2FATH

An anti-urokinase plasminogen activator receptor (upar) antibody: crystal structure and binding epitope
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
GVKLQQSGPEVVKPGASVKISCKASGYSFTNFYIHWVKQRPGQGLEWIGWIFHGSDNTEYNEKFKDKATLTADTSSSTAYMQLSSLTSEDSAVYFCARWGPHWYFDVWGQGTTVTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIAAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anti-urokinase plasminogen activator receptor (uPAR) antibody: crystal structure and binding epitope
pubmed doi rcsb
molecule keywords FAB ATN-615, light chain
molecule tags Immune system
total genus 44
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatH02
1S9XA 2EYSA 1FSKC 3FZUD 4M1GL 3MRRB 1U8QA 5L8KB 5C86A 5DGRA 2M2DA 1C16A 1RIUH 3DI3B 4BZ1L 1GRWA 1IGYA 3V5HA 1K8IA 5HSFA 4JFXA 1F3DJ 1YEHH 1FYHB 3KJ4B 4I13B 3RVWD 1V3MA 2D3VA 3WJJC 2AABH 1BREA 2R4SH 1HYSD 2ZKHH 4QTIH 2MHAB 4NFDA 2YC1A 1N6QL 1DBJH 3IYLW 1OY3B 3CVHL 4ORGB 1KCLA 2F74B 5F6HI 1W0WB 4R2GB 3PNWB 4MQ7A 1A6UH 4E42B 3GSNL 3T4AA 4OGAC 4G5ZL 4NWUH 2H1PL 2VZOA 4TVPH 4ETQA 4YAQA 4EN3D 1J1OL 3GKWL 1R5IB 3AGVA 1MRFH 4ONOA 5DJAB 1S9XB 1K5NA 1EJ6A 4APQD 1IC5H 1JWMB 1FL6A 3BPNB 3GMNA 3LIZL 2V5MA 4JFDE 4P23B 1KB5B 4JVUA 3UPRA 3IU4H 2K9UA 1KEGH 1SY6A 1T89C 1CLZL 5FA3A 1NMBL 3GI9L 2H45A 3MODH 4X7DC 2UWEF 5FGCE 1IGYB 3V5HB 1K4DA 1K8IB 4JFXB 2X1WL 5IFJA 4OT1H 2IQ9H 4D8PB 1L9NA 1A21A 2M26A 2Q20A 4WO4B 2DQTL 1IGFH 1HKFA 1E4XH 4JFOB 4BK4A 2DQCH 3IU3B 4N8CL 1FZKB 1F11A 4MQ7B 5DC4B 3T4AB 2JIXB 2ADIA 4L3EE 3WUWA 2XN9A 4M02A 5ESQA 5MEPA 2Z35A 4QOKD 4C57C 1K5NB 4I0PC 3BPOC 1HHGA 1FL6B 3T8XB 5CP3A 2BVUA 4AENA 1FLRH 3LB6C 1EAJA 2NZ9D 3PV7A 4LARH 3UO1L 1AJ7L 4GW5A 1WBZB 1T21A 3CUPB 5C08A 2Q8AH 2VDLL 1K4DB 4LSUL 2A0LC 4Y4HD 4MA3A 5EZLA 3QDJB 5HYIA 3MZGB 4L8DA 3SGJA 2Q87A 4DKAA 3WFHA 4IIQA 5HDBF 1FSKB 4M48H 3V7MA 5EORH 1FYTE 5FK9B 1JHTA 4Y5XC 3ZTNH 5CGMA 1K9TA 3EYUH 3RKDC 1MSPA 1A2YA 4I2XE 1CLOH 2GJZB 2LTQC 4P2QE 5H2BA 3EBAA 2QLVB 3E1F1 1TTFA 3CFCH 3PGDB 5DUMH 3EZJB 5BS0E 1DEDA 5KSBB 1FVDA 2OTUB 3GSOB 3OX8B 2Z35B 1QHOA 3T0EE 2UZXB 2E7LC 3MRLA 1MRDL 4LSSL 2F53A 3MGOB 3EYFA 5ID1A 1XCQA 4AENB 3SGDI 3BN9D 4GMSL 1N6VA 4GW5B 4CVWA 5GSRB 1T21B 2AW2A 1H3VA 1QFWM 5C08B 1JTOA 1S7XA 2V9RA 1RURH 2B1AH 3I2CL 3MOQA 2YA1A 2HFFA 1H15B 4MS8D 2DYPA 3VCLB 2CSPA 5EZOH 3RWDB 1O5DT 3VFSA 3VXRE 4AM0A 1UXSA 1JHTB 4ZXBA 1MCRA 4OLUH 2J8HA 3C9NA 1A6TA 3H9SB 4X5WA 4OFYD 1RULL 1YPZE 1OTSD 1NMAL 1FVDB 4TUOA 2W9DL 3N50A 1XAUA 4KROD 3MRLB 2F53B 1ZA3A 2JK5A 2IPUK 5ELIA 2EDRA 5ADPH 3ZDYE 3MGTB 3QDAA 4G9FE 1AP2A 1TJIL 3BPCA 3OZ9L 3SGKC 4KWUA 3PL6A 4R0LA 1NCWH 4JCMA 4GLRH 1S7XB 1F8TH 3QISA 5D1ZC 3K8KA 4YDVA 1YECL 4GAJH 2GAZA 4G7YH 4YXKH 4CVUA 5C0BA 3FO0H 1CR9H 2DYPB 1ZMYA 3MRJA 1AD9A 5FYKD 1JGLH 4I0PB 4AM0B 2PN5A 2ZWLT 2I24N 3BPOB 5GGSB 4ZXBB 1T7WA 3BKMH 2JB6A 3C9NB 3OXRA 1A6TB 1F13A 4QRRE 4XWGH 1J86A 5GZND 3IDMA 1Q0XL 3P9MB 1SBSH 4NQSA 1UWGL 5DMJB 1YY9C 1GXEA 2GY5A 3F5WB 5D1XD 4YDIL 5TF1L 3EDKA 1CXKA 2JK5B 3L5XH 2IADB 5T3ZL 1BQLL 2ZUQC 1FGVL 1N0XH 1DUZB 2V9TA 4MVBD 3UTSA 4YHML 1T6VN 4ZFGH 3CGTA 3UPAA 2EKJA 4KKNA 3HS0A 3PL6B 3BDXA 4KJQD 4Y5XB 2HYMA 1H3TA 2IPTH 3QQ3B 2WBKA 4YDVB 1UGNA 3RA7H 5FHBH 2D0HA 1VACA 3SDDC 4YO0A 1TENA 3JWOC 3QRGH 5C0BB 4MB4A 3CXHK 3MRJB 4KK8C 4UAOC 2IMMA 1AD9B 3O4OB 1A6ZA 1IARB 4CDGC 5L6YL 2HKFH 3OXRB 1QEWA 5IROA 4XBEL 4PP1D 3B8SA 4L3CA 4EJ1C 2CLRB 4ZOEA 4NQSB 1AI1L 2VKWA 3EYSH 2NMSA 3MLVH 3VXTA 5HHXH 5FO7A 3QUXC 4JDTH 2D9QB 25C8H 1DQDL 5E8OB 3G9AB 2BNQD 2YPLD 3LRSA 1E6JH 5IIEA 5FGBC 2XTJC 3L5WA 4GXUN 4D9RE 4DFIA 3MV9E 12E8L 4LPTA 5K9QI 1TVDA 3VD5A 5HYEA 2A9MH 2BERA 4PRPB 2IBBA 4M6NH 5KANI 3SCMC 5EULV 2W60B 1CDCA 1OHQA 1KCVH 3CLEL 4MJ4A 5IQ7H 4FQCL 5K9KB 1PGRB 4EI6A 3ARWA 4E5XB 1G7PA 3CD4A 3D39D 1A6ZB 4OD1L 4CU6A 1BWWA 5CSZB 3ARFC 2X1PA 4MJ2A 3PP3K 3G6JA 1DLHB 4M7KH 1NLBL 5DMYA 5D7SL 5FO7B 3NZHL 3EOTL 1NKRA 2F19L 5BVJB 3LRSB 5TGBB 5GIRB 5IIEB 1RJCA 2EDDA 5DRWA 1FG9C 4MLSA 1U6AL 1HH6A 1YMMA 1P2CA 5DK3A 1RMFL 3QHZL 4OB5H 1FQ9C 2FH8A 5EC2B 2XZQL 4GUPA 4UB0H 3TZVA 3TT1H 3VU2A 2YMXL 5E8EA 5SX4I 1F6LL 2BRQA 1F4XH 1P4BH 1KJVA 3ARYA 3F58H 2B4CH 1D5BB 2ZUQB 4WDIB 1YEIH 4TTDD 1MFCL 1KN2L 1WAAA 4P2OD 4ZS7H 3KPSB 3T2OA 4D0CB 4KPHL 3U30B 2FWOB 3G6JB 3U7YL 3V4VL 1YEFL 3WFDL 4OM1L 1D7FA 4U7KA 3SOBH 2NXYD 3OKLA 2LU4A 3QQ4A 1A4JA 1QNZH 1G6RB 5D70H 4L9LC 2HLFD 4ZNEE 5DRWB 1HH6B 3RNKA 4ZPTB 5I75C 1P2CB 2YRPA 4Y1AE 4M1DL 5K9OA 1KPVA 4PRID 3WIHL 1XGTA 2Z91B 3C08L 4JQXC 3QG6B 1OP3H 2HA1A 4PJFA 2X70B 1YYLH 2E5EA 4KZDL 4WI9A 1CXFA 4ESKA 2Q76A 3QUXB 4NQCE 1B0GA 2VWEE 1CFTB 2VSCA 1O7SA 5TE4L 5CHNA 2X4RB 2CQVA 3WS6A 1BLNB 4HIJA 4JG0H 4U2YA 1LWRA 1H3PH 1NGQL 3IFPA 1R3HA 5DEGA 1JCKA 3OKLB 1XZ0A 2CRYA 3QQ4B 4PRNB 3B9AA 5A3IC 5JW4Q 1P4LA 3DGGA 1QFUL 4UQ3A 3ZSTA 5ALCL 1CGXA 3RX8A 1YC8A 3KJ6L 3O3AA 4XPBH 4ZO9A 5K9OB 1KPVB 1TQBC 3QUMH 4PJEF 4X4MA 2VLMD 1CD1A 5IR1A 3B3IA 4IOSD 2F54E 3FL7A 2UYLA 3WFEH 3DVNA 4O4YL 3GJFK 5IEHA 4KTDH 4FS0A 2CDFB 4MCYA 2P8PA 2Q76B 1P9MC 4K94L 1B0GB 1BD2A 3UTTD 5JW4M 1ZEAL 4TRPH 1G7JA 5CHNB 2F5AL 2KZ1B 2EH7L 2AXFB 4YFEA 3P4MA 3RKPA 4HIEA 2VAJA 