2F9ZC

Complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
154
Chain Sequence
AHMKKVIGIGEYAVMKNPGVIVTLGLGSCVAVCMRDPVAKVGAMAHVMLPDSGGKTDKPGKYADTAVKTLVEELKKMGAKVERLEAKIAGGASMFESKGMNIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEYNIETGKLLVRKVLEIKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemotaxis protein CheC
publication title A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 37
structure length 154
sequence length 159
chains with identical sequence D
ec nomenclature ec 3.1.1.61: Protein-glutamate methylesterase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03975 CheD CheD chemotactic sensory transduction
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.200 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2f9zC00
2F9ZC
chains in the Genus database with same CATH superfamily
5JH7A 4I50B 5JVDA 3ZO8A 3JASA 2CVLA 3K14A 1KC8H 5C8YA 5EO3A 3K0TA 3RA5A 1SA0B 5GONB 1VQ6F 3FFMA 4C8IA 2HX0A 2Z01A 1VQLF 1VQ9F 2RHJA 1VQ4F 5LYJA 2VAWA 4O4LA 5JH7B 3CC4F 5JVDB 3VI6A 3PAFA 3VOAA 1R1MA 5MN5A 2LCAA 3RYHA 2GZLA 3JASB 3ELCA 5HXZA 5C8YB 3WGNA 1VQ7F 2HVYD 1W5BA 1N8RH 2QI2A 5JQGA 1JD1A 1NMUB 4TUYA 1RQ2A 3P0ZA 3GHZA 2FGYA 4DRXA 3CYQA 2Z1TA 4ZOLA 5LYJB 3SIUA 3D00A 3GYQA 1W41A 4O4LB 3MBMA 3ON1A 4BT2A 4EI8A 3F0EA 3RYHB 3G6EF 3LWOC 3CCJF 3C9UA 3CC7F 1IV2A 1W5FA 3JARA 4U3JA 5HP8A 1COMA 2P6YA 5G4UC 3ZOPA 5JQGB 3TD3A 1W5EA 2AMTA 2RHLA 2H6LA 1FFXA 1X25A 2ZVYA 4DRXB 3CMAF 1VQVA 4ZOLB 1GO1A 2UYPA 4X1IA 3T80A 4U39A 4BW0B 4ZHWA 3WJRA 2Z1FA 3IR9A 3LMEA 5G4VC 5FNVA 5HXUA 1YJ9F 2PMPA 3JARB 4U3JB 2UZHA 4BVTA 1KD1H 5EB0A 3OW2F 1RA4A 1FFXB 1ODEA 2LBTA 1QVGF 3S0HA 1VQ8F 1UI9A 3I56F 4X1IB 1QD9A 5EAZA 2WALA 2LBWA 4BT6A 1Q82H 2OTJF 5FNVB 5IYZA 3LWQC 3I55F 1IV4A 3VTIC 4F6RA 2JNBA 1S72F 3AGKA 3VMFB 1DT9A 1X52A 2F9ZC 2ZAUA 3L7QA 4HNAA 4BT7A 2MQEA 2H8EA 1PXWA 4B5CA 2VXYA 3CCEF 3ZP7A 4EI7A 2HQSC 3V7QA 5GANK 4I55A 5IYZB 5KX5B 2IQQA 2AIFA 4BVSA 4ZHVA 4F6RB 1GZ0A 1YITF 1E7KA 2EWCA 3P4EA 5LP6C 1IV3A 2HS3A 1YI2F 1JN1A 2HS0A 3V3TA 1ZWZA 3F0DA 3CPWF 