2FAEA

Crystal structure of e. coli decanoyl-acp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 23
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2faeA00
2CNRA 2JGPA 2LPKA 2K2QA 2KG6A 4MRTC 1T8KA 2DNWA 3RG2A 2GDYA 2K92A 1KLPA 2X2BA 2EHSA 2CQ8A 4DG9A 3EJEA 1VKUA 2AVAA 2N6ZA 3LMOA 4HKGA 2LMLA 2JQ4A 2VSQA 2KGEA 2AF8A 3EJDA 4H2YC 2K93A 2AFEA 2KR5A 4H2XC 2FHSC 2L9FA 5EJDA 2MD9A 2FVFA 2KOPA 3GZLA 2MR8A 2FQ2A 2JU1A 3CE7A 1HY8A 1ACPA 2L4BA 5HV8A 2EHTA 4BPHA 2LTEA 2N5HA 2PNGA 2KGCA 2K0YA 2KORA 1NQ4A 2L0QA 2KG9A 2XZ0D 1F80D 4CA3A 4IZ6A 5KP6B 2K94A 2N50A 2KOSA 2FACA 2ROQA 2K0XA 3GZMA 2CG5B 1HQBA 2LL8A 2FAEA 2JU2A 2MY5A 2XZ1C 2GDWA 3NY7B 2GDXA 2MR7A 2AFDA 1DNYA 2FQ1A 4BPGA 2LIUA 3EJBA 1L0IA 2N6YA 2QNWA 2KOOA 2L22A 2N98A 2N5IA 5HVCA 2KWLA 4R0MA 2CGQA 4PWVB 1L0HA 1DV5A 2LKIA 1AF8A 4PXHB 2KGDA 2FADA 2KOQA 2KW2A 2LIWA 2FVAA 1OR5A 2M5RA 4BPFA 2MVVA 2FVEA 5KP7B 2FQ0A 2KGAA 1X3OA 4H2WC 4NEOA 2KG8A 5CZDB 2MF4A 2MVUA 5KP8B 2LOLA
chains in the Genus database with same CATH superfamily
2JYLA 2CNRA 2JGPA 2K2QA 1YITP 2KG6A 4MRTC 2GDYA 4U0DA 2AVAA 1YIJP 2AF8A 4H2YC 2K93A 4H2XC 5EJDA 3DPHA 4IPYA 5I4TG 2FQ2A 2JU1A 3B4QA 3G0VA 1A43A 4XFXA 2KGCA 1YI2P 1KC8Q 3P05A 2L0QA 2XZ0D 1VQ4P 4CA3A 2GZEA 2E1MA 2VLPA 3CC2P 2ROQA 2CWOA 1AUMA 4U0EA 2JYGA 3NTEA 3HYBA 3DS3A 1S72P 3DS0A 1DNYA 2Z46A 4BPGA 7CEIA 1M1KQ 3G29A 1L0IA 2L22A 3U43A 4R0MA 1EIAA 1L0HA 1GXGA 2ERHA 2M8PA 1Q82Q 1AF8A 4PXHB 4PH1A 2EFJA 4QNBA 3RG6C 2M5RA 4PH0A 1M74A 1UNKA 2Z44A 5KP7B 4H2WC 5HGLA 2EG5A 5KP8B 4U0FA 3WBHA 3OW2O 2K0DX 1VQ6P 2LPKA 1RO0A 2K92A 1KLPA 2X2BA 1VQ5P 4HKGA 4U0CA 2JQ4A 1NJIQ 1YHQP 1RO2A 2M8NA 1ZMBA 2L9FA 2NO8A 1UJZA 1YJWP 3GZLA 3CE7A 1HY8A 1IMQA 3CCVP 1K30A 1YJ9P 2LTEA 2N5HA 2GYKA 2PEKA 2PNGA 5F2KA 1BAJA 2GZIA 1NQ4A 4U0BA 4XROA 1F80D 4XRQA 1IUQA 2BUOA 2VLQA 2JB0A 2N50A 1Z6MA 3MGEA 2OARA 3CD6P 2CG5B 1HQBA 2FAEA 2K5XA 2XZ1C 3VRLC 2GDXA 4COCA 4WYMA 1D1DA 2M8LA 1M90Q 2VLOA 1FR2A 2QNWA 1QVGO 2N98A 2N5IA 2XV6A 3H47A 3G1IA 4GR2A 2VLNA 3H0DA 1VQMP 