4Z7QE 3IFPB 4IM8A 1JWSB 1R3HB 3Q1SL 4LKXA 4XPHH 3WN5C 1W72L 4BFEA 1XZ0B 3L7FA 2QHRL 3QDHA 4OSUH 3VG9C 3V7AE 3LSOA 1M6OA 1U3HD 1P4LB 4DEPB 1DDHA 2YR3A 3DGGB 4UQ3B 3RAJH 5T1KD 4MNGA 5FCSH 3FQRB 2XXMB 3O3AB 5CLWA 3NCEB 5I66A 4F7TA 3LHPH 1J8HA 3NH7L 3V6OE 4LHUD 2VUYA 4XVTH 4X9BA 2VH5H 4R8WL 4UINL 3IFOB 3OKMB 4OCWL 3K8LA 3N06B 1MVFA 4UDTA 4DAGL 4MCYB 3UJIL 4Z6AT 2J6EH 4FQQA 4LLMB 1BD2B 5CILH 1OGTA 3ZLQC 2EIEA 1S7QA 1RZFH 4L9LB 2BNUA 3QDGB 4NQDB 5D1QD 5ACMA 4HIEB 5CSGA 4Y16C 1WZ1L 4LAQH 4YX2L 4LEOB 5KSUA 3LSOB 4I1NB 1I8IA 3ROLA 1HHIA 1DDHB 4NUJA 1JZ4A 3SBWA 1WUNT 4H5SB 4OZ4A 2RBLA 4MNGB 2OS7A 1I1AD 4HWEH 3HB3D 4CMMA 3GRWL 1U92A 5IB3B 2AI0L 5I66B 2GKIA 3IJSA 5SX5K 3RUGE 2DI7A 3C8KB 5GS0D 4YK4C 2HMIC 1T80A 2J4WH 4NP4H 5MHSE 1EHLH 1NCDL 1NUDA 2C3VA 4UDTB 4RZCA 4PGJA 2DN7A 3JZ7A 5HGAA 4FQQB 4AEHL 1A1MB 1A3LH 1GOHA 2UWEA 1OGTB 4LCUA 4Z8FH 1G1CA 4NO0D 4LPCA 5D96C 4M6AA 1D9KD 5C8JA 1CZ8H 1IL1A 3DIFA 4J6RH 2QQKH 3QIWB 4LVOB 4WEBH 1X7QB 4LBEB 4NQEA 4CVXA 4L1DA 1UG9A 3AUVA 1I8IB 1QKZH 3ROLB 1HHIB 1WFNA 4RGOH 4DGIL 4OZ4B 1IQWH 1KULA 4CMMB 4X9FA 3A6BL 1OCWH 4JG1L 5JDSA 3MREB 3TBYA 1R3JA 3HUJE 2DWEA 4PJ8A 4XGZA 2C1OA 4MXWH 4MX7A 1XR8A 2APWA 3WNPA 3FFDA 4QWWC 4BELD 2GQHA 2GSIA 3WN5B 5HGAB 1YEDA 4NC0B 3VD3A 2XWTA 2UWEB 1PG7H 2QSCH 3HAEH 5CZVL 3RL1A 4NZRL 4NQTA 1AO7E 2FD6L 4FMKA 5C8JB 3QYCA 1JGDB 4BYHA 3DIFB 3U1SH 3N1PC 4GRWE 4ODHL 1BFOA 1GL4B 4AMKH 1GIGH 2AGJH 5HTSA 2IAND 3RWGA 3HC0A 5IW6A 4U6XA 3SE3C 4PJHE 3WE6A 1TQCC 4JFHD 4BQ6A 3HPLB 1SYSA 2CJUL 1GVIA 5JDSB 1R3JB 3H9ZA 3OAYK 5BQ7B 3P0GB 4RGMB 4LCCA 2QQLL 2YEZB 4P59H 2FIRT 3QXDA 4HUXA 3S6CA 1XR8B 3HRPA 3MJ9H 4MCZA 3RY5A 4DKFH 5C70A 2GSIB 1I7RB 2DD8H 1QLEH 1I3GH 2J5LC 3RY6A 2EC9U 2XWTB 4F58H 4EDXB 2VLKA 3QUZB 2JELH 5LGHH 1T20A 4XP9H 3SE4C 5IT2H 2Q3ZA 3FO1A 1K3IA 1BFOB 5FO9B 4M1CD 4PJAA 1YUHA 3RZCC 4UTAL 3RWGB 3HC0B 3IS0X 1FBIH 5IW6B 1IC4H 5TDOA 4HFUL 1SEQL 3S97C 4LCYA 2IWGA 2GJ6E 4GBXC 4GRLA 3DBXA 1ZLVK 3O4LE 3ZE1F 1BOYA 3QXDB 1RZJL 5JOFA 1OT1A 3R1GL 5E2VL 1UQSA 4MCZB 1NL0H 3FKUS 3K0WA 1JVKA 2QADC 3EYOB 1ZT4A 1DE4B 2LU7A 2ESVD 3MBEA 5T5FH 3RI5F 2NY4C 3MV8A 1T20B 3MV9D 3V95A 5T33L 1CD8A 2DB8A 2WBJA 3VXSE 1DLFL 4TULL 1U93B 4Y5YA 1A9BB 1BBJB 1N7ML 1ZANL 4PJAB 4W4OC 4JGMA 5T1DH 3QCVL 3D0VA 4OZGE 2H2SD 4Y19A 1N59A 4I48B 1IAIH 4UTBH 5EBWA 1JGVL 2HT4C 1U8HA 3GMMA 2PR4H 3DBXB 5F6IC 2O5ZL 4HGKC 1ZTXL 3SDYH 5J1AB 5JOFB 1UQSB 2DIBA 3QCTH 2AK4D 3CMGA 3R4DA 3BT2H 2ICWJ 4OI8A 4PLJC 3MLUL 3W0WE 1ZT4B 5HYJB 3KG5A 4UBDC 2ICEA 3PWPB 1MHPH 3MV8B 2YD2A 3OG4B 2ZCKH 3MR9A 4NUGL 3INUH 4E41D 4R90H 4Y8AA 2ZCHL 3ORJA 3OTTA 2WBJB 4P0DA 4Y5YB 3FFCE 4P9HL 1DANU 4JGJA 3VWJB 2ORBH 1CICA 3FO9A 4IRZH 2G60L 5BZDA 3ILPA 1M05A 3KS0H 3D0VB 1OL0A 2D7TL 4JRYA 5I8KL 1H3GA 4JO4H 1IZKA 1MFEL 5ECJE 1E27A 4LIQE 2QQNH 3NFPA 4YEFA 3B2VH 5EG6C 4W4NA 1MUJA 3BO8A 3QCUH 3QO1B 1KBGH 1IM3A 1C1EH 5DC0A 5E5UB 2SEBA 1QYGL 2PCPB 2DL2A 4HEME 1X5FA 2Y07H 3MR9B 3QULA 3N0PB 4Q0XH 1OSZA 1QUNA 3HZVB 4NHCL 5FAAA 5LQBH 3DTXA 4GBXB 3DPBA 4JZJA 5DFWH 4Y4FA 5FM5O 4DN4H 3GMPA 5IHUL 2R0ZH 1CICB 2P5WE 3FO9B 4U1KA 4JANA 1NCCH 3BSZL 5HGDB 4LLQB 3ILPB 3LPGA 1JZ3A 1M05B 3LKNA 4JRYB 3ZDZE 3DARA 4HJ0C 2AJYL 3DO3A 4NZTL 1LE5A 1ZSDA 2QADB 1T1WA 1E27B 1EX0A 3C60C 4ODVH 5CP7B 3NFPB 3NN8A 2NY4B 1OT2A 1A6AB 3BO8B 3BFOA 3T3ME 5C0AB 1QFWL 2FX8L 3IGAA 3HLAA 4JN1L 4D9LL 4JZNB 4YHLH 4ORZC 3RX7A 4HMEA 1QVOA 3ESUF 1EO5A 4O5LL 4L4VE 5M94B 2BVEA 5K9QG 3PV6A 1NGZA 43CAA 1JMXA 5E08L 1OSZB 3HA0A 5KANG 4M6MH 1IZJA 2EDYA 1AY1H 4JZJB 2OK0L 4Y4FB 4PV9A 2EEBA 5F6IB 4WTZG 4YJZL 2NY6C 4TNVF 2V2WA 1K2DA 2AXHA 4B0MM 4YZFE 2G2RB 4R26H 2OI9C 1LE5B 1ZSDB 2B20A 1T1WB 3AY4A 3GBNL 4KDTA 3NN8B 3F62A 4PTUB 2YUWA 3RHWK 5EOTA 4GQ9H 1UYWL 3KXFD 2CGRH 3IGAB 1MI5A 2FATL 2IEPA 4FQXA 3ZYJA 5B8CA 2CUMA 4WFGE 1QVOB 1AGCA 1TZGH 3PV6B 4JM2A 1S7VA 2NNAA 3G6DH 5E7FA 43CAB 1TPXC 3QPXH 4WVRA 2NW3A 1EXUA 1FLTX 3QIUA 1HILA 2Q8BL 3O11A 1YQVL 3ZKXB 3DO7B 4PV9B 1IGCH 5FGSA 4RWYL 4FQ2H 4J12A 1LDSA 1K2DB 1S3KH 2PYEA 3EO1B 3WFZA 1FHGA 5A2KH 1HK6A 2WUBH 4A6YH 5I19L 1K3ZA 5F89A 3ARGB 1ETZA 4GSDH 5IM7A 4MDJA 1R3IH 4NZUL 1QFPA 3LKPB 1AFVH 3QUYD 2JCCA 5EOTB 2MCG1 4PJ5E 4V2CB 2DM4A 1UB6A 2W9LA 3AVEA 3MRKA 3S37H 3KPRE 1RK1A 1ADQA 4IOFD 5C0JA 1FAIH 1OTUC 2MCPH 2XWBA 4NT6A 2BK8A 2A38A 3MXWH 3V6ZB 4XCCH 1A22B 1AGCB 2RFXA 1LILA 4HT1L 2P8LB 2NNAB 2FEDC 5JZ7D 3EDEA 1P53A 3VJ6B 4XBGB 1EEQA 2HP4A 3QIUB 3I6GA 3OGCA 1E4WH 3C60B 4C56E 4ZTOL 4LOUD 2DQFA 1H5BA 4JPIA 3WKNA 2IQAB 4FTVE 3O2WH 1X5LA 1FORH 1R6VA 2E3VA 2YBRB 4EN3A 1A7OH 2PYEB 1U8PB 4NNYA 4XVSH 4APQA 5F89B 3RRQA 4L8CB 5F7KC 3WFCL 5MI0C 5I6XB 5IM7B 4X4YA 4X9HA 5DK2A 4RQQB 4TOYL 3BAEH 2DBLH 1PAMA 3S35H 4KVCH 1EFXD 3MRKB 4QRPA 2O93L 4EBQL 5IJKC 1IE5A 4DGVL 2E27L 4OQTL 1NH6A 4XHJC 2XWBB 4L4TE 4HCRH 2MPAH 3ILQC 1XCTA 2NX5D 2RFXB 4XMPH 3RBGA 4PJEB 5CKGA 3U9PH 3Q5OA 5ERWB 5ANME 1I8LC 1KIRA 5HI3D 3WXVL 3MRIA 4UU9A 1LO3H 4KUCD 4KVNL 1OWRM 4N5UA 6FABH 5ICZB 1KJ2A 2Z4QB 5EIVA 1WICA 3S36H 5FYJL 3EFDH 3O6ML 1NGPH 1MCCA 4APQB 4PJDF 1RZ7L 5CINH 4X4YB 1D3CA 5KVEH 5DK2B 2CIKB 5T3XD 1BM3H 1FRGL 3EJYD 1RJLA 1B4JL 5F7MC 