3P10A 1Q8RA 1VQKF 3PLAC 3VYTC 4O4JA 4I55B 3MDOA 3CCLF 4I4TA 2FC3A 3KHNA 4LNUA 3G4SF 1VHAA 3HKEA 2R751 4LCKA 3IEWA 3S0YA 5LP6A 4BVQA 1TUBB 2L26A 5GINC 3S02A 1IPAA 2Q1XA 3S0WA 2OTLF 1OFUA 2RB9A 4O4JB 2W8BC 2IG8A 1RQ7A 5GIPC 2YYEA 1W59A 3OONA 4LNUB 3CCVF 3HKCA 3HKEB 2KG4A 5KMGA 1QVFF 4TV8A 4BT5A 5LP6B 3RYIB 4IIJB 3MCQA 2Q1YA 5GIOC 3LWRC 4B62A 1U3LA 4DXDA 5ITZA 5IT9M 4B45A 5HP7A 2HS4A 3E22A 1PF5A 3MCAB 1CLIA 3HKCB 5KMGB 4TV8B 3DDNA 4ZHYB 3CD6F 1XHOA 3LWPC 2KTVA 3N4ZA 3E1YA 4C8EA 1H47A 2BO1A 2B33A 5ITZB 2QEXF 3WJPA 4M8IA 3JAWA 3CCQF 1CN7A 4TZZA 3WPXA 2VAMA 3CXCF 3FBAA 5CA0A 5HWEA 1FNKA 3TD4A 2R6R1 3K12A 1YGYA 3IEQA 4TUYB 3O85A 3C9SA 3VO8A 2YXZA 2UYKA 3HJWC 5AVMA 3JAWB 3FD5A 2CW4A 2DYYA 3BYQA 4NQ3A 4YJ2A 4R40B 2ZODA 4C81A 3V7EA 5CB4A 4NWOB 4XCQA 3I3FA 3KJJA 2VAPA 5CA0B 2KGWA 2RHHA 3F0GA 4C8GA 1JY8A 2I6RA 3IMPA 2CHTA 2NMUA 3JVHA 3HKBA 3HAXD 1W581 2DT4A 3J81M 3DC2A 5MN6A 4YJ2B 2G9IA 2OZBA 1VQNF 3CYPB 3B6NA 3C9TA 3M1XA 5CB4B 3F0FA 5HY2A 2CZWA 1TVKA 2Z1UA 3WGJA 5IJ0A 3HKBB 2HRYA 4BVRA 5EZYA 5MN4A 3LYBA 2Z1EA 4IHJA 1VQMF 2HRUA 2ZOVA 1TVKB 1JFFA 4O4IA 2BTUA 1W57A 5IJ0B 3JCMM 1U40A 4G4WA 3ZP4A 4EB6A 2N48A 1T0AA 3UT5A 5JCOC 3CPQA 1XRGA 4X1YA 5EZYB 3WXMB 1SZQA 4IHJB 4HNAB 1QAHA 1W40A 2GVIA 2KTUA 3RYFA 4X1KA 2CSLA 3LWVC 3CCMF 5IJ9A 1RLUA 4ZHQA 3IKFA 5FLXM 4RQOA 1RLGA 1XV2A 4O4IB 2VGNA 4FFBA 5BMVA 3LDTA 4X3LA 3IKEA 3I7TA 4EB6B 1W5AA 3HKDA 3UT5B 3WGKA 4X20A 4X1YB 4RHAA 3SIVA 5EIBD 1IV1A 3HTNA 4X1KB 3D01A 5IJ9B 4ZHQB 4ZI7A 5HY4A 1YQNA 3QHDA 2ZF8A 4FFBB 3JALA 4I4TB 2OHWA 5BMVB 1CK2A 2BTQB 3ESJA 3J7AR 2LBXA 1XBIA 5CA1A 5EWRA 2GLZA 2UYNA 1YJWF 1Z5WA 3R0PA 4O2AA 5J2UA 4BY9D 1H48A 4ZI7B 1M1KH 4TV9A 3ERNA 5DCVA 2CWJA 4C82A 3JALB 5EIBC 4C4WC 1NJIH 2ZVZA 5CA1B 3WPWA 5FJ4C 2UYNB 3JATA 4O2AB 3NK6A 5J2UB 1YHQF 3LFOA 3QTYA 4TV9B 5GAPK 1SDSA 1U3PA 4G4VA 3WGMA 4KWEA 1K8AH 2RHOA 1VK3A 3CMEF 2BTOA 3E22B 5HY1A 2QTPA 3CB2A 3VYSC 3NVKE 3D54A 3RE3A 1QU9A 3JATB 1GO0A 1Q81H 1W55A 3RYCA 2ALEA 4G88A 1H7MA 3CCRF 3VYUC 3VCZA 1Q7YH 3F6MA 5B8FA 3OBWA 4G4YA 1KQSF 1VQPF 4X3MA 1Q86H 5LOVA 