2FAPA

The structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2fapA00
1JNTA 2DG4A 2ZQTA 1J4HA 2VCDA 1NMVA 4R0XA 4DRKA 5BXJA 1L1PA 2F2DA 2RQSA 4DRPA 1YATA 5DIVA 3WH0A 4DRJA 4DZ2A 2F21A 5GPGA 1PINA 2DG3A 4GIVA 1J4RA 5HKGA 3O5FA 4TW7A 3TC5A 3JYJA 3KADA 4IQCA 1D6OA 2LJ4A 2ZR4A 2KO7A 1FKKA 3CGNA 3CGMA 3GPKA 3IKDA 2PPPA 1Q6IA 3RGCA 5B8IC 1KT0A 2RUDA 2XP5A 4JFJA 4U85A 5HT1A 4QT3A 4DROA 2OFNA 2RUQA 3NTPA 1ZCNA 1B6CA 2PPOA 2XPAA 2Y78A 3VAWA 4DRNA 2MLYA 2M2AA 3MDYB 3O5OA 1FKHA 1HXVA 3UQBA 4TX0A 2VN1A 4MGVA 4IPXA 5HWCA 1BL4A 2KI3A 2MPHA 4W9OA 4ODQA 4O2TA 5D75A 3KACA 5HW8A 4TW6A 3I6CA 3UQAA 1M5YA 3OOBA 3UI5A 2ZQSA 1Q6UA 3JXVA 4G50A 1FKRA 4W9QA 1Q6HA 4ODKA 4QT2A 2ZQVA 2FKEA 3UF8A 4C02B 1J4IA 1FKTA 2XP8A 1KT1A 1P5QA 3NRKA 3O5LA 4ODRA 2FAPA 4TW8A 3O5DA 4DRMA 4DT4A 2DG9A 1J6YA 1D7JA 2Q5AA 3KZ7A 1FKBA 3NI6A 2JZVA 4DH0A 2LKNA 2M1IA 2MLZA 3IHZA 4DRIA 3TDBA 2ITKA 1ROTA 3JYMA 1BKFA 4LAVA 4LAYA 2MLXA 3KAFA 4MSPA 5DIUA 4BF8A 5I98A 2PV1A 1W26A 3O5IA 2KE0A 2RUCA 2MNTA 3O5GA 5HWBA 1FKGA 4W9PA 2ZQUA 3IK8A 5HUAA 2KGJA 1JNSA 1ZK6A 1NMWA 1D7IA 2K8IA 4ODOA 1FD9A 4JYSA 5J6EA 2RURA 1N1AA 1FAPA 2XP3A 4JFLA 4GGQA 2KFWA 1F8AB 3KCEA 3PRBA 1QPFA 2PV3A 2UZ5A 1A7XA 2IF4A 5DITA 1FKSA 2LPVA 1FKDA 2LGOA 1FKJA 1ROUA 1U79A 1Q1CA 3KAIA 4J4OA 4JFKA 4LAXA 4U86A 4DRQA 4DRHA 5HW6A 4IQ2A 2ZR5A 3O5QA 2AWGA 4LAWA 4ODMA 4QIBA 1JVWA 2KR7A 4N19A 4J4NA 3LUOA 4TNSA 3TCZA 3UQIA 5HW7A 1Y0OA 3H9RB 2XPBA 3O5MA 4ODNA 2XP6A 3EY6A 4G2PA 3O5EA 4DIPA 2PBCA 2MF9A 1FKLA 4TYOA 4FAPA 1YW5A 3UI6A 1QPLA 4U84A 2M08A 4DZ3A 3KABA 1EQ3A 1QZ2A 1FKIA 2RSEA 4NNRA 1C9HA 2PV2A 3O5RA 2XP7A 3IKGA 3O5KA 1FJDA 2F4EA 2XP9A 4JFIA 1T11A 3RFWA 5HTGA 1NSGA 4ODLA 2D9FA 2PPNA 1F40A 1FKFA 3PA7A 2N87A 4FN2A 3O5PA 3FAPA 1R9HA 4JFMA 1PBKA 4ODPA 3KAHA 3ODKA 1EYMA 1D7HA 2L2SA 2ZR6A 3O5JA 2XP4A 3PRDA 3KAGA 4ITZA 1TCOC 3UI4A 3B7XA
chains in the Genus database with same CATH superfamily
3WD3A 3WL0A 5DF0A 1NMVA 4R0XA 4KQZA 2RQSA 1YATA 5DIVA 4DRJA 3EIPA 4Z2GA 4TW7A 3JYJA 3W4RA 3ARWA 3RGCA 4ZPWR 3GPKA 4WKHA 3WIJA 3WD1A 4QT3A 4DROA 3NTPA 1HKMA 2XPAA 2M2AA 3O5OA 2DT0A 1HXVA 2VN1A 1BL4A 2KI3A 1W9UA 1M5YA 3BXWA 3GTYX 3JXVA 4W9QA 1Q6HA 1FKTA 4DT4A 4DRMA 2FAPA 1J6YA 1D7JA 2MLZA 2O92A 3JYMA 4LAVA 2PV1A 1H0GA 2KE0A 2RUCA 4MNKA 3WQWA 3G6MA 3RM8A 2YBUA 3IK8A 1JNSA 3ARYA 1NMWA 2PN0A 1N1AA 4ZS6A 1ZBCA 5JH8A 3PRBA 1HJXA 4MTVA 2PV3A 2UZ5A 1A7XA 2A3EA 2LPVA 3KAIA 4DRQA 4IQ2A 1SR0A 3B9AA 1EDQA 2ZR5A 3O5QA 3ARRA 4LAWA 4ODMA 2KR7A 3GU0A 5HW7A 1Y0OA 2XP6A 2WM0A 2MF9A 1FKLA 1JNDA 1X6LA 1LL6A 2M08A 1C9HA 1W1TA 3O5KA 2QF8A 2F4EA 4JFIA 1T11A 5GQBA 1NSGA 4ODLA 2D9FA 