE3 A;  3HP0 A;  1RJM A;  2QQ3 A;  3T88 A;  4FN7 A;  2J5I A;  3QRE A;  4EMM A;  3H0U A;  3SLL A;  3QXZ A;  2DUB A;  2UZF A;  2ZL4 A;  1WDM A;  4B3I A;  3R9Q A;  4GM2 A;  1N6D A;  5DZK A;  3L3S A;  3RST A;  4FB8 A;  1UYT A;  2VSS E;  5FUS A;  5DTP A;  3VIV A;  4K29 A;  1UYV A;  2VSU A;  1NZY B;  1OD2 A;  1YG8 A;  4JVT A;  4FN8 A;  3NJB A;  1WDK A;  3TT7 A;  4Q0G A;  3HE2 A;  4U1A A;  5DUC A;  1OD4 A;  3M6M A; 
#chains in the Genus database with same CATH topology
 3TLF A;  4Q1I A;  5DKP A;  3T8A A;  2J5S A;  3LKE A;  3OT6 A;  2YJG A;  3TT6 A;  3H0J A;  4U0H A;  4KWB A;  3KQF A;  5E0N X;  4IZD A;  1JXZ A;  3QXI A;  5CTC A;  1Q52 A;  4Z0M A;  3U9R B;  3WG5 A;  3GF7 A;  3H02 A;  4K3W A;  4JYJ A;  1ON9 A;  5KDR B;  3V5E A;  2VSU E;  4OMR A;  4U19 A;  2F9I A;  3GLM A;  2BZR A;  3H81 A;  5C90 A;  3QWD A;  2A81 A;  3ST9 A;  3TV5 A;  3FDU A;  3MFM A;  3T89 A;  3SWX A;  3Q0J A;  3HLN 1;  4DI1 A;  5DU4 A;  3V5I A;  1J7X A;  4RYF A;  4WCZ A;  3KTH A;  4MOU A;  4HC8 A;  1PIX A;  3P2L A;  3GF3 A;  4J2U A;  1FC7 A;  1TYF A;  1XNY A;  5DTW A;  2X24 A;  1FC9 A;  1K32 A;  3OC7 A;  3RSI A;  4GHN A;  2F9Y A;  2FZS A;  3TVW A;  3ZW9 A;  4ZU2 A;  2EJ5 A;  5FIF A;  1SZO A;  3KTK A;  4NNQ A;  3K8X A;  4K2N A;  1WDL A;  2FW2 A;  1HZD A;  1VRG A;  3P85 A;  2FBM A;  2F6Q A;  3GMA A;  2Q2X A;  3LAO A;  2VX2 A;  4KD6 A;  3RRV A;  3P5M A;  3MYB A;  2ZQR A;  3DJA A;  4ELW A;  4QIJ A;  5DZK H;  4IZB A;  5E0S A;  2F9I B;  5JBX A;  5MGB A;  3TZ3 A;  4FNB A;  4MXI A;  2C8T A;  2IEX A;  3PEA A;  5DL1 A;  3U9S B;  1RJN A;  5KJP A;  2WTB A;  4JJT A;  2W3P A;  4JCT A;  1FC6 A;  4QFE A;  2ZQQ A;  4OLQ A;  1EF9 A;  4KPK A;  1O8U A;  4JCQ A;  2HW5 A;  3ZW8 A;  1UIY A;  3KTG A;  3KTJ A;  4IZC A;  5CTB A;  4EML A;  3BEZ A;  1EF8 A;  4I42 A;  4ZDE A;  3TRR A;  2J5I I;  1EY3 A;  2VSU F;  2J5I B;  4KNP A;  3IBB A;  4OG1 A;  3BF0 A;  3N6R B;  5DUF A;  4B3H A;  4G2R A;  1XO6 A;  4MI2 A;  3H0Q A;  1XNW A;  4B3J A;  3T8B A;  3QMJ A;  3MOY A;  3QKA A;  2A7S A;  2F6I A;  4ZDF A;  3IB9 A;  4RCN A;  4U0G A;  3PE8 A;  3PZK A;  1DCI A;  4RYF H;  2PPY A;  1FCF A;  4L6W A;  4ASI A;  1HNU A;  2D3T A;  3IAV A;  2ZL2 A;  5JBW A;  4ELX A;  5KDR A;  1HNO A;  3Q0G A;  4I4Z A;  3T3W A;  4F47 A;  3R9T A;  4I52 A;  4ELS A;  4FZW A;  4JYL A;  4U18 A;  1ON3 A;  2VSS F;  5C9G A;  3ZWC A;  3QK8 A;  4FND A;  2PBP A;  