2FATH

An anti-urokinase plasminogen activator receptor (upar) antibody: crystal structure and binding epitope
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
b'GVKLQQSGPEVVKPGASVKISCKASGYSFTNFYIHWVKQRPGQGLEWIGWIFHGSDNTEYNEKFKDKATLTADTSSSTAYMQLSSLTSEDSAVYFCARWGPHWYFDVWGQGTTVTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIAAAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ATN-615, light chain
molecule tags Immune system
publication title An anti-urokinase plasminogen activator receptor (uPAR) antibody: crystal structure and binding epitope
pubmed doi rcsb
total genus 44
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatH02
3PV7A 1J86A 5EPMA 1MIEL 3UTPE 1DEEA 5C0NC 1LEIB 2VL5A 5HGDB 1CFNA 4U1KA 2FR4A 4MAYA 1IQDB 2J6EA 4H26A 1ZVYA 1YYLH 3LSOA 5D9SB 1MWAB 4I0PC 1C12A 1G7LB 3Q6FA 1S78D 4HJJH 2VAAA 5ESQB 5EZIH 4ALAL 4TPRL 2FECI 1B0RA 4YZFF 2IANA 1S9WA 2H32H 5LBSH 4Z7VE 4QRRA 1KV3A 3FQRB 1XFPA 4LQFH 5DXWA 3TBWA 3MRQA 2G5RA 4R4ND 1UZ6E 1DBJL 2IFFL 5IMKB 3N9GL 4R4FL 1V3MA 3K8LA 4H0HB 1U3HC 3FQXA 5M94B 1MI5B 4NP4H 3D48R 4OJFH 2DBLL 4UU9B 4D9QD 3BPLB 1JZ6A 3RTQB 3BQUB 2BXYA 4XP6H 2AW2A 1RUQH 3NMEA 3D0VA 3VGEA 1MFCH 1NGPH 2CIKA 3GMQB 4JJ5B 4AL8H 1AQDA 4DQOL 4M5ZL 5JLZB 2R15A 3LQZB 3UTSA 2IPTL 5C0BE 1Z0MA 3QISA 4LQFL 3ULVD 5D72L 3BZEB 4OJFL 4OTXL 4NOBA 5T1MB 5TDPB 4UNUA 3SE9H 3MFGB 4XNXL 5IMMA 4CUCA 3ULUH 1T2QL 5CFHA 1NGXA 5L9DH 3QQ9C 2NZIA 4OFYD 2JJTC 4HLZG 4NHCH 1QBML 2YPVL 1Q8MA 4D0CB 2BNRE 4JGJA 3QNXA 4NT6B 3PHQA 4LL9A 3WFBL 4U05A 1I9RL 3VXMD 3O8XC 1QFWH 1MIEH 3EHBC 2Z31C 5GS0C 1GH7A 1AGCA 3I9GL 4LLQB 1J7VR 4NNYB 4MAYD 4C59B 1DVFA 2GSGA 4PPTA 4P2CG 4QXUL 1U8OA 4JFQA 5ITFA 1GGBL 5CEZD 4OF7A 5DHVH 1J18A 2BSRB 4FOMA 4C57C 3EDEA 1XCTA 2GJ6D 4UQ2A 2YK1H 4EOWH 4F7CA 1KSRA 4BH8B 5DJ6A 4DGIL 3SDDD 1TVHB 4P2QA 4QCIB 1LK2A 4HKBB 3LV3A 1BFTA 2R56H 3GI8H 2X4QA 5DD5L 3LKPB 4MS8C 1H8SA 2K7PA 5E94B 3HZVB 2Z8RA 1A21A 4ZTOH 3MUJA 2O5ZH 5HGHA 2GJZA 2W38A 2HH0H 3AY4A 3UX9B 5EU5B 3QWRA 4OZGF 1UJTA 1XF3A 5BVPH 3FB5A 1AY1L 5D1XD 3SDYL 4V1DD 4FNLH 1U8LB 5DLML 4LEXH 3QRFM 1WAAA 1OLZA 1UH3A 2P24B 4NZJA 5JNYB 1F6FB 3JV6B 1T5WA 4QT5B 1N6UA 5FYJD 2IQAA 3GSNL 1BVKA 2VQTA 4ZFZA 1M1SA 1MCEA 5CJOH 5ISZA 1JYWA 5EWIH 2JJSC 4JM4H 5CZKA 1CK0L 4ZMAT 1F4XH 3OR6A 3LS4H 1UB5A 4PRDB 3S3SA 3OAUL 2HH0L 3FOLB 4QHMA 3WUWG 1M7DB 3TA3A 2HTKD 5HDBE 2DQHL 2X4PB 1FFQA 4XVSH 1DSFL 1M7IB 1Z9MA 3RX7A 3SN6N 2NY5H 4YFLF 4OLXL 4L5FL 1ULVA 3FL7A 5IJVA 5D71H 3S37H 5MEPB 4N9OB 3RIAK 5GS1B 4LLWB 2X44D 1UCBL 3EIFA 2V5RA 1W72H 1FZJB 3F7PC 4YC2C 4JRWA 3UBXI 1GZPA 4J4PC 5KS9E 1NL0L 1TJHL 2YZ8A 3UJJL 4FQ1H 4Y4HA 1D3CA 4LDEB 1S9VB 1HILB 1VPOH 2X05A 5SWQA 1HDMA 4WHTA 4WUUE 3IFLL 3NN8B 2IBBA 5AG9A 4GW4B 3UO1H 1MJJA 3IDNB 3WXWL 1ZVHA 3GJEA 1RZ7H 5GSRA 3VXOA 1FZKB 2GFBB 1BJ1H 1QLEH 1A14L 3M45A 2YC1A 3HE7B 4HIHA 1BOGB 3PWNB 4LCWE 3AS2A 3ULVC 3Q6FB 2VQUA 4QRTA 1X5KA 1L9NA 3BDYL 4PRIE 4WCYH 1T7ZA 2GTWB 1FBIL 2EKSB 1T2QH 4LKCB 3M1BA 4GKSA 3DUUB 3CPLB 4KK9D 7CGTA 5IEKA 1KT2A 3LKRA 5SX4H 4P9HH 5HPOA 2CD0A 2BRRL 5C0CA 3SQOH 1IZJA 3S6CA 5I1KL 1I9IH 3FONB 1FGVL 2ZZUT 1A6PA 1TZIB 3F7QA 4URTB 3CSGA 1TDQA 1T3FA 2EDJA 4WV1C 1A7NL 3KJ6H 2V17H 4HK3N 3ARGA 1Y6KR 1E6OH 4M6NH 2WWKO 2G9HB 1X5FA 5F9WB 1CR9L 4N5UA 1CFVH 4XMPH 3TVMB 5DUBB 1J11A 3H3PL 4MA1C 3RUGF 1EVTC 2O5YL 1YNTA 1T0NB 2H6PA 4TVPH 1BEYH 4PY8I 4ODVH 5IEHA 2ARJB 1CXEA 4NQUA 3STLB 3UYOD 4R7NB 4E42A 3TO4D 1OP5H 3DX9B 4HJ0D 1E0OB 5FYJL 3T2QA 4JZNA 3C9NB 5L8KB 5F9JA 5GRJL 5FF6A 2IGFL 3IB4A 3PGCB 3HPJB 4EIGB 2GT9A 2HN7A 5IBUG 3F7YB 3WFZA 2A83A 4GUPB 4H25B 5EUKA 1ZSDA 4X8XA 4JY5H 1UVQA 2XWTB 1AGBA 1P7QD 2BVTA 3D18A 4FQ2L 1G7JA 5DMYA 3QA3A 2JK5B 5F1OB 3O11B 3RIFK 2WIIA 4WVRA 1WJ3A 2A6JA 4Z7VB 1INDL 3VFRA 4KKBC 1WISA 2VDNL 1MVUB 2Z93B 4Y2DD 1FNGA 3HI6H 5BXFB 5IG7B 4PRIB 1JZ8A 5H94A 4EN3D 4PJFB 4MB5A 3LS5L 4HMEA 5T5NG 4JPVL 5D7IA 5ANMA 2XRAL 1J0YA 4JHAH 5IOPA 4JY5L 3H0TB 4PLKD 5BJTB 5CSGA 2VR9A 2EIBA 2VC2H 5SWZD 5KAQG 5HHXH 2FR4B 1AP2B 2C9AA 3RY6C 3LD8B 3O0RL 3V4PL 1OCWL 4Q74A 4O2FA 3FB5B 1NMAH 4WW2C 4WUUB 5F9OH 1A9BB 2HVJB 3INUH 4J6RL 5JW4M 4EIZC 1K5NA 2AJZA 4ZOAA 4ZD3L 5KTEH 3C5JB 2E6JA 3BN3B 4NO0B 1R5VB 3I6LD 2DQDH 3P4MA 5JHLH 3ISWA 5T3XE 3J8F7 1WITA 3GMLB 3MV8A 3G6AA 4ZTOL 4QHKJ 4X6DA 5IGXH 3UAJD 3VFMB 4JN1H 3PWLA 4NQDD 3EDJA 4OGAC 1F4WH 1CD1B 1ORSA 3BEVB 2C5DC 4NJAH 3Q1SL 1MRCL 4K2UH 4N0CD 2IH3A 3ZE2E 1OSZA 3S5LG 2P5WA 3MOQA 5IK3B 1IE5A 4K3DL 3TZVB 3WSQH 4U1HA 2B2XL 3AAZB 1ORQB 5IBLD 1Z3GH 4QHLB 1Q9WA 4JR9L 5IFJB 5E2WL 2IADA 1YEHH 5IESH 2VIRB 4KZEH 1RVFH 2A9NL 1H5BB 2D7NA 1OW0A 1DBML 4OT1H 4PS4H 4PIRF 4YHIB 2BP3A 2EC8A 5DVMA 5DURB 5C9JB 1YZZA 4PLJD 4JDVB 4OKDA 3MJ6A 2F5AL 4MWFA 3ARBD 5I30L 3MLXL 3C6LB 4Y2OA 1T22A 5T5NF 1Q72H 3GRWH 2V2XA 1EAPB 1FZMA 1K4CA 1EV2E 2OZ4H 4M6NL 1AIFA 4HKXB 3WXWH 4YGAB 3WL9B 4CMHB 2OTPA 4WW1A 5KVDL 3VXTB 3RWCA 4G7VL 3SJVB 3PWNA 4HG4K 3TIEB 1AXTH 4Y1AA 1F90L 3SKUD 4EKXA 4P48A 4Y4KB 1ZGLP 1IGIL 3GZKA 4FQ1L 3BRFA 3F7VA 5TE7L 2OMBA 4KK6D 2HJKB 3DX6A 4D2NA 3VI3E 1P1ZA 3FCTA 2EECA 1CGXA 2RR3A 1QSEE 1YEEL 2EDBA 3TNNA 1MCCA 2VH5H 1E6JH 