1F40A 1FKFA 3PA7A 4FN2A 3FAPA 5DO2A 2DSUA 3ODKA 3ARTA 2ZR6A 3KAGA 1TCOC 4QZVB 1JNTA 2DG4A 2F23A 4Q7NA 1GRJA 1L1PA 1K9TA 2F2DA 1ZBVA 3FY1A 4DRPA 3AS0A 2A3AA 2AOSA 1ZBKA 3O5FA 4MAVA 3KADA 1HJWA 4IQCA 1D6OA 2ZR4A 3CGNA 1FKKA 3IKDA 2PPPA 5B8IC 2DT2A 1XRVA 2RUDA 2XP5A 5HT1A 1NWUA 1EIBA 1E15A 3VAWA 4DRNA 3MDYB 1FKHA 4AY1A 2EULA 4IPXA 4HBEA 1E6ZA 4P8XA 4O2TA 1RD6A 2DSZA 3I6CA 3CZ8A 3CHEA 2B5UB 1FKRA 4NZCA 1O6IA 4QT2A 4S3JA 3NRKA 3O5LA 2DG9A 1HKJA 3CHDA 3PR9A 2JZVA 4Z2IA 2LKNA 2M1IA 1GPFA 3IHZA 3RM4A 4DRIA 2WLZA 1LQ0A 2IUZA 2A3BA 3ALFA 4LAYA 5I98A 1ZL1A 2MNTA 5HWBA 1FKGA 5HUAA 1UR9A 4URIA 1NWSA 2K8IA 4LGXA 3WD2A 1W9VA 1E6PA 1JNEA 2DT1A 3WD0A 1FFQA 4DWSA 1KFWA 3FXYA 4Z2JA 1FKJA 1ROUA 3BMBA 3AS3A 5HW6A 4IT6A 4NSBA 4DWSD 3AQUA 4TYOA 1YW5A 4KR0B 4U84A 4DZ3A 3KABA 1FKIA 2PV2A 3O5RA 3B9EA 1LG2A 4R5EA 3RFWA 2DSWA 2PPNA 1ZB5A 1D2KA 2YBTA 3O5PA 1R9HA 1OGBA 4ODPA 2L2SA 3ARQA 4UDMA 3B7XA 2G8ZA 1J4HA 1W1PA 3ARSA 2VCDA 5BXJA 3ARPA 3WH0A 2F21A 2DG3A 4GIVA 1J4RA 4HARA 5HKGA 1IX5A 3TC5A 2G41A 1LG1A 1Q6IA 1ZU8A 1KT0A 4JFJA 4U85A 1WAWA 1B6CA 1GOIA 4L3NA 2Y78A 1UR8A 3UQBA 4TX0A 4L72B 4Z2LA 2WK2A 5HWCA 2PI6A 4W9OA 4ODQA 4WKFA 5D75A 3UQAA 1OWQA 2FDMA 1Q6UA 4WK9A 3WKZA 2ZQVA 3UF8A 1KT1A 4ODRA 4TW8A 3O5DA 2Q5AA 1HJVA 3NI6A 4DH0A 3CH9A 1E44A 2ITKA 1BKFA 2MLXA 1NH6A 3KAFA 1EHNA 3O5GA 4DWSB 4W9PA 1ITXA 2KGJA 1CTNA 2RURA 4Z2HA 1FAPA 4JFLA 3ARUA 1E9LA 1QPFA 4MPKA 1FKDA 2LGOA 5J6EA 1U79A 4JFKA 4J4OA 4XAKA 4U86A 4WKAA 4WIWA 1HKKA 4QIBA 3OA5A 4N19A 1W1YA 1X6NA 4J4NA 4TNSA 4P8WA 2XPBA 4ODNA 3EY6A 4DWSC 4ZPTR 1EQ3A 4WJXA 4Q22A 2XP7A 1VF8A 3B8SA 2O9OA 4MNLA 4ITZA 1D7HA 2XP4A 1NWTA 2ZQTA 1OGGA 4ZPVR 1W9PA 4DRKA 1XHGA 4DZ2A 5GPGA 1PINA 1WB0A 1FFRA 2LJ4A 2KO7A 3CGMA 5HBFA 2OFNA 2RUQA 3RMEA 3ALGA 1E6NA 1ZCNA 2PPOA 2P4VA 1NWRA 1ZBWA 3WD4A 2MLYA 3AS2A 4ML4A 4HBOA 3B9DA 4MNMA 4MGVA 1H0IA 2MPHA 2A3CA 4IT4A 3KACA 5HW8A 3ARXA 4TW6A 3OOBA 3UI5A 2ZQSA 2DSVA 4G50A 4ODKA 2FKEA 4C02B 1J4IA 4P8UA 2XP8A 1P5QA 3KZ7A 1FKBA 1WNOA 1LL4A 3TDBA 1ROTA 4BF8A 3ARZA 4MSPA 5DIUA 1W26A 3O5IA 3G6LA 2ZQUA 4PTMA 1ZK6A 1D7IA 4ODOA 1FD9A 4JYSA 1HKIA 2XP3A 3ARVA 4GGQA 2KFWA 1F8AB 3KCEA 4MNJA 2ESCA 4S3KA 2IF4A 2DT3A 5DITA 1FKSA 4LAXA 1Q1CA 4DRHA 1LJYA 5DEZA 4P8VA 2B31A 2AWGA 1JVWA 3QOKA 3LUOA 3TCZA 4W5UA 3UQIA 3WQVA 1E6RA 3H9RB 2DPEA 3AROA 3O5MA 4G2PA 3O5EA 4DIPA 2PBCA 3RM9A 4FAPA 3UI6A 1QPLA 1GUVA 3WL1A 3AS1A 3CHCA 1QZ2A 2RSEA 4NNRA 2ETNA 3PRAA 5GPRA 3IKGA 1LL7A 3CHFA 2OLHA 1FJDA 2XP9A 5HTGA 1TFVA 4Z2KA 2N87A 1JCHB 1W1VA 4JFMA 1PBKA 2WLYA 3KAHA 1EYMA 3O5JA 3PRDA 3UI4A 1SYTA
chains in the Genus database with same CATH topology