2LAGB 5FHAH 4QRUA 4HKXA 5J12C 3RWFA 4G3YL 4KY1L 2BVPB 2CLVA 5ITFB 3W39B 2CKBB 4YQXL 5CJBA 2DJSA 4Y4HA 4H1LG 4HS8L 3TFKC 1S7TA 1MRCL 4XP5H 4FFVC 3JVGC 3OKDA 1FVCB 1ACYL 4S1RL 1F2QA 3DRQB 1FGNH 2V2XA 4UU9B 2VDQL 2IPKB 2CO6B 4X6EA 4Z7UE 5C1MB 4BZ1H 1A8JH 1KJ2B 3A0OA 1JNNL 5E1AB 3E8UL 1XF4B 5I8OL 3FB8A 5IESL 4YEEA 5C9JA 4QOKB 2AQ2A 5EUKA 3D3VE 3PG2A 4X8JA 3P3YA 1RJZA 4XTRD 3QPQC 4U1SB 4V1DE 2DQJL 4LKCA 2FGWL 4QRUB 1N6QH 5GGQL 4BH7B 5F9OH 3CVHH 4OFVA 2QBWA 2X44D 3B9KD 5ESVB 2GK2A 1CS6A 4G5ZH 3SQOL 1S7TB 1BX2B 1F6AB 2EDTA 3O6FC 3L5IA 4IOIB 3HAEG 4ELMF 5CD5D 3LIZH 2V2XB 2GJ6D 4AEIL 3ZE2F 3P30H 4ETYA 2OZ4A 4ENED 3GEWB 4OFYA 2O5YL 2A77L 4X6EB 1CLZH 4XCEB 1NMBH 3GI9H 3NIDE 4OZIF 3MLWL 3O4LD 3WO4C 2B39A 4H8WH 3SPVA 1ZGLP 4X6BB 3UC0L 4KKBD 2AP2A 2HLAA 4K7PL 5L9DL 5D71H 4WI6A 3ZKND 2OXGA 1RJZB 5D6CA 4JY5L 1JYWA 2DQTH 3JV0A 2GTWA 4RFOH 3O3UN 3ARVA 4N8CH 1NFDE 2R15A 3ABZA 4UIKL 2C4FT 2YK1L 5IGXL 1T22A 1WCQA 3ULVE 1KFAL 3SKNB 1T66C 3GGWA 1PZ5B 3TBTA 3BW9A 1QRNE 1UWXK 1HZHH 1QLFA 1ZT7A 4KK5D 3WLWD 1ES0B 1CDUA 1I1YB 4BJLA 2AJSL 1IAMA 3G5VA 5C07E 3UO1H 2DLHA 3WNKA 1U91A 3P11L 5JTWA 4KQ3H 2PO6A 5I15L 2VDLH 4LSUH 5D1XA 4ZPVA 3M45A 4Z7OE 1GGBL 1LP9F 5L7XL 4Z9KB 3C2AL 1UB5A 2X9YA 4JKKA 4QF1B 5HHMD 5C0FB 2P5ED 4XVJL 3ZKSD 1PJ9A 2QSQA 1OF2A 3FFCD 3BP4B 3G6AA 5DJ6B 5C0CE 2V5TA 3NCYS 1MH5B 2BFVL 1HI6A 1CXIA 4IDJL 3TBTB 4LIQL 4LSSH 3J7HA 1ED3A 3MLXL 5FYKU 3G5VB 2BMKA 2NPLX 1P5UA 4GMSH 1AGDA 2EKSA 5IVNA 2HJFB 4NWTL 2CDGA 3BKYL 1KIQA 3GHBL 4H0GA 4P2CG 1TLKA 2EO1A 3I2CH 3LH2L 4KHXL 4LRIA 1E4JA 2BNQA 2YPLA 4K3HA 2R39A 3BXNB 1P7KB 2ZPKL 3WIIL 3KHQA 4ODSL 1LO4L 4B53A 1I3RB 1SQ2N 1BMGA 5D5MF 3G6AB 4R4ND 2IH1A 3CC5B 1HI6B 3NFNA 2P5WD 1MHHA 5L2JB 2W9DH 1NFKA 3QBTB 2AV7B 1KB9K 1A47A 1WIOA 5B39A 1NJ9A 1B6UA 4FFZL 4YBHA 3RGVD 1K85A 1TJIH 1AGDB 2EKSB 2RJMA 2CDGB 3LCYA 2DLGA 4XMKL 5BRZE 3GJEB 1S9YA 3BD4A 3TYFB 1IM9D 1M7IA 1DQQA 3UAJC 5JA9A 1YECH 3LQZB 2G5BB 2BNQB 2EDQA 2YPLB 4KDWA 1OM3H 3R0NA 4J8RA 4L4VD 2X4OA 4NRZA 1L7TL 2ZUWA 2RAMA 4BZ2H 5E70A 3VFUA 2DQDL 5EU3B 4MNQD 4TUJA 1N5YL 1IMHC 1FFRA 5L88L 3T3PE 4OZHF 4PRDA 1I8KA 1Q0XH 2EYTB 1TXKA 2IH1B 1UWGH 2XNAA 3S34H 5BV7C 1MHHB 5HVGB 4YDIH 5TF1H 1EBAA 3JSSA 4U0RC 3D39B 3TP4A 4CMHC 5T3ZH 1BQLH 4MD4A 3BRFA 1FGVH 5BOPA 4WUKL 1BJ8A 3ZTJG 2IFFH 4P2OA 4MDIB 5IFHH 5K93A 3TO2A 2B4CC 3V8CA 4JO3H 1KTRL 4R7DA 4M61A 3O2DL 3QDME 1M7IB 1MCIA 5GHWL 4DK6A 4Q9RH 1F00I 4MMZC 4NRZB 1JYVA 5AG8A 1SMOA 2HRPL 3BZ4A 3QZWG 3VFUB 5L6YH 3RY4A 1NFIA 2YHGA 3H3PH 4PRIA 4QRTB 4XBEH 2IALA 5DUBB 1I8KB 3WD5H 1AI1H 2XNAB 1YA5A 5F88B 4R7NB 1PKQA 4X9GA 2IGFL 2F15A 5DD1L 2ZOKA 1DQDH 4KTEL 1SM3H 1IKFL 3KLAA 1CFBA 4XAKE 12E8H 3MRNA 4OF6A 1YJDL 5LG1A 3DMMD 2AJVL 4E0RA 3PHOA 3TO2B 3PDDA 1HN1A 4R7DB 1T5WA 1V3KA 1KC5L 3HMXA 4XNMB 4FQCH 1KT2B 4S2SA 1D6VL 4YFLI 5I1IH 4GG8A 3GHEL 1BFSA 1DTUA 1YEJL 4OD1H 2NYYD 4OUOA 5KS9E 3QWOA 2FL5A 2A74A 2IALB 4JRXB 2VIRA 4GKZA 5F1KC 1J0JA 1MNUL 2UZYB 4U6HB 2Y6SC 5D7SH 2EDHA 3V9FA 3NZHH 4N0YL 4ZFOA 2ZOKB 5KAQF 3EOTH 4AG4H 2F19H 3BRGC 3KLAB 2R1XA 1KIUA 4LLWA 1CK0L 1XF3A 5DZOA 4P5KA 5DMKB 4HD9A 4PGZA 2EDWA 1U6AH 2VR4A 2XRAL 2NY5L 4E0RB 3IJHB 3PHOB 4R97C 1RMFH 3QHZH 4WTZA 1T5WB 1EGJL 2H2PD 2XZQH 3C8DA 3TZVC 3WLBA 1B4RA 1MWAA 3D1MC 3SKJL 4HDIA 1LE9A 2BX5A 2XZCL 1ZK9A 3AB0C 4S2SB 4PJ7F 5IW3A 5BV7B 4ZUTA 1RY7B 5EO1A 5K9JL 1U3HA 3NTCH 1QSED 1VERA 4CMHB 4KI5E 3QWOB 5FUCE 1EUTA 1CGVA 2FL5B 2A74B 4Z77A 3HN3A 4JZOB 3F7VB 3AU1A 4KPHH 4PJBE 1QSFD 4GKZB 4GMTH 4LNVA 3U7YH 4LHUA 3V4VH 1YEFH 5KZCD 1HDMB 4OM1H 3MJGX 2X10A 4KUCF 1ND0A 4ZFOB 2VLLB 4MAYD 1BZ7A 1HSBA 5I1LA 4KDVA 1WFOA 2R1XB 2P24B 4PRAB 3UTTB 1Q38A 1B6DA 4KRPC 4XB7A 5DURD 2F58L 4C4KO 1JGUH 2HG5A 2Y7QA 4M1DH 4JN2A 4J3WA 3WIHH 5D1QA 3C08H 5CIPH 1UM4L 4JR9H 3DUSA 3L1OL 3KR3H 2ADFL 3I02B 3FAWA 1NGWA 4N8VG 1T83A 3QQ9C 4UT7H 3VXME 5E99H 4BSJA 3P4NB 4ZUTB 4KZDH 3E3QE 1U3HB 2I60L 3KYOA 1LNUB 4KMQA 3GKZA 3IAQA 2Z31A 3IFNH 5T1KB 3VGAC 4NN5C 5CJ8A 5ISZD 1J05B 1UKSA 1FYTA 2F9BT 3DLQR 3EIFA 5DEFA 4Z77B 3HMXH 2EDLA 3AU1B 3NBNA 1SBBA 3ULUE 3QI9C 1XGPB 3BHBA 3JV6A 1CE1L 4OM0L 5B3JF 5BS0A 1ND0B 3EYVA 4FQLL 5MP6H 3T0EA 4YBLB 4OBSA 5E00A 2B1HL 1KTLA 4C83A 2MMXA 1QFUH 3KPQA 2BJMH 4NO0A 4RAUB 5ALCH 2GIYA 2HG5B 2Y7QB 1D9KA 4OJFL 4F3FA 5EA0L 5D1QB 3D2UD 1HQRA 3WKML 3DUSB 3BWAA 3D5OF 3I3EA 3TGXA 7FABL 1BZQK 2BCKB 4O4YH 2XA8L 2UUDH 1E6OH 5GISL 5FKAA 5AZ2L 1D5IH 1NGWB 3R8QA 3QUMB 2ZSWB 4KKLD 5CJQL 1MJ8H 4X6DF 1MHCB 3KYOB 3SDXF 1BVLA 4K94H 4P46D 1RUPL 4JCLA 1I1AB 1DVFC 3VXRA 4OD2B 4HLZG 5DEFB 1ZEAH 1MWAH 4N5EC 1INEL 4LPWA 2JJTC 4R97B 1X4ZA 5LWYL 5EZIL 2Y06L 1IAKA 1JNHB 1UXWA 2APFA 2ICES 3EYVB 4GKNA 2QHRH 1O0VA 5E00B 3AB0B 1L0YA 5I71C 4ONFL 3EYQD 1KTLB 2A9NH 3KPQB 4NO0B 1FZMA 3TN0D 1XFPA 1D9KB 3MNWA 2VDNL 1HH9A 4F3FB 3NH7H 5GRYA 3VFOA 2VDML 1T1XA 5IEKB 4R8WH 5KVFL 4UINH 2PETA 4OCWH 4OLYL 5DK0B 3UJIH 3GBML 4NM4L 1DN0B 3AMLA 3GDBA 2FDBP 4E9LA 3MLPA 2ADJB 2Y23A 4H1LA 5J8OA 4PYGA 1NGXB 4NC1E 1OAQH 4PJDB 1IEAA 5IMKA 1OP9A 1IAKB 1UXWB 2GW5A 1WZ1H 4N68A 3QEHB 4PB0L 4YX2H 3STZA 3LEXB 4C4KT 1CLYL 3A6CH 4OCLC 5DJCA 1BFVL 3QDJE 4NKIH 5FFLA 