4AT6B 2R1YA 4IM8A 4X0KA 1U3HB 4XNYH 3RZCC 4ZNEA 1FNSL 4HDIB 2OJEB 5C0BB 3RWGA 1XGPB 5FUZH 2E6QA 4K94C 4EQ3A 3VD5A 5IMOB 1NLDH 5F21B 3IS0X 3OAUH 3T0EB 4XPBH 1DBKL 3MRPB 5JW5A 3NFNA 3RDTC 3RZCB 2GAZA 4J3XA 1FYTB 3IJSA 5CS7A 3UC0L 5H35B 3VI4E 2RCSL 4TRPL 4RWYH 4P2QD 3WJJC 5ILTH 3U2SA 4PJHE 2VXSH 2OX5A 4TSAL 2HT4D 2ZUWA 5CWSA 4P3DA 3T65A 1RVFL 2DQGH 3NCJL 1T20B 3VFOA 1NCCH 1NL0H 4R7NA 4E42B 2X4PA 4P99A 2LE9A 2A1WL 3BFOA 5E8OB 1BQHA 1KELL 2MCPH 1MY7A 3BT2H 4WHYG 3RI5K 3QWRD 3DIFB 3QUZB 4L8SA 5CLWA 3C9NA 1FIEA 5JMRA 2DKMA 4Y4FA 4Y5YA 2ZJSL 4NC0B 2PTTA 1HINL 3F58H 3R1GH 4LSTH 4LCYB 4NPYB 5GHWH 4MXWH 4NKMA 4QRQA 3ZKXB 4JHBA 4LLMA 2Y07L 2XTJE 5LAXB 4NQEE 1I3GL 3W9DA 1S9VA 4ETQA 3MLTB 2YPLA 4DAGH 1F4YL 3I6GA 5T3ZH 4GS7B 2I60L 4PRNB 4U1LA 1YA5A 4GBXC 2Z8VC 3CFEB 2ITCA 3P77A 5CGYD 3GJEB 3KPQB 4FTVA 1QSEB 1F5WA 4WTWA 5HHPA 3NPSC 1Q38A 1HKFA 3VWKD 1J12A 2DQEL 3P0VH 4I9WD 5IBLC 3BVNB 4KRPC 3MCLL 1UZ8B 5IKCB 5IIEB 5BVJA 4P9HC 3IDJA 4WUUA 2YD5A 5EOTB 4XNXH 5B4MC 4G9FB 4UDTA 4YIQA 3PGDA 5C0EB 3O41A 3LRSB 3EOAA 1F4AA 4PP2A 5I1LA 1Y0LB 3H9YA 2P42B 3OKDB 4QXGH 5D2NB 5EU3A 4XNQB 5ID1B 1RUAH 5SWSE 5C2BH 1LP9F 1CFTA 5E95B 1T7YA 4KTDL 4M61B 4FABH 4HPOH 2DLIA 4PRHE 2Z31B 1RJYA 3U79A 4RFEA 4XX1E 1I1FA 3DETD 3TC9A 1MCHA 5ESQA 3QG6A 3ZT5A 4BZ2H 1A7BA 4BSWA 5ICZB 3VW3H 2P5WB 3I9GH 3V4UL 1UKQA 1D6VH 3MRFA 2W0PA 3FAXA 4PGCB 5I16B 3W5NA 3T2NL 4MMXC 3L7FA 1KEMH 4QHLA 2CDFA 5AUMA 1XF5A 3WFCL 2H41A 3AREB 2EDWA 2R8SH 3TGXA 4MJIE 3OZ9L 3UJIH 3VFWA 1AO7E 3GSNB 3OPZH 3PJSA 1WBYA 1AO7D 1VCAA 5B38G 4HK0A 2UWEE 3NFPB 5C9JA 4KY1L 3RVWD 1FRGL 3RL2A 1U8NB 5CP7B 1MUJB 3L3DB 1XH3A 5CJ8A 1EJOH 5E08H 2VLJE 5E2VH 4JFDE 4NNPL 4BZYA 3IXAA 3QNYA 1OTTC 1YEDB 1RZGA 1IEAA 2AJVH 4GKZA 5J9PB 1OAKL 1Z6JT 5F9DC 2DTSA 3ARFB 1OP3H 4RGNC 2BHUA 1PQZA 3X13B 1EUTA 3T08A 3ZE1E 4PR5A 5FAAA 1KCSH 2NY3C 2C1PB 3CH1B 1QNZL 4YDVB 2D4FA 2CMRL 2AJSH 2UVFA 3H3KA 4JFED 4MLSA 4AM0A 4L8CA 4KH2A 3O9WA 1B88A 3RTQC 3MO1A 4HS8H 4UINL 1JF1A 3OAZH 1ZLUH 1AP2A 5GRVL 4P46A 3S4SA 3ETBF 4JPKH 4YHNB 2I5YL 2BMKA 2X4TA 2ZKHL 4M6MH 4TTGA 2HKHH 1LK3H 1RIVH 3ZHLA 3TBTB 3PDOA 1R5IB 4G8GB 4PG2C 3SGEI 3HMXL 3LKPA 2B0SL 3O4OB 1MNUH 5C7XL 4QOKE 5I1CL 4POYA 4Z9KB 4ORGA 2OTWB 4R2GB 5B38A 1EPFA 3IDIB 2EICA 1VSCA 3CDYA 3KWWB 4LSQH 4XNZB 5D7LE 5C8JA 1WICA 2OQJB 2XFXA 3HR6A 5J13B 2Q8BH 2ZPKH 1T7WA 4ELMA 3QDMB 3JWDH 4S11A 3T04D 5DK0A 1WZLA 3O3BA 4WWKC 4OQTH 2A73B 2VDRL 5B4MD 3ZKND 5ALCH 2VTFA 4IOIB 1RZKH 5D7KE 5DJYB 4OZIB 2V7HB 4MA3A 3KNBB 1J1XL 3VDAA 2NNAB 2UWEF 3QSKB 2BOBB 3O3DA 3A6OA 4PY7B 5EBMB 2Y5TB 2XZAL 2EXWD 1VENA 4OCXH 4Z8FH 3QO0A 3UJTL 1L7IH 3BZEA 2DQGL 4YDLC 3RKPA 2WV3A 1I75A 1MCDA 3GSRB 1RQ5A 4JFEA 1NAKL 2IAMC 5DR5H 4HWNA 1YC8A 1FE8L 4NQDA 4WU5B 1D5IH 1KTKE 5HHPB 4KJWD 4NQXB 3R06A 2BVOB 4YQXH 2W65A 2R0ZL 1QP1A 3VDBA 3KYKL 1KULA 3IT8D 4JPKL 2X1XR 1NUNB 4JM2B 3MPCA 2KBGA 1B3JA 5I19H 1E6OL 3HLAB 4LGPB 2DJUA 4DCQA 5I1IH 4YX2L 3MLYL 1GL4B 1CD9B 3B9DA 1FNEA 3KPRB 4H8WL 3SGKA 2DQIH 4BUHA 1Y0LA 2HTLC 4EXPX 1BAFL 1TETH 1F42A 1EEZB 4ODTH 3CFKB 2AABH 4HWBA 3FOMA 2PTVA 4LSVH 1QA9A 4I3SH 2C7UA 4QWWD 3DGGA 3S35L 4KI5E 5FYJU 5FUOH 4DN3L 5SWSB 3G5ZA 5CGTA 4XPAL 3GO1H 2X1WL 8CGTA 1KJMB 1SHMA 5CILH 3TBWB 2BHYA 4WHDA 1D5MA 5A2LH 5SX5K 5HHOB 4KKLC 1IQDA 4ZS7H 5C1MB 3G6JF 3PV6A 4FZ8L 1MWAA 4NZRL 5L6YH 1ZA3A 3FQXB 2B2XH 3PQYB 1UACH 1MI5A 4NC2B 1BAFH 3WDHA 4M7ZB 3S35H 3DIFA 4PB0L 1F6AB 4JGUA 4KZEL 3ARDC 2IPUG 1B6DA 3I6KB 2ATPA 4FFYH 5DO2D 4XP1H 2VR5A 2SEBB 3IJHB 2Y6SD 2UYLA 4UUJA 3QXWA 5JXEA 1Q9LB 1NMCC 5EU4A 1IGFH 43C9B 4J2XA 3WIHA 1HEZB 4WI6A 2DM4A 2JCCE 4ONFH 5KTEL 3GNML 5HBBA 1EHLH 2GSIB 1SM3H 3OJDB 4DTGL 3GBLA 5IFHH 4ACPA 5I6XC 2XTJB 3T2PA 2X1PA 4ODWB 3DSFL 4XHJC 5KSAA 3OR7B 4I2XA 4KQ4L 4RMTA 4YHKH 4WWKD 5HYFA 1HDMB 4KUCF 3MRJA 3SDCB 4WV1B 5A2JH 3S9DB 4O4YH 4FQJH 4OI7A 2QSTA 4LGSB 1MIMH 3BZFA 2BMKB 2X4TB 2GFBA 1LMKA 4IRJC 4JE4B 4LPVA 4IOSD 1EIBA 3MRGA 4ZSOA 4X4XA 1E28B 4MNHB 4FS0A 1QPXA 2Y07H 2IBGA 5EN2B 3EO1A 4TNWK 4PTUA 3CVIL 4LSDA 4DW2L 3CMOH 2OBGA 3T8XA 2A6KA 3NZ8A 5CEZE 3WUWB 3B5HA 5DHYB 1A4JA 1U95B 1CGWA 3CD4A 2G5BA 3KPSD 4PG9B 4M8VA 5E1AA 3DV4A 4GW1A 4ERSL 3QIWA 2ZCHL 5JXAH 3KPMA 1FAIH 1QZ1A 5GZOC 4F7CB 4BH8A 1DVFC 3NFSH 3OAYH 1C5BL 4Q6YA 4KKCC 1N4XH 2PYEB 4ETYA 3QDMA 2PR4L 1J88A 2E9WA 2G75A 3TN0C 5D5MF 4BM7A 3MRFB 3RY4A 3QULB 4HH9A 5IHLB 4K3HA 5IBTL 4D8PA 5HGHB 2A1WH 4DW2H 3QRGL 1R3KB 5FV1L 4X6DF 4WFHD 3FO0L 1A3RL 1HYRC 2YHGA 1JHLH 2DKUA 3AS3A 2D0HA 2P24A 1JZ4A 5CP7A 3KPPB 5J1AA 4O51A 3QG7H 3UJTH 2WINA 3SJVE 1M7DA 2YMXH 2V2WB 1OSZB 3T0BA 4NQDB 3LD8C 2KDGA 2NY7L 5EBWA 3TZVA 4HS3A 3T2OA 3VRJA 3U0WH 1AHWA 1ORQA 3MGTA 5CAYB 2FX9L 1LO4L 4DKFL 4KJQC 1OP3K 3TZVD 4DEPC 1LP9A 2PO6D 4Q9QL 4P2RE 1JNLH 3ILQC 4LGRB 4YDVA 1S3KH 5ENWA 5HVGB 5C0JA 5E8NA 4JZOA 5C09A 3ULVF 3G9VA 1U91B 4G7VH 5BW7A 1E27A 4YPGB 2BSTB 5D1QB 2WUCH 1ZHNB 1MPAL 2AXJA 1F8TL 2IALB 4GG6F 4ZO7A 2HLAB 4MZ3A 1G9NC 5E08L 5TE7H 1OGTB 4M7LT 3L5WA 4IRZL 3P30L 1T83C 1JN6B 4FFVC 1X5XA 4P59H 3QPXL 3MRIB 1CGUA 5D4QA 1LO0L 5BZDB 2VN4A 1JUFB 3DVGB 3KLHC 1G0DA 2YR3A 3FN0L 1WAAF 3QWQB 4PJHF 1XCQA 1HXMA 