2F9ZC

Complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
154
Chain Sequence
AHMKKVIGIGEYAVMKNPGVIVTLGLGSCVAVCMRDPVAKVGAMAHVMLPDSGGKTDKPGKYADTAVKTLVEELKKMGAKVERLEAKIAGGASMFESKGMNIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEYNIETGKLLVRKVLEIKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemotaxis protein CheC
publication title A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 37
structure length 154
sequence length 159
chains with identical sequence D
ec nomenclature ec 3.1.1.61: Protein-glutamate methylesterase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03975 CheD CheD chemotactic sensory transduction
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.200 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2f9zC00
2F9ZC
chains in the Genus database with same CATH superfamily
5HY2A 3F0DA 4NQ3A 5EYPB 4BVQA 3OW2F 2CZWA 3LWPC 3LWQC 2RHOA 5MN4A 1ODEA 2BTUA 3FD5A 3RYIA 5CA1A 3HWUA 3IEWA 2R6R1 5J2TB 2OZBA 3F0EA 4C8EA 1RA4A 3JALA 1JY8A 4I4TA 5FNVA 5GONB 2YXZA 3TD4A 3ZOPA 3E1YA 4WBNB 2NMUA 3OBYA 2ZODA 1JJ2F 2HS3A 1CN7A 3JASA 5LP6C 1K73H 5JCOC 1YGYA 2KTVA 4U3JA 3ON1A 1FFXB 3HKCB 5G4UC 2UYNB 2UYKA 3ZO8A 4RQOA 3RYCA 2V9YA 4ZOLB 4X1IA 2PHNA 3S0HA 1W59A 3NK7A 3WGMA 1VQLF 5EO3A 1VQ9F 3VCZA 4G4VA 3O85A 1XV2A 1FNJA 2AIFA 3G71F 3WGKA 1QVFF 2CHTA 3S03A 4E6EA 3CYPB 3LYBA 3JALB 3NK6A 3J7AR 4IHJA 1TUBB 2YYEA 3I3FA 3ZP7A 5JQGB 1VQ5F 2UYJA 4BT2A 4BY9D 2UYPA 4X3LA 3ERNA 3GTZA 1YIJF 1W2BF 4TV8A 5HWEA 2RHHA 3DDNA 3IKEA 3I7TA 1GZ0A 4BT4A 3VYTC 3VOBA 4LNUB 2JNBA 4X1IB 3WGJA 3MQWA 1UI9A 2ZAUA 3KHNA 4EI9A 5J2UA 2VAPA 3J81M 3JVHA 4O4JB 2HP3A 1VHAA 3K12A 2QEXF 2ALEA 3S02A 5HXZA 3G4SF 3GYQA 4C82A 4B46A 3B6NA 4IHJB 2GZLA 3TD5A 3I55F 3GHZA 1PXWA 2Z1TA 3AGKA 3QUWA 1Z5VA 1W3EX 4EB6B 2LBTA 5KX5A 1Z5WA 5GAPK 1XHOA 3V4DA 1GX1A 4ZK7A 4ZI7A 3G6EF 5GANK 2ZF8A 1K8AH 3E22A 5IYZA 3FPIA 4NWOB 1X25A 3VOAA 1U3PA 2IAFA 4X1YA 1RQ7A 3RA5A 1RLUA 3WGNA 3TD3A 3CG6A 3CC7F 2GLZA 1ZWZA 2HP0B 1JFFA 3WJPA 1M90H 1JN1A 4C8GA 1ONIA 2CSLA 3V7QA 4G4YA 5ITZB 