3WD3A 3WL0A 5DF0A 1NMVA 4R0XA 4KQZA 2RQSA 1YATA 5DIVA 4DRJA 4Z2GA 4TW7A 3JYJA 3W4RA 3ARWA 3RGCA 4ZPWR 3GPKA 4WKHA 3WIJA 3WD1A 4QT3A 4DROA 3NTPA 1HKMA 2XPAA 2M2AA 3O5OA 2DT0A 1HXVA 2VN1A 1BL4A 2KI3A 1W9UA 1M5YA 3BXWA 3JXVA 4W9QA 1Q6HA 1FKTA 4DT4A 4DRMA 2FAPA 1J6YA 1D7JA 2MLZA 2O92A 3JYMA 4LAVA 2PV1A 1H0GA 2KE0A 2RUCA 4MNKA 3WQWA 3G6MA 3RM8A 2YBUA 3IK8A 1JNSA 3ARYA 1NMWA 1N1AA 4ZS6A 1ZBCA 5JH8A 3PRBA 1HJXA 4MTVA 2PV3A 2UZ5A 1A7XA 2A3EA 2LPVA 3KAIA 4DRQA 4IQ2A 1SR0A 3B9AA 1EDQA 2ZR5A 3O5QA 3ARRA 4LAWA 4ODMA 2KR7A 5HW7A 1Y0OA 2XP6A 2WM0A 2MF9A 1FKLA 1JNDA 1X6LA 1LL6A 2M08A 1C9HA 1W1TA 3O5KA 2QF8A 2F4EA 4JFIA 1T11A 5GQBA 1NSGA 4ODLA 2D9FA 1F40A 1FKFA 3PA7A 4FN2A 3FAPA 5DO2A 2DSUA 3ODKA 3ARTA 2ZR6A 3KAGA 1TCOC 4QZVB 1JNTA 2DG4A 4Q7NA 1L1PA 1K9TA 2F2DA 1ZBVA 3FY1A 4DRPA 3AS0A 2A3AA 2AOSA 1ZBKA 3O5FA 4MAVA 3KADA 1HJWA 4IQCA 1D6OA 2ZR4A 3CGNA 1FKKA 3IKDA 2PPPA 5B8IC 2DT2A 1XRVA 2RUDA 2XP5A 5HT1A 1NWUA 1EIBA 1E15A 3VAWA 4DRNA 3MDYB 1FKHA 4AY1A 4IPXA 4HBEA 1E6ZA 4P8XA 4O2TA 1RD6A 2DSZA 3I6CA 3CZ8A 3CHEA 1FKRA 4NZCA 1O6IA 4QT2A 4S3JA 3NRKA 3O5LA 2DG9A 1HKJA 3CHDA 3PR9A 2JZVA 4Z2IA 2LKNA 2M1IA 1GPFA 3IHZA 3RM4A 4DRIA 2WLZA 1LQ0A 2IUZA 2A3BA 3ALFA 4LAYA 5I98A 1ZL1A 2MNTA 5HWBA 1FKGA 5HUAA 1UR9A 4URIA 1NWSA 2K8IA 4LGXA 3WD2A 1W9VA 1E6PA 1JNEA 2DT1A 3WD0A 1FFQA 4DWSA 1KFWA 3FXYA 4Z2JA 1FKJA 1ROUA 3AS3A 5HW6A 4IT6A 4NSBA 4DWSD 3AQUA 4TYOA 1YW5A 4KR0B 4U84A 4DZ3A 3KABA 1FKIA 2PV2A 3O5RA 3B9EA 1LG2A 4R5EA 3RFWA 2DSWA 2PPNA 1ZB5A 1D2KA 2YBTA 3O5PA 1R9HA 1OGBA 4ODPA 2L2SA 3ARQA 3B7XA 2G8ZA 1J4HA 1W1PA 3ARSA 2VCDA 5BXJA 3ARPA 3WH0A 2F21A 2DG3A 4GIVA 1J4RA 4HARA 5HKGA 1IX5A 3TC5A 2G41A 1LG1A 1Q6IA 1ZU8A 1KT0A 4JFJA 4U85A 1WAWA 1B6CA 1GOIA 4L3NA 2Y78A 1UR8A 3UQBA 4TX0A 4L72B 4Z2LA 2WK2A 5HWCA 2PI6A 4W9OA 4ODQA 4WKFA 5D75A 3UQAA 1OWQA 2FDMA 1Q6UA 4WK9A 3WKZA 2ZQVA 3UF8A 1KT1A 4ODRA 4TW8A 3O5DA 2Q5AA 1HJVA 3NI6A 4DH0A 3CH9A 2ITKA 1BKFA 2MLXA 1NH6A 3KAFA 1EHNA 3O5GA 4DWSB 4W9PA 1ITXA 2KGJA 1CTNA 2RURA 4Z2HA 1FAPA 4JFLA 3ARUA 1E9LA 1QPFA 4MPKA 1FKDA 2LGOA 5J6EA 1U79A 4JFKA 4J4OA 4XAKA 4U86A 4WKAA 4WIWA 1HKKA 4QIBA 3OA5A 4N19A 1W1YA 1X6NA 4J4NA 4TNSA 4P8WA 2XPBA 4ODNA 3EY6A 4DWSC 4ZPTR 1EQ3A 4WJXA 4Q22A 2XP7A 1VF8A 3B8SA 2O9OA 4MNLA 4ITZA 1D7HA 2XP4A 1NWTA 2ZQTA 1OGGA 4ZPVR 1W9PA 4DRKA 1XHGA 4DZ2A 5GPGA 1PINA 1WB0A 1FFRA 2LJ4A 2KO7A 3CGMA 5HBFA 2OFNA 2RUQA 3RMEA 3ALGA 1E6NA 1ZCNA 2PPOA 1NWRA 1ZBWA 3WD4A 2MLYA 3AS2A 4ML4A 4HBOA 3B9DA 4MNMA 4MGVA 1H0IA 2MPHA 2A3CA 4IT4A 3KACA 5HW8A 3ARXA 4TW6A 3OOBA 3UI5A 2ZQSA 2DSVA 4G50A 4ODKA 2FKEA 4C02B 1J4IA 4P8UA 2XP8A 1P5QA 3KZ7A 1FKBA 1WNOA 