4JFHE 3DURB 1KIPA 4O2EA 3CLEH 1I7ZA 2JB6A 4FXKB 3NIFF 2I9TB 2ERJC 4GAYA 4UT7L 2GCYA 5KSBA 1UWXK 1YN7A 3DUUA 4NHCL 5HHOA 2XV6B 1QEWA 4JN2A 2DAVA 3UC0H 5IW1A 3ZKMC 1KT2B 3LKRB 1VPOL 4AEFA 5IBUB 3I84A 4LPXA 1QTYT 4ELMB 2EDYA 4JVWA 1S8DA 3LVEA 3T09A 5AZEH 2YD4A 4JAMB 4WI9A 2GK0B 3LSOB 4G6AD 2EDHA 4CMHC 3NIDE 5IQ7L 1NBZB 3VXQA 3G04B 4NKQB 1FZOB 4CAGA 3NCFB 4LLUB 4XAWL 5H35A 4CBPA 3LHPH 3ECBA 3VXSD 1U8IB 3U7WL 4NO3B 5F6IC 3VXUA 3P4OB 1VEOA 5ID0A 5IB4B 5DURD 1MQKH 1RSFA 1CDCA 1T3FB 3G5XA 4NZRH 5GGVY 1MJ8H 1PZ5B 5B8CA 1CF8H 3WS3A 3P4LA 4WU5A 1YPZB 2VITA 5ESAA 1R0AH 3K2MC 4NQXA 2XZCL 2ZCLL 3ABZA 1YC7A 1F4YH 2PXYD 5C6PB 3EBAA 2NXYD 3MBED 3MV9D 4BQ9A 2XQYK 1TQCC 2V2XB 2C4FT 2VZ3A 4G7YL 1CLYH 2J2ZA 1PSKL 3UTTD 1H3VA 2FJHB 4MJID 3RVVC 3BQUC 5CEZH 1WIPA 5FUCC 4JZNB 4NQVB 2OJZH 4HJGA 4MQXD 5DMKB 3U36B 1IM9D 1K6QL 5F89B 3MJ7B 2LAAA 1T03H 3IDMA 1U3HD 2VNCA 4OGXL 1TMCB 1A4JB 1U95A 1YJDL 1N6VA 2W0KA 5JORA 2IMNA 1MWAL 2KPNA 4Q6IB 1MFEH 3U0PA 3HMXH 1UWEL 3ULUC 3IXTB 5I1EL 5BW7C 4XRCB 4PGEA 3BSZL 5J6GB 5I1AA 2FD6L 3G5ZB 3GSWA 4ZUWB 4OB5L 1J8HE 5ICXA 5HGGS 4LDOB 3D69B 4OD1L 2DJ4A 2NX5E 3E3QC 1KGCD 4NO5A 3HS0A 4CRPA 1N26A 4OZHF 4HIJA 5T3XL 4L9LA 4WO4D 4CN1A 4XP5L 3VMOA 4QRPA 3HZVA 3RNQA 3GMLA 1EFQA 3SDAC 3G6AB 3GJFH 4JPWH 5L9DL 2GJZB 3H3PH 5ABDE 1LE5A 4WEMB 12E8L 3NH7H 4YO0B 5JHDD 5GS0H 2V2WA 4OGZA 1E4WL 4JDZB 4TTDC 1G7IA 3TT3L 3O8XD 5FUZL 4ESKA 1U6AL 2Z31D 4PGCA 5I16A 4JANA 5MENA 4GAGH 3BSZH 2W91A 1G7MA 2CDFB 2YN5A 5AUMB 2ATKB 5I75C 3L3KA 4K3JL 1WWWX 1LVEA 4XPFH 4HSQA 5IFAH 4QOKD 4Z7WF 2HLFD 5ETUB 2WANA 4WI3A 5EO9B 2VLKD 2E8YA 3OHXB 1GSMA 2Q76A 1XGTB 3S36X 2UWEA 4QRRB 4EI6B 1WFUA 2OR8A 5IVXF 5FUCE 4M1CD 2EDFA 3HNVL 3QXVA 2GY5A 1KUMA 5GIRB 1RZJC 1XR8A 3ARVA 3DBXA 3BT2L 4CKVX 4KHTH 4FTVB 3BO8B 1EAPA 3ARFA 1ZANL 2CKBL 4N90E 4WW1B 4XMPL 4JZJC 2ZUSA 4TULL 1PLGL 1RZ7L 3D0VB 3PGCA 4R4NC 1UGNA 2GKIA 3IGAB 1QR4A 4NHUB 3D6GA 2EDNA 4ZPTB 1EHLL 4Z0XB 4HUUA 4K9EC 1NBYA 4Z7WA 5DVOA 1M05A 3LEXA 3JTTA 4U6XB 2EO1A 5JTWA 4KJYA 3JWOL 1CQYA 3V6FB 3QFJB 4P2OC 4JN2B 2I24N 3RL1A 4O5LH 1KXVC 3H6JA 3PL6D 3GKWL 3DJ9A 3OF6D 3S88H 4X9IA 5FM5O 1MI5D 3E1F1 3HE7A 1HKLH 4RRPA 1OAKH 3IRPX 3QI9C 5FDYA 1F4WL 2JKXA 5CMAA 3RVVD 4OI9A 1KBGH 3VJ6A 1DN0B 3GBNH 2FATL 1UACL 2WAHA 4U3HA 2COQA 4DN4L 3T77A 2EKSA 2MSPA 2V2TA 1IGIH 3FFDB 2JJTA 3MLRL 1DEEB 1GGCL 5K9QG 3BGMB 4Y8AA 4CJ0A 1A2YA 3AREA 1K5NB 2V9TA 2J5LC 4TVPD 1QR1A 3NA4A 3MLSL 4POUB 2Q1EA 3I75B 4HKZA 3WD5H 1ZWIB 5E5RB 3HC3H 2PR4H 2VXVH 5E2WH 2Y5EA 3B9KA 4F3FB 3UTQA 4XPAH 5AYQA 3QZWA 3QIBB 3ARFD 3DYMA 4PJGA 3WN5B 2VXUH 3VXMB 2A0LC 4HIEA 4NZUL 3G5VB 1SJXA 4LCYA 1AGDB 4LEOA 5FDWA 1CTOA 5AZ2H 3TBSA 4MNGB 3QUXC 1CDJA 5C08A 4HFUL 5JDJA 1RUML 1E27B 4K8RD 4YPGA 4FQLH 4Q9RH 1P2CB 4JFEB 1A5FH 3BKML 4YBQC 4YHLH 2YPLB 3CMOL 4V1DB 4AH2A 4KK9C 3AMLA 4B7LA 5F88A 3V2AR 3RNKA 5FCSH 5D70H 1EERB 1ERNA 3A0OA 5I1JL 1MRCH 4ZXBA 1HI6B 4U3XA 1IBGL 4AMKH 3JWNC 1WEJH 4MA1B 5C70A 1I8MA 4HIXH 1KEGH 1IMHC 1EEYA 4YE4H 4EQ2A 3MRKA 1TTGA 3PWUA 1BBDL 2R2EB 5EUOB 3D0LA 3VG0L 4IIQB 3RUGE 2HLFC 3P77B 1AFVH 1W0WB 2ZP0T 1OP9A 4X7DC 1FN4B 3GBNL 1QQDB 4IMLA 4XBEL 4ENED 1AGFB 1YEJH 4NO5B 1JNNH 1J1PL 1YNKH 4MXQD 1UWXH 1S7WB 1TPXC 3BEWA 4U1MB 2DQCL 1HIML 2ADFL 3BD3A 3KLAB 4W4OA 3WLWC 1MCWM 1U36A 3MLWL 4G6ML 5E4IA 2AK1L 1MFBL 5IB5A 1U3YA 4GW4A 1B0GB 3WFEL 5JR1L 1JHKH 4E5XA 3VWJD 3VFPA 2F53E 3D1MC 1ZHKA 4DK6A 4R4BA 1KPVA 1JTTA 4LVOB 4NBZB 3RWGB 2M1KA 3QEQD 2JJWA 1NCCL 2VL5B 5HGDA 1AXTL 4PJ9C 2PF6A 5C07A 1N64H 1CDGA 2DB8A 1E4KA 1PZ5A 4K7PY 5B8CB 4ZYKA 3IDYC 2AI0H 5DFWH 1J5OH 4UB0H 5DEZA 4S1QH 4KTEH 5LCVH 3DI2B 1NAML 3FB7B 1S7UB 2ICWB 2XG5A 1BGXL 3BRGC 4GKSB 1T5WB 5JIKA 2WZPD 2V6HA 1NCTA 3IXAB 1BIIA 5IROA 4YXKH 4AEEA 4L3AA 2AQ1A 4A2LA 3ZTNH 5HDLA 3TPUA 5E7FA 4DKEH 3BHBA 5B21A 3RL2B 5IFAL 1U8NA 4XTRC 2F58H 3P9WB 3ULUL 4DUVA 4Y5VB 4GG6E 4C83B 1CDUA 4WFFD 4TVSa 1H3TA 1F4HA 3L5JA 4HUUB 3V6ZA 1QLFA 5EIQA 2R2BA 4I2XB 4OCRH 1U41A 4LSRH 2BY1A 4CVXA 2P7TB 2XTJD 2WNGA 15C8L 1BZ7A 4JY4B 4MQ7B 4R3SA 3BJ91 5F6HJ 3TVMD 1GJIA 3KPOB 2C1PA 3CH1A 4NIKB 5CCKH 3QUKA 1M6OB 4N0CC 4IS6B 5F7NC 4XVSL 4Y19E 3OX8B 2DBLH 1QSEA 3CU7A 3ARWA 1KPUA 4K8RC 4PJ5A 1MCKA 5GGUB 1JPTL 3CZFA 4BJLA 3QPQC 5KAQF 1F00I 3EYSL 3OKNB 3SDXF 3GIZL 2BOCA 3T4AB 2CPCA 4NO2B 3MRBB 4F9PC 3FFDA 2I60H 4UTAL 5E03A 1S5HA 2JK5A 2FGZA 2FECL 3L3OA 3ZL4H 4C54A 4OCSH 4PLJC 3GJFK 5C8JB 2W92A 3WO4B 3PV6B 5I30H 4HUWB 4S0TD 4X4MA 1MCIA 4LLYB 4C55A 1PYWA 2E9IA 1FFOB 1GOHA 3MXWL 2C3VB 3UBXB 4UTBH 2WQ8A 3BKCH 5DQ9B 4UDUA 2BCKA 4HGKC 3IJSB 5TE6L 3E8UL 5JQ6L 1OTSD 1IVLA 4HC1L 1RJYB 1XAUA 2F19L 4EN3C 4E9LA 4PJXE 3WNKA 3NPZB 5EU4B 2FEEI 3ZDYE 3B2VL 4U31A 1TZIA 1DFBH 2WINB 3ZL4L 4G8FA 4LU5H 2DQDL 5FKAA 1JTPA 1YEIH 3ARRA 1TJIH 2V7HA 4KI1A 2D3VA 2EZ0C 4KZDL 1MCOH 2NTFB 1IGCL 2B1HH 3TT3H 3QZWG 5HD8D 3FQTA 2Y5TA 2W65B 2D2OA 5CD5D 1NLDL 4JFFE 4OZGA 1ORSB 2E7LC 2UVEA 5C3LD 2OXGA 1I8LA 4LPYA 1IT9H 3SDYH 4ZOBA 5AAMA 1W0WA 1HYSC 1MJ8L 3RA7L 3TT1L 2CJUH 3TM6A 3T1FB 4XC1H 1OT1A 1BECA 2IPKA 1J0JA 2LAGB 3P2TA 2HT4C 2GT9B 2HN7B 2EC9T 2IC2A 2CDEB 3KJ4C 4LLWA 2W0FB 5E2UL 2DLGA 3EYUL 