1U8NA 4U1NA 3VI4E 2LE9A 1FZMB 1ZV5A 1UEYA 1IEHA 2YPKB 2R56L 3TH4T 3VGAB 1HH9B 3GRWH 2AI0H 3KLHD 3BEVA 1DBKL 2ATKB 3VFOB 4X99B 1T1XB 2VC2L 4S1SL 4ELMA 4LVNC 2BY2A 3SKOB 3U0TA 1KF9B 1GGUA 3BZEA 1BVKA 1NCDH 2IANB 4D0BA 5KSBE 4AEHH 5HYQB 4OZIA 1CF8L 5IBUG 3HMWL 3BMVA 4H1LB 4XNQA 3N1QC 2ZUVA 1F2XK 3CSYB 5I73C 5IMKB 1UM5L 3BDBA 4WTXA 1INDL 1GC1L 5GRVK 1AQDA 4PJIF 5C08E 2PNDA 3LS4H 1V3LA 2ZSVA 1N6UA 2AJZB 4PY8I 5LXGL 2EEAA 3K8MA 2ESVA 1MIML 2W38A 4U1NB 5FYLE 4D3CL 3MV9A 2OJEB 3TM6A 1E4KC 2WWKO 3BEVB 4JG1H 4PJ8C 1ZLUK 2NTFA 3H9SE 5E5MA 4ELMB 5FO8A 2NLJB 1XIWD 4YR6A 3WDIA 4LLDA 3DX8B 4D0BB 4RFNC 1RUML 3C6LD 4DCQA 3VFNA 4OZIB 3MLYL 4WTWA 2F53E 5CZVH 2I07A 3V6BR 4TQEH 5C7XH 4NZRH 1LP9A 4G43B 1M71A 2L4OA 3K1DA 3HAEB 4ODHH 1FP5A 5EOCJ 2ZSVB 3TVMD 2AK4A 4HKJB 2OR9L 2P49B 3BYYA 2ESVB 3STBA 3FOLA 2J8OA 2MQ3A 3VWKC 2CJUH 5IBTL 1CFSB 2NTFB 4U3XA 2QQLH 3HG1D 4KGJA 5FO8B 4M8QB 3HCVB 1U8JA 1QP1A 1DBBL 4HPOL 3BKJL 4MXQD 1VPOL 5F70A 4HPYL 4RNRA 5AYUL 2H26A 4KJWD 4NRYA 4DOHE 1A02N 1AXTH 1LP9B 4ZYKA 1QFOA 5JIKA 3VFWA 4XP6L 1M71B 1N4XL 5EO9A 5EFIA 3QDMD 2AK4B 1TDQA 4UTAH 1MAJA 1JGEA 5E7BA 1MJUH 1C08A 5C0BE 5D5MA 4ZNEA 1S7UA 3FOLB 5TH2B 4YUEL 3M8OL 4BUHA 3QXAB 2GK0A 4E41B 3C5JA 1FFOB 2EDFA 1PKOA 1UJTA 4GRMB 4RDQG 3EW3B 3PJSA 1RZJH 2X4NA 4TNWF 5SWQA 5E2VH 3VA2C 3W9EA 4EI5D 3GMOB 4NKDB 4PY7B 5GGVL 4RNRB 4U1JB 4GT7A 4IS6B 3CPLA 4XXCC 2H26B 4NKMA 5CEZE 2R2BB 4NRYB 5ALBL 1XF5A 3UTSE 4M3KB 3FT4B 1ZA6A 3O0RH 1X5GA 1OSPH 5F7UA 3VFWB 5J57B 1DLFH 4EXPX 5D2NC 3BGMA 4PRPE 3EZ8A 5DZLA 4RDQF 2V17L 1N7MH 3S35X 3GB7A 1ZANH 2VDPL 5JOEA 3ARBD 3LPWA 1KLUA 3MRMA 3N9GL 1SJVA 3NFSL 1X4YA 1C08B 3QCVH 5D5MB 3QUYC 2WWKT 1S7UB 1K8DA 4RFNB 1M1SA 2PXYD 2Q6WA 2L7UA 4NSKB 1BGXL 2EIZB 2KQMA 1HHJB 3C5JB 1JGVH 4DN3L 4Q9BA 1I1FA 1TETL 3STLA 4NN7C 2O5ZH 1J1XH 3PJSB 1A3QA 2X4NB 2F54A 4JPVL 1Z0MA 4XXDA 3WSQL 1UZ8A 3W9EB 4MHHI 2YA0A 3F7RA 4ZAKD 5D72L 3X17A 2HTKD 1A1NA 4OGXL 5D7JD 2Y5TB 3QIBD 3MLUH 2FX7L 3S36X 2R69H 1XF5B 3ARXA 4OCRL 4NUGH 2P4AB 3HI5H 1MFAH 1ZA6B 4I18A 2YUZA 2ZCHH 1JI1A 3GMLB 1YDPA 3VWKB 3KXFA 5I76B 3KYKL 1BQHG 1QFWI 2VDRH 4P9HH 3TBVB 1VKXA 4MWFB 3U9UA 4EDWL 4LSQL 1MEXH 3WHXB 2WUCL 3MRMB 2JF1A 3VFRB 1RPQA 2G60H 4OZHB 1WT5C 5F8RC 2G5RA 5C0DB 3OQ3B 2COQA 5LCVH 1AGFA 2D7TH 1J0ZA 5I8KH 1K8DB 2Q6WB 1B9ZA 4KI5D 1NEZG 1ZVSA 3C6SA 1RZKL 2VRAA 1OGAD 1JPTL 3STLB 1DBJL 3KPSE 5FM8A 4Z5RA 1MIEL 1GH7A 5EBLB 2HTLD 3ZKQD 1UZ8B 5IVZB 3G6JE 3F12B 1A6UL 3QZWA 1A1NB 4NWUL 9CGTA 3V6FA 3RDTD 5DO2D 1IAIM 3VGHA 1ORSA 4NHCH 4I18B 1YDPB 3KXFB 4KJPC 5EUOF 5IHUH 4IMKC 5D7KD 1OARL 3X14B 5FIEA 5DR5L 5GS2H 1LEGA 3BSZH 1A7RH 1LK2A 5C3LD 1N3NB 1QBML 3ULUL 4FNLL 2A6DB 3C6SB 4DZBA 4Z78B 1IGFL 3VI3F 5IMMA 1WAAE 1SVCP 2AQ3A 4Z5RB 2AK1L 4HZLB 3N1FC 4JO2H 4AL8H 1QFWH 2FX8H 3P9LB 5SWSD 1JPFB 3DYMA 3QZWB 2X5PA 4H88H 4ALAH 4U6VL 4FHBD 2R2EA 2DLFL 4GQPH 2IAMD 4L1HA 3NIFF 5E08H 2YSSB 5MEOA 3QUYB 5ICXA 2XY2A 1ORSB 4AQ1B 1EFXA 3PWUB 3AREA 4G6AD 1BBDL 3BZFB 3U36B 4L8BB 3BP7A 5H35B 1CG9A 3PGFH 5J6HA 2DTML 1LK2B 3OB0H 2YN5A 3LQMA 3MRHA 2MFNA 4ONHA 1EEZB 3C5ZC 4IEFB 1LEIA 2Q1EA 5I1DA 5IB1B 2A73B 1R3LA 1L0QA 3HUJA 1UYWH 3RNQB 4FQXC 4YFLF 4QY8A 3CFCL 4RGNC 3QB7C 5EU5A 3VRLE 2R2EB 1RAMA 4JM2C 5E2UH 4ENEC 1AE6L 4HC1A 3AS3A 1LMKA 4K9EL 5MEOB 4YXLL 1F4WH 5ICXB 3UXFA 3UJJL 4WO4D 1Q72L 1EFXB 4PJ7B 2Q8BH 3M17B 1YQVH 1Q94B 4GAGL 5C0GA 4X4ME 3QAZB 5ESAA 4GKOA 5D7LD 4RWYH 3BP7B 3CSPA 4S11A 1CG9B 3RVUC 2JIXD 2NX5B 1CD9B 1CVSC 2B1AL 4P5MA 4FG6D 4IRJA 2CMRL 4PJHA 1VADA 3EHBD 4NZUH 1PD6A 1SY6L 1LEIB 1BD2E 5I1DB 4A6YB 4OLUL 2CXGA 3QDGE 5EU7E 4NQDE 1SHMA 2J8UF 3MV01 4X6FA 5GSVA 3TNMB 4OUUB 5JDJA 1MCNA 4QY8B 1NAKH 5EU5B 1CQYA 2L7JA 4HT1H 5EZJA 3GSWA 3MGAA 3OJ2C 5ADPL 2DIAA 3U82B 4OI9A 1MCJA 3OJMB 4MNGE 1FV1A 1GZQA 5HHOD 4JFED 3B9KA 3IAPA 2QTEA 2XWJA 3QJFA 4QRSB 2OM5A 4GG6F 3MJ8A 3L3DB 2V7NA 3A6OA 1KV3A 5HDQL 4F57H 1AC6A 4MLIA 3OKEA 5C6PB 1RK0A 1CVRA 3FO0L 1CR9L 3WFCH 1VADB 4OF7A 1RZIA 5LGKA 2GJ6A 1UWEL 3BKML 4N8VB 4QHUA 4XWGL 1MCPL 2XKUA 4EBQH 3O4LA 2E27H 3RL2A 3TBSB 1KTKE 1YEKH 4JB9L 4X6FB 5GSVB 1EEYA 4XBPB 1SBSL 3OAZK 4BFGA 4LSPH 1I7UA 4CW1A 4H8WC 4I0CC 3LMJH 5EZJB 4OGAD 3WUZA 3WXVH 3WHE1 5I74C 1F6FB 1KSRA 4K07A 1PEWA 2RR3A 4IJ3B 3B9KB 4KVNH 3C5ZB 4X6DB 3SDXB 3H9SD 5J3HC 3VDCA 2WQ8A 2QR0A 5DHXB 3TBWB 3IDGA 1X5IA 3QO0A 1J87A 2V7NB 2IPTL 1Z9SA 2BSRB 3T1FB 1UM6H 2AEIT 3O6MH 1O7VA 3OKEB 1RK0B 2AJ3A 3MFFA 2YZ1A 3RIFF 1FRGH 1A14L 2UWEE 2HVJA 1CFVL 4GRWH 4G3YH 3FN0H 2HKFL 2X9WA 1WSST 4NBXB 4U1IA 3RL2B 1EEYB 4JAMA 4Z7VF 4CW1B 3CFDA 3MLVL 5KW9L 3I85A 5HHXL 4JDTL 1ZKAA 1X5ZA 1HKLL 4S1RH 5DHVA 2JB5H 1V7NL 2CRIA 5FKPB 1URLA 2XYCA 1EHAA 4ACPA 2P5EA 4EEEA 1GPOL 2MJWA 5EIIB 3B2UC 5BCAA 1Q0YH 3K81A 3FFCA 1UC6A 4DUVA 3UDWA 2F8XC 3IDGB 3E8UH 3M1BA 5I8OH 2OQJB 5IESH 3BIBX 4ZO6A 2YZ8A 2LAAA 5E9DB 5C92A 2AJ3B 3MFFB 5I1AA 2CPCA 1P4IL 5F71A 3MJ6A 2A0LD 2WINB 1WF5A 3DECA 2DQJH 3OR7A 2FGWH 2HVJB 1H3XA 2EE3A 5GGQH 4Q6IA 5KG9B 1A64A 1NLDL 4HIHB 4BFIA 4OZFG 1WV7T 2HVKB 3WYRA 5DS8A 4JAMB 3FQWB 1AXIB 2VXVL 4M7KL 3CFDB 3CVHB 3QNZA 1NBYB 3RKDD 5HDBE 3VFMA 1IFHH 2Y36H 3GSNB 5DHVB 2DMCA 