4G4ZA 1JJ2F 3MQWA 2VGMA 1KNKA 3RYCB 2AIZP 1M90H 5EB1B 3CC2F 3M4SA 4G4XA 5J2TA 3VIUA 3U0OA 1Z5VA 2IAFA 2UYJA 4NUTA 1OAPA 5LOVB 3KJKA 2CHSA 2I6DA 4E6EA 3WGLA 4WBNA 5LA6A 2PHNA 3CCSF 1X7OA 5J2TB 3N2GA 3EORA 3VOBA 2H8CA 3JAKA 1U43A 3NVIB 4WBNB 5LA6B 5KX5A 4ERHA 3N4YA 3CG6A 3K2XA 2V9YA 1T0KB 4ZK7A 3V4DA 1FSZA 3HWUA 1DBFA 1GX1A 3C9RA 1VQOF 3N2GB 4O4HA 4YJ3A 1FNJA 4O2BA 4BT3A 3JAKB 5A2QM 1JFFB 3Q8HA 5EYPA 3C8LA 3KIZA 1W42A 3S06A 1X7PA 5JCOA 1K9MH 3JAMM 2HP0A 3M84A 4PWTA 3RYFB 4B46A 4O4HB 4YJ3B 4BT4A 4EI9A 4O2BB 3N2KA 3WJQA 1TUBA 3CCUF 3G71F 1UFYA 5EYPB 5LXTA 3KE1A 1YJNF 1VH8A 3HKDB 3S03A 1W2BF 1ONIA 2HP3A 3TD5A 4I50A 4X20B 1VQ5F 1W3EX 3FD6A 2HP0B 1NQ3A 3N2KB 3RYIA 3NMUC 2QA4F 4IIJA 2OTMA 5HY0A 1KNJA 1SA0A 3NK7A 5GONA 3FPIA 3J80M 3E20B 3GTZA 3QUWA 5LXTB 1YIJF 2K1SA 3RA6A 1J7HA 3OBYA 1K73H
chains in the Genus database with same CATH topology
1ZWZA 3CPWF 1VQKF 3PLAC 1Q7YH 3OBWA 4BVRA 1KC8H 1KQSF 1VQPF 4X3MA 3CCLF 5EO3A 1Q86H 2FC3A 3RA5A 1VQMF 1VQ6F 3FFMA 1JJ2F 3G4SF 2VGMA 1VQLF 1VQ9F 4LCKA 1VQ4F 1M90H 4BVQA 3CC2F 5GINC 3CC4F 3VI6A 3PAFA 1IPAA 3JCMM 2OTLF 5HXZA 3CPQA 4NUTA 1VQ7F 3WXMB 2HVYD 1N8RH 2QI2A 1H7MA 5GIPC 3CCVF 1W40A 2I6DA 1NMUB 2KTUA 3LWVC 3CCMF 5FLXM 2KG4A 1RLGA 2FGYA 1QVFF 3SIUA 3CCSF 3D00A 3GYQA 1W41A 2VGNA 1X7OA 3ON1A 4X3LA 4EI8A 3G6EF 5GIOC 3LWOC 3LWRC 3CCJF 3CC7F 3NVIB 5G4UC 3SIVA 5IT9M 3MCAB 5HY4A 3N4YA 3CMAF 3CG6A 3CD6F 1GO1A 1T0KB 4BW0B 2OHWA 1CK2A 3LWPC 1VQOF 2KTVA 3J7AR 2LBXA 3IR9A 3E1YA 1XBIA 3N4ZA 5G4VC 5HXUA 5EWRA 1YJ9F 2BO1A 5A2QM 2GLZA 2QEXF 1YJWF 4BVTA 1KD1H 3CCQF 1CN7A 4TZZA 3OW2F 4BY9D 1RA4A 1W42A 1M1KH 1QVGF 3CXCF 5DCVA 1VQ8F 3I56F 1X7PA 5HWEA 1K9MH 3JAMM 2WALA 2LBWA 1Q82H 3O85A 4C4WC 1NJIH 4EI9A 2OTJF 1K73H 3LWQC 3HJWC 5FJ4C 3CCUF 3I55F 3G71F 4NQ3A 2JNBA 1S72F 3NK6A 1YHQF 3LFOA 3AGKA 3VMFB 1YJNF 1X52A 1DT9A 2F9ZC 5GAPK 3V7EA 1W2BF 1SDSA 4XCQA 1K8AH 1PXWA 1VQ5F 1W3EX 3CMEF 3CCEF 5HY1A 4EI7A 3V7QA 5GANK 3NVKE 3HAXD 3NMUC 2QA4F 3J81M 2AIFA 5HY0A 4BVSA 2OZBA 3NK7A 1GZ0A 1VQNF 1GO0A 3J80M 3E20B 1YITF 1Q81H 1E7KA 1YIJF 2ALEA 3RA6A 5HY2A 2CZWA 1YI2F 3OBYA 3CCRF 3V3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F9Z C; 