3P10A 1W40A 5C8YB 2OTJF 5LP6A 2W8BC 2ZVYA 4HNAA 3JAWB 2QI2A 5LA6B 1M1KH 2QA4F 1COMA 5CB4A 1TVKA 2QTPA 2VAMA 4TV9B 5IJ9B 4I55A 1N8RH 1QVGF 1KD1H 3P0ZA 2ZOVA 2CWJA 4ERHA 3NVIB 4X20A 1J7HA 3ZP4A 3N4ZA 4EI8A 2HVYD 1IV1A 1FNKA 3LWRC 1YJWF 4NUTA 2IG8A 3CYQA 4BW0B 2KGWA 3I56F 4EI7A 1W5BA 2Z1EA 3QHDA 3HKEB 3MDOA 3VTIC 1RLGA 1VQVA 1PF5A 4LCKA 5CA0A 1K9MH 3VIUA 3VO8A 2DT4A 1T0AA 1KNKA 2CHSA 3CD6F 4XCQA 4I50A 5EZYA 4G88A 1KNJA 4F6RA 2BTOA 4O2AB 4O4IB 2H6LA 5MN5A 1YJ9F 1UFYA 3RYHA 2OHWA 5LYJA 3KE1A 3R0PA 5MN6A 1VH8A 1E7KA 3S0WA 2H8CA 2RHLA 3RYIB 5CA1B 3WJQA 3MCQA 2Q1YA 5BMVA 1Q81H 1R1MA 5IJ0A 3K0TA 1CK2A 5KMGA 4I4TB 4BVTA 5FNVB 1QAHA 2LBXA 2GVIA 5IT9M 4DRXA 2CVLA 2WALA 2Z01A 3JASB 3K2XA 4U39A 2OTLF 3N2GA 4U3JB 3JATA 4I50B 3HJWC 5A2QM 1DT9A 1H48A 5EZYB 1VQKF 3OONA 4FFBA 4F6RB 3JAKA 3RYCB 2BTQB 3UT5A 4ZHQA 1CLIA 3ESJA 3K14A 5GIPC 1W5FA 2UZHA 4BT5A 3RYFA 1OAPA 3P4EA 2LBWA 4C81A 1GO1A 4G4XA 5JH7A 4X3MA 3MCAB 3JCMM 1YHQF 4O4HA 2EWCA 3HKBA 4YJ3A 4TUYA 3CCRF 3LDTA 4X1KA 5BMVB 3F0GA 3C9SA 5KMGB 3JARA 3CC2F 4BVSA 1OFUA 1U3LA 4TV8B 5JVDA 1KC8H 1W57A 2LCAA 3CCJF 4O2BA 1VQ7F 4C4WC 5LXTA 5AVMA 5HP8A 4ZHQB 2B33A 3DC2A 2MQEA 5J2UB 5LOVA 3CMAF 4KWEA 3VI6A 4IIJA 4YJ2A 3C9TA 2HX0A 3C9RA 2PMPA 1JD1A 3JARB 5FJ4C 3HKDA 3IMPA 2Z1UA 3LMEA 5KX5B 1S72F 5JCOA 3N4YA 2FGYA 5EWRA 1H47A 4ZI7B 3KJKA 3SIUA 2IQQA 3E22B 1VQ4F 5IYZB 4G4WA 4M8IA 4B62A 4X1YB 5EYPA 3CB2A 2Z1FA 3U0OA 1W5EA 4ZHYB 2VGMA 1W581 1JFFB 1GO0A 5GONA 4B45A 4WBNA 5EIBC 3S06A 4ZHWA 3HKDB 3KIZA 3BYQA 5EAZA 1KQSF 2I6RA 5EB0A 5LP6B 3HKCA 1FFXA 2HRYA 1SZQA 4HNAB 2UYNA 3VYUC 2VXYA 5HY1A 1X7PA 3PLAC 4C8IA 5CB4B 1TVKB 5G4VC 4I55B 1VQOF 3D54A 2RHJA 4O4LA 1FSZA 1SA0A 5FLXM 5HP7A 2HS4A 2N48A 3ELCA 3CCEF 3CMEF 5HY0A 1VQMF 4X20B 4RHAA 2R751 3F0FA 1YJNF 1TUBA 3LWVC 5JQGA 4PWTA 5B8FA 1XBIA 3C9UA 3N2KA 3CPQA 3J80M 3KJJA 3V7EA 2KTUA 3WJRA 3L7QA 2AIZP 1VQPF 5CA0B 3CCUF 3QTYA 4LNUA 3RE3A 3M84A 4TZZA 4O4LB 1NQ3A 1SA0B 3WGLA 2VGNA 3V3TA 1RQ2A 2F9ZC 4O4JA 1VQ8F 1W42A 2Q1XA 3WPXA 1VQ6F 3M1XA 3RYHB 1IV4A 3LWOC 4BVRA 2KG4A 2G9IA 4G4ZA 5LYJB 