5HHMB 4W6XB 1U58A 4AEIH 2P5EB 3T2PA 1X5KA 4LCIH 1NANI 5FYJD 1FZOB 2O5YH 2A77H 3CK0H 2D4DA 2JJSC 3FQXA 4OB5L 1GGCH 3BIKA 3M1BB 4JM4L 1QBBA 2P5WA 4LGSB 4UB0L 1OW0A 3B4NA 4P9ML 4UV7L 1KPRB 4UT9H 4ZD3L 3LQAL 4Q6YA 1DQML 2G9HA 3RGVA 5CEZD 1JTTA 4PJIB 2R9HC 4F7PA 2A6JA 4OFDA 1BECA 3VA6A 3V5DB 1ZS8A 5I74B 4ZS7L 4UIKH 3V52L 5K33A 2YK1H 5IGXH 3BZDA 5F7DB 4PRPD 1IM9A 3O3BB 2NW2A 3HZMB 1U8IB 4RCAA 5IBUB 3QNZB 3EKCA 5D6DA 4FABH 4PJAE 3T65A 5HHNA 1MHEA 4L4VA 3C09C 3U4BL 1QNZL 1UJ3B 1U58B 4FXGA 4MNQA 5D70L 2YD5A 5EU4A 4UT6H 4NQVB 3P11H 2L0DA 2PO6C 1RIVL 5F93C 3FQXB 3KLDA 4J4PD 2NR6C 2G75A 3BIKB 1YNTB 3OF6D 4I0KA 3TJHC 1GGBH 1JV5A 2DQGL 4WU7A 3QG7H 4XNZB 4UDUA 4YDLC 3JWDL 1UKQA 2P1YA 1OAUL 5D1ZD 3LY6A 3RGVB 2Z8RA 2A6JB 5HYJE 3MV8E 4U2ZA 1ZS8B 4PGCB 4XVJH 5DJXB 1Z2KA 3BISA 5F7LB 1IM9B 2FRGP 2NW2B 2BFVH 5KSVB 1H3PL 4IDJH 3LN4A 4LIQH 2Z92B 2GJJA 5HHQB 5JORB 32C2A 4DK3A 1YY9D 2XKNA 2OTPA 4FXGB 4MNQB 1MJJA 2H2PC 4K2UL 4P3CL 2DM3A 3BKYH 5DD5H 4TNVK 1IKNC 3U4EA 3KPSD 1IT9L 1T2XA 2FCBA 3RTQA 5F7HA 4ZUWB 5F96L 1DBAH 1CIUA 4MD0B 2UVEA 3LH2H 3WFEL 5F9WC 4KHXH 4WU7B 1W0VA 3CFIC 4UDUB 4O2FA 3P4LA 5GS1A 5I17A 4KTDL 4I5BB 3UCRA 2EDKA 3SN6N 3EO9L 3B43A 2PTTB 3DMMA 3SDDD 5FDYA 5JIHA 4KK8D 1LO4H 5IJVA 3PIQA 2MQCA 4PJ5A 2BOCA 3W11D 5JR1H 3KPRA 4LCWD 1AHWA 1B0RA 4N0UB 2ICWA 2BY3A 1ORQB 4XZUA 1WBXA 3VXUD 1CFNB 1UADC 2VXTL 4M7LL 4F9PA 2XKNB 4OSUL 1ZWIA 4WWKC 4W6WB 4JRYE 1DANT 3DWTA 5DJZB 1MJJB 3ARTA 1H8NA 2OL3A 1WFUA 2PYFB 4C56A 1OB1B 4XCNA 4LGRB 3ZDXF 2XTJD 1NAMA 1C5DA 4NYLA 3QXVA 4HXAH 4K71C 2Q7YA 1FG2A 4XVTL 2VH5L 3D85B 3SCMD 5GS1B 5EH1A 5IW1B 5I17B 1OTTC 4JREB 4LLVA 1CGWA 4FOMA 3DUUA 2DQDH 1N5YH 4LL9A 2YD8A 1OVZA 5CILL 5L88H 3PIQB 2BOCB 5CJXA 3PP4L 4LGPB 3DHMA 3HPJB 4FRWA 1B0RB 4PD4K 5B38G 1WBXB 5JHDD 5EOQL 3ARFD 1V05A 2K1MA 3D9AL 5ANMA 3EFFB 3D69A 4O58L 4GOSA 3MNZA 1BQHA 5DYOA 5I0DA 2DLEA 2VLRD 1B3JA 3CMOL 4YHPA 1LHZA 1NAMB 4MHHG 5CWSB 4KJYA 1JYXA 3O2DH 4UI2A 1WC7A 4X5XB 4JFQA 3FRPG 5GHWH 4F7MA 1FG2B 1UH3A 4YDJA 1NEZA 1FO0A 4MAYA 4UOJA 1EHLL 1OQXA 1G84A 4LLVB 4HSQA 4U05A 2HRPH 5CZXC 3F7YB 1KXTB 3PWJB 1BHGA 1WISA 1EHXA 1JIBA 2OYPA 5H37H 2OLDA 5GPRA 3MCLL 1VGKA 4BUGA 4JFPB 4OTXL 1CZ8L 2BSSA 5GGSY 3RVXC 2IGFH 1WZMA 5ID0A 3L5HA 1P84J 3JWNC 1KG0A 5DD1H 3H7BA 1PX3A 3R06B 1QSEB 1A6VL 5F9WB 4QTHA 5F1IA 4ZUVA 5I1CH 5ISZA 3D69B 3O8XC 4PUBL 2APTA 3MNZB 3MSPA 1BQHB 1JF1A 1YJDH 2W1NA 2I9TA 3DURB 1MREH 2AJVH 3MRGA 4TSAH 2AEQH 1QSFB 1HQ4B 5KZCB 3BWUC 4WI7A 1KEML 4KJYB 1WC7B 4NO3A 4JFQB 5CS7A 4F7MB 1ZGLA 1KENL 3BKCH 5KTEL 5IWLA 4ODBD 1CCZA 2YRZA 3U0PA 1NEZB 2NY3C 4MAYB 5CEYB 3O3DB 3GHEH 1YEJH 1PVHA 3PE9A 4QT5A 4YIQB 3BD5A 5DURB 5EUOB 3PP3H 1FCCA 1PG7L 1YN7A 4K8RL 1SEBA 3ULSA 4Y88A 1JN6A 3P73A 3KPTA 4HHAB 1S9WA 4N0YH 3HHRB 2AGJL 4Q74A 2PYEE 1QLRB 4QTHB 4P46A 4ZUVB 5ISZB 5DHYA 3KLHC 1NSNH 4HQQL 5F6HJ 1ROWA 2NY5H 4K94C 3CXDL 3WMSA 2UY6A 3MRGB 1FZJB 2VZ1A 5A3ID 2H6PB 4ODUA 1EGJH 2X1XR 1U2HA 4HBCH 3TA3C 3I75A 1I7ZA 3SKJH 4B7IA 1FDLH 3P2TA 1H0DA 4WI8A 3WEXB 4P59L 3OAUH 3SDCC 3MJ9L 3DX9B 3MCKA 1QQDB 4DKFL 4PJEE 2AS5M 3TN0A 1YN7B 2Q86A 3HC4L 4XT1C 4CRPA 4JKPL 3TO4A 2JELL 2PW1A 3ULSB 3D2UB 3QEQD 1FO0H 3BH8A 3W5MA 4EUPH 4N0CC 3DUHA 1SJEA 3V0WL 3ZT6A 1QRNA 2VKXA 5IB5A 4P46B 5A43C 1BFTA 5DHYB 3KNBB 1IC4L 4XPFL 3TC9A 2D31A 4MGXA 3IETB 5C07A 5FOJA 1T6WA 4ODUB 2RCSL 1UM4H 4Q9QH 3CJJA 3I75B 2Z8WC 1T83C 2YRLA 1YN6B 2VR5A 5AYQA 5CIPB 1D5ZA 2OX5A 2Z31C 5I8EA 4A2MA 4PRBA 4RFEB 5D2LF 3TN0B 2Q86B 1UZ6F 5T5FL 2PW1B 3HNSL 5A2IH 3TVMC 3EDDA 3BH8B 2CH8A 1BIHA 3QP3A 1CE1H 5C0CA 2ZG2A 4OM0H 3T0EC 2HT3C 1MLBB 5DJDB 4FQLH 4UIMA 5F44A 3HE6C 5IB5B 4DFHA 3VMOA 3T0XA 4QOKE 2B1HH 2J8UB 1G7HA 3MRQA 1SVZA 4Y16D 2D31B 4HWZA 1W72A 5J6GA 4OFIA 2W91A 4UTBL 1DQJA 3KDMA 4OJFH 3MUY1 3GJFH 5D8JL 3WKMH 5C0RH 2YD3A 1PZUB 4MXQC 4HX1A 4G9DB 3QFJD 2XG4A 2XA8H 5TJWK 2EDNA 5GISH 5AZ2H 1D5ZB 2VQTA 2VJXA 1BIIA 4NO5B 4BSVA 1RUPH 3HE7D 4GG6B 4CVZA 3AS0A 2FH6A 1MHPL 4N0RA 4TVSa 4LASL 3IXTB 3TESA 4U4BA 3BP6A 2WSKA 4L4JA 4PGDA 4R90L 1XIWA 1OP5H 2Y06H 3L3OA 1N26A 2QJDA 3MUHL 3HI1A 4WV1A 2JJVA 4UIMB 2ORBL 4QLRA 5EN2B 2QQQA 1MELA 1I3VA 3UYPA 3WL9A 2FBOJ 5E24E 1G7HB 3MRQB 4WW2F 1BEYL 3O3EA 3SDCB 4HWZB 1W72B 4JO4L 3VE0B 3ULVH 2ZUTA 3ESVF 4U0QB 1NC2D 2QQNL 3FJTA 4P3DA 4EI5C 2VDMH 2X40A 1F90L 5KVFH 3QCUL 2J88H 4L3EB 4XCYA 3PWNA 3RWHA 4LSVH 4NM4H 3GMRB 1MCSA 3PABA 4QWWD 2YUVA 1VFBA 1SJXA 3FN3A 3BP6B 4M3JA 1S7SB 4PGDB 3CZFA 3TIEB 2A83A 3HZKB 4K3EH 2ZG3A 3HI1B 4WV1B 1FH5H 2D7MA 3C6LB 1RUQL 1NMCB 1CLYH 1BFVH 1SJHB 3QEGL 1TZIB 3NZ8B 5IKCA 4RMWA 4Z7VB 4LDOB 5DMIL 5SX5H 2VXUH 5HYJD 5J89A 5HYFA 5KN5A 2R56H 2V5RA 3PWPD 3L9RA 4ODVL 3VRIA 4P3DB 3HR6A 5IHLB 1LO0H 4S1SH 3BJLA 3QDMA 3TVMB 1Q9WB 3DRTA 1P1ZB 3DYPA 4JGUA 3S8WA 3PDOA 1MCQA 1CF8H 2XV6B 1EAPA 4OZFA 3HMWH 3KPLA 1VFBB 5GRVL 4EIGB 1EO7A 3DX6A 3CZFB 4M6ML 3HG1B 2A83B 1UM5H 2P8MB 4WHDA 3H0TA 1GC1H 5ETUA 5GJSL 4OCNC 4XPGL 3DXAD 1FVEA 1RZJC 4PG2A 3VFGL 1F3JA 1MIMH 4D3CH 5LJYH 3H9HA 4OGZA 3L3JA 2CO7B 3RZCD 2MOVA 2OP4H 2PW2A 4DTGL 5KN5B 3VRIB 4P5TD 2FB4L 2KZWA 2Z93A 5JLZA 4WY7L 3E2HC 2BOBB 4KXZI 5LBSL 3ARBA 4HKBA 