1LL4A 3TDBA 1ROTA 4BF8A 3ARZA 4MSPA 5DIUA 1W26A 3O5IA 3G6LA 2ZQUA 4PTMA 1ZK6A 1D7IA 4ODOA 1FD9A 4JYSA 1HKIA 2XP3A 3ARVA 4GGQA 2KFWA 1F8AB 3KCEA 4MNJA 2ESCA 4S3KA 2IF4A 2DT3A 5DITA 1FKSA 4LAXA 1Q1CA 4DRHA 1LJYA 5DEZA 4P8VA 2B31A 2AWGA 1JVWA 3QOKA 3LUOA 3TCZA 4W5UA 3UQIA 3WQVA 1E6RA 3H9RB 2DPEA 3AROA 3O5MA 4G2PA 3O5EA 4DIPA 2PBCA 3RM9A 4FAPA 3UI6A 1QPLA 1GUVA 3WL1A 3AS1A 3CHCA 1QZ2A 2RSEA 4NNRA 3PRAA 5GPRA 3IKGA 1LL7A 3CHFA 2OLHA 1FJDA 2XP9A 5HTGA 1TFVA 4Z2KA 2N87A 1W1VA 4JFMA 1PBKA 2WLYA 3KAHA 1EYMA 3O5JA 3PRDA 3UI4A 1SYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNT A;  2DG4 A;  2ZQT A;  1J4H A;  2VCD A;  1NMV A;  4R0X A;  4DRK A;  5BXJ A;  1L1P A;  2F2D A;  2RQS A;  4DRP A;  1YAT A;  5DIV A;  3WH0 A;  4DRJ A;  4DZ2 A;  2F21 A;  5GPG A;  1PIN A;  2DG3 A;  4GIV A;  1J4R A;  5HKG A;  3O5F A;  4TW7 A;  3TC5 A;  3JYJ A;  3KAD A;  4IQC A;  1D6O A;  2LJ4 A;  2ZR4 A;  2KO7 A;  1FKK A;  3CGN A;  3CGM A;  3GPK A;  3IKD A;  2PPP A;  1Q6I A;  3RGC A;  5B8I C;  1KT0 A;  2RUD A;  2XP5 A;  4JFJ A;  4U85 A;  5HT1 A;  4QT3 A;  4DRO A;  2OFN A;  2RUQ A;  3NTP A;  1ZCN A;  1B6C A;  2PPO A;  2XPA A;  2Y78 A;  3VAW A;  4DRN A;  2MLY A;  2M2A A;  3MDY B;  3O5O A;  1FKH A;  1HXV A;  3UQB A;  4TX0 A;  2VN1 A;  4MGV A;  4IPX A;  5HWC A;  1BL4 A;  2KI3 A;  2MPH A;  4W9O A;  4ODQ A;  4O2T A;  5D75 A;  3KAC A;  5HW8 A;  4TW6 A;  3I6C A;  3UQA A;  1M5Y A;  3OOB A;  3UI5 A;  2ZQS A;  1Q6U A;  3JXV A;  4G50 A;  1FKR A;  4W9Q A;  1Q6H A;  4ODK A;  4QT2 A;  2ZQV A;  2FKE A;  3UF8 A;  4C02 B;  1J4I A;  1FKT A;  2XP8 A;  1KT1 A;  1P5Q A;  3NRK A;  3O5L A;  4ODR A;  2FAP A;  4TW8 A;  3O5D A;  4DRM A;  4DT4 A;  2DG9 A;  1J6Y A;  1D7J A;  2Q5A A;  3KZ7 A;  1FKB A;  3NI6 A;  2JZV A;  4DH0 A;  2LKN A;  2M1I A;  2MLZ A;  3IHZ A;  4DRI A;  3TDB A;  2ITK A;  1ROT A;  3JYM A;  1BKF A;  4LAV A;  4LAY A;  2MLX A;  3KAF A;  4MSP A;  5DIU A;  4BF8 A;  5I98 A;  2PV1 A;  1W26 A;  3O5I A;  2KE0 A;  2RUC A;  2MNT A;  3O5G A;  5HWB A;  1FKG A;  4W9P A;  2ZQU A;  3IK8 A;  5HUA A;  2KGJ A;  1JNS A;  1ZK6 A;  1NMW A;  1D7I A;  2K8I A;  4ODO A;  1FD9 A;  4JYS A;  5J6E A;  2RUR A;  1N1A A;  1FAP A;  2XP3 A;  4JFL A;  4GGQ A;  2KFW A;  1F8A B;  3KCE A;  3PRB A;  1QPF A;  2PV3 A;  2UZ5 A;  1A7X A;  2IF4 A;  5DIT A;  1FKS A;  2LPV A;  1FKD A;  2LGO A;  1FKJ A;  1ROU A;  1U79 A;  1Q1C A;  3KAI A;  4J4O A;  4JFK A;  4LAX A;  4U86 A;  4DRQ A;  4DRH A;  5HW6 A;  4IQ2 A;  2ZR5 A;  3O5Q A;  2AWG A;  4LAW A;  4ODM A;  4QIB A;  1JVW A;  2KR7 A;  4N19 A;  4J4N A;  3LUO A;  4TNS A;  3TCZ A;  3UQI A;  5HW7 A;  