2KW2A 3I56P 2FVAA 2PEMA 2XT1A 2FQ0A 2KGAA 4NEOA 5BS2A 3G4SP 1QVFO 1VQ8P 3B5IA 1E0HA 1VQPP 1T8KA 2Z45A 3RG2A 5F2OA 2EHSA 1E6JP 2CQ8A 3E2DA 4DG9A 3EJEA 3LMOA 2N6ZA 2LMLA 2VSQA 1KQSO 1VQ7P 2KGEA 4COPA 3G71P 4XFYA 1K73Q 2AFEA 2L6EA 2KR5A 2JAZA 2FHSC 2EIAA 2MD9A 1W2BO 1Q81Q 1ACPA 2L4BA 4BPHA 5F2NA 5JPAA 2K0YA 1AYIA 2P9XA 1GXHA 3GJNA 1KD1Q 1A8OA 5BS1A 2K94A 1M6NA 2GZFA 3DS1A 2KOSA 4F37A 1N8RQ 2K0XA 5DCKA 1EOQA 1VQOP 2WPTA 1VQNP 2GDWA 2DGYA 2JO0A 3NY7B 2PEOA 5HGMA 2FQ1A 1CEIA 1GPJA 1EMVA 4QKOA 3G6EP 3DS4A 2KWLA 2QA4P 2PEJA 3H4EA 4PWVB 1VQ9P 2KODA 2PY8A 5HGNA 2KGDA 4M0IA 2FADA 2KOQA 2PEQA 1OR5A 3CCLP 3CC7P 4BPFA 2MVVA 1X3OA 1ZNVA 3CMEP 1VHNA 3HZQA 3CCEP 1RNIA 3G21A 2JBGA 3M1MA 2XXMA 3CPWO 2DNWA 1VKUA 2OTLP 2LF4A 3EJDA 5EW5E 3CCMP 1Q7YQ 1IMPA 2OTJP 3CC4P 1BXIA 2PENA 2FVFA 2KOPA 3G28A 3G26A 2MR8A 2QEXP 1VQLP 5HV8A 2EHTA 3CCSP 2PEIA 2KORA 2KG9A 4UHPB 4IZ6A 5KP6B 1JJ2O 2FACA 3G1GA 1K8AQ 1YJNP 1M6EX 3GZMA 3CMAP 3CCQP 2LL8A 1K9MQ 2JU2A 2MY5A 3Q20A 1QRJA 2MR7A 2AFDA 3CCRP 3I55P 2LIUA 3EJBA 3CXCO 3DS5A 3DS2A 1Q86Q 3LRYA 2N6YA 3GKLC 2KOOA 5HGOA 5HVCA 2CGQA 1DV5A 2LKIA 2GZJA 2GZGA 4GR6A 2ONTA 3CCUP 3CCJP 2LIWA 3DTJA 4U0AA 1VQKP 2FVEA 4XFZA 2KG8A 5CZDB 2MF4A 1MZ8A 2BHVA 2MVUA 2LOLA
chains in the Genus database with same CATH topology
2CNRA 2JGPA 2LPKA 2K2QA 2KG6A 4MRTC 1T8KA 2DNWA 3RG2A 2GDYA 2K92A 1KLPA 2X2BA 2EHSA 2CQ8A 4DG9A 3EJEA 1VKUA 2AVAA 2N6ZA 3LMOA 4HKGA 2LMLA 2JQ4A 2VSQA 2KGEA 2AF8A 3EJDA 4H2YC 2K93A 2AFEA 2KR5A 4H2XC 2FHSC 2L9FA 5EJDA 2MD9A 2FVFA 2KOPA 3GZLA 2MR8A 2FQ2A 2JU1A 3CE7A 1HY8A 1ACPA 2L4BA 5HV8A 2EHTA 4BPHA 2LTEA 2N5HA 2PNGA 2KGCA 2K0YA 2KORA 1NQ4A 2L0QA 2KG9A 2XZ0D 1F80D 4CA3A 4IZ6A 5KP6B 2K94A 2N50A 2KOSA 2FACA 2ROQA 2K0XA 3GZMA 2CG5B 1HQBA 2LL8A 2FAEA 2JU2A 2MY5A 2XZ1C 2GDWA 3NY7B 2GDXA 2MR7A 2AFDA 1DNYA 2FQ1A 4BPGA 2LIUA 3EJBA 1L0IA 2N6YA 2QNWA 2KOOA 2L22A 2N98A 2N5IA 5HVCA 2KWLA 4R0MA 2CGQA 4PWVB 1L0HA 1DV5A 2LKIA 1AF8A 4PXHB 2KGDA 2FADA 2KOQA 2KW2A 2LIWA 2FVAA 1OR5A 2M5RA 4BPFA 