1NC2A 4KTYA 2R29H 1A6ZB 2HKFH 2YRZA 1GZPB 1EO7A 1ZLWK 4S10A 5HVFB 1M7XA 2CO7B 1OPGL 2VDLL 5E4EC 3C6LA 5DUML 1XCQB 3VU2A 4TULH 4HAFA 3L3HB 5L2JB 2X10A 2MOVA 1WWBX 3RZWA 1NC4B 2V9RA 4U1SA 5D7IB 1XIWA 3TNMB 5IJKC 1OVZA 1UQSB 5D1QC 1A7RH 2YC1B 1D7FA 2JJSA 5C07B 5SX5H 4Y4KA 3ESVF 5HYJE 3DGGB 3CFJA 1N64L 1ZWIA 5FYJE 4MDJA 2FNBA 3H9SD 5FO8B 1EFXD 4OCYH 2Y7QA 1T2JA 4HQQL 3FO1A 4AT6A 4O2CB 1SMAA 3BZDA 3ARPA 3QYCA 5B38B 2AEQH 3ARBB 4LVHB 4XPTH 1WBZB 1AC0A 1D9KC 4P57A 1QFWM 4FQIL 2CO6B 2UYLB 4KPHH 1AHWB 3ZDXE 3HC0A 3QP3A 4OI8A 4MNGA 3BHBB 4L8DB 4O58H 5K9JL 4H88L 1F6AA 4W4NA 1TENA 3GSNA 4BFGA 2ZCKH 1CZ8H 3BYYA 3FQWB 4ZUVA 3MNWB 1UADC 2WBWB 1VGKB 5FYLD 4IRJD 4L9DA 3T0ED 1XH3B 3TH2T 3MLUH 1NGQL 3MJ8A 2G9HA 1A6WH 5IB3A 4U1IB 1J87A 4FA8A 3TCXA 2YUXA 3GMMB 2EDDA 3B3IB 4GQ9L 1ES0B 4MNQA 1DQTA 1PEZA 5FM8A 4PY8J 1FCCA 4FFYL 1H5BA 2NXYB 3NABL 1JRHL 4FQIH 3OB0H 2YRLA 3NTCH 3C6LD 3ARZA 1IGML 4NQVA 5E6IC 2VC2L 3OR7A 5TJWK 3IAPA 5GZOD 2AK4D 4Z7NF 1VFOA 4HGWA 1HSAA 1AGFA 5EIIB 5F93C 1FL3A 1XIWD 4X7CC 3QUYA 3AS1A 1DL7H 1T22B 4NWTL 3ZDZE 3CFBA 3JUYA 4JJ5A 3KYOA 4OB5H 1IM9B 1WWCA 3VH8G 3TA3C 1JGUH 3MR9A 4GRMB 4ZFOL 4MHHI 4PJHB 3IFPA 2ZUQB 3QCVL 2A6JB 5D7JC 1FLRH 2DMBA 5DHVA 5J6GA 2ITCB 1VFMA 4PJAB 4S1DD 3OAYK 4R4BB 1CWVA 4GO6B 3VXSB 5HGAB 1PSKH 1IRAY 3PHQB 2H3NB 1NBZA 2YA0A 3VXQB 1WZKA 5D1XA 3KXFB 4D8PB 2DQTL 2D9QB 3ES6B 5TE6H 1MLCB 3GSXA 4O2FB 4XB7A 5CGYC 1KELH 2MCPL 2JELH 4R26L 3QHZL 1JGUL 1IILE 1A7OL 2BVPA 5ISZD 4YHPA 2YSSA 4UQ2B 4CADB 5HHVL 2M26A 4JEGB 5I0ZA 4B53A 5F1SA 1MCBA 3OGCB 4YJZL 2NTFA 1JGEA 3V4VH 3QIUC 3OKOB 1R5VA 1FNLA 4JG1L 5JPMB 1X5JA 2P5EA 2BNUB 3P4MB 3WIHL 3GNMH 2QSCL 3MREA 2OLDA 2CIIA 5E24E 2P47B 2EDXA 1ADQH 1JV5A 4P9ML 5KOVC 2WMPA 5HHVH 1T80A 4X99B 3RUGA 3QHFL 1B0WA 1BQHB 1IKNA 1YDPA 4NM8L 2N56A 4XP4L 3DOSA 4EDWH 4D94A 5FFLA 5LXGL 5BV7H 1A64A 2D9CA 4M9OA 4OV5A 1TPXB 4Z0BL 1LGVA 3MBXL 4P23A 1YMMD 4UZGA 3R06B 1X5GA 2VXUL 3QUKB 5BV7C 1D9KD 3ULUF 5HTSA 3CVIH 4XZUA 3QXTA 3KPSA 2GY7B 1FFNA 1YMMA 4UI2A 2BSTA 5D1QA 4LIQE 1YN6B 2ADJA 5L2KE 2LTQC 2VERN 3FFCD 2CUIA 4X98A 4YXHL 4AEIH 3L7EB 1K2DB 5T1KA 5GGTL 4LVOC 4KQ3L 1JN6A 4R7DA 1HHKA 4WO4B 4ZUWA 3MV01 2UZIH 2DDQL 1KYOJ 4DJMA 2BFVL 5GS1A 3SE9L 1QEWB 1QYGL 1MF2L 3EJYC 4L9LB 4HUWA 1RUPL 4PREB 4KXZI 4RWYL 3RNQB 2YPVH 1UZ6F 5KVEH 3ZDXF 4OLZH 1NUFA 3DURA 1U9KA 4LASH 4J23A 5E1AB 1F97A 4AJ0A 2QR0A 4NRZA 5K9KB 5FIEA 3SKOB 3QEQA 5F7UA 2UZXB 4JDZA 2R1YB 2ERJB 4XMLH 1LDPH 1P7HL 2IMMA 4PP2B 3PDGA 5I1LB 1CU4H 2L0DA 5GSRB 3KPTA 3H9HB 2NW3A 1A2YB 2LU4A 4OM1L 1S9YB 1M71B 3Q1SH 4HH9B 3QULA 4R0LB 2YWYA 1UKSA 3LN9A 4MD0B 4XCFL 3RTQD 2VH5L 2OI9C 4Z7UE 4LVEA 4R90L 3FO2B 3V95A 1OARL 3HE6C 4KDWA 1Q0YH 4U6YB 3NH7L 4YHYB 4FZEH 1HN1A 5T33L 5DZNA 2J8HA 3MRHA 3ALXA 3KVQA 5K9QI 1YYLL 3MV8D 4LEXL 4QHKI 4LSPL 4R2GD 3QEHB 5EU6D 2DQEH 4HZAA 4ISVA 2A73A 4W68A 5D2LE 1OTUC 3M17B 3STBA 4BFEA 8FABB 5T1KD 2DI9A 4IRZH 4QEGA 2W1NA 4BK4A 2P8PB 2YD2A 2EE9A 1I1RA 5F88B 4G8GD 1I8KA 1CDIA 3BPLC 3OZ9H 3UJIL 4PYHA 4HLJA 5ERWB 1HHHB 4UOW0 3VRLF 4QGYA 4OZHE 4OQ1A 4WFED 1B4RA 1EVUA 4WI5A 2FJFA 1KC5H 1HQRB 5JIIA 3MRKB 2IALA 4QXUH 4HJGB 4DKFH 5T1LA 1JYXA 1NSNL 5DD6B 3SDDB 5HVWA 5HYIA 3V6BR 2XA3A 3ALWA 3TNMA 5FF6B 5F9JB 1J0KA 1OW0C 3QWOA 3FTGB 5IB2B 4EDWL 1ZA6A 5CD3A 3V5DA 3IVKA 3EYQC 5EUKB 3ZKXC 2FO4A 2F9BT 5LGHH 5IKCA 1J8HD 2NY6C 4JFHD 1NCAL 1N3NA 2QSQA 5EOTA 4JM2D 4MGXA 4A6YL 1KGCE 2ZG3A 3MROB 4J3OC 3TJHC 1QFPA 4PB9H 1FNEB 1NC2D 3KPRA 4C56A 1YN7B 5DJZA 4PJFA 3BIBX 4LPTA 1EMTH 1BQUA 1MHEA 4L8SC 3O3AA 1MCQA 4IRSA 4KAQL 2VLMD 1B9ZA 1CGYA 1CR9H 4XNQA 4C56D 2F53B 3EOTL 1S8DB 4FQPA 4PRPE 4F3FA 3LRHA 1N5YL 1EGJH 5EUOF 3WN5A 3MLVH 4NCC2 4HIEB 1JPFA 1GHFL 1HH6B 3CSYB 1UG9A 3EUUA 3QG6B 2LTQB 5SWSA 2F5BH 1Z9OA 4RISL 4ZXBC 5DFVC 5BRZD 5KVEL 4PJAF 3NBNA 2CLRA 1X6LA 5IVXE 1JP5A 5SWSD 4K7PL 1NCWL 1EFXA 4G8EA 4LOUC 4NQCE 2VDKH 4M93B 4LSSL 4OGYH 3NZHL 1ZGLB 1E4XI 3WS3B 4LP5A 2HT3D 5ESAB 2PKDA 4JKMA 3PXHA 5B22A 3I85A 2W9EL 3BW9A 4E0RB 1YN6A 4CN4A 1GZQB 2ESVB 4LIQL 4LCCC 1PBYA 5EIIA 5DDHB 5ENWB 1WGOA 1SMOA 3DO7B 4HUVB 1QLEL 4KGJA 5DRXA 3TYFA 1OAQH 3UZQA 4OLVH 3LN4A 3S97C 5LCVL 1KXQE 5EU7C 1BEYL 1QFOA 1SM3L 1S7SA 3GIZH 1MREL 1RFDH 5B39G 5DS8A 4S2SB 5E5MA 5IB1B 2I9LB 4NQEA 5DMKA 3DROA 2K3TA 5BZDA 3WFHA 4NHUA 1BJ1J 1F6LL 2HJFA 1MFAL 1X7QA 2ZUUA 5DC0A 1FFRA 2AVGA 2J4WL 1KPUB 4F2MB 4JFXA 4JO2H 5GGUA 3O4LB 1I8IA 3RDTA 3FB6B 1JF1B 1SEBB 2JIXD 1MRFL 2HYMA 4KAQH 4HMCA 4EI5D 2IQ9L 3S4SB 1K4CB 3L3OB 5H2BB 1XMWA 4WWKB 5KVDH 3V7MA 3LZFL 3MRGB 4F57H 1CGVA 3WJLC 4I0KA 5I1AB 2W9DL 3KYNB 1WFNA 3KJ4B 1ADQL 4PTUB 3FT3B 3VJ6B 5BRZA 1PG7W 1XF2A 2VLRA 3TBYB 1KIQA 3OKOA 1GC1C 3MRNA 4XVTH 2F8XC 4PJDA 4JPIB 1UXSA 4RCAA 5JPMA 1BD2E 1T0MB 5DRZA 3KHQA 1XGRA 1F45A 3B9KB 5I2IA 2GI7A 4ZTPH 2DBJA 1F11A 1QLRB 1I3UA 1LE5B 1D5MB 1L7TL 1NMAL 2OTUA 5EC1B 5IM7B 1SJHA 3I02A 3O0RH 3H3BC 2V5TA 1G7IB 1MHPL 3BAEL 5F8RC 4P2RB 2W9EH 2QJDA 3GMRA 4JANB 5MENB 3T0EA 1GC1L 5I0DA 5JW5B 1YUHB 5GGTA 3VGBA 4ZUSB 3SCMB 4HUXB 4RMSA 1EEUA 4RA3A 2ATPB 3WO4C 2NY0C 1Q9KA 3CH8A 3GB7B 4CVZA 4I0CC 3RNKB 1VEMA 2CKBA 4JN1L 5ETUA 2P7TA 3AM8A 