1Y0O A;  3H9R B;  2XPB A;  3O5M A;  4ODN A;  2XP6 A;  3EY6 A;  4G2P A;  3O5E A;  4DIP A;  2PBC A;  2MF9 A;  1FKL A;  4TYO A;  4FAP A;  1YW5 A;  3UI6 A;  1QPL A;  4U84 A;  2M08 A;  4DZ3 A;  3KAB A;  1EQ3 A;  1QZ2 A;  1FKI A;  2RSE A;  4NNR A;  1C9H A;  2PV2 A;  3O5R A;  2XP7 A;  3IKG A;  3O5K A;  1FJD A;  2F4E A;  2XP9 A;  4JFI A;  1T11 A;  3RFW A;  5HTG A;  1NSG A;  4ODL A;  2D9F A;  2PPN A;  1F40 A;  1FKF A;  3PA7 A;  2N87 A;  4FN2 A;  3O5P A;  3FAP A;  1R9H A;  4JFM A;  1PBK A;  4ODP A;  3KAH A;  3ODK A;  1EYM A;  1D7H A;  2L2S A;  2ZR6 A;  3O5J A;  2XP4 A;  3PRD A;  3KAG A;  4ITZ A;  1TCO C;  3UI4 A;  3B7X A; 
#chains in the Genus database with same CATH topology
 3WD3 A;  3WL0 A;  5DF0 A;  1NMV A;  4R0X A;  4KQZ A;  2RQS A;  1YAT A;  5DIV A;  4DRJ A;  3EIP A;  4Z2G A;  4TW7 A;  3JYJ A;  3W4R A;  3ARW A;  3RGC A;  4ZPW R;  3GPK A;  4WKH A;  3WIJ A;  3WD1 A;  4QT3 A;  4DRO A;  3NTP A;  1HKM A;  2XPA A;  2M2A A;  3O5O A;  2DT0 A;  1HXV A;  2VN1 A;  1BL4 A;  2KI3 A;  1W9U A;  1M5Y A;  3BXW A;  3GTY X;  3JXV A;  4W9Q A;  1Q6H A;  1FKT A;  4DT4 A;  4DRM A;  2FAP A;  1J6Y A;  1D7J A;  2MLZ A;  2O92 A;  3JYM A;  4LAV A;  2PV1 A;  1H0G A;  2KE0 A;  2RUC A;  4MNK A;  3WQW A;  3G6M A;  3RM8 A;  2YBU A;  3IK8 A;  1JNS A;  3ARY A;  1NMW A;  2PN0 A;  1N1A A;  4ZS6 A;  1ZBC A;  5JH8 A;  3PRB A;  1HJX A;  4MTV A;  2PV3 A;  2UZ5 A;  1A7X A;  2A3E A;  2LPV A;  3KAI A;  4DRQ A;  4IQ2 A;  1SR0 A;  3B9A A;  1EDQ A;  2ZR5 A;  3O5Q A;  3ARR A;  4LAW A;  4ODM A;  2KR7 A;  3GU0 A;  5HW7 A;  1Y0O A;  2XP6 A;  2WM0 A;  2MF9 A;  1FKL A;  1JND A;  1X6L A;  1LL6 A;  2M08 A;  1C9H A;  1W1T A;  3O5K A;  2QF8 A;  2F4E A;  4JFI A;  1T11 A;  5GQB A;  1NSG A;  4ODL A;  2D9F A;  1F40 A;  1FKF A;  3PA7 A;  4FN2 A;  3FAP A;  5DO2 A;  2DSU A;  3ODK A;  3ART A;  2ZR6 A;  3KAG A;  1TCO C;  4QZV B;  1JNT A;  2DG4 A;  2F23 A;  4Q7N A;  1GRJ A;  1L1P A;  1K9T A;  2F2D A;  1ZBV A;  3FY1 A;  4DRP A;  3AS0 A;  2A3A A;  2AOS A;  1ZBK A;  3O5F A;  4MAV A;  3KAD A;  1HJW A;  4IQC A;  1D6O A;  2ZR4 A;  3CGN A;  1FKK A;  3IKD A;  2PPP A;  5B8I C;  2DT2 A;  1XRV A;  2RUD A;  2XP5 A;  5HT1 A;  1NWU A;  1EIB A;  1E15 A;  3VAW A;  4DRN A;  3MDY B;  1FKH A;  4AY1 A;  2EUL A;  4IPX A;  4HBE A;  1E6Z A;  4P8X A;  4O2T A;  1RD6 A;  2DSZ A;  3I6C A;  3CZ8 A;  3CHE A;  2B5U B;  1FKR A;  4NZC A;  1O6I A;  4QT2 A;  4S3J A;  3NRK A;  3O5L A;  2DG9 A;  1HKJ A;  3CHD A;  3PR9 A;  2JZV A;  4Z2I A;  2LKN A;  2M1I A;  1GPF A;  3IHZ A;  3RM4 A;  4DRI A;  2WLZ A;  1LQ0 A;  2IUZ A;  2A3B A;  3ALF A;  4LAY A;  5I98 A;  