#chains in the Genus database with same CATH topology
 5JH7 A;  4I50 B;  5JVD A;  3ZO8 A;  3JAS A;  2CVL A;  3K14 A;  1KC8 H;  5C8Y A;  5EO3 A;  3K0T A;  3RA5 A;  1SA0 B;  5GON B;  1VQ6 F;  3FFM A;  4C8I A;  2HX0 A;  2Z01 A;  1VQL F;  1VQ9 F;  2RHJ A;  1VQ4 F;  5LYJ A;  2VAW A;  4O4L A;  5JH7 B;  3CC4 F;  5JVD B;  3VI6 A;  3PAF A;  3VOA A;  1R1M A;  5MN5 A;  2LCA A;  3RYH A;  2GZL A;  3JAS B;  3ELC A;  5HXZ A;  5C8Y B;  3WGN A;  1VQ7 F;  2HVY D;  1W5B A;  1N8R H;  2QI2 A;  5JQG A;  1JD1 A;  1NMU B;  4TUY A;  1RQ2 A;  3P0Z A;  3GHZ A;  2FGY A;  4DRX A;  3CYQ A;  2Z1T A;  4ZOL A;  5LYJ B;  3SIU A;  3D00 A;  3GYQ A;  1W41 A;  4O4L B;  3MBM A;  3ON1 A;  4BT2 A;  4EI8 A;  3F0E A;  3RYH B;  3G6E F;  3LWO C;  3CCJ F;  3C9U A;  3CC7 F;  1IV2 A;  1W5F A;  3JAR A;  4U3J A;  5HP8 A;  1COM A;  2P6Y A;  5G4U C;  3ZOP A;  5JQG B;  3TD3 A;  1W5E A;  2AMT A;  2RHL A;  2H6L A;  1FFX A;  1X25 A;  2ZVY A;  4DRX B;  3CMA F;  1VQV A;  4ZOL B;  1GO1 A;  2UYP A;  4X1I A;  3T80 A;  4U39 A;  4BW0 B;  4ZHW A;  3WJR A;  2Z1F A;  3IR9 A;  3LME A;  5G4V C;  5FNV A;  5HXU A;  1YJ9 F;  2PMP A;  3JAR B;  4U3J B;  2UZH A;  4BVT A;  1KD1 H;  5EB0 A;  3OW2 F;  1RA4 A;  1FFX B;  1ODE A;  2LBT A;  1QVG F;  3S0H A;  1VQ8 F;  1UI9 A;  3I56 F;  4X1I B;  1QD9 A;  5EAZ A;  2WAL A;  2LBW A;  4BT6 A;  1Q82 H;  2OTJ F;  5FNV B;  5IYZ A;  3LWQ C;  3I55 F;  1IV4 A;  3VTI C;  4F6R A;  2JNB A;  1S72 F;  3AGK A;  3VMF B;  1DT9 A;  1X52 A;  2F9Z C;  2ZAU A;  3L7Q A;  4HNA A;  4BT7 A;  2MQE A;  2H8E A;  1PXW A;  4B5C A;  2VXY A;  3CCE F;  3ZP7 A;  4EI7 A;  2HQS C;  3V7Q A;  5GAN K;  4I55 A;  5IYZ B;  5KX5 B;  2IQQ A;  2AIF A;  4BVS A;  4ZHV A;  4F6R B;  1GZ0 A;  1YIT F;  1E7K A;  2EWC A;  3P4E A;  5LP6 C;  1IV3 A;  2HS3 A;  1YI2 F;  1JN1 A;  2HS0 A;  3V3T A;  1ZWZ A;  3F0D A;  3CPW F;  3P10 A;  1Q8R A;  1VQK F;  3PLA C;  3VYT C;  4O4J A;  4I55 B;  3MDO A;  3CCL F;  4I4T A;  2FC3 A;  