2H2PD 1TZGH 4GRLB 3U2SB 1Q9LA 3WO3B 4GLRI 1K6QH 1H0DB 3RPKA 1DL7L 1KOAA 4LPWA 3C09C 4M7KL 4YHOH 1SQ2N 3QUXB 4XP9H 3K81A 1G6RL 3FRUB 3PF2A 4P2YA 2P8LA 1VACA 4D9LL 3K2UL 4YX2H 3HUJB 5GIRA 4QNPE 1MFNA 1QRND 4PRID 1BBJA 3SDCD 3VRJB 3T3PF 4OUUB 3WIIL 3QAZB 3U9UB 1ZT1B 3U36A 1QSFA 4Y4FB 2VZSA 1BP3B 4N90D 1G84A 3C5ZD 3QEUB 1BZ9B 1AC6A 1MQKL 3MRJB 3SDCA 4GG8A 4OLYH 4Y19A 4WEUD 4ZNCD 1BHGA 2IPTH 4NPYA 3PWUB 2JELL 3BZFB 1P84J 4ZFFB 3L5IA 4Q6IA 1NGQH 4XWGH 2VYRE 4HZLB 1FP5A 4Y4FC 3K8KA 3RVXD 3JTTB 3CSPA 5EH1A 2Y06L 4XPBL 5J3HD 5HDQL 4NRZB 3BPCA 1A1OB 1LO2L 4PGEB 4TOYH 1MJ7H 1XZ0A 5GGQL 1U8PB 3QRGH 3EFFA 1E4XH 5KVFH 2VISA 3BGFC 4K23L 1MCWW 5DHYA 4G9FE 1ZLSH 2DQUH 1EEZA 1LWRA 2NW3B 3ULVL 3MJGX 1HSBB 1Y18B 5IW6A 1NANH 1T89A 4P46D 2E7HA 3BP5B 4DKDC 2AGJL 4L3EB 2IFFH 4MQXC 3CFJB 2AV1B 3U7AA 4DZBA 3QCVH 3T3MF 1B0GA 2QQLL 4NBYB 5EZLB 5F7HA 2VB5A 3B6SA 5A2FA 1EHXA 5K9JH 2XYCA 1KB5B 4YBLC 3F62A 5HY9B 5DUPH 1I4FA 4U6YA 4GAYB 1DQQB 4KC3B 4M6OH 1AO7A 4J4PA 2ID5A 3O41B 1TJGL 3BGMA 3LIZH 3DX8A 3L1OL 2KH2B 4XXDB 5I66B 1EFXB 4H1LH 1ZLVK 3R0NA 4KFZC 4Z7OE 4KVCH 2CXGA 3CXDH 5EFIA 3DX7B 4OM0L 2X2YA 4MB3A 1FIGH 3RVUD 4Y7MA 5DC4B 3PABB 3LRGA 4KHTL 2MNUA 3UTQB 3IU3A 4Z7QE 2KZWA 2DI8A 2R4RH 4HUVA 2XPGB 1ACZA 4KVNL 4IRSC 3OQ3B 3SGDI 1I1YA 3ZYIA 2M2DA 3V5HA 3QPXH 4L29A 2BDNH 4LLDA 4P3CH 4CU7A 2PW2A 3FAWA 4Y4HD 1S7VA 2KQMA 3BO8A 1A6VH 5D7IF 1KLUA 3UTSE 5FHBL 3PWVA 5KW9H 2FWOB 5D1XC 3ZE1F 3OKLA 3IFNH 4WNQA 4LVNB 1YECH 4F2MA 3NIGF 2NMSA 1MFBH 5KSAB 1INQA 3ILPA 3PE9A 5FK9B 4NSKA 5GGRY 3BE1L 4NCDA 3V5DB 4WV1A 1XEDA 4LCWB 1M05B 1X5HA 3DUHA 1KLFA 5H2BA 2JF1A 4EUPG 4XXCC 1IQWL 3PQYE 1I9JH 4I9WE 2Y25A 3RWJB 2CKNA 2J1KA 1QSVA 1RFDL 2H2PC 3JVGC 1P7QA 3DARA 2FIKA 4KDVA 2PXYC 1IC4L 1MH5A 1UWGH 1WTGT 4NCC1 4NFDA 5HXMA 4QHNB 1J5OL 2VSDA 3OKNA 1MCSA 1FYTD 2VSCA 4ZUTA 4YDJA 5GJTH 1FFOA 1UEYA 1MFEL 4L8CB 3V4UH 3SDCC 3ZDYF 4UDUB 3DO3A 2F5AH 4PG9A 1I1AA 3HN3A 5C08E 5IW1B 1WVZA 4UB0L 5J56B 1C5DB 3MBEB 3VXUE 4XRCA 1N59B 1LD9A 3ZYZA 4QRSB 1ZXQA 1AGEB 1A9EB 3QUMB 4M1DL 3R0MA 4N68A 2ZSWB 1CQKA 4JO4H 4BSVB 4N8VA 3FQWA 1FQ9C 3GI9H 2APTA 2BC4B 5D7JB 1FPTL 5DVLA 5AZ2L 4F9LA 4JRYA 1VESA 3EO9H 4G8EB 5ISZB 4MNGE 2HWZH 1KXTB 1R3KA 1DZBA 4YDKH 3JBG7 3QEGL 1ZVSB 2AJ3B 4L5FH 3U7YH 4Q9QH 1QUNA 1RZ8B 4PLKC 2LFGA 5CJQL 1QVOA 3TF7C 2Q7YA 4M7LH 1VGEL 4X6CA 4IJ3B 5GS2D 2FLBT 4NN6B 3LH2H 4LRNH 2PNDA 2DWEB 4LPUA 5DQJA 2BZDA 3SKMA 2A6DA 1IC1A 2NCMA 4OBSA 2X4OA 5DF0A 5BZWB 3MV9B 2D7PA 1RK1A 4G6KH 1V3LA 3OKMB 4JFFD 2MHAB 5F72S 4Y5XB 4O4YL 4K71C 3IF1A 1UM5L 4JKKA 5DJYA 1A0QL 3MCLH 2HRPL 1BMGA 2VKXA 2EYRA 5CJOL 3QUYB 2CRIA 5IROC 1E4JA 5EO9A 5TFSL 3LH2L 1JHTA 4GRMA 1J8HA 1A22B 1YMMB 1QO3B 1EJ6A 4DVRH 2UWEB 4EI6A 4CVUA 3EGSB 5SWQB 1CGSL 5CBAB 4P4RB 3S96B 2GJ6E 2BVEA 4ODBD 3PP4H 4NZDA 5DQDL 5F89A 1URLA 1CE1H 5C0IA 4NKDA 3IDMB 3RGVB 3MV7E 4M3JA 4U7KA 3CJJA 3O3EA 5GHWL 1M6OA 4TSCL 2R0WL 2Y36L 3DVNA 2C4FU 3BKJH 1XF2B 3CAFA 3LKOB 4OCWL 4Z0XA 5JUEH 5E00B 2C1OB 4UT9L 1U8JB 2VLKB 4KUZL 3WFCH 1QFUL 3C6SB 2Y7QB 5I2IB 3X3FL 3ZHDA 1JPGA 2H9GB 4HC1A 4HBQA 5KSBB 3ROOA 4AIOA 2BY2A 1G7PB 5EO1A 2BNQB 3MLXH 5GZND 3HS0B 1SEQH 2R0WH 1AQKH 5E6IB 1KPVB 2E7LA 1BGXH 3CFKA 2P49B 3HC0B 4U7MA 3ULSA 1WC7A 3MZGB 1EK3A 2OS7A 3S35X 5FO8A 3BISA 4OLUH 2BSED 4ODHL 4JAMA 3PABA 4ENEC 4LSSH 1DN0A 4YHZH 5C0ND 3VDCA 4Y16A 1S7UA 4KK6C 1U8IA 5EA0H 2BRQA 4QOKB 1EBAA 1T21B 5DRNB 1YMHB 1AD0B 1YNTB 1CD8A 3I2CL 3F8UB 1BZQK 2VWEC 4YUEH 5L0QB 2APXA 4OLUL 3QEHA 5E2UH 1EMTL 3MNWA 2P8LB 3QQ4B 3I75A 1UM4H 4LSRL 3CCHA 4KK8D 4UV4H 2FWOA 3QB7C 5I73B 4GMSH 1QSFE 4OF5A 3MJ8B 5C0AE 5BMFH 5CZVL 4JO3L 3D39A 1KCRH 3BYTA 2J8UB 5D96B 2NW2B 3QIBA 3NOIA 1A7PH 3A6BL 3RDTD 4POZD 5GXBB 3JV5A 4OZGB 1K2DA 5T1KB 1AGBB 4F7TB 1VFBB 3SEPA 5DLMH 2YD6A 4JM2F 3TBSB 1RZIA 1U3ZA 3QIBD 3VMNA 3U4BH 3B2VH 5TH2B 4R3SB 5FM4A 3OJMB 2AAVA 5LGHL 1DDHA 5I8OH 3VWKA 4R97B 3OPZL 5DD6A 3SDDA 1PFCA 3JXAA 1RURL 5GISL 2EO9A 4WI8A 1ZTXL 2DQJL 3KYOB 1J1OH 3LIZL 4DGIH 4LCCB 4UIMA 1MLBA 3N85L 3KXFA 1YPZF 1XF4B 4ZFGH 5CEZL 2PETA 3ZE2F 3UPRA 4PJ9A 1MLCA 3D87B 3B9EA 1S5HB 3TJEL 1DSFH 1EA9C 4G7YH 2X89D 4XBPB 3CMGA 3BH9B 3QUMA 4OSUL 2MPAH 4X80H 3HC3L 3ZTJG 4EVNB 5CBEA 4XC1L 3KG5A 5EOQH 4YHPB 3RWIB 1HXYB 3HMWH 2GW5A 3V52H 2X89A 5INDB 4MJ4A 4I4WA 4PJ7E 4LLYA 5DMGC 2X4SB 4S1SH 3BAEH 4IRSB 4K71B 3FO2A 3RU8L 1MJ7L 4AIXA 4TUKL 1AHWC 3MV8B 4X6BB 2OXHA 4QRPB 1EUUA 2XA8L 5EFIB 1BD2B 4N0FB 5EU6B 2MFNA 4MDJB 3VWKC 1PY9A 1U58A 1ZKAA 1I8LC 3V0WL 2YKLH 3QDGD 2Q7YB 4CADA 1PJ9A 2B1HL 2Z91B 1NEZG 1KBGL 2VZVA 4NUJA 1R0AL 3R8BB 2A6DB 1HWHB 3F7RA 4FP8L 2XNAA 2ZKHH 5E9DA 2YWZA 5TDNA 2V9QA 1KTDA 5GS1C 3WLWD 4MD5B 1VKXB 3O45A 3FO0H 3MUY1 5IFJA 1PAMA 4R90H 4HIXL 3O6KH 1S7VB 1JK8B 3P4NB 4ZUVB 4XPGH 5GZNC 4RSVA 4L4JA 3VI4F 3K3QA 2ZPKL 5GGRB 2ICWA 3FB7A 4CDGC 2Q76B 1ITBB 1Q94A 4PB0H 1YDPB 3IRZA 5HI4D 1HQRA 4F37K 4CU6A 5CBAA 3LPWA 2ZOLA 1W0VB 3DETC 5DI8B 4P5KB 3L7EA 3ARGC 5DWUL 5HYJD 1WFTA 3CZJA 1F3JA 4KPHL 1O0VA 3MGTB 4ZXBB 2HTKC 3DXAB 1I9EA 5DVNA 3A67H 5LGJA 2Q7NA 4B0MM 2JCCF 4HV8B 2EEBA 2UUDH 3RGHA 4HH8A 4OT1L 4PS4L 3SBWA 3UDWA 4Z78B 3BKJL 1GOGA 1CE6A 2KKQA 