2F8OA 5KSAC 3MRCB 3L3KA 4OZFB 2PXYA 3MLYH 1WCBA 3QR2A 4D94A 2HAZA 5KS9A 3ZE1E 2FR4B 3BP5A 2QADD 3DX6B 1Z5LA 3MXVL 2LQRA 3QPXL 4Z7NE 2X4SA 3GSVA 4MZ2A 3QJHB 2I27N 4QHLA 5ETUB 4EI5B 1JPGA 5T1LB 1I85C 3O41B 4ZAKA 5C0AD 1FVEB 4NCDA 4PV8A 2DTSA 2OR9H 5D7JA 4FQ2L 5A1AA 1KCUL 1F3JB 5ACZA 4ZNCD 2WUBL 4X6CF 3H9HB 2BNQE 2YPLE 3FONB 3L3JB 3OAYH 2X1QA 5F9AC 5LAXA 5I9QC 4GSDL 5CGTA 4C58B 4QRRB 5IBTH 2KPNA 1AFVL 5DSCA 5I16A 3QEUA 1KIPA 1A7QH 3BGAA 3ARBB 2NY2C 4HKBB 2HT4D 3BKJH 4P9HC 3MXWL 1VPOH 4HPYH 4XCCL 1KELL 2PXYB 5AYUH 3D39E 1IGML 3IDYB 2HRLA 3U79A 2MKLC 1HSAB 2FJHA 1VEPA 5BXFA 3BP5B 4PLJD 1Z5LB 1OGAA 3GSXA 3UBXI 3GSVB 1WEJL 1N4XH 3HI6L 1WBYA 4Z0XB 2H32H 2R8SL 2JKXA 4KXZH 2CUHA 5D7JB 3O2WL 3QIBB 1WZKA 2BRRH 1A7OL 5FUZL 3MROA 1FIEA 2CUIA 1ITCA 3CZJA 3FOMB 4S10A 2OMNA 4YUEH 3RDTA 1ZLVH 5BJTA 5I2IA 1ZLWK 5IFAL 5DSCB 2DBLL 3S35L 4KVCL 4XPAL 3SDAC 1J11A 1KIPB 3ARDC 1FJ1B 4O2EB 4WGWB 4ZDHA 3VXMA 3MNVA 3TPUA 4HJGA 1PQZA 3VXQB 2VWEC 5HD8C 2FJGA 4XMPL 1VENA 5BXFB 5F7EH 3MRRA 1OGAB 3GSXB 5F8QC 3VDAA 1LO3L 5L2KD 1T5XA 5E4EB 1I7TA 4FG6C 5SWSA 1IGTB 2VDPH 1J5OL 3N9GH 4G42B 3S36L 4OIIL 1CDYA 1NUNB 2B0SL 2IAMA 3MROB 4YLQT 3RDTB 3HZYB 4FN0A 5HVWA 1CYGA 1BM3L 3KPOA 1IEBA 4XC1L 4DN3H 2MHAA 4UUJA 4HF5L 1TETH 4HH8A 4HJ0D 1EMTH 4ORGA 2F74A 4JRXE 3C60D 4JPVH 1VFMA 3U7WL 3PNWA 3WSQH 4ZDHB 3LZFH 4PS4L 1PKQE 3TPUB 4OGXH 1N64L 1PQZB 2FX7H 2R1WA 3P0VL 2FJGB 2EO9A 5DJAA 4OCRH 2VXSL 1JWMA 4GO6B 4JO1H 5I9QB 1ADQL 1FGNL 2WZPD 1E4XI 2W0FB 3H3BC 3R0MA 1T5XB 4P23A 1KB5A 1I7TB 2EEDA 3N85L 3KYKH 4CUCA 5C71A 5SWSB 4EDWH 4WNQA 2BVOB 4LSQH 3S9DB 2WUCH 4MQXC 5GGRB 1U41A 2IAMB 2IMNA 4HV8B 2AVGA 3Q2CA 4FQHB 5J9PB 2NY6D 3MV11 5EBGA 4D8PA 1MLCA 3KPOB 4WO4A 3FRPA 1IEBB 3L95A 1RZKH 4UUJB 1YNKL 4OCYL 4JFOA 3V6OC 1JPTH 5F9OL 3IU3A 1FZKA 1MIEH 2VLME 2NY0C 3O6LH 5D7LA 2E6QA 4POZC 2DBJA 2JIXA 3DV4B 3DX7A 1S9KC 2J1KA 4P2RD 5IV2B 3F6IA 2R1WB 3CVIL 3AM8A 4PJXF 3TCLA 2BC4A 3T8XA 3UTTE 5B38B 3NACL 4FXKB 3P30L 3NGBB 2VL5B 1CLCA 3QXWA 4QEGA 2Z9TA 2CR6A 1WBZA 4Y8DC 2EDXA 2BZDA 1OARH 3CUPA 1AKJD 4WNQB 5DR5H 4ZS6C 4H8WL 3SDAB 1BOGB 4Q7DA 3QDJA 3T0VA 1MAML 1Q9KB 5D71L 1RUAL 5I1EH 2EDEA 4G8GB 1QBMH 3ULUH 4FNLH 4NQCB 1MLCB 4ONGL 3L95B 1AR2A 2B5IB 4JFEA 5FK9A 4RFOL 2AK1H 5D7LB 3MUZ1 3B83A 2GJZA 3RGHA 3DX7B 3PGDA 4DUXA 4U6VH 5KSBA 2DLFH 4P57B 2OTUA 3GSOA 3OX8A 1OTUD 4B5EA 4AZ8A 5I8CA 1HZHL 3TCLB 3MGOA 2BC4B 3FCTA 3WJJA 2ADGA 4KUZL 1OQOA 2FEDD 1BBDH 5GSRA 2DF3A 1XMWA 3PWVB 4KQ3L 1M4KA 3NCFB 4MNHA 1AD0A 4KHTL 2DTMH 5FUOL 2CDEA 4LHJB 5JQ6L 4QXTB 4UZGA 3TIDA 1H15A 4WHTA 1UH2A 15C8L 3VCLA 5IF0B 2EE9A 2CLZB 3RWDA 1CBVL 4KMLB 5HHOB 4JFEB 2ZUSA 4TVPD 5CAYB 3BYTA 3SGEH 3H9SA 1TCRA 3MV7B 5IB2A 4GLRI 3OKNB 1XGQA 1T89A 1NBVL 1J0IA 3OSKA 4N1HB 5BZWB 5I8CB 1AE6H 4XHJD 4K9EH 4ZUUA 4YXLH 3OV6A 3ILQD 3FCTB 4XNYL 3MGTA 3UJJH 1Q72H 2ADGB 1RV6X 4WW2C 4GAGH 4L8SC 1UEMA 3LEYH 1I9IH 4PB9L 5I18H 4MNHB 4Y5VC 1AD0B 2NY0B 3N1MC 2CDEB 4HG4J 2CMRH 3TIDB 3MCG1 4WHTB 2OZ4L 4AT6B 4PBWD 1SY6H 4YHYC 2BSED 3EO0B 5DXWA 2R29H 1T4KB 5JO5B 4I0PA 4OCMC 1V3JA 5GGSA 1TCRB 3LKRB 3O45A 4NFBA 3P9MA 5IB2B 3D0LB 3S3PA 4PJDE 1XGQB 5BO1H 3F5WA 3W9DB 3ZE0F 4ZUUB 1II4E 2IADA 3TFKD 1HXMB 4J4PC 4WW1A 4FFVD 3HKFA 1DUZA 2VABA 3BGFC 3RX5A 1JHLL 4IRSC 5HHPA 2AKRA 2X4UA 2N7AA 2NY7H 5CZKA 3UJTL 3BESR 4Y5XA 5D2LB 3VW3L 5HDQH 2FHBA 3QQ3A 5FYKL 5SV3A 5CP3H 1T1YA 4X4XB 2IANE 1NC4D 3FMGH 1KJ3L 3NIDF 2YD1A 2O26U 4YPGB 5GZOC 3GNMH 1UWEH 1OM3L 4JFHE 5CBEB 3UZQA 4BZ2L 2ID5A 2E7LA 2XA3A 2ERJC 5TF0A 2XT1B 3BDYL 5IG7B 1MCPH 3O45B 5FA4A 3QPQD 3K4ZA 4JB9H 1MQ8A 3LN5A 5J11C 2CLRA 4CAGA 5FYLH 3S34L 5TFSL 1H8OA 1B0WA 1UCBH 3IF1B 5E8OA 2EE6A 2FIKB 4JPKH 4WW1B 1RZ8B 2VABB 2R23A 3O6FD 4RIRB 2IFFL 5HHPB 2AKRB 2J3SA 2X4UB 5IFHL 5JUEH 4HWNA 4PRPA 1G9NL 4JO3L 2W60A 4FQ1H 4MD5B 4ELME 2E6PA 4DKEL 5IQ9A 1TJHL 5B4MC 5BMFL 2LTQB 1T1YB 3ZE2E 2EYRB 5K9KA 1AR1C 4Q9RL 4E5XA 5FCUL 3W11C 4OZIE 4HWBA 1A14H 1BQSA 1CFVH 2ZUXA 1Z6JT 4TNWK 1ZVYA 5DJ2A 1YEGL 5FA4B 3H3PL 3RWIB 5CSZA 2KBGA 3OF6A 4WW2B 3LN5B 2OSLB 3WD5L 3ROOA 3SGKA 2BSTB 3PWLB 4L8SB 3WJLC 5IP4A 1DLHA 2PKDA 5KW9H 4Y5VB 2AEWA 1EERB 5DVKA 5D1ZA 5DJ0A 2XN9D 1HKLH 2P42B 1V7NH 1SM3L 2ESVE 5BVJA 5TGBA 5GIRA 1T66D 2BP3A 2R23B 1FNHA 1GPOH 4Y4KC 4A2LA 4XC3H 3K4DA 1FN4B 2KQNA 3MBXL 2N1KA 5F3HA 4NRXA 5FECA 5EC2A 1W2KT 2WANA 5IQ9B 2AAVA 2XICA 1P4IH 5FM4A 2FLBT 2GHWB 5I1IL 3FQTB 2VZTA 3BN3B 1SYVB 5DJ2B 4EVNB 1D5BA 1NLDH 4WDIA 4D0CA 3KPSA 1LP9E 4MJ5A 2VOTA 1G7LA 4AQOA 3ROOB 2FWOA 2VXVH 4JE4B 3CFBB 1UA6L 2AK4E 5D1ZB 5DJ0B 4P99A 4AG4L 4PLNC 1G6RA 3SDDA 1GOFA 1PYWA 4AIXA 5JIPA 4ZPTA 4E41E 5F3HB 3GM8A 4NRXB 4JM4H 2Z91A 5FECB 4M7ZC 3RIAK 3QG6A 1DSFL 3VXUA 4P9MH 4UV7H 5SV4A 1I9RL 1Y6NR 2X89D 2X70A 2DJ4A 3FB7B 4ZD3H 3LQAH 1TTUA 1DQMH 2BVQA 1V5JA 3MMEB 3NTCL 2P48B 3QUXA 3EGSA 3ZL4L 1QA9A 2R0KH 4I9WD 1CFTA 2WW8A 5EPMB 5FGBA 3V52H 2DAVA 1W8NA 2X4RA 4MJ5B 1UWXH 1G7LB 1BLNA 2HT2D 4GMTL 4JQVC 1I8MB 5HGGS 3BUYB 3VXNA 3MC0A 4FFYH 4PJ9C 3SCMA 2C1PA 4R3SB 4HS6A 1ZHBA 3ZMRA 4N1EA 4PRNA 3U4BH 4KZEL 2OBGA 3SDDB 5D5ME 1NCAL 2ZG1A 1PYWB 4UAOB 1W8OA 1JGUL 4LCWB 1RIVH 3CSGA 2KDGA 4JRXD 