3KHN A;  4LNU A;  3G4S F;  1VHA A;  3HKE A;  2R75 1;  4LCK A;  3IEW A;  3S0Y A;  5LP6 A;  4BVQ A;  1TUB B;  2L26 A;  5GIN C;  3S02 A;  1IPA A;  2Q1X A;  3S0W A;  2OTL F;  1OFU A;  2RB9 A;  4O4J B;  2W8B C;  2IG8 A;  1RQ7 A;  5GIP C;  2YYE A;  1W59 A;  3OON A;  4LNU B;  3CCV F;  3HKC A;  3HKE B;  2KG4 A;  5KMG A;  1QVF F;  4TV8 A;  4BT5 A;  5LP6 B;  3RYI B;  4IIJ B;  3MCQ A;  2Q1Y A;  5GIO C;  3LWR C;  4B62 A;  1U3L A;  4DXD A;  5ITZ A;  5IT9 M;  4B45 A;  5HP7 A;  2HS4 A;  3E22 A;  1PF5 A;  3MCA B;  1CLI A;  3HKC B;  5KMG B;  4TV8 B;  3DDN A;  4ZHY B;  3CD6 F;  1XHO A;  3LWP C;  2KTV A;  3N4Z A;  3E1Y A;  4C8E A;  1H47 A;  2BO1 A;  2B33 A;  5ITZ B;  2QEX F;  3WJP A;  4M8I A;  3JAW A;  3CCQ F;  1CN7 A;  4TZZ A;  3WPX A;  2VAM A;  3CXC F;  3FBA A;  5CA0 A;  5HWE A;  1FNK A;  3TD4 A;  2R6R 1;  3K12 A;  1YGY A;  3IEQ A;  4TUY B;  3O85 A;  3C9S A;  3VO8 A;  2YXZ A;  2UYK A;  3HJW C;  5AVM A;  3JAW B;  3FD5 A;  2CW4 A;  2DYY A;  3BYQ A;  4NQ3 A;  4YJ2 A;  4R40 B;  2ZOD A;  4C81 A;  3V7E A;  5CB4 A;  4NWO B;  4XCQ A;  3I3F A;  3KJJ A;  2VAP A;  5CA0 B;  2KGW A;  2RHH A;  3F0G A;  4C8G A;  1JY8 A;  2I6R A;  3IMP A;  2CHT A;  2NMU A;  3JVH A;  3HKB A;  3HAX D;  1W58 1;  2DT4 A;  3J81 M;  3DC2 A;  5MN6 A;  4YJ2 B;  2G9I A;  2OZB A;  1VQN F;  3CYP B;  3B6N A;  3C9T A;  3M1X A;  5CB4 B;  3F0F A;  5HY2 A;  2CZW A;  1TVK A;  2Z1U A;  3WGJ A;  5IJ0 A;  3HKB B;  2HRY A;  4BVR A;  5EZY A;  5MN4 A;  3LYB A;  2Z1E A;  4IHJ A;  1VQM F;  2HRU A;  2ZOV A;  1TVK B;  1JFF A;  4O4I A;  2BTU A;  1W57 A;  5IJ0 B;  3JCM M;  1U40 A;  4G4W A;  3ZP4 A;  4EB6 A;  2N48 A;  1T0A A;  3UT5 A;  5JCO C;  3CPQ A;  1XRG A;  4X1Y A;  5EZY B;  3WXM B;  1SZQ A;  4IHJ B;  4HNA B;  1QAH A;  1W40 A;  2GVI A;  2KTU A;  3RYF A;  4X1K A;  2CSL A;  3LWV C;  3CCM F;  5IJ9 A;  1RLU A;  4ZHQ A;  3IKF A;  5FLX M;  4RQO A;  1RLG A;  1XV2 A;  4O4I B;  2VGN A;  4FFB A;  5BMV A;  3LDT A;  4X3L A;  3IKE A;  3I7T A;  4EB6 B;  1W5A A;  3HKD A;  3UT5 B;  3WGK A;  4X20 A;  4X1Y B;  4RHA A;  3SIV A;  