3CCLF 3NMUC 1XRGA 1IV2A 3N2KB 3VYSC 3CPWF 4EB6A 2RB9A 3FD6A 5EIBD 5IJ0B 2L26A 1H7MA 4DXDA 1Q82H 3CCMF 3CCSF 3M4SA 4DRXB 2OTMA 4B5CA 3N2GB 2AMTA 3CC4F 3JATB 3E20B 2FC3A 2VAWA 3IKFA 3T80A 2BO1A 1T0KB 4FFBB 3JAKB 3NVKE 1IV3A 1QD9A 3CCVF 1YI2F 4BT6A 3UT5B 2HP0A 3SIVA 3PAFA 3RYFB 1SDSA 5JH7B 3JAMM 4BT3A 1NMUB 4O4HB 3CXCF 1VK3A 5ITZA 3HKBB 1YQNA 4YJ3B 5C8YA 4TUYB 3HAXD 4X1KB 5HY4A 1NJIH 3JAWA 5LA6A 5EB1B 5IJ9A 4TV9A 3S0YA 3Q8HA 3WPWA 3IR9A 3RA6A 4BT7A 1X7OA 2I6DA 5JVDB 1X52A 1QU9A 3FBAA 1W55A 2HRUA 2K1SA 1U40A 2ZVZA 4O2BB 1IPAA 3OBWA 2H8EA 5LXTB 3EORA 3HTNA 1VQNF 2CW4A 1Q86H 5LOVB 1W41A 2DYYA 3LFOA 5J2TA 3F6MA 1W5AA 3D00A 4IIJB 5DCVA 3WXMB 3HKEA 2P6YA 4YJ2B 1Q7YH 1DBFA 5GIOC 1YITF 4R40B 3C8LA 3IEQA 4ZHVA 1U43A 3D01A 1Q8RA 3FFMA 5GINC 4O2AA 4O4IA 2HS0A 3VMFB 3CCQF 4ZOLA 3MBMA 5HXUA 2HQSC
chains in the Genus database with same CATH topology
4BVSA 5HY2A 1M90H 4TZZA 4NQ3A 4BVQA 3OW2F 2CZWA 3LWPC 3LWQC 3V7QA 2VGNA 3V3TA 2F9ZC 1W40A 1KC8H 2OTJF 1VQ8F 1W42A 3CCJF 2OZBA 2QI2A 1VQ7F 1RA4A 1M1KH 1VQ6F 2QA4F 4C4WC 1N8RH 3LWOC 4BVRA 1QVGF 3E1YA 2KG4A 3OBYA 1KD1H 1JJ2F 1CN7A 3CCLF 1K73H 3NVIB 3NMUC 2KTVA 3CMAF 3ON1A 3CPWF 5G4UC 3VI6A 1H7MA 1Q82H 3N4ZA 4EI8A 3CCMF 2HVYD 3CCSF 3NK7A 1VQLF 5EO3A 1VQ9F 5FJ4C 3LWRC 3CC4F 1YJWF 3O85A 3E20B 2AIFA 2FC3A 4NUTA 3G71F 1S72F 2BO1A 4BW0B 1T0KB 3N4YA 2FGYA 5EWRA 1QVFF 3I56F 4EI7A 3NVKE 3CCVF 1RLGA 3SIUA 1YI2F 4LCKA 1VQ4F 3NK6A 3J7AR 1K9MH 3SIVA 1VQ5F 3PAFA 1SDSA 3CD6F 4XCQA 3JAMM 4BY9D 4X3LA 1NMUB 1YIJF 3CXCF 1W2BF 5HWEA 3HAXD 5HY4A 1YJ9F 2VGMA 1NJIH 1GZ0A 1GO0A 2JNBA 2OHWA 3IR9A 3RA6A 1X7OA 4EI9A 1E7KA 2I6DA 1X52A 1KQSF 3J81M 1Q81H 3PLAC 5HY1A 1X7PA 2QEXF 1CK2A 2ALEA 1IPAA 3OBWA 4BVTA 5G4VC 2LBXA 5HXZA 3G4SF 3GYQA 1VQOF 5IT9M 1VQNF 2WALA 5FLXM 3I55F 1Q86H 2OTLF 1PXWA 3AGKA 1W41A 1W3EX 3HJWC 5GAPK 3CCEF 5A2QM 5HY0A 1DT9A 3CMEF 1VQMF 3LFOA 1VQKF 3D00A 5DCVA 3WXMB 3G6EF 5GANK 1K8AH 1Q7YH 1YITF 5GIOC 1YJNF 5GIPC 3LWVC 2LBWA 1XBIA 1GO1A 3RA5A 3CPQA 4X3MA 3MCAB 3JCMM 1YHQF 3J80M 3V7EA 3FFMA 5GINC 2KTUA 3CG6A 3VMFB 3CCRF 3CCQF 3CC7F 1VQPF 2GLZA 1ZWZA 3CCUF 5HXUA 3CC2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F9Z C; 