4OIAA 4JR9L 3VXUB 3KR3L 3BQUC 2DQGH 1HOCA 4Y2DC 3RVTC 4UT7L 3JWDH 5E99L 2BVQB 1OAUH 2CDFA 1RQ5A 4P4KC 2QSTA 3UAJD 4RAVB 3EGSB 3IFNL 1QA9B 3C2SA 3L3GA 2VLRA 1NDGA 2J2ZA 2XTJB 3HMXL 1BZ9A 4X6CB 2AXFA 5I1HH 4PIRF 5E6ZA 1HE7A 3VXNB 5HGBA 3I50H 3KPMB 2C1PB 3SCMB 3VFTB 2HWZL 1JWSA 4HS6B 1ZHBB 5MP6L 4N9GA 1FL3B 4OZHE 2VMFA 4DWHA 2X7LA 1INQA 2BJML 1PG7W 4K2UH 4P3CH 3NABL 4FZEL 2BHUA 2HKHL 3FQRA 3RTQC 4EQ2A 1VEMA 4BH8A 1IT9H 5F96H 5E56A 4ZFOL 5GGTA 2YA2A 1MCWM 1RZGB 1IRAY 5JHDB 4S1DC 3ARFB 1HOCB 1G6RH 1E6OL 2X1OA 4WENB 1D5IL 3IFOA 1ZLSL 3OKMA 1MJ8L 4OQ1A 3EO9H 5KVMC 4FP8L 4YWGL 5EOCH 4LLMA 3UBXG 2WP3O 3L3GB 5HHVH 2VLRB 2DQIH 1YJDC 1NDGB 4L9LA 1MWAL 3QDGA 1LGVA 4NQDA 1RUKL 1BZ9B 4RA3A 5DA4A 1OAZL 3KLSA 3KXFE 2FECL 4H25A 5HGBB 4PJCF 1NCTA 1F3RB 3FRUA 2VXTH 4JQXA 4M7LH 4N9GB 4LEOA 2X7LB 1OP5K 3GIZH 4RX4D 1INQB 3HFML 2A9NL 4H5SA 4CJ0A 4GAYB 5TQ2L 4ODWA 1WZLA 3EOAA 4BH8B 5EB9A 5IB3A 5IMOB 1I75A 4NKOA 4YBQC 5IHBA 3S88H 4M8VA 3U2SB 1S78D 2ZNWA 3C8KA 4XHQA 2CIIA 5E8NA 3MRBB 3TH2T 2ARWA 5ICYA 4LLUA 5J0BA 4QHNA 1A1MA 4AK1A 1EJOL 3RBSA 3PP4H 2NY5C 5FEBA 3L6FA 4JY6B 3VRJA 1NCBH 5I75B 1OAQL 4H25B 3QIWA 3FRUB 1DR9A 1X7QA 5EOQH 4LBEA 5FF6B 1FC1A 4QRQB 3BQUB 3D9AH 4Y2DB 3A6CL 2Y6SD 4O58H 4NKIL 4P4KB 1WGOA 1F45A 1JUFB 1DEEB 1P9MA 4ODWB 3EOAB 5GS0L 3CMOH 3FTGA 4NKOB 1YMMD 1C12A 3MREA 4AH2B 3QNYA 1H9VA 4PJXA 1R3KB 2CIIB 3HE7C 5E8NB 3TNNA 1KLGA 5LGJB 4OV5B 1S7RB 3TZVD 5ICYB 1LD9A 4LLUB 4QHNB 3LD8C 3WN5A 2VR9A 2LFGA 3RP1A 4ZFFB 2P44B 3AXLA 3CNKA 2YPVL 4FFWC 2AEPL 1FPTL 3QQNA 3L6FB 3MCLH 1GHFL 4PJ7E 3VRJB 4OTXH 4O9HL 1JGDA 4MAUH 1TQBB 3ZYIA 3ZZ1A 4Y7MA 3LS4L 1Y18A 1OAYH 2UZIH 4OLVH 1A6VH 3FHQA 4HH9B 2NX5E 4I3RH 4J1UA 4OGYL 2XPGB 4PUBH 1OD9A 3L7EA 3LPFA 3DNKA 4JDVB 3WS3A 3FQUB 3QEQB 3A67L 4GXVL 3HPLA 1G0YR 1F4AA 3FTGB 1KEMH 1C12B 4KRPD 4EZMA 3QNYB 1MAKA 5BQ7A 3OGOE 1KENH 1QPXA 4PJXB 5KTEH 5CBAA 2YEZA 4NGHL 1YZZA 3TNNB 1KLGB 5DVOA 4TSCL 1A5FL 2V5SA 2WP3T 3AS1A 1LD9B 3HC3L 4Y16A 1I7RA 3D48R 1FIGH 5T3XE 3AXLB 3QQ9D 3DETC 3NVQA 4K8RH 3VG9B 4EDXA 3QUZA 4TQEL 5C7XL 5FM5M 2FHFA 5DQ9B 4OIBA 4J23A 3QFJA 4WU5A 5FB8B 2ATPB 4CBPA 1G1YA 5MENB 4MQSB 5C0NC 5FO9A 1Y18B 3RHWF 3QI9D 4J1UB 1Y6KR 1HIML 1D6EB 2VZUA 4YC2C 3L7EB 1U2CA 4HQQH 3WS3B 3CH8A 3CXDH 4NHUA 4NJAH 1KJMA 3LKSA 3ISWA 5B3JE 1JWUA 3OR6B 4GXUM 4PRHD 1FL5A 5CBAB 4YE4L 3PF2A 3W5NA 3T04D 3I3DA 4Y16B 3EYOA 1DE4A 3HC4H 4JKPH 3C5SA 2VZ3A 1G9ML 4KV5F 1IAII 1NC2A 1T1ZB 1AXTL 1ZAGA 3VG0H 3MUGB 3P9WB 1DCLA 3ULVC 5CKAA 4LP4A 2P7TB 3QFJB 4WU5B 1DVFD 5E95B 4X6DE 3D18A 1U93A 3SDXE 3E6HB 4N5ED 3V0WH 1A9BA 1BBJA 4FQJL 5J56B 3TF7C 4OAWA 2AXJA 2HJKB 2IF7A 1NBQA 4YK4B 1IVLA 3TJEH 3HE7B 4P5TC 1TFHA 1MJUL 1A9EB 2FLRT 4XPFH 4BSWA 2AV1B 3NMEA 4NHUB 1KJMB 2YD9A 3LKSB 4OD3H 2Y5EA 4I48A 3WUWG 4UOW1 2V6HA 2RCSH 1NDMA 1JWUB 4XI5D 3O9WC 4LVHC 4DKDC 2VE6B 4TYUA 4ZUSA 3CFKB 1FL5B 5D96B 4XCFH 2YD7A 4YGVB 1J8HD 5EC1A 5J1AA 2EICA 3MOAH 3IAGC 5E4IA 3SEPA 3OG6B 2R2CA 1JTPA 3ARSA 5HYJA 4WFED 5JXEA 3C5SB 3PWPA 4WHYH 1RSFA 2DKMA 1NC2B 3HNSH 3SE3A 3O0RL 3I6LD 1OSPL 3FHAA 3D18B 3VWJA 4U1GC 1C7TA 4OAWB 2JTDA 5CGYC 1Z3GL 5E9DE 1ZHNA 5C2UB 2VQUA 3OJDB 4BSWB 2C4FU 1XR9B 3H6JA 3H2WA 4RMSA 5MERB 3PQYD 1NDMB 5D8JH 3T0DA 4ZUSB 3IKKA 2VLJD 3SE4A 1J1XL 5EC1B 3CFEA 3DXAA 3QO1A 4U31A 1GC1C 1PLGH 3GJFB 1L7IH 4KRNA 5F7YC 2PCPA 2A6KA 1KGCD 3IDXH 3RZCA 1MCKA 5KOMC 2R69L 5HHME 1WLHA 3JUYA 4LASH 1KCSL 5FDWA 4POYA 2P5EE 1TQCB 1MFAL 3HI5L 3HZVA 4GBXA 2J7LA 5HDLA 2VDRL 2W9EL 5IHZB 1P5VA 3T1WA 1AXSB 1MEXL 4D9QD 5HGDA 1ZHNB 4LLQA 5SWZD 1BEYH 1RHFA 5LCVL 5JOPD 3L3HB 5ILTL 2J5LB 1LQSR 4P48A 4PJIE 5CP7A 1ZGLM 1F90H 3ZKMD 4NPYB 5DVNA 1A6AA 5E6IC 5C0AA 4J3VA 3CFEB 3DXAB 5DTFA 2VZSA 3KAAA 4PJ8D 2WV3A 2DS4A 2VUOA 2CK2A 2EC8A 4JZNA 2XZAH 3V4PL 2A6KB 2NY1C 3RZCB 4XRCB 1UVQB 3MTRA 4P5TB 4W4OA 3CX5K 5FDWB 1IGJB 5DUPL 3V2AR 1JPSL 3WXWL 5TDNA 2XI9A 5E8PA 3VD7A 1HHHB 1ZOXA 1RUQH 4QHMA 4ZG1A 4ZQKB 2E8ZA 1ZE3C 3QEGH 3T09A 1TNNA 3ARZA 1A7RL 1E28A 2D4FA 5DMIH 2G2RA 1QRKA 4M5YH 1UCTA 4NBYB 5HPMB 4PTUA 5B21A 3UTZB 4JO2L 4AL8L 3VWKD 5DTFB 1U42A 4QHKI 3MQIA 4WRLA 3NOIA 3NIGF 1X3DA 2OTWB 4H88L 4ALAL 2RQ8A 1WWCA 2DLTA 5TDPB 1QR4A 4WFFD 1H8SA 1ZHLA 3MO1A 3WHE0 3G08A 4MNQE 2VLKD 5TDNB 2DWDA 4HGMA 5E8PB 4ZSOA 5GJSH 2RGSA 3DO7A 4XPGH 3PXJA 1A7PL 2IJ0C 4QHMB 3VFGH 4U6YA 3GZKA 3PGFL 5DD6A 3EO1A 1E28B 1ZLUH 2DOCA 5HY9B 3ARGA 4DTGH 2UY7A 3S96A 4OLZL 3G9VA 2XZZA 5E1HB 2FB4H 5K59F 5L2KA 1MCFA 3LKPA 3KVQA 1AGBA 1Z9OA 3PUCA 4WY7H 4LDEB 5LBSH 2IBZY 3T0AA 2D2OA 4KK9C 1BAFH 3V6ZA 4N0UE 3RVVC 1OAKL 2JJWA 4WI2A 2EZ0C 3L3IA 1MCHA 5BW7C 1A0QH 1AGEB 1ZHLB 5E2UL 3MO1B 3FQNA 2P8LA 3G08B 3UPCA 4JKWA 4CADB 1F4WL 3IKCB 3MXVH 3VJ6A 4XBGA 4Q97A 3C60A 3AMKA 2DWDB 3P0YH 3P40A 5JMRA 4ZSOB 4O02L 2D03L 4UMGA 5AG9A 3P4OB 2FO4B 2IQAA 5E6IB 1KCUH 2EECA 4U6YB 1GOGA 2YBRA 5DD6B 2B8OT 1U8PA 3LV3A 4KRLB 4L8CA 3S96B 3SJVB 1MOEA 2NY1B 4RQQA 3NCBB 5L2KB 4NN6C 5IVXF 3TWCL 1AGBB 4Y19D 3NCJL 4LMQI 3GSUB 3G04B 1F02I 2O5XH 3PGCB 5DF0A 1MVUB 1NAKL 3L3IB 3MJ7B 1KELH 3REWB 4YXHH 1IGMH 1YMHB 4RBPK 4PJEA 4ZOBA 5FUCC 3FQNB 5ERWA 1EK3A 1OLZA 1DQTA 1WEJH 2FYYA 2VNCA 