2MVVA 2FVEA 5KP7B 2FQ0A 2KGAA 1X3OA 4H2WC 4NEOA 2KG8A 5CZDB 2MF4A 2MVUA 5KP8B 2LOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNR A;  2JGP A;  2LPK A;  2K2Q A;  2KG6 A;  4MRT C;  1T8K A;  2DNW A;  3RG2 A;  2GDY A;  2K92 A;  1KLP A;  2X2B A;  2EHS A;  2CQ8 A;  4DG9 A;  3EJE A;  1VKU A;  2AVA A;  2N6Z A;  3LMO A;  4HKG A;  2LML A;  2JQ4 A;  2VSQ A;  2KGE A;  2AF8 A;  3EJD A;  4H2Y C;  2K93 A;  2AFE A;  2KR5 A;  4H2X C;  2FHS C;  2L9F A;  5EJD A;  2MD9 A;  2FVF A;  2KOP A;  3GZL A;  2MR8 A;  2FQ2 A;  2JU1 A;  3CE7 A;  1HY8 A;  1ACP A;  2L4B A;  5HV8 A;  2EHT A;  4BPH A;  2LTE A;  2N5H A;  2PNG A;  2KGC A;  2K0Y A;  2KOR A;  1NQ4 A;  2L0Q A;  2KG9 A;  2XZ0 D;  1F80 D;  4CA3 A;  4IZ6 A;  5KP6 B;  2K94 A;  2N50 A;  2KOS A;  2FAC A;  2ROQ A;  2K0X A;  3GZM A;  2CG5 B;  1HQB A;  2LL8 A;  2FAE A;  2JU2 A;  2MY5 A;  2XZ1 C;  2GDW A;  3NY7 B;  2GDX A;  2MR7 A;  2AFD A;  1DNY A;  2FQ1 A;  4BPG A;  2LIU A;  3EJB A;  1L0I A;  2N6Y A;  2QNW A;  2KOO A;  2L22 A;  2N98 A;  2N5I A;  5HVC A;  2KWL A;  4R0M A;  2CGQ A;  4PWV B;  1L0H A;  1DV5 A;  2LKI A;  1AF8 A;  4PXH B;  2KGD A;  2FAD A;  2KOQ A;  2KW2 A;  2LIW A;  2FVA A;  1OR5 A;  2M5R A;  4BPF A;  2MVV A;  2FVE A;  5KP7 B;  2FQ0 A;  2KGA A;  1X3O A;  4H2W C;  4NEO A;  2KG8 A;  5CZD B;  2MF4 A;  2MVU A;  5KP8 B;  2LOL A; 
#chains in the Genus database with same CATH topology
 2JYL A;  2CNR A;  2JGP A;  2K2Q A;  1YIT P;  2KG6 A;  4MRT C;  2GDY A;  4U0D A;  2AVA A;  1YIJ P;  2AF8 A;  4H2Y C;  2K93 A;  4H2X C;  5EJD A;  3DPH A;  4IPY A;  5I4T G;  2FQ2 A;  2JU1 A;  3B4Q A;  3G0V A;  1A43 A;  4XFX A;  2KGC A;  1YI2 P;  1KC8 Q;  3P05 A;  2L0Q A;  2XZ0 D;  1VQ4 P;  4CA3 A;  2GZE A;  2E1M A;  2VLP A;  3CC2 P;  2ROQ A;  2CWO A;  1AUM A;  4U0E A;  2JYG A;  3NTE A;  3HYB A;  3DS3 A;  1S72 P;  3DS0 A;  1DNY A;  2Z46 A;  4BPG A;  7CEI A;  1M1K Q;  3G29 A;  1L0I A;  2L22 A;  3U43 A;  4R0M A;  1EIA A;  1L0H A;  1GXG A;  2ERH A;  2M8P A;  1Q82 Q;  1AF8 A;  4PXH B;  4PH1 A;  2EFJ A;  4QNB A;  3RG6 C;  2M5R A;  4PH0 A;  1M74 A;  1UNK A;  2Z44 A;  5KP7 B;  4H2W C;  5HGL A;  2EG5 A;  5KP8 B;  4U0F A;  3WBH A;  3OW2 O;  2K0D X;  1VQ6 P;  2LPK A;  1RO0 A;  2K92 A;  1KLP A;  2X2B A;  1VQ5 P;  4HKG A;  4U0C A;  2JQ4 A;  1NJI Q;  1YHQ P;  1RO2 A;  2M8N A;  1ZMB A;  2L9F A;  2NO8 A;  1UJZ A;  1YJW P;  3GZL A;  3CE7 A;  1HY8 A;  1IMQ A;  3CCV P;  1K30 A;  1YJ9 P;  2LTE A;  2N5H A;  2GYK A;  2PEK A;  2PNG A;  5F2K A;  1BAJ A;  2GZI A;  1NQ4 A;  4U0B A;  4XRO A;  1F80 D;  4XRQ A;  1IUQ A;  2BUO A;  2VLQ A;  2JB0 A;  2N50 A;  1Z6M A;  3MGE A;  2OAR A;  3CD6 P;  2CG5 B;  1HQB A;  2FAE A;  2K5X A;  2XZ1 C;  3VRL C;  2GDX A;  4COC A;  4WYM A;  1D1D A;  2M8L A;  1M90 Q;  2VLO A;  1FR2 A;  2QNW A;  1QVG O;  2N98 A;  2N5I A;  2XV6 A;  3H47 A;  3G1I A;  4GR2 A;  2VLN A;  3H0D A;  1VQM P;  2KW2 A;  3I56 P;  2FVA A;  2PEM A;  2XT1 A;  2FQ0 A;  2KGA A;  4NEO A;  5BS2 A;  3G4S P;  1QVF O;  1VQ8 P;  3B5I A;  1E0H A;  1VQP P;  1T8K A;  2Z45 A;  3RG2 A;  5F2O A;  2EHS A;  1E6J P;  2CQ8 A;  3E2D A;  4DG9 A;  3EJE A;  3LMO A;  2N6Z A;  2LML A;  2VSQ A;  1KQS O;  1VQ7 P;  2KGE A;  4COP A;  3G71 P;  4XFY A;  1K73 Q;  2AFE A;  2L6E A;  2KR5 A;  2JAZ A;  2FHS C;  2EIA A;  2MD9 A;  1W2B O;  1Q81 Q;  1ACP A;  2L4B A;  4BPH A;  5F2N A;  5JPA A;  2K0Y A;  1AYI A;  2P9X A;  1GXH A;  3GJN A;  1KD1 Q;  1A8O A;  5BS1 A;  2K94 A;  1M6N A;  2GZF A;  3DS1 A;  2KOS A;  4F37 A;  1N8R Q;  2K0X A;  5DCK A;  1EOQ A;  1VQO P;  2WPT A;  1VQN P;  2GDW A;  2DGY A;  2JO0 A;  3NY7 B;  2PEO A;  5HGM A;  2FQ1 A;  1CEI A;  1GPJ A;  1EMV A;  4QKO A;  3G6E P;  3DS4 A;  2KWL A;  2QA4 P;  2PEJ A;  3H4E A;  4PWV B;  1VQ9 P;  2KOD A;  2PY8 A;  5HGN A;  2KGD A;  4M0I A;  2FAD A;  2KOQ A;  2PEQ A;  1OR5 A;  3CCL P;  3CC7 P;  4BPF A;  2MVV A;  1X3O A;  1ZNV A;  3CME P;  1VHN A;  3HZQ A;  3CCE P;  1RNI A;  3G21 A;  2JBG A;  3M1M A;  2XXM A;  3CPW O;  2DNW A;  1VKU A;  2OTL P;  2LF4 A;  3EJD A;  5EW5 E;  3CCM P;  1Q7Y Q;  