#chains in the Genus database with same CATH topology
 5HY2 A;  3F0D A;  4NQ3 A;  5EYP B;  4BVQ A;  3OW2 F;  2CZW A;  3LWP C;  3LWQ C;  2RHO A;  5MN4 A;  1ODE A;  2BTU A;  3FD5 A;  3RYI A;  5CA1 A;  3HWU A;  3IEW A;  2R6R 1;  5J2T B;  2OZB A;  3F0E A;  4C8E A;  1RA4 A;  3JAL A;  1JY8 A;  4I4T A;  5FNV A;  5GON B;  2YXZ A;  3TD4 A;  3ZOP A;  3E1Y A;  4WBN B;  2NMU A;  3OBY A;  2ZOD A;  1JJ2 F;  2HS3 A;  1CN7 A;  3JAS A;  5LP6 C;  1K73 H;  5JCO C;  1YGY A;  2KTV A;  4U3J A;  3ON1 A;  1FFX B;  3HKC B;  5G4U C;  2UYN B;  2UYK A;  3ZO8 A;  4RQO A;  3RYC A;  2V9Y A;  4ZOL B;  4X1I A;  2PHN A;  3S0H A;  1W59 A;  3NK7 A;  3WGM A;  1VQL F;  5EO3 A;  1VQ9 F;  3VCZ A;  4G4V A;  3O85 A;  1XV2 A;  1FNJ A;  2AIF A;  3G71 F;  3WGK A;  1QVF F;  2CHT A;  3S03 A;  4E6E A;  3CYP B;  3LYB A;  3JAL B;  3NK6 A;  3J7A R;  4IHJ A;  1TUB B;  2YYE A;  3I3F A;  3ZP7 A;  5JQG B;  1VQ5 F;  2UYJ A;  4BT2 A;  4BY9 D;  2UYP A;  4X3L A;  3ERN A;  3GTZ A;  1YIJ F;  1W2B F;  4TV8 A;  5HWE A;  2RHH A;  3DDN A;  3IKE A;  3I7T A;  1GZ0 A;  4BT4 A;  3VYT C;  3VOB A;  4LNU B;  2JNB A;  4X1I B;  3WGJ A;  3MQW A;  1UI9 A;  2ZAU A;  3KHN A;  4EI9 A;  5J2U A;  2VAP A;  3J81 M;  3JVH A;  4O4J B;  2HP3 A;  1VHA A;  3K12 A;  2QEX F;  2ALE A;  3S02 A;  5HXZ A;  3G4S F;  3GYQ A;  4C82 A;  4B46 A;  3B6N A;  4IHJ B;  2GZL A;  3TD5 A;  3I55 F;  3GHZ A;  1PXW A;  2Z1T A;  3AGK A;  3QUW A;  1Z5V A;  1W3E X;  4EB6 B;  2LBT A;  5KX5 A;  1Z5W A;  5GAP K;  1XHO A;  3V4D A;  1GX1 A;  4ZK7 A;  4ZI7 A;  3G6E F;  5GAN K;  2ZF8 A;  1K8A H;  3E22 A;  5IYZ A;  3FPI A;  4NWO B;  1X25 A;  3VOA A;  1U3P A;  2IAF A;  4X1Y A;  1RQ7 A;  3RA5 A;  1RLU A;  3WGN A;  3TD3 A;  3CG6 A;  3CC7 F;  2GLZ A;  1ZWZ A;  2HP0 B;  1JFF A;  3WJP A;  1M90 H;  1JN1 A;  4C8G A;  1ONI A;  2CSL A;  3V7Q A;  4G4Y A;  5ITZ B;  3P10 A;  1W40 A;  5C8Y B;  2OTJ F;  5LP6 A;  2W8B C;  2ZVY A;  4HNA A;  3JAW B;  2QI2 A;  5LA6 B;  