1ZL1 A;  2MNT A;  5HWB A;  1FKG A;  5HUA A;  1UR9 A;  4URI A;  1NWS A;  2K8I A;  4LGX A;  3WD2 A;  1W9V A;  1E6P A;  1JNE A;  2DT1 A;  3WD0 A;  1FFQ A;  4DWS A;  1KFW A;  3FXY A;  4Z2J A;  1FKJ A;  1ROU A;  3BMB A;  3AS3 A;  5HW6 A;  4IT6 A;  4NSB A;  4DWS D;  3AQU A;  4TYO A;  1YW5 A;  4KR0 B;  4U84 A;  4DZ3 A;  3KAB A;  1FKI A;  2PV2 A;  3O5R A;  3B9E A;  1LG2 A;  4R5E A;  3RFW A;  2DSW A;  2PPN A;  1ZB5 A;  1D2K A;  2YBT A;  3O5P A;  1R9H A;  1OGB A;  4ODP A;  2L2S A;  3ARQ A;  4UDM A;  3B7X A;  2G8Z A;  1J4H A;  1W1P A;  3ARS A;  2VCD A;  5BXJ A;  3ARP A;  3WH0 A;  2F21 A;  2DG3 A;  4GIV A;  1J4R A;  4HAR A;  5HKG A;  1IX5 A;  3TC5 A;  2G41 A;  1LG1 A;  1Q6I A;  1ZU8 A;  1KT0 A;  4JFJ A;  4U85 A;  1WAW A;  1B6C A;  1GOI A;  4L3N A;  2Y78 A;  1UR8 A;  3UQB A;  4TX0 A;  4L72 B;  4Z2L A;  2WK2 A;  5HWC A;  2PI6 A;  4W9O A;  4ODQ A;  4WKF A;  5D75 A;  3UQA A;  1OWQ A;  2FDM A;  1Q6U A;  4WK9 A;  3WKZ A;  2ZQV A;  3UF8 A;  1KT1 A;  4ODR A;  4TW8 A;  3O5D A;  2Q5A A;  1HJV A;  3NI6 A;  4DH0 A;  3CH9 A;  1E44 A;  2ITK A;  1BKF A;  2MLX A;  1NH6 A;  3KAF A;  1EHN A;  3O5G A;  4DWS B;  4W9P A;  1ITX A;  2KGJ A;  1CTN A;  2RUR A;  4Z2H A;  1FAP A;  4JFL A;  3ARU A;  1E9L A;  1QPF A;  4MPK A;  1FKD A;  2LGO A;  5J6E A;  1U79 A;  4JFK A;  4J4O A;  4XAK A;  4U86 A;  4WKA A;  4WIW A;  1HKK A;  4QIB A;  3OA5 A;  4N19 A;  1W1Y A;  1X6N A;  4J4N A;  4TNS A;  4P8W A;  2XPB A;  4ODN A;  3EY6 A;  4DWS C;  4ZPT R;  1EQ3 A;  4WJX A;  4Q22 A;  2XP7 A;  1VF8 A;  3B8S A;  2O9O A;  4MNL A;  4ITZ A;  1D7H A;  2XP4 A;  1NWT A;  2ZQT A;  1OGG A;  4ZPV R;  1W9P A;  4DRK A;  1XHG A;  4DZ2 A;  5GPG A;  1PIN A;  1WB0 A;  1FFR A;  2LJ4 A;  2KO7 A;  3CGM A;  5HBF A;  2OFN A;  2RUQ A;  3RME A;  3ALG A;  1E6N A;  1ZCN A;  2PPO A;  2P4V A;  1NWR A;  1ZBW A;  3WD4 A;  2MLY A;  3AS2 A;  4ML4 A;  4HBO A;  3B9D A;  4MNM A;  4MGV A;  1H0I A;  2MPH A;  2A3C A;  4IT4 A;  3KAC A;  5HW8 A;  3ARX A;  4TW6 A;  3OOB A;  3UI5 A;  2ZQS A;  2DSV A;  4G50 A;  4ODK A;  2FKE A;  4C02 B;  1J4I A;  4P8U A;  2XP8 A;  1P5Q A;  3KZ7 A;  1FKB A;  1WNO A;  1LL4 A;  3TDB A;  1ROT A;  4BF8 A;  3ARZ A;  4MSP A;  5DIU A;  1W26 A;  3O5I A;  3G6L A;  2ZQU A;  4PTM A;  1ZK6 A;  1D7I A;  4ODO A;  1FD9 A;  4JYS A;  1HKI A;  2XP3 A;  3ARV A;  4GGQ A;  2KFW A;  1F8A B;  3KCE A;  4MNJ A;  2ESC A;  4S3K A;  2IF4 A;  2DT3 A;  5DIT A;  1FKS A;  4LAX A;  1Q1C A;  4DRH A;  1LJY A;  5DEZ A;  4P8V A;  2B31 A;  2AWG A;  1JVW A;  3QOK A;  3LUO A;  3TCZ A;  4W5U A;  3UQI A;  3WQV A;  1E6R A;  3H9R B;  2DPE A;  3ARO A;  3O5M A;  4G2P A;  3O5E A;  4DIP A;  2PBC A;  3RM9 A;  4FAP A;  3UI6 A;  1QPL A;  1GUV A;  3WL1 A;  3AS1 A;  3CHC A;  1QZ2 A;  2RSE A;  4NNR A;  2ETN A;  3PRA A;  5GPR A;  3IKG A;  1LL7 A;  3CHF A;  2OLH A;  1FJD A;  2XP9 A;  5HTG A;  1TFV A;  4Z2K A;  2N87 A;  1JCH B;  1W1V A;  4JFM A;  1PBK A;  2WLY A;  3KAH A;  1EYM A;  3O5J A;  3PRD A;  3UI4 A;  1SYT A; 