4PGZA 2E8ZA 5D6DC 3VG9B 3X14A 3GMOA 1U8JA 2PYFA 3PHOB 1TNNA 3GKZA 1NBYB 4Z7WB 4HCRA 4JREB 4C56B 3MR9B 2QQLH 4K3EH 4XTRD 2BNQA 1OSPH 1A02N 2XZQL 1GIGH 4NQSA 3BRDA 5DD3L 1X5ZA 4XPHH 1NBVL 1AGEA 1A9EA 2XQBH 2NY5L 1BX2A 1M71A 3VXSA 4XB8A 1Y6NR 4FQQB 5C0FA 1L9MA 2XT1B 3I50L 4MD0A 5LWYL 4PJDF 1PKQE 1KIQB 4IOFC 2JB5H 2FZ3A 2Y06H 3QEQB 1S5IH 1V8HA 5FCUL 2ICWJ 2DQIL 1KF9B 2A9MH 1NGWA 4J3SA 1V3KA 1UM5H 4RDQG 2AJ3A 4OLZL 4ZS6C 1AXSA 3H42L 2Y9RT 3MLWH 1CFSA 1SJHB 3I02B 4OD3H 3V7AE 1MCLA 2ESVD 3EO0B 4R8WH 4YAQA 1OCWH 4NJ9L 1IAIL 2NQCA 3DYPA 4FRWA 1Z2KA 3G08A 3OKMA 3BQUA 4MAUL 5H37G 3GSVA 1BQLH 3SO3C 1G6RH 3F6LA 4YWGH 1A7RL 5DDHA 4LKXB 3GRWL 1W2KT 1MHCA 4LMQE 4ZQKA 1IZKA 1JHLL 4NO3A 5D6CA 4P59L 1JV5B 5JLZA 3S34L 1MCJA 3RU8H 1J0HA 2AXFA 3O2WL 1AGDA 4LEOB 1X44A 4R26H 3NA9H 4P2QE 1TJIL 4L4TB 4NGHL 2ENYA 5J6HA 2XICA 5GGVL 3MYZA 5IMMB 1OTSC 3DYOA 4NJAL 4OUUA 5D93C 4JDTL 1XR9B 1DLFL 5E8EA 2YOCA 4EI5B 4M4RA 4P5TB 1KNOA 4J3VA 1GGBH 4UIMB 1IGJA 4G8IA 4HFUH 1J05A 2YD7A 1QHOA 3FB6A 3KPSB 3Q48A 4YDIH 3E6HB 2QLVB 5IIEA 1I1CA 3SCMC 3TCLB 2AK1H 4NC1C 2OP4H 5AWNH 1A8JH 2QV2A 4O02H 4YIQB 3QHTC 5TF1H 3T1FA 1OOAA 1UFUA 2Q86B 4WO4A 1XCTB 3EYVA 5FO7A 4DVRL 3EOAB 5DJ6B 1FHGA 1V7ML 1QKZL 2ED8A 4TYUA 5EDXA 5D8JL 1EDQA 1P4LB 1H3XA 2EIEA 2IBZY 4JPIA 4UOJA 3TH4T 4NWUH 1JFQL 1NCBL 5MP6L 3ULSB 4YQXL 4N0FA 1RZFL 1K9TA 1WEJL 3HCVA 3ZMRA 3BPOB 1OT2A 4RGND 4XNUH 1OD7A 2AV1A 4DZBB 3RWHA 4LU5L 5DA4A 4OBRA 4NQTA 1IAOB 3REVB 2H32A 3LPFA 3CSYA 1YMME 1X5LA 5HY9A 4MXVE 4ELKB 4UT6H 1FL5A 2C3VA 1T21A 3UBXA 3L7FB 5J11C 4RX4A 4YHYC 3V52L 2ILLA 1J0IA 5DQ9A 1FJ1B 2VDMH 1NC4D 5F70A 1PG7X 3RBGA 4QTIH 2DL2A 4Z76B 4LHJB 5CIPA 1DBBL 4TN9A 3MREB 3D9AH 1CLYL 1H3PH 3LAFA 1MAMH 4MMZC 1QRNB 2CIIB 4KJPD 5E6YA 3H2WA 4O2CA 4DKAA 1OY3B 3FOLA 4ZAKB 2XPGA 4XMKL 5A3IC 5DI8A 3MUHL 1UXWB 4JG0H 2DQJH 1U3JA 4TUOA 2VKWA 5F7FA 1DLHA 4APQD 3SKJH 2X5PA 4M7ZC 4WDIB 1INEL 3UYRL 1IAKA 1JF6A 3TYFB 4F8TA 4DOHE 2AI0L 2BVUA 1LNUB 3FMGL 3VGDA 3KPSE 3FQTB 1OM3H 3T0WA 2ZOKB 2ICEA 1DP0A 5CILL 4JQIH 4TSAH 4MYWB 4OD3L 4KXZH 4YGVB 4U1NA 3ZYJA 2ZCLH 1T5XA 3OHXA 3TH3T 4BA8A 2PYFB 2AKRA 2OSLB 4NUGL 4Y4HB 2O5YH 3T3ME 1XGTA 5E2TL 3NZHH 2HKHL 4G43B 5FEBA 2R2BB 1JPTH 1CL7I 3HB3C 2FX7H 2VXTL 2GUOA 4WHTB 3HRPA 5DA0B 4JO1H 4NDMB 3ZKNC 1MJJB 1SY6H 4MLIA 4IHOA 2ORBH 2NZ9C 5KSAD 2CDEA 3TESA 3CK0H 4ZUUB 4WWKA 2NYYD 1P6AB 4KKAD 5IQ9B 2HFFB 4Z6AT 3T0EC 4AL8L 5MI0B 1JHKL 1DR9A 1KTLB 3QDAA 4XAWH 1K8DA 1A0QH 4BZ1L 4XPTL 5EZLA 2X4SA 5EO0B 5GQBA 3CX5J 2NX5A 3VFVB 1RD6A 4XAKD 1LO3L 1MAJA 1SY6L 2QKIA 4J3WA 3LEXB 3JWOH 2OTWA 5GSVB 4JFEE 3B8YA 5EB9A 1N3NB 1XIWB 3VFGH 5GS3A 4OFPA 1QLRA 1IGCH 3H8NA 3H9HA 4KTEL 3UTTE 3SGEH 2X4RB 5HYSG 3GMNA 2DLHA 4MCZB 4PJDB 2H8PB 4F8QA 4R0LA 5DRZB 3B2UC 1I7TA 1TZHA 4QRUA 1VGEH 3FO1B 3NCEB 4OZIA 4KI5F 5EG6C 3MFFA 2E7BA 2DD8L 4XCEA 2OTUB 1JK8A 7FABL 1JZ2A 3V8OA 1HOCA 1P9MC 2MQ0A 1LHZA 2CKBB 1OWWA 1I7UB 1NAMA 5LQBL 2EKJA 1YEKH 1RMFH 4L4TA 4R0LC 5LVEA 3TN0A 2CLRB 1I3VA 1YUHA 2VL4A 1FAIL 3MOBH 3D39D 4BKLB 4N8VG 1E4WH 4NQED 3C8HA 4PJFF 4N0YL 2I27N 4QYOA 4LCWD 3RVXC 2NY0B 3GIVA 4UTBL 3BKYL 5J3HC 3MLPA 5EUOE 3RY6A 2NY2C 4KGLA 3EZ8A 5GGSB 3ZE0F 3DWTA 5TPWL 3ESUF 4JB9H 4LCWA 3S34H 4M6ML 4JHWL 1CCZA 4Z78A 2A74A 2Z92A 5CIPH 3QDHA 4TNVK 1MVUA 3VFUB 3OSKA 2C3XA 3E6FA 5IG7A 5I17A 4PRAA 4S1SL 5C09D 1TCRB 1CF8L 3HNTL 2X9YA 4ZUTB 4PRBA 3RBSA 4OD1H 4N0YH 3H0TA 3X17A 4ZFFA 1HSBA 1X7QB 5I9QC 1OQOA 5C0FB 3BP6A 1PY4A 2ADJB 2E27H 3RGVD 2DM3A 3O4LA 1YYML 4F7EB 1WIOA 1FC2D 2EXYC 3HI1A 3E2HB 3S3JA 4PJAA 5L2JA 4U0RC 1SYSA 1SBBA 3RWDA 4NUGH 3FN3A 1KJ2B 1QQDA 2VLRE 4IMLB 3BGFB 4AYFA 4CJ1A 2DTMH 4XXDA 2H45A 1OP5K 4AZ8A 4NBXB 5KOMC 3GSXB 2NZ9D 3ZSSA 5KSAC 4YAQB 2R9HD 1GC1H 4H1LG 1PKOA 1KB5A 4NGHH 1N6QH 1DQLL 1DQQA 3GSVB 2HMID 1RULL 1S7XB 1YEGH 4U1GB 1RIVL 3IFLH 4RNRB 4XCYA 1AI1L 3ZYOA 1CDBA 4X7SL 1MEXH 3IU3B 4ZQKB 1BFOA 3FN0H 1GAFH 4Y88A 4UBDC 2ITDA 5BMFL 1B6UA 1YMHA 4PBVC 4HD9A 3SKJL 1AD0A 3DX7A 4Z95H 2P46B 5DMIL 2ARWA 3PHSA 1TIUA 1RAMA 1RIHH 1MI5E 4J1UB 1ZGLM 2IAMB 2JJVA 4X6DE 1FAKT 3WIFA 3PWPE 3BW9B 4E0RA 4JKPH 1MFDH 5GJSL 3TVMA 4MA8H 2F54D 4O5LL 1K4DA 3EOTH 2DYPB 4D3CH 5HDQH 5DJ2A 1J05B 5E1HB 4U6HB 4MJIA 1EO8L 4ZOEA 1ES0A 3E6HA 5DGRA 4KDTA 5KZCD 2O61A 4Y5YC 5DTFA 1ZT4A 1GGUA 3MLYH 2W60A 1S78C 3FRUA 4BUGA 4OZGE 4XC3H 4JCMA 4KVNH 4EN3B 4M62H 2J88H 4HHAA 5TH2A 1T1WB 1KACB 2DJSA 3M17A 2R1WB 4RZCB 1JGDB 5FGCE 4HUMB 4OFDA 3IJYA 5EZJA 1ZS8A 1OGAE 1PVHA 3IU4H 2WLZA 4HT1H 4LCIL 3T4YA 1I8KB 2AEPH 3F7VB 2HFGL 1BFVL 3EYFB 4BQ6A 4DGVL 3V6ZB 3FRPG 4GRWH 5HHXL 1OB1A 1T1YB 2FBJH 3ZLQC 2BNQE 2XZAH 3K2UH 4R2GC 4RAHA 2X4NB 3HMWL 3BWAA 1IBGH 3VFRB 1HWGB 2FJFB 1NFKA 5F9OL 1B2WL 4HZLA 1U3HA 2B20A 3QIUB 1NAKH 2NY2D 5F3BB 2NXYC 3OKEB 4KJQD 5JW4N 1EAJA 5HYEA 4TUKH 1KEGL 2FO1A 1D6EB 4KVCL 1A7OH 4I8DA 2OJEA 5C0BA 3JTSB 4N0RA 1N7MH 4KQ3H 3UZEA 4OZFG 1F2XK 4S1QL 5JOFB 5MEOA 4DZ8A 4K94H 3A67L 3BQUD 5TDOA 3NGBC 5BJTA 4N8VB 4OCLC 2VXQH 3VXUD 4HCRH 1L6ZA 3MV7B 4NZUH 2QR0B 1H3GA 4H8WH 3QI9B 2VDRH 3FHAA 3O2WH 5D7KD 4RMUA 3VA2C 4Q9RL 5HI5D 4GXUN 3RI5F 5JXAL 5I8EB 2ENSA 3C08H 1KG0B 4G80B 4P9MH 