1M1K H;  2QA4 F;  1COM A;  5CB4 A;  1TVK A;  2QTP A;  2VAM A;  4TV9 B;  5IJ9 B;  4I55 A;  1N8R H;  1QVG F;  1KD1 H;  3P0Z A;  2ZOV A;  2CWJ A;  4ERH A;  3NVI B;  4X20 A;  1J7H A;  3ZP4 A;  3N4Z A;  4EI8 A;  2HVY D;  1IV1 A;  1FNK A;  3LWR C;  1YJW F;  4NUT A;  2IG8 A;  3CYQ A;  4BW0 B;  2KGW A;  3I56 F;  4EI7 A;  1W5B A;  2Z1E A;  3QHD A;  3HKE B;  3MDO A;  3VTI C;  1RLG A;  1VQV A;  1PF5 A;  4LCK A;  5CA0 A;  1K9M H;  3VIU A;  3VO8 A;  2DT4 A;  1T0A A;  1KNK A;  2CHS A;  3CD6 F;  4XCQ A;  4I50 A;  5EZY A;  4G88 A;  1KNJ A;  4F6R A;  2BTO A;  4O2A B;  4O4I B;  2H6L A;  5MN5 A;  1YJ9 F;  1UFY A;  3RYH A;  2OHW A;  5LYJ A;  3KE1 A;  3R0P A;  5MN6 A;  1VH8 A;  1E7K A;  3S0W A;  2H8C A;  2RHL A;  3RYI B;  5CA1 B;  3WJQ A;  3MCQ A;  2Q1Y A;  5BMV A;  1Q81 H;  1R1M A;  5IJ0 A;  3K0T A;  1CK2 A;  5KMG A;  4I4T B;  4BVT A;  5FNV B;  1QAH A;  2LBX A;  2GVI A;  5IT9 M;  4DRX A;  2CVL A;  2WAL A;  2Z01 A;  3JAS B;  3K2X A;  4U39 A;  2OTL F;  3N2G A;  4U3J B;  3JAT A;  4I50 B;  3HJW C;  5A2Q M;  1DT9 A;  1H48 A;  5EZY B;  1VQK F;  3OON A;  4FFB A;  4F6R B;  3JAK A;  3RYC B;  2BTQ B;  3UT5 A;  4ZHQ A;  1CLI A;  3ESJ A;  3K14 A;  5GIP C;  1W5F A;  2UZH A;  4BT5 A;  3RYF A;  1OAP A;  3P4E A;  2LBW A;  4C81 A;  1GO1 A;  4G4X A;  5JH7 A;  4X3M A;  3MCA B;  3JCM M;  1YHQ F;  4O4H A;  2EWC A;  3HKB A;  4YJ3 A;  4TUY A;  3CCR F;  3LDT A;  4X1K A;  5BMV B;  3F0G A;  3C9S A;  5KMG B;  3JAR A;  3CC2 F;  4BVS A;  1OFU A;  1U3L A;  4TV8 B;  5JVD A;  1KC8 H;  1W57 A;  2LCA A;  3CCJ F;  4O2B A;  1VQ7 F;  4C4W C;  5LXT A;  5AVM A;  5HP8 A;  4ZHQ B;  2B33 A;  3DC2 A;  2MQE A;  5J2U B;  5LOV A;  3CMA F;  4KWE A;  3VI6 A;  4IIJ A;  4YJ2 A;  3C9T A;  2HX0 A;  3C9R A;  2PMP A;  1JD1 A;  3JAR B;  5FJ4 C;  3HKD A;  3IMP A;  2Z1U A;  3LME A;  5KX5 B;  1S72 F;  5JCO A;  3N4Y A;  2FGY A;  5EWR A;  1H47 A;  4ZI7 B;  3KJK A;  3SIU A;  2IQQ A;  3E22 B;  1VQ4 F;  5IYZ B;  4G4W A;  4M8I A;  4B62 A;  4X1Y B;  5EYP A;  3CB2 A;  2Z1F A;  3U0O A;  1W5E A;  4ZHY B;  2VGM A;  1W58 1;  