1Q51 A;  2PG8 A;  4JSB A;  3Q7H A;  5INI A;  2J5G D;  2ZL3 A;  4L8K A;  5G1S A;  3PGQ A;  3I47 A;  5DU6 A;  1UYR A;  4WZ8 B;  5IKL B;  3JU1 A;  2Q35 A;  4YLH A;  4EMP A;  3KTI A;  4HDT A;  3K50 A;  2VRE A;  4QII A;  5E0S H;  4JWV A;  4JCR A;  3HIN A;  2Q34 A;  4ZDD A;  4WYO B;  5G1Q A;  4FZW C;  1WZ8 A;  3DOR A;  3NJD A;  3R0O A;  3MT6 A;  1W2X A;  3ZWB A;  4JCS A;  1UYS A;  2J5G A;  3ZWA A;  2ZL0 A;  1N6F A;  5DU8 A;  3QYR A;  1X0U A;  3R6H A;  3BPT A;  1Y7O A;  3TDC A;  1TG6 A;  1XNV A;  2F9Y B;  4FJW D;  4LK5 A;  3HRX A;  3H0S A;  2VSU C;  3TVU A;  3G64 A;  1NZY A;  5ING A;  1MJ3 A;  3STA A;  3BPP A;  3M6N A;  2GTR A;  4JOT A;  4JFC A;  3ISA A;  4NEK A;  3U9T B;  5INF A;  5G1R A;  2A7K A;  2DEO A;  1N6E A;  1DUB A;  3FF6 A;  2VSS A;  3R9S A;  1YG6 A;  2X58 A;  4ZDC A;  1XX4 A;  1SG4 A;  2NP9 A;  5HUQ A;  3GKB A;  3Q1T A;  3OME A;  4ZDB A;  1PJH A;  4U0G H;  1K39 A;  4HNK A;  2CBY A;  2CE3 A;  3HP0 A;  1RJM A;  2QQ3 A;  3T88 A;  4FN7 A;  2J5I A;  3QRE A;  4EMM A;  3H0U A;  3SLL A;  3QXZ A;  2DUB A;  2UZF A;  2ZL4 A;  1WDM A;  4B3I A;  3R9Q A;  4GM2 A;  1N6D A;  5DZK A;  3L3S A;  3RST A;  4FB8 A;  4NAR A;  1UYT A;  2VSS E;  5FUS A;  5DTP A;  3VIV A;  4K29 A;  1UYV A;  2VSU A;  1NZY B;  1OD2 A;  1YG8 A;  4JVT A;  4FN8 A;  3NJB A;  1WDK A;  3TT7 A;  4Q0G A;  3HE2 A;  4U1A A;  5DUC A;  1OD4 A;  3M6M A; 
#chains in the Genus database with same CATH homology
 3TLF A;  4Q1I A;  5DKP A;  3T8A A;  2J5S A;  3LKE A;  3OT6 A;  2YJG A;  3TT6 A;  3H0J A;  4U0H A;  4KWB A;  3KQF A;  5E0N X;  4IZD A;  1JXZ A;  3QXI A;  5CTC A;  1Q52 A;  4Z0M A;  3U9R B;  3WG5 A;  3GF7 A;  3H02 A;  4K3W A;  4JYJ A;  1ON9 A;  5KDR B;  3V5E A;  2VSU E;  4OMR A;  4U19 A;  2F9I A;  3GLM A;  2BZR A;  3H81 A;  5C90 A;  3QWD A;  2A81 A;  3ST9 A;  3TV5 A;  3FDU A;  3MFM A;  3T89 A;  3SWX A;  3Q0J A;  3HLN 1;  4DI1 A;  5DU4 A;  3V5I A;  1J7X A;  4RYF A;  4WCZ A;  3KTH A;  4MOU A;  4HC8 A;  1PIX A;  3P2L A;  3GF3 A;  4J2U A;  1FC7 A;  1TYF A;  1XNY A;  5DTW A;  2X24 A;  1FC9 A;  1K32 A;  3OC7 A;  3RSI A;  4GHN A;  2F9Y A;  2FZS A;  3TVW A;  3ZW9 A;  4ZU2 A;  2EJ5 A;  5FIF A;  1SZO A;  3KTK A;  4NNQ A;  3K8X A;  4K2N A;  1WDL A;  2FW2 A;  1HZD A;  1VRG A;  3P85 A;  2FBM A;  2F6Q A;  3GMA A;  2Q2X A;  3LAO A;  2VX2 A;  4KD6 A;  3RRV A;  3P5M A;  3MYB A;  2ZQR A;  3DJA A;  4ELW A;  4QIJ A;  5DZK H;  4IZB A;  5E0S A;  2F9I B;  5JBX A;  5MGB A;  3TZ3 A;  4FNB A;  4MXI A;  2C8T A;  2IEX A;  3PEA A;  5DL1 A;  3U9S B;  1RJN A;  5KJP A;  2WTB A;  4JJT A;  2W3P A;  4JCT A;  1FC6 A;  4QFE A;  2ZQQ A;  4OLQ A;  1EF9 A;  4KPK A;  1O8U A;  4JCQ A;  2HW5 A;  3ZW8 A;  1UIY A;  3KTG A;  3KTJ A;  4IZC A;  5CTB A;  4EML A;  3BEZ A;  1EF8 A;  4I42 A;  4ZDE A;  3TRR A;  2J5I I;  1EY3 A;  2VSU F;  2J5I B;  4KNP A;  3IBB A;  4OG1 A;  3BF0 A;  3N6R B;  5DUF A;  4B3H A;  4G2R A;  1XO6 A;  4MI2 A;  3H0Q A;  1XNW A;  4B3J A;  3T8B A;  3QMJ A;  3MOY A;  3QKA A;  2A7S A;  2F6I A;  4ZDF A;  3IB9 A;  4RCN A;  4U0G A;  3PE8 A;  3PZK A;  1DCI A;  4RYF H;  2PPY A;  1FCF A;  4L6W A;  4ASI A;  1HNU A;  2D3T A;  3IAV A;  2ZL2 A;  5JBW A;  4ELX A;  5KDR A;  1HNO A;  3Q0G A;  4I4Z A;  3T3W A;  4F47 A;  3R9T A;  4I52 A;  4ELS A;  4FZW A;  4JYL A;  4U18 A;  1ON3 A;  2VSS F;  5C9G A;  3ZWC A;  3QK8 A;  4FND A;  2PBP A;  1Q51 A;  2PG8 A;  4JSB A;  3Q7H A;  5INI A;  2J5G D;  2ZL3 A;  4L8K A;  5G1S A;  3PGQ A;  3I47 A;  5DU6 A;  1UYR A;  4WZ8 B;  5IKL B;  3JU1 A;  2Q35 A;  4YLH A;  4EMP A;  3KTI A;  4HDT A;  3K50 A;  2VRE A;  4QII A;  5E0S H;  4JWV A;  4JCR A;  3HIN A;  2Q34 A;  4ZDD A;  4WYO B;  5G1Q A;  4FZW C;  1WZ8 A;  3DOR A;  3NJD A;  3R0O A;  3MT6 A;  1W2X A;  3ZWB A;  4JCS A;  1UYS A;  2J5G A;  3ZWA A;  2ZL0 A;  1N6F A;  5DU8 A;  3QYR A;  1X0U A;  3R6H A;  3BPT A;  1Y7O A;  3TDC A;  1TG6 A;  1XNV A;  2F9Y B;  4FJW D;  4LK5 A;  3HRX A;  3H0S A;  2VSU C;  3TVU A;  3G64 A;  1NZY A;  5ING A;  1MJ3 A;  3STA A;  3BPP A;  3M6N A;  2GTR A;  4JOT A;  4JFC A;  3ISA A;  4NEK A;  3U9T B;  5INF A;  5G1R A;  2A7K A;  2DEO A;  1N6E A;  1DUB A;  3FF6 A;  2VSS A;  3R9S A;  1YG6 A;  2X58 A;  4ZDC A;  1XX4 A;  1SG4 A;  2NP9 A;  5HUQ A;  3GKB A;  3Q1T A;  3OME A;  4ZDB A;  1PJH A;  4U0G H;  1K39 A;  4HNK A;  2CBY A;  2CE3 A;  3HP0 A;  1RJM A;  2QQ3 A;  3T88 A;  4FN7 A;  2J5I A;  3QRE A;  4EMM A;  3H0U A;  3SLL A;  3QXZ A;  2DUB A;  2UZF A;  2ZL4 A;  1WDM A;  4B3I A;  3R9Q A;  4GM2 A;  1N6D A;  5DZK A;  3L3S A;  3RST A;  4FB8 A;  4NAR A;  1UYT A;  2VSS E;  5FUS A;  5DTP A;  3VIV A;  4K29 A;  1UYV A;  2VSU A;  1NZY B;  1OD2 A;  1YG8 A;  4JVT A;  4FN8 A;  3NJB A;  1WDK A;  3TT7 A;  4Q0G A;  3HE2 A;  4U1A A;  5DUC A;  1OD4 A;  3M6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...