#chains in the Genus database with same CATH homology
 3WD3 A;  3WL0 A;  5DF0 A;  1NMV A;  4R0X A;  4KQZ A;  2RQS A;  1YAT A;  5DIV A;  4DRJ A;  4Z2G A;  4TW7 A;  3JYJ A;  3W4R A;  3ARW A;  3RGC A;  4ZPW R;  3GPK A;  4WKH A;  3WIJ A;  3WD1 A;  4QT3 A;  4DRO A;  3NTP A;  1HKM A;  2XPA A;  2M2A A;  3O5O A;  2DT0 A;  1HXV A;  2VN1 A;  1BL4 A;  2KI3 A;  1W9U A;  1M5Y A;  3BXW A;  3JXV A;  4W9Q A;  1Q6H A;  1FKT A;  4DT4 A;  4DRM A;  2FAP A;  1J6Y A;  1D7J A;  2MLZ A;  2O92 A;  3JYM A;  4LAV A;  2PV1 A;  1H0G A;  2KE0 A;  2RUC A;  4MNK A;  3WQW A;  3G6M A;  3RM8 A;  2YBU A;  3IK8 A;  1JNS A;  3ARY A;  1NMW A;  1N1A A;  4ZS6 A;  1ZBC A;  5JH8 A;  3PRB A;  1HJX A;  4MTV A;  2PV3 A;  2UZ5 A;  1A7X A;  2A3E A;  2LPV A;  3KAI A;  4DRQ A;  4IQ2 A;  1SR0 A;  3B9A A;  1EDQ A;  2ZR5 A;  3O5Q A;  3ARR A;  4LAW A;  4ODM A;  2KR7 A;  5HW7 A;  1Y0O A;  2XP6 A;  2WM0 A;  2MF9 A;  1FKL A;  1JND A;  1X6L A;  1LL6 A;  2M08 A;  1C9H A;  1W1T A;  3O5K A;  2QF8 A;  2F4E A;  4JFI A;  1T11 A;  5GQB A;  1NSG A;  4ODL A;  2D9F A;  1F40 A;  1FKF A;  3PA7 A;  4FN2 A;  3FAP A;  5DO2 A;  2DSU A;  3ODK A;  3ART A;  2ZR6 A;  3KAG A;  1TCO C;  4QZV B;  1JNT A;  2DG4 A;  4Q7N A;  1L1P A;  1K9T A;  2F2D A;  1ZBV A;  3FY1 A;  4DRP A;  3AS0 A;  2A3A A;  2AOS A;  1ZBK A;  3O5F A;  4MAV A;  3KAD A;  1HJW A;  4IQC A;  1D6O A;  2ZR4 A;  3CGN A;  1FKK A;  3IKD A;  2PPP A;  5B8I C;  2DT2 A;  1XRV A;  2RUD A;  2XP5 A;  5HT1 A;  1NWU A;  1EIB A;  1E15 A;  3VAW A;  4DRN A;  3MDY B;  1FKH A;  4AY1 A;  4IPX A;  4HBE A;  1E6Z A;  4P8X A;  4O2T A;  1RD6 A;  2DSZ A;  3I6C A;  3CZ8 A;  3CHE A;  1FKR A;  4NZC A;  1O6I A;  4QT2 A;  4S3J A;  3NRK A;  3O5L A;  2DG9 A;  1HKJ A;  3CHD A;  3PR9 A;  2JZV A;  4Z2I A;  2LKN A;  2M1I A;  1GPF A;  3IHZ A;  3RM4 A;  4DRI A;  2WLZ A;  1LQ0 A;  2IUZ A;  2A3B A;  3ALF A;  4LAY A;  5I98 A;  1ZL1 A;  2MNT A;  5HWB A;  1FKG A;  5HUA A;  1UR9 A;  4URI A;  1NWS A;  2K8I A;  4LGX A;  3WD2 A;  1W9V A;  1E6P A;  1JNE A;  2DT1 A;  3WD0 A;  1FFQ A;  4DWS A;  1KFW A;  3FXY A;  4Z2J A;  1FKJ A;  1ROU A;  3AS3 A;  5HW6 A;  4IT6 A;  4NSB A;  4DWS D;  3AQU A;  4TYO A;  1YW5 A;  4KR0 B;  4U84 A;  4DZ3 A;  3KAB A;  1FKI A;  2PV2 A;  3O5R A;  3B9E