4K7FA 1B4JH 2L7UA 3BP7B 5A2KH 3L5XH 2RGSA 3MNVB 5DJZB 4LP4A 3DHJA 1H8NA 2E5EA 2FCBA 4RA0C 2QADD 4NKIH 3NA9L 5C0GA 1NH6A 3P40A 3RKDD 5GS0D 3SKMB 2PCPB 1EGJL 1RJZB 2VAJA 4UILH 3RJDA 1ZVSA 1Q9OA 4ZUSA 4WGVB 5CSBA 3MLRH 2R69L 3IF1B 1SJEA 4JM2C 3TBVB 1OL0A 1QVOB 3V6OE 3DSFH 1U92A 1MIML 3MLZL 2APVA 3P9LA 1G9EA 3QBTB 3AU1A 1J8HB 5FGCB 3HAEA 4YDKL 1J0ZA 4ETQB 4HT1L 4NOFA 2MHAA 4U1HB 5D1ZD 5FKAB 5ITBL 3VG0H 4XCCH 5C07E 3I6GB 1BIHA 3HUJA 1DQJB 2EYRB 2EXWC 1QBLH 3DPBA 4KROB 5C0IB 3MRLA 5I18L 2ZWLT 5INCB 1TLKA 1ZT1A 4MNQD 5IQ9A 3GSUB 2ZCHH 4GRLC 1F90H 5F7DA 1MCNA 5EU6E 5E6ZA 4CDHA 1XT5A 1WF5A 5JW4Q 1DQDH 2XZQH 1XF4A 3EGSA 1FFNB 1I1AD 1B0RB 5DK2A 3DXAD 4F7EA 4JGMA 3GMOB 1AJ7H 1I3RB 1WBXA 3BDXA 3Q0HA 4ZFOA 2GCYB 4R7DB 2XN9B 3DV6A 1LE9A 2WBJB 1JPGB 2H9GA 2HT3C 4LF3A 4QRPD 4RGOL 3RFZC 4OUOA 4QRPE 4WHYH 1H9VA 4WY7L 3KGRA 7FABH 4UU9A 1ND0B 3L3JB 4K3GA 1PGRB 2HP4A 5IW3A 2IFGA 3WFHB 1DBMH 4LAJH 1NC2B 5ISZE 4ALAH 5GPRA 3BP5A 3VGHA 1IEHA 2PW1A 5IVXA 5KVMC 5L7XH 4W6XB 2Z31A 4F80A 1ROWA 2APFA 4LLUA 2CRZA 5JDSA 5EIVA 3NCYS 3AMKA 5K9KA 1BFOB 4AEIL 4YXHH 1C08B 4QF1A 1NC4A 2ITDB 4Y16B 5E9DB 4RMWA 1P6FA 2H1PL 2EDKA 2YXFA 5TDPA 1P4IH 2ADIA 4ZO9A 3O45B 5I66A 1NGXB 1IC5H 5TE4L 3QHFH 5BRZB 5E4EB 3ULUD 1WZMA 4H0GA 2VLRB 5AZEL 3TBYA 1HH6A 4PGJA 5D7JA 4KTDH 2DIAA 5SV3A 4FABL 2MTPA 3DMMA 4RGNE 4QYOB 3BP4A 1TTFA 2P1YA 3KPRE 1RZFH 1KLGB 1UB6A 1U6AH 3ARBA 5L2KA 4OCRL 3DMMD 3RHWF 6FABH 1SBSL 3QUYC 1I1YB 1LDSA 2P4AB 2Q6WB 5TGBA 3B9KD 1QHPA 3CLFH 4K8RH 3ARDD 3VXSE 5C0AD 2VXTH 3EDFA 4L1DA 1N0XL 3O6FD 1RHHB 4HLZH 5DZOA 5B3NA 5L2KD 4I1NB 3B8SA 3U30C 2GTZB 1VERA 1T4KB 4PR5B 1DDHB 4M43L 5C3TA 5C08D 2NY6B 1KEML 5KN5A 4HG4J 5H8DA 5IB3B 4L4VB 1RZIB 3PGFH 5ERWA 2K9UA 3GMMA 1MAML 1NGZB 4ZAKC 1KYOK 3DRTA 4HIIA 3FB8A 4MA7L 4HUKB 1MLBB 5DMGD 4IMKC 3RVUC 1GGYA 1FGNH 2EH8L 4X7TA 5JNYA 4ZNEE 5T1MA 3VH8A 2E9BA 5DMJB 5DT1H 5FGRA 5F44A 2Q86A 3WE6B 1HCFX 1WK0A 3QUXD 4HWEH 2Z0BA 5BS0B 4HGWB 3BJLA 4HC1H 4YDLB 1CL7L 4KUCD 5I6XB 1T03L 3L95A 3D25B 4GG8B 4M1CC 3SE8H 4YDJB 3MBXH 2APWA 1S3KL 2DQFB 5FA3A 4PRDA 2VLJD 3HNTH 4X6BA 3TO4C 3EYUH 4XBPA 1EXUB 3CDGB 3NAAL 2MCG1 1DQML 2FJGB 3MQIA 1G9MH 5GGQH 3CFDB 3REVA 2C3WA 2H32B 1HXYA 2VLJA 2OQJA 2XFXB 1CICC 3EOYG 1U8PA 3EFFB 5E5UB 2OYPA 1LK2B 4HKBA 1HQ4A 3S98A 2QSVA 3FT2B 3MRNB 4I13B 5ID1A 5DK0B 2J3SA 3CVHL 1NCDL 5F1IB 2FATH 3LZFH 3PG2A 1MCOL 2WM0A 4OD2B 5D7SH 4CU8A 4L3EA 4Y4FD 2QQKL 4Y2DC 3LY6A 1MHCB 2A9ML 5K93A 1P69B 5C0DB 4L4TD 2Z91A 3PL6C 5EC1A 3B6SB 4FXGB 2Z4QB 4PUBL 4B5EA 3C2AL 3QO0B 5TQ2H 2VUOA 1WAAE 4QT5A 4P5TD 4Y2DB 2D7MA 4LASL 3OGCA 3FT4A 1JGEB 4F58L 4ZFZB 3AXLA 1G6VK 4Q2ZB 2MQCA 1J1OL 3QDJA 1PW3A 2IANE 1U42A 1T89C 1MHPH 4XP1L 4RAVA 5FXCH 4OIIL 2AQ2A 4RIRB 1H0DA 1JCKA 3ZKSD 2QHLA 1A6TB 3U46B 1PD6A 3RPIA 3JV0A 4PJ9D 2AKRB 2OSLA 4W81A 1JHTB 4RFOL 2N7AA 4LPCA 4WUUD 3AVEA 1REIA 3KLDA 1F3JB 4GT7A 3GMPB 2GUOB 5LBSL 1UM6H 3EYVB 4X9FA 1CDYA 3UAJC 3HRZB 3ILQD 5KBNC 2CH8A 3X13A 3EKCA 3ARFC 1NCWH 4ZUUA 1ETZA 4S2SA 5D2LA 3PWVB 3B9KC 3JTSA 1CE6B 3X14B 3OKLB 3CC5A 3HTLX 5C6TL 1S9XB 3ZHKA 1QA9B 2DL9A 2Z9TA 1INQB 3ILPB 4FFVD 5CJ5A 1J8KA 4OLEA 3X11A 4M6OL 4YH6A 4NSKB 4Y8DC 2BERA 3MNZA 5CUSH 3SE3C 2RFXA 2I25N 4Z5RB 2EIZA 4PJIA 3HPLB 4WW2B 4P46B 2XXCB 1KPRB 5FECA 1DBAL 2VISB 4L3ED 1YNLL 5D7LB 4YXLL 5GS0L 3EHBD 4RFNC 4WHCA 2ARJA 4HGMA 4XGZB 4LLAA 4DUXA 1NGYA 2O5XH 5HHMB 3KYNA 4FP8H 3D85B 3V5KA 3FKUS 5ESVA 4Z76A 1OSPL 4QHUB 3C2AH 4X9HA 4JKPL 5FYKE 3W39B 2FHFA 2YPKB 2DIBA 3CDFA 3IFOB 5B39A 4PJGB 3QDJD 5ADPL 3WNLA 3QDJE 2CR3A 4Z8FL 5BCAA 2APBA 1YQVH 5IM7A 5FDWB 1C16A 2ZUTA 4F7PA 5DRNA 4XP5H 4BSJA 4TUJB 5BXFA 4M02A 1FLTX 1LEGB 5M95B 1T0PB 4ZS7L 1T4KA 2AJYH 5DJCB 4HWZB 1FNFA 3C08L 4G5ZL 5BO1L 2V5MA 1FH5L 1T1XB 3ARGB 4TVPE 4MCYB 2R56L 3GI8L 3HI5H 4CVZB 3SDAA 3QT2A 3D39B 2B5IC 4BK5A 2J6EH 5CZXC 4CW1A 1FLRL 4G8IB 5HPMB 5IHZB 5ALCL 5D2NE 3VXRD 3GSRA 1YJDH 4BZ2L 4LLVB 4X83A 5IEHB 2AXGB 5D5MB 3BUTA 3WSQL 4G3YH 1FH5H 3RVTD 1I3RA 1OHQA 3K0WA 3VFUA 4J12A 4M5YH 1M4KA 4X4XB 1NDGA 3H7BA 1FL6A 4K3JH 5FO7B 5D93B 3IDUA 4GSDH 2P8PA 1FV1B 1QSFB 2F15A 43CAB 3QDGE 1AD9A 1N7ML 4JFOB 1Z0NA 4JM2A 5D7IE 4JFFB 1CLOL 4U49A 2QKIB 1WT5A 3KLAA 3PGFL 3S3PA 3QQNA 4LCCA 5F1NA 1KN2L 2IH3B 3SE4A 5IF0B 1R3JB 4RMRA 2DOCA 4JRXA 2WBKA 3CXHK 3WHXA 4ZD3H 3KAAA 5TPWH 3AAZA 5FKPB 1FYHB 2X4RA 3G5YA 4LFHG 4D9LH 4ONOA 3NABH 2X1OA 5T3XD 5KVGH 1KIRB 4JFDB 4HX1B 4ODSH 4M5YL 3PQYD 5GRZA 2BRRH 6FABL 4WUKH 1IL1A 2FH6A 4YHIA 1FNAA 3B43A 5F9WC 2Q8AL 3TVMC 4MWFB 2C1OA 4ERSH 2Z4QA 2EYSB 2HVJA 4NRYA 3O6LL 4WIQA 1J1XH 2FSEA 4W70A 5C6TH 1KJMA 2R4RL 4G9DA 1G7PA 5EO1B 1AXSB 1EX0A 4N8PA 5DZLA 5DJAA 1MHEB 3WL9A 4ZG1A 3AXLB 4LSTL 1UXWA 3QO1A 5EBWB 4D0DA 1FO0B 2BDNL 3RWCB 3WN5C 3QPQD 3L6FA 4XPHL 3G6DH 1ZOXA 4MD5A 1VKXA 4ODHH 3VMPA 2IF7A 3SE4C 1LNUA 1WCBB 2X6MA 4RAVB 4KKNA 3G08B 5GGSA 4RIRA 5DD0L 2HJKA 2W0LA 1IAIM 1KCVH 1WCQA 3THML 4OF6A 1RV6X 4Z7UB 1LEKA 3W0WA 5GGRA 2CKBH 32C2A 1I9JL 1JI2A 4JZOB 4XVJL 5C09B 5C7XH 4FZEL 1Q94B 2DDQH 4CVXB 4Y4KC 1Q0YL 1G7HA 4YR6B 3D9AL 3HG1B 3JWDC 5GGTH 1DTUA 3VGAC 4WY7H 5FHAL 4MQ7A 1LEIA 4FN0A 1Q0XL 4X7TB 4IHOB 