5EIB D;  1IV1 A;  3HTN A;  4X1K B;  3D01 A;  5IJ9 B;  4ZHQ B;  4ZI7 A;  5HY4 A;  1YQN A;  3QHD A;  2ZF8 A;  4FFB B;  3JAL A;  4I4T B;  2OHW A;  5BMV B;  1CK2 A;  2BTQ B;  3ESJ A;  3J7A R;  2LBX A;  1XBI A;  5CA1 A;  5EWR A;  2GLZ A;  2UYN A;  1YJW F;  1Z5W A;  3R0P A;  4O2A A;  5J2U A;  4BY9 D;  1H48 A;  4ZI7 B;  1M1K H;  4TV9 A;  3ERN A;  5DCV A;  2CWJ A;  4C82 A;  3JAL B;  5EIB C;  4C4W C;  1NJI H;  2ZVZ A;  5CA1 B;  3WPW A;  5FJ4 C;  2UYN B;  3JAT A;  4O2A B;  3NK6 A;  5J2U B;  1YHQ F;  3LFO A;  3QTY A;  4TV9 B;  5GAP K;  1SDS A;  1U3P A;  4G4V A;  3WGM A;  4KWE A;  1K8A H;  2RHO A;  1VK3 A;  3CME F;  2BTO A;  3E22 B;  5HY1 A;  2QTP A;  3CB2 A;  3VYS C;  3NVK E;  3D54 A;  3RE3 A;  1QU9 A;  3JAT B;  1GO0 A;  1Q81 H;  1W55 A;  3RYC A;  2ALE A;  4G88 A;  1H7M A;  3CCR F;  3VYU C;  3VCZ A;  1Q7Y H;  3F6M A;  5B8F A;  3OBW A;  4G4Y A;  1KQS F;  1VQP F;  4X3M A;  1Q86 H;  5LOV A;  4G4Z A;  1JJ2 F;  3MQW A;  2VGM A;  1KNK A;  3RYC B;  2AIZ P;  1M90 H;  5EB1 B;  3CC2 F;  3M4S A;  4G4X A;  5J2T A;  3VIU A;  3U0O A;  1Z5V A;  2IAF A;  2UYJ A;  4NUT A;  1OAP A;  5LOV B;  3KJK A;  2CHS A;  2I6D A;  4E6E A;  3WGL A;  4WBN A;  5LA6 A;  2PHN A;  3CCS F;  1X7O A;  5J2T B;  3N2G A;  3EOR A;  3VOB A;  2H8C A;  3JAK A;  1U43 A;  3NVI B;  4WBN B;  5LA6 B;  5KX5 A;  4ERH A;  3N4Y A;  3CG6 A;  3K2X A;  2V9Y A;  1T0K B;  4ZK7 A;  3V4D A;  1FSZ A;  3HWU A;  1DBF A;  1GX1 A;  3C9R A;  1VQO F;  3N2G B;  4O4H A;  4YJ3 A;  1FNJ A;  4O2B A;  4BT3 A;  3JAK B;  5A2Q M;  1JFF B;  3Q8H A;  5EYP A;  3C8L A;  3KIZ A;  1W42 A;  3S06 A;  1X7P A;  5JCO A;  1K9M H;  3JAM M;  2HP0 A;  3M84 A;  4PWT A;  3RYF B;  4B46 A;  4O4H B;  4YJ3 B;  4BT4 A;  4EI9 A;  4O2B B;  3N2K A;  3WJQ A;  1TUB A;  3CCU F;  3G71 F;  1UFY A;  5EYP B;  5LXT A;  3KE1 A;  1YJN F;  1VH8 A;  3HKD B;  3S03 A;  1W2B F;  1ONI A;  2HP3 A;  3TD5 A;  4I50 A;  4X20 B;  1VQ5 F;  1W3E X;  3FD6 A;  2HP0 B;  1NQ3 A;  3N2K B;  3RYI A;  3NMU C;  2QA4 F;  4IIJ A;  2OTM A;  5HY0 A;  1KNJ A;  1SA0 A;  3NK7 A;  5GON A;  3FPI A;  3J80 M;  3E20 B;  3GTZ A;  3QUW A;  5LXT B;  1YIJ F;  2K1S A;  3RA6 A;  1J7H A;  3OBY A;  1K73 H; 