A;  1LG2 A;  4R5E A;  3RFW A;  2DSW A;  2PPN A;  1ZB5 A;  1D2K A;  2YBT A;  3O5P A;  1R9H A;  1OGB A;  4ODP A;  2L2S A;  3ARQ A;  3B7X A;  2G8Z A;  1J4H A;  1W1P A;  3ARS A;  2VCD A;  5BXJ A;  3ARP A;  3WH0 A;  2F21 A;  2DG3 A;  4GIV A;  1J4R A;  4HAR A;  5HKG A;  1IX5 A;  3TC5 A;  2G41 A;  1LG1 A;  1Q6I A;  1ZU8 A;  1KT0 A;  4JFJ A;  4U85 A;  1WAW A;  1B6C A;  1GOI A;  4L3N A;  2Y78 A;  1UR8 A;  3UQB A;  4TX0 A;  4L72 B;  4Z2L A;  2WK2 A;  5HWC A;  2PI6 A;  4W9O A;  4ODQ A;  4WKF A;  5D75 A;  3UQA A;  1OWQ A;  2FDM A;  1Q6U A;  4WK9 A;  3WKZ A;  2ZQV A;  3UF8 A;  1KT1 A;  4ODR A;  4TW8 A;  3O5D A;  2Q5A A;  1HJV A;  3NI6 A;  4DH0 A;  3CH9 A;  2ITK A;  1BKF A;  2MLX A;  1NH6 A;  3KAF A;  1EHN A;  3O5G A;  4DWS B;  4W9P A;  1ITX A;  2KGJ A;  1CTN A;  2RUR A;  4Z2H A;  1FAP A;  4JFL A;  3ARU A;  1E9L A;  1QPF A;  4MPK A;  1FKD A;  2LGO A;  5J6E A;  1U79 A;  4JFK A;  4J4O A;  4XAK A;  4U86 A;  4WKA A;  4WIW A;  1HKK A;  4QIB A;  3OA5 A;  4N19 A;  1W1Y A;  1X6N A;  4J4N A;  4TNS A;  4P8W A;  2XPB A;  4ODN A;  3EY6 A;  4DWS C;  4ZPT R;  1EQ3 A;  4WJX A;  4Q22 A;  2XP7 A;  1VF8 A;  3B8S A;  2O9O A;  4MNL A;  4ITZ A;  1D7H A;  2XP4 A;  1NWT A;  2ZQT A;  1OGG A;  4ZPV R;  1W9P A;  4DRK A;  1XHG A;  4DZ2 A;  5GPG A;  1PIN A;  1WB0 A;  1FFR A;  2LJ4 A;  2KO7 A;  3CGM A;  5HBF A;  2OFN A;  2RUQ A;  3RME A;  3ALG A;  1E6N A;  1ZCN A;  2PPO A;  1NWR A;  1ZBW A;  3WD4 A;  2MLY A;  3AS2 A;  4ML4 A;  4HBO A;  3B9D A;  4MNM A;  4MGV A;  1H0I A;  2MPH A;  2A3C A;  4IT4 A;  3KAC A;  5HW8 A;  3ARX A;  4TW6 A;  3OOB A;  3UI5 A;  2ZQS A;  2DSV A;  4G50 A;  4ODK A;  2FKE A;  4C02 B;  1J4I A;  4P8U A;  2XP8 A;  1P5Q A;  3KZ7 A;  1FKB A;  1WNO A;  1LL4 A;  3TDB A;  1ROT A;  4BF8 A;  3ARZ A;  4MSP A;  5DIU A;  1W26 A;  3O5I A;  3G6L A;  2ZQU A;  4PTM A;  1ZK6 A;  1D7I A;  4ODO A;  1FD9 A;  4JYS A;  1HKI A;  2XP3 A;  3ARV A;  4GGQ A;  2KFW A;  1F8A B;  3KCE A;  4MNJ A;  2ESC A;  4S3K A;  2IF4 A;  2DT3 A;  5DIT A;  1FKS A;  4LAX A;  1Q1C A;  4DRH A;  1LJY A;  5DEZ A;  4P8V A;  2B31 A;  2AWG A;  1JVW A;  3QOK A;  3LUO A;  3TCZ A;  4W5U A;  3UQI A;  3WQV A;  1E6R A;  3H9R B;  2DPE A;  3ARO A;  3O5M A;  4G2P A;  3O5E A;  4DIP A;  2PBC A;  3RM9 A;  4FAP A;  3UI6 A;  1QPL A;  1GUV A;  3WL1 A;  3AS1 A;  3CHC A;  1QZ2 A;  2RSE A;  4NNR A;  3PRA A;  5GPR A;  3IKG A;  1LL7 A;  3CHF A;  2OLH A;  1FJD A;  2XP9 A;  5HTG A;  1TFV A;  4Z2K A;  2N87 A;  1W1V A;  4JFM A;  1PBK A;  2WLY A;  3KAH A;  1EYM A;  3O5J A;  3PRD A;  3UI4 A;  1SYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...