1IMP A;  2OTJ P;  3CC4 P;  1BXI A;  2PEN A;  2FVF A;  2KOP A;  3G28 A;  3G26 A;  2MR8 A;  2QEX P;  1VQL P;  5HV8 A;  2EHT A;  3CCS P;  2PEI A;  2KOR A;  2KG9 A;  4UHP B;  4IZ6 A;  5KP6 B;  1JJ2 O;  2FAC A;  3G1G A;  1K8A Q;  1YJN P;  1M6E X;  3GZM A;  3CMA P;  3CCQ P;  2LL8 A;  1K9M Q;  2JU2 A;  2MY5 A;  3Q20 A;  1QRJ A;  2MR7 A;  2AFD A;  3CCR P;  3I55 P;  2LIU A;  3EJB A;  3CXC O;  3DS5 A;  3DS2 A;  1Q86 Q;  3LRY A;  2N6Y A;  3GKL C;  2KOO A;  5HGO A;  5HVC A;  2CGQ A;  1DV5 A;  2LKI A;  2GZJ A;  2GZG A;  4GR6 A;  2ONT A;  3CCU P;  3CCJ P;  2LIW A;  3DTJ A;  4U0A A;  1VQK P;  2FVE A;  4XFZ A;  2KG8 A;  5CZD B;  2MF4 A;  1MZ8 A;  2BHV A;  2MVU A;  2LOL A; 
#chains in the Genus database with same CATH homology
 2CNR A;  2JGP A;  2LPK A;  2K2Q A;  2KG6 A;  4MRT C;  1T8K A;  2DNW A;  3RG2 A;  2GDY A;  2K92 A;  1KLP A;  2X2B A;  2EHS A;  2CQ8 A;  4DG9 A;  3EJE A;  1VKU A;  2AVA A;  2N6Z A;  3LMO A;  4HKG A;  2LML A;  2JQ4 A;  2VSQ A;  2KGE A;  2AF8 A;  3EJD A;  4H2Y C;  2K93 A;  2AFE A;  2KR5 A;  4H2X C;  2FHS C;  2L9F A;  5EJD A;  2MD9 A;  2FVF A;  2KOP A;  3GZL A;  2MR8 A;  2FQ2 A;  2JU1 A;  3CE7 A;  1HY8 A;  1ACP A;  2L4B A;  5HV8 A;  2EHT A;  4BPH A;  2LTE A;  2N5H A;  2PNG A;  2KGC A;  2K0Y A;  2KOR A;  1NQ4 A;  2L0Q A;  2KG9 A;  2XZ0 D;  1F80 D;  4CA3 A;  4IZ6 A;  5KP6 B;  2K94 A;  2N50 A;  2KOS A;  2FAC A;  2ROQ A;  2K0X A;  3GZM A;  2CG5 B;  1HQB A;  2LL8 A;  2FAE A;  2JU2 A;  2MY5 A;  2XZ1 C;  2GDW A;  3NY7 B;  2GDX A;  2MR7 A;  2AFD A;  1DNY A;  2FQ1 A;  4BPG A;  2LIU A;  3EJB A;  1L0I A;  2N6Y A;  2QNW A;  2KOO A;  2L22 A;  2N98 A;  2N5I A;  5HVC A;  2KWL A;  4R0M A;  2CGQ A;  4PWV B;  1L0H A;  1DV5 A;  2LKI A;  1AF8 A;  4PXH B;  2KGD A;  2FAD A;  2KOQ A;  2KW2 A;  2LIW A;  2FVA A;  1OR5 A;  2M5R A;  4BPF A;  2MVV A;  2FVE A;  5KP7 B;  2FQ0 A;  2KGA A;  1X3O A;  4H2W C;  4NEO A;  2KG8 A;  5CZD B;  2MF4 A;  2MVU A;  5KP8 B;  2LOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...