1JFF B;  1GO0 A;  5GON A;  4B45 A;  4WBN A;  5EIB C;  3S06 A;  4ZHW A;  3HKD B;  3KIZ A;  3BYQ A;  5EAZ A;  1KQS F;  2I6R A;  5EB0 A;  5LP6 B;  3HKC A;  1FFX A;  2HRY A;  1SZQ A;  4HNA B;  2UYN A;  3VYU C;  2VXY A;  5HY1 A;  1X7P A;  3PLA C;  4C8I A;  5CB4 B;  1TVK B;  5G4V C;  4I55 B;  1VQO F;  3D54 A;  2RHJ A;  4O4L A;  1FSZ A;  1SA0 A;  5FLX M;  5HP7 A;  2HS4 A;  2N48 A;  3ELC A;  3CCE F;  3CME F;  5HY0 A;  1VQM F;  4X20 B;  4RHA A;  2R75 1;  3F0F A;  1YJN F;  1TUB A;  3LWV C;  5JQG A;  4PWT A;  5B8F A;  1XBI A;  3C9U A;  3N2K A;  3CPQ A;  3J80 M;  3KJJ A;  3V7E A;  2KTU A;  3WJR A;  3L7Q A;  2AIZ P;  1VQP F;  5CA0 B;  3CCU F;  3QTY A;  4LNU A;  3RE3 A;  3M84 A;  4TZZ A;  4O4L B;  1NQ3 A;  1SA0 B;  3WGL A;  2VGN A;  3V3T A;  1RQ2 A;  2F9Z C;  4O4J A;  1VQ8 F;  1W42 A;  2Q1X A;  3WPX A;  1VQ6 F;  3M1X A;  3RYH B;  1IV4 A;  3LWO C;  4BVR A;  2KG4 A;  2G9I A;  4G4Z A;  5LYJ B;  3CCL F;  3NMU C;  1XRG A;  1IV2 A;  3N2K B;  3VYS C;  3CPW F;  4EB6 A;  2RB9 A;  3FD6 A;  5EIB D;  5IJ0 B;  2L26 A;  1H7M A;  4DXD A;  1Q82 H;  3CCM F;  3CCS F;  3M4S A;  4DRX B;  2OTM A;  4B5C A;  3N2G B;  2AMT A;  3CC4 F;  3JAT B;  3E20 B;  2FC3 A;  2VAW A;  3IKF A;  3T80 A;  2BO1 A;  1T0K B;  4FFB B;  3JAK B;  3NVK E;  1IV3 A;  1QD9 A;  3CCV F;  1YI2 F;  4BT6 A;  3UT5 B;  2HP0 A;  3SIV A;  3PAF A;  3RYF B;  1SDS A;  5JH7 B;  3JAM M;  4BT3 A;  1NMU B;  4O4H B;  3CXC F;  1VK3 A;  5ITZ A;  3HKB B;  1YQN A;  4YJ3 B;  5C8Y A;  4TUY B;  3HAX D;  4X1K B;  5HY4 A;  1NJI H;  3JAW A;  5LA6 A;  5EB1 B;  5IJ9 A;  4TV9 A;  3S0Y A;  3Q8H A;  3WPW A;  3IR9 A;  3RA6 A;  4BT7 A;  1X7O A;  2I6D A;  5JVD B;  1X52 A;  1QU9 A;  3FBA A;  1W55 A;  2HRU A;  2K1S A;  1U40 A;  2ZVZ A;  4O2B B;  1IPA A;  3OBW A;  2H8E A;  5LXT B;  3EOR A;  3HTN A;  1VQN F;  2CW4 A;  1Q86 H;  5LOV B;  1W41 A;  2DYY A;  3LFO A;  5J2T A;  3F6M A;  1W5A A;  3D00 A;  4IIJ B;  5DCV A;  3WXM B;  3HKE A;  2P6Y A;  4YJ2 B;  1Q7Y H;  1DBF A;  5GIO C;  1YIT F;  4R40 B;  3C8L A;  3IEQ A;  4ZHV A;  1U43 A;  3D01 A;  1Q8R A;  3FFM A;  5GIN C;  4O2A A;  4O4I A;  2HS0 A;  3VMF B;  3CCQ F;  4ZOL A;  3MBM A;  5HXU A;  2HQS C; 