2F54B 3BZ4B 3WHE1 1YEFL 4YGVA 3OJDA 4LAQH 1T1WA 3DXAA 3MJ9H 1UKTA 2CSPA 1FORH 4TQEL 4K8RL 3ARSA 2IWGA 1F02I 4U0QB 5JOEA 5IR1B 4P3CL 4M5ZH 4L8BB 5ITBH 1VFAB 4K2UL 3VI3F 1O5DT 2CJUL 2NX5B 2J8UE 2AXHA 3VFVA 1RIHL 1RUAL 1QSZA 1EHNA 1U8HA 2UV3A 3DVIA 2DKSA 2D31B 5TE4H 1N8ZB 25C8L 3ARED 5FM5M 4NQSB 3MCG1 1K8IB 1MFAH 2H26B 3D5OF 2FIKB 4GAJH 1U8KA 2WUBH 1TQCB 2A38A 3EJZD 2OR7A 4N1CA 3FT2A 5SWZB 3NACH 4GLRH 4JZJB 4NRXA 1P1ZB 1WTLA 2GK0A 1HH9B 3UP1A 3LEVH 5E6ID 3QIBC 1S7XA 3MZTA 3G04A 5ELIA 4IJ3C 1G0XA 2CIKB 3GMQA 4LQ1A 5D6DA 2R8SL 4XCNB 5MENE 4MZ2A 2LQRA 5BQ7A 2DWDA 3B4NA 4X80L 4Q97A 1CFQA 3SE8L 1C16B 1IAOA 3VXUB 5A40E 4E41A 3P4OA 5TF1L 4EVNA 5JXED 5IB4A 4EXKA 2EEAA 1TZHB 4QRUB 5I15H 3RY5A 3STZA 4EEEA 2P5EE 2VR4A 4I4WB 2CK0H 3RZCA 5HVHC 4M8QA 5FYLH 2ZNWA 5JR1H 2BY3A 1DUYA 1N4XL 1NDMA 4YHLL 4MA7H 1U58B 3MTRA 5AD0A 1F11B 1QRNA 1L6XA 5JW3L 1P5UA 3N1PC 3WS6A 4MVBC 2C3GA 4IOFD 3LRSA 2Q8AH 4EZMA 4TUOB 1R24A 4I3RL 1NCNA 4FMFA 1MVFA 3P0VL 5I17B 4PRAB 4J7RA 5DK3A 2W0FA 1A3RH 3IAGC 4M7LL 4P5TA 2NY2B 3QIUD 1VFBA 5DJ8A 4LSPH 4GQ9H 2OMNA 4PRPD 1UM4L 2ZG1A 4UV4L 1IGJB 2A74B 3CC5B 2OL3A 3U7YL 5EWIL 4LMQI 5F7WC 1JWMA 3BKYH 3LB6D 1FDLL 3CFCH 5DK2B 1HK6A 3IXTA 3EYOA 2NXZB 5CSZB 5DHXB 3HPLA 2R9HC 1ZEAH 3O2VL 3WIIH 1RIUH 4JB9L 4PJ8A 3QDMD 2EDLA 2XN9A 2VE6A 4B7IA 5EORH 5E99L 1RUMH 1UQSA 1XGUB 5K9OA 4PFEA 2F53D 3VXME 3NFPA 2P48B 3C2SA 4EJ1C 5J8OA 2XN9D 3V5KB 3UPRB 1QBAA 2ZUYA 1W8OA 2IANB 5IQ7H 5ICYB 4PLNC 4QHUA 5BVJB 4PJCA 3Q5TA 3HI6L 3KR3L 2NR6D 3W39A 1KN4H 4BELD 3WYRA 2IEPA 2FSEB 5EULV 4G5ZH 1ODAA 4RQQA 4HJJL 3FO9A 4MX7B 4KV5F 5I76A 3OV6A 1XZ0B 4NNXB 1BD2D 5ILTL 4ELKA 2B4CH 1FO0A 1NAMH 4UIKH 5I1HL 3CUPB 5AG8A 3RTQA 4F9PA 3GMNB 1Q9OB 4YHMH 4NFCA 1BX2B 2GK2A 4M61A 1HHGB 1BLNA 5IVZB 3AREC 1INEH 2FZ3B 1IC4H 5DJXA 1CN4A 4BSWB 5I74B 5ICZA 5EBLA 1TJGH 4I0PB 3HAEB 4P23D 1PZUB 3A6BH 2YD1A 4ZOCA 5D71L 2XY1A 4MNQB 3F6IA 2R0KH 3DX8B 3DGCR 2OI9B 1G9NL 4M03A 5ALBL 1AE6H 1HNGA 3NCCB 1O7SA 2GYSA 1A6UH 1IAKB 2CRMA 4QWWC 5JIPA 1WBYB 2AXGA 2WUCL 2W60B 3QNXB 4NT6A 4H88H 4G8GA 2GITA 2NLJB 1U8MA 2P43B 2B4CC 1MUJA 3ET9F 3ME0A 3WJLA 1BPVA 1K4DB 2KUTA 1RI8A 3O6FB 3MLVL 4ORGB 4KKLD 3QNYB 3O4LD 3GKWH 5MEQB 3M1BB 4JFFA 1IEAB 3WV0A 4G43A 4ORZC 3MRCA 1XGYH 4ODSL 1OB1B 4N8CL 3FB8B 2A77L 2AP2A 4KY1H 2Z92B 4F15C 5JHDE 3MCKB 1R3HB 1F4XL 1TFHA 3U4AA 5HHOD 4L4VD 2FD6H 2MKWA 3WHXB 3IJYB 2FBOJ 3OKEA 3VH8B 5T5FH 5HI5C 1FVDB 1JNHB 3ZE0E 5EOQL 4LNRA 4WENB 3PHOA 1JWSB 4YDIL 4NM4H 4AM0B 1WQVT 1PG7H 4GBXD 3UCRA 2YUZA 3OB8A 4LIQH 4O9HH 1AR1C 3KDMA 2ICES 1U8LA 4J3UA 3BP6B 1C08A 5F3BA 1VADA 3WFDH 2Q8BL 4YHNA 4K9EH 4A2MA 3O8XB 2EYSA 3PWJB 4XHJD 1SYSB 4Q0XH 5CKGA 5F9AC 3A6CL 4U1GC 4GAGL 3S36H 1E4XL 1MH5B 2BVOA 1JL8A 3LB6C 1INDH 1U0QA 3MV7A 4Z7UF 1LO2H 4TOYL 3SDXA 4X6CF 5GRVK 5FYLL 2AJYL 4XVUD 4FQCL 2AERT 3ARDB 3WFEH 3T1WA 1FFPB 4AEHH 5EU6A 1CFSB 2P5WD 5KG9B 4QRRD 3CNKA 4I18A 4NYLA 3EYQD 3MNVA 4QRRE 1JRHH 1GGCH 4XXCA 5E8DL 3W0WB 1DBKH 4JO3H 1JMZA 3LS4L 4RGNB 5C08B 2NY6D 4L3CB 4OLWL 2XNAB 1RJLB 4DN4H 1G7MB 5ACZA 3DHMA 2XIDA 1JYNA 2AK4E 4DGVH 4JRYB 1EH9A 2A77H 2BOBA 5D6CB 4L4VA 3KLSA 4LHUG 3P73A 2C7UB 4ODXB 3ORJA 3D2UB 1ADQA 3DRTB 5CINL 4LHUD 1IAMA 3HZYB 4L1HA 3IDXH 4XNMB 2J8UF 3UTSD 5CSZA 2DYPA 35C8L 4JFPB 2R2EA 3AY4C 4U6HA 5EUOA 1JWUA 1IGFL 1VA9A 3JUZA 5L8LB 1HHKB 4FMKA 2VE6B 2AS5M 1N2RA 1IGYB 5E8EB 2DQTH 3F5WA 3I50H 1DE4B 2AJXH 2WBJA 3PQYA 2VLLB 1N8ZA 3MOAL 1HYSD 3RHWK 4PJIF 5BO1H 1TTUA 1ND0A 3GM0A 1U2CA 4NN6C 2BK8A 3IGAA 3UROR 1U2HA 1S9XA 2JIXA 1WBXB 3K1DA 5IEKB 3X11B 2IPUK 2SEBA 3VXRE 1FGNL 4U6XA 5IVXB 4ZFOB 4DCQB 1CBVH 2RFXB 5E2VL 4KJYB 3SKOA 3SGJA 4LBEA 5D96C 5EC2B 4OZIE 5JZ7D 1RZKC 4QF1B 4NKDB 1RJCA 5CJXC 2HVKB 2YZ1A 4U7SA 3WFBH 4RMVA 4PJIE 4FQJL 3LEYH 1X4YA 3DMMC 4GQPH 1G6RA 1ZT7A 4Y0GA 5C0DA 2FEDD 1CTNA 3TV3H 3VGFA 1GGTA 3KPLB 1KN4L 3UZVB 1X6NA 1GPOL 4XP4H 4DGYL 2VLKA 3QR2A 1OGAA 5KVFL 3NPSB 3BP4B 4I3GA 2FX9H 1MAKA 1KLGA 3MRHB 5DRWB 2ADFH 4N0UB 1F58L 4HKXA 1AIFB 2CLVB 1KG0A 4G80A 4J8RA 4YBLB 1HHJA 1OGAD 4PBXA 1YQ2A 4M9PA 2CXKA 4MNHA 5EN2A 4CVWA 3TPUB 3QDJB 4K23H 3EO0A 4MCZA 2H8PA 2WQRA 4ZAKD 3MODH 3BPNB 1U8MB 3DRQB 2AQ3A 2X4UB 1HCVA 3NZ8B 3UXFA 1OF2A 4NQDE 1FE8H 1BVLB 5CP3H 3OG6B 1CT8B 2G5BB 4ZAKA 3WNPA 1V05A 2RJMA 4A6YB 1Z5LA 3RIAF 2YD8A 2R0ZH 1BF2A 3VXMA 2X7LA 3K4AA 1YEIL 1UCTA 4W4OC 2VZUA 1NGZA 3AU1B 3BD5A 3W11C 4FQCH 4HQQH 1ZHBA 1XF1A 1MF2H 4G6AC 2FEEL 5DC9B 1AKJD 4NN7C 1X5AA 2Y36H 3OXSA 3KPOA 5ANMB 2UZIL 4PGBA 2GSIA 1L0YA 1UH2A 4GRWB 3MV8E 2ICWI 4TSBL 5DYOB 3VD3A 3GIVB 1RUKL 4EI5A 2IH1A 2J8UA 2K7QA 3MNZB 3V6OC 3VFNB 1A7QH 1A4KA 4NDMA 1NBQA 2CLZB 2NY0D 1VADB 4G8GE 1C5BH 4LSVL 5FECB 4O51B 2X4NA 5DD5H 2DQFA 1IM3A 3R1GL 4GMTH 4HMDA 2HFFA 1EXUA 3CDGA 4HCRL 1R3JA 1FN4A 4RQQB 3CFIC 1RU9L 3CFDA 5BS0A 1C7SA 3EO1B 2R29L 1ZTXH 2EH8H 2DD8H 1QBMH 1LO5A 1HQ4B 5D7JD 5F96H 4X5LA 1RIUL 2B7DT 2F8OA 3FQUB 1F3DJ 4YEEA 5F1IA 4KQ4H 4YHKL 1DUZB 1N5AA 3W0WE 4TNWF 4U6TA 2C26A 4PP1C 5C0JB 2FJGA 4LRNL 1RK0A 4GRWF 5IVZA 3WDJA 2YMXL 4AG4L 3WIHH 5CEYA 3F12A 5JDSB 5CJQH 3BH9A 3QG7L 2R1XA 4Q58C 4NRYB 4AENB 3KYMB 3U48A 3TYGL 5FGBA 2Y4SA