#chains in the Genus database with same CATH homology
 1ZWZ A;  3CPW F;  1VQK F;  3PLA C;  1Q7Y H;  3OBW A;  4BVR A;  1KC8 H;  1KQS F;  1VQP F;  4X3M A;  3CCL F;  5EO3 A;  1Q86 H;  2FC3 A;  3RA5 A;  1VQM F;  1VQ6 F;  3FFM A;  1JJ2 F;  3G4S F;  2VGM A;  1VQL F;  1VQ9 F;  4LCK A;  1VQ4 F;  1M90 H;  4BVQ A;  3CC2 F;  5GIN C;  3CC4 F;  3VI6 A;  3PAF A;  1IPA A;  3JCM M;  2OTL F;  5HXZ A;  3CPQ A;  4NUT A;  1VQ7 F;  3WXM B;  2HVY D;  1N8R H;  2QI2 A;  1H7M A;  5GIP C;  3CCV F;  1W40 A;  2I6D A;  1NMU B;  2KTU A;  3LWV C;  3CCM F;  5FLX M;  2KG4 A;  1RLG A;  2FGY A;  1QVF F;  3SIU A;  3CCS F;  3D00 A;  3GYQ A;  1W41 A;  2VGN A;  1X7O A;  3ON1 A;  4X3L A;  4EI8 A;  3G6E F;  5GIO C;  3LWO C;  3LWR C;  3CCJ F;  3CC7 F;  3NVI B;  5G4U C;  3SIV A;  5IT9 M;  3MCA B;  5HY4 A;  3N4Y A;  3CMA F;  3CG6 A;  3CD6 F;  1GO1 A;  1T0K B;  4BW0 B;  2OHW A;  1CK2 A;  3LWP C;  1VQO F;  2KTV A;  3J7A R;  2LBX A;  3IR9 A;  3E1Y A;  1XBI A;  3N4Z A;  5G4V C;  5HXU A;  5EWR A;  1YJ9 F;  2BO1 A;  5A2Q M;  2GLZ A;  2QEX F;  1YJW F;  4BVT A;  1KD1 H;  3CCQ F;  1CN7 A;  4TZZ A;  3OW2 F;  4BY9 D;  1RA4 A;  1W42 A;  1M1K H;  1QVG F;  3CXC F;  5DCV A;  1VQ8 F;  3I56 F;  1X7P A;  5HWE A;  1K9M H;  3JAM M;  2WAL A;  2LBW A;  1Q82 H;  3O85 A;  4C4W C;  1NJI H;  4EI9 A;  2OTJ F;  1K73 H;  3LWQ C;  3HJW C;  5FJ4 C;  3CCU F;  3I55 F;  3G71 F;  4NQ3 A;  2JNB A;  1S72 F;  3NK6 A;  1YHQ F;  3LFO A;  3AGK A;  3VMF B;  1YJN F;  1X52 A;  1DT9 A;  2F9Z C;  5GAP K;  3V7E A;  1W2B F;  1SDS A;  4XCQ A;  1K8A H;  1PXW A;  1VQ5 F;  1W3E X;  3CME F;  3CCE F;  5HY1 A;  4EI7 A;  3V7Q A;  5GAN K;  3NVK E;  3HAX D;  3NMU C;  2QA4 F;  3J81 M;  2AIF A;  5HY0 A;  4BVS A;  2OZB A;  3NK7 A;  1GZ0 A;  1VQN F;  1GO0 A;  3J80 M;  3E20 B;  1YIT F;  1Q81 H;  1E7K A;  1YIJ F;  2ALE A;  3RA6 A;  5HY2 A;  2CZW A;  1YI2 F;  3OBY A;  3CCR F;  3V3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...