#chains in the Genus database with same CATH homology
 4BVS A;  5HY2 A;  1M90 H;  4TZZ A;  4NQ3 A;  4BVQ A;  3OW2 F;  2CZW A;  3LWP C;  3LWQ C;  3V7Q A;  2VGN A;  3V3T A;  2F9Z C;  1W40 A;  1KC8 H;  2OTJ F;  1VQ8 F;  1W42 A;  3CCJ F;  2OZB A;  2QI2 A;  1VQ7 F;  1RA4 A;  1M1K H;  1VQ6 F;  2QA4 F;  4C4W C;  1N8R H;  3LWO C;  4BVR A;  1QVG F;  3E1Y A;  2KG4 A;  3OBY A;  1KD1 H;  1JJ2 F;  1CN7 A;  3CCL F;  1K73 H;  3NVI B;  3NMU C;  2KTV A;  3CMA F;  3ON1 A;  3CPW F;  5G4U C;  3VI6 A;  1H7M A;  1Q82 H;  3N4Z A;  4EI8 A;  3CCM F;  2HVY D;  3CCS F;  3NK7 A;  1VQL F;  5EO3 A;  1VQ9 F;  5FJ4 C;  3LWR C;  3CC4 F;  1YJW F;  3O85 A;  3E20 B;  2AIF A;  2FC3 A;  4NUT A;  3G71 F;  1S72 F;  2BO1 A;  4BW0 B;  1T0K B;  3N4Y A;  2FGY A;  5EWR A;  1QVF F;  3I56 F;  4EI7 A;  3NVK E;  3CCV F;  1RLG A;  3SIU A;  1YI2 F;  4LCK A;  1VQ4 F;  3NK6 A;  3J7A R;  1K9M H;  3SIV A;  1VQ5 F;  3PAF A;  1SDS A;  3CD6 F;  4XCQ A;  3JAM M;  4BY9 D;  4X3L A;  1NMU B;  1YIJ F;  3CXC F;  1W2B F;  5HWE A;  3HAX D;  5HY4 A;  1YJ9 F;  2VGM A;  1NJI H;  1GZ0 A;  1GO0 A;  2JNB A;  2OHW A;  3IR9 A;  3RA6 A;  1X7O A;  4EI9 A;  1E7K A;  2I6D A;  1X52 A;  1KQS F;  3J81 M;  1Q81 H;  3PLA C;  5HY1 A;  1X7P A;  2QEX F;  1CK2 A;  2ALE A;  1IPA A;  3OBW A;  4BVT A;  5G4V C;  2LBX A;  5HXZ A;  3G4S F;  3GYQ A;  1VQO F;  5IT9 M;  1VQN F;  2WAL A;  5FLX M;  3I55 F;  1Q86 H;  2OTL F;  1PXW A;  3AGK A;  1W41 A;  1W3E X;  3HJW C;  5GAP K;  3CCE F;  5A2Q M;  5HY0 A;  1DT9 A;  3CME F;  1VQM F;  3LFO A;  1VQK F;  3D00 A;  5DCV A;  3WXM B;  3G6E F;  5GAN K;  1K8A H;  1Q7Y H;  1YIT F;  5GIO C;  1YJN F;  5GIP C;  3LWV C;  2LBW A;  1XBI A;  1GO1 A;  3RA5 A;  3CPQ A;  4X3M A;  3MCA B;  3JCM M;  1YHQ F;  3J80 M;  3V7E A;  3FFM A;  5GIN C;  2KTU A;  3CG6 A;  3VMF B;  3CCR F;  3CCQ F;  3CC7 F;  1VQP F;  2GLZ A;  1ZWZ A;  3CCU F;  5HXU A;  3CC2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...