1RZKC 3HI6H 3RFZC 1X5XA 2R8SH 1R5VA 2PTUA 5ICZA 2Z4QA 1S9VB 1RHHB 4P2RA 2BNRD 5FUZH 4F57L 3LV3B 3E6FB 1WK0A 3WIFB 1BQUA 2CIKA 1MFDL 4PJGF 1JNLH 4PJCA 5IFAH 5DVLA 3CDYA 2BVPA 5J7CC 4XPAH 4HMDA 5ITFA 3W39A 2CKBA 3UROR 4QNPF 1YEKL 5TE6L 4KMTH 3E3QC 3UBXA 4HS3B 4LSPL 2WIMA 1KXQE 5INCA 4U1HA 2NY6B 1QSEE 3UTQA 1FVCA 3LMJL 5DI8B 4X9IA 4NO2B 3DRQA 4YPJA 3ULUC 3HNTL 5HJ3B 2FYYB 4CNIA 2OI9B 4G6KL 3SE9L 2IPKA 4JLRB 1G7IA 1QSFE 4MJIB 1TVHA 1R5VB 4XWOC 1J5OH 5E1AA 4RSVA 4HC1L 1XF4A 4P2RB 3IVKB 5T3XL 3GIVA 4KJPD 4NQUA 4OIIH 1UM6L 2B0SH 4IDLA 1X6NA 3DROB 4QOKA 3UTPD 2A6IA 1RU9L 3HNVL 2ZOLB 5EWIH 3VGGA 1CE6B 4U1SA 3QNXB 5EUOE 4PJCB 4F9LC 4XC1H 4HF5H 5DRNA 3VGDA 4PJFF 4LAJH 3GMQB 4BH7A 3FN0L 1EVTC 4R2GC 2DRUA 5C09D 3F7QA 1AKJB 3RQ3A 4EOWH 1TPXB 3U7WH 5ESVA 2X4QB 4PS4H 2DMKA 3UBXB 1N64H 5DMGC 1BX2A 3P0VH 1F6AA 4U1HB 5INCB 3VI3E 2ZZUT 3UTQB 4IOIA 2VXSH 1YY8A 5ISZE 2JB5L 4ELKA 4S0TD 1ADQH 5AUMB 4CNIB 1D5MA 4JQIL 3N85H 1G7IB 1Q0YL 1U8LA 1TVHB 4XCEA 4LPYA 4W68A 5C6TL 3NIFE 1J0KA 5IJKA 3EOBA 4X6BA 3GIVB 3ALPA 2A6IB 5EBMA 4XP1L 4WIQA 4TTGA 4QKXB 1UKTA 4K9EC 1YNKH 4OCYH 5DRNB 7CGTA 3C5ZD 1KPUA 1WWBX 1N8ZB 5IK3A 3SKNA 2N4IA 1MI5D 1PZ5A 3AM8C 3WFBH 4F2MB 3CVIH 4FQXD 2DLIA 3RJQB 1IFHL 2Y36L 1YY8B 4RGND 1ES0A 1X5HA 4UV4L 1J18A 1I1YA 4ELKB 3NACH 4NC1C 4JM2D 1MCEA 5MI0B 4LCIL 2F8VA 1D5MB 4JFFD 1U8LB 3KGRA 2CR3A 3CK0L 2VISB 4LFHD 1GGCL 4GH7B 5DDHB 1G0XA 1JRHL 3H42L 4W81A 3EOBB 2XXCB 3U46B 1MAMH 5EBMB 5JW4R 1RUAH 4ERSL 4UT9L 3FO2A 1CL7H 3RVUD 2E6JA 4ONGH 3JVGA 4QF1A 1KJ2H 5C0FA 2MQ0A 4ZFZA 4HWUA 1KPUB 3BP4A 4YHOL 5DJ6A 5IK3B 5JNYA 1MH5A 4JJ5B 5DJYB 1NC4A 4FABL 5E9DD 2VQ1B 1FNFA 2DM2A 5JHLL 2J8UE 4AY0A 1N2RA 3DHJA 1G6VK 4KUZH 3I9GL 4O51B 1A4KB 4UT6L 3V8OA 2HJFA 1C7SA 5J12B 3H3KA 1RVFH 1T2QL 4KHTH 4OF5A 5F1SA 5FUOH 1HNFA 5JQ6H 3SGJC 3QG7L 3X3GL 1VDGA 2HJLA 3FO2B 4IIQC 15C8H 2EYSB 3O6FA 1NQBA 1T7ZA 3BXNA 4NQXA 2YS4A 2W0LA 4GG6E 1P7KA 1CBVH 4GW4A 1U8QB 4ZFZB 2Y4SA 4PY8J 1I3RA 4LQFL 2EH8H 1C16B 4QRPD 2E7CA 3LRHA 3OKOA 3CC5A 5JNYB 1NBVH 3IXAA 3KWWA 5L2JA 1HWGB 1NC4B 2AV7A 5DGQA 2EDJA 4LEXL 2UVFA 4WHYG 4XNYH 3CU1A 4OFKA 1N2RB 5FXCH 2AXGA 5DQJA 1JZ7A 2YC1B 2E8YA 5DD5L 4PB9H 3GJEA 2PUQT 1DBAL 3TYFA 1A3RL 5F1OB 5KOVC 4ETQB 5J3HD 4YAQB 3LQZA 2HJLB 3B5GA 5I1GH 2G5BA 2OZ4H 2BHZA 4QGYA 5E2WH 4QGTA 2W65A 1J7VR 4U1MA 5C3TA 1R0AH 4K7PX 3O6FB 4NQXB 4ZXBC 3GMNB 2HT2C 4GW4B 5EU3A 2X09A 3UPRB 1T3FA 1IC1A 5JR1L 2EYTA 5FA3B 3V4UL 3OKOB 3VD4A 1FNGA 3IXAB 4M43L 3KWWB 4L5FL 3WO4B 3D39A 5IFJB 5JW4N 2PTVA 4YHKL 4J3TA 4Z7VE 2AXGB 1JHLH 1JK8A 5DQJB 3PL6C 3CX5J 4MDIA 4R0LC 4X4ZA 4LRNL 1F11B 3UJTH 4N1CA 3VW3H 4KH2A 3B2UD 4HXAL 5FYKH 2ADIB 3WUWB 2AERT 2XN9B 1KJ3H 5ESQB 5MEPB 2W65B 4U1MB 3O4OC 1HHGB 1JZ8A 1T0PB 2EIDA 3OAZH 4JRWA 3BDYH 1T3FB 4QRTA 5D7IF 5DUBA 3S4SG 2EXYD 3HG1E 4JFZH 2R1YA 5F88A 1FNGB 3VXOA 5TFSH 4R7NA 2DKUA 2X89A 4TUKH 5CUSL 4NDMA 1CFQA 2D7QA 3QXUA 4MA3B 3BE1L 5EZLB 1BJ1J 2C3GA 4L8DB 3LQAC 3WFHB 4IIQB 1JK8B 2XQBL 2MWCA 1Q1JL 1EFQA 4PJAF 3BRDA 1G9NH 3RU8L 1A2YB 1GAFL 4WEUD 1QSVA 1JHKL 4HUUA 4DKEH 5H2BB 1TJHH 5BMFH 4XNMA 1KT2A 4XX1G 1JZ2A 3KPPA 5FCUH 1FNSL 3H8NA 1G7MA 3TCXA 3EYFB 5ID1B 1J1PH 1XCQB 5IROC 1YEGH 5EU6D 2R9HD 4JRXA 2R1YB 5D93C 3VXOB 1MCDA 4U6HA 3DGCR 4YGAB 4NDMB 1CFQB 3VH8G 2HFFB 3D85D 4WUUD 3JWDC 5I1CL 5DMKA 4HJJH 3B5HA 3VFSB 1MREL 1B2WH 3SGDH 1ZHKA 3IJHA 1JZ5A 1UXSB 4G6MH 1S78C 4TSAL 2AEQL 3MBXH 2ICCA 1DN2A 2XOTA 1I3UA 4X5WB 2BDNH 1CGTA 5I1JL 2ED8A 4HUUB 3DJ9A 4X5LA 2PO6D 2Z8SA 3BKCL 4LSDA 4TUOB 5KAQG 2NR6D 2OL3L 3KPPB 3RWCA 2A2QT 3TJHD 1OWWA 2GYSA 1JNJA 1G7MB 1ZA3B 3S7GA 1ITBB 4DOHB 1TIUA 1NAML 2FEEL 4M6OL 4BK5A 1AP2B 3U30C 4JZOA 3BPCB 3F7VA 5T3ZD 3EDFA 4R0LB 1EZVY 1HDMA 2X2YA 1UA6H 4M5ZH 1A1OA 2VLLA 2GAZB 4M03A 3UP1A 4J3XA 2Y72A 2IG2L 2P24A 4PRAA 4OFPA 3UTTA 3LN9A 1NSNL 4PLKC 3RZWA 1NGYA 1ZHKB 2VB5A 2JB6B 1QSZA 4WHCA 2VAAA 2OR7A 4I77L 3UX9B 3IDMB 4HBCL 3DSFL 1DSFH 1FDLL 2LABA 1I9RH 3I02A 3EJJX 2RIKA 5CJOL 3P4NA 3OAUL 3JXAA 1X5JA 3RWCB 4DGYH 4RX4A 1LNUA 4U0RB 1KCRH 3ZL4H 5T1KA 3UTSB 1J05A 4BQ8A 3OPZL 1T03H 1OGAE 4JDZA 3HS0B 1FO0L 4DVBA 4YHNA 1XGPA 2VO5A 1YQ2A 1A1OB 4JKLA 5IVXA 1VACB 4YO0B 3ARUA 4AEEA 4KZEH 4FQIL 1NCAH 1LO2H 2R0WH 1KTDA 1NGYB 4RAUA 5C0IA 5E2TH 4NOFA 3EJZC 5AAMA 2VAAB 1QEWB 3CCHA 4WWKD 4WCYL 3B9VA 5HI5C 4L3CB 4Q9QL 2FECI 5D7KE 5E8DL 2BCKA 5IBLC 3VXTB 5D93B 3MYZA 3QUMA 2ZSWA 4OCSL 4KKAC 2WWMC 1MHCA 1MPAL 3ZDXE 1FNLA 5GJTL 1BF8A 4DW2H 1I1AA 3L5WB 1ODAA 4OD2A 1OTTD 1L9MA 4G8EA 3WS6C 2XQYG 4JDZB 1DQLH 2OCFD 4DVBB 4R6UA 4YHNB 4R4BA 1U3YA 5BV7H 2X05A 5SWSE 4Z7WF 1JNHA 4PJGA 5CCKL 2HWZH 5IVXB 4EI6B 4M62H 4DEPC 3SY0A 1G7PB 1BP3B 1KTDB 1I1RA 4URTB 5C0IB 3NABH 4FZEH 1IGIH 2HKHH 4HK0A 3CCHB 3GM0A 3NPSC 1Z9MA 5C0RL 5IEKA 4Q9CA 5TPWL 3MRDA 1ZLSH 5DK0A 4LFHG 4RRPG 3QRFM 4FP8H 2MSPA 3K2UL 4YWGH 1DN0A 2APVA 4M9OA 3OJVC 4WFHD 4G8EB 5EU7C 3LKOA 4NBZB 2ADJA 1G7QA 1YMMB 4Z0BH 1RUKH 2J6EA 2K7PA 1OAZH 5CZXD 3IDIA 4R4BB 1NGXA 2WIIA 4XPTL 4PJDA 4U3CA 1MQKL 4JM2F 4GUPB 4PJGB 3DVFA 3GK8L 2O61A 4Z18A 2CD0A 5HI4C 4S0SD 3QEHA 3THML 4RMTA 3TZVB 4F33A 5E8EB 3RVXD 3LEXA 2ZJSH 4I3GA 3SY0B 3O2VL