2FATL

An anti-urokinase plasminogen activator receptor (upar) antibody: crystal structure and binding epitope
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anti-urokinase plasminogen activator receptor (uPAR) antibody: crystal structure and binding epitope
pubmed doi rcsb
molecule tags Immune system
molecule keywords FAB ATN-615, light chain
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL01
4Y2OA 2F58L 1FQ9C 2D31B 4LCIH 3UX9B 3MRRA 1M05A 1P7QA 1BEYH 3WDHA 1S9XB 5IGXH 4NRXA 5EUKB 4YEEA 5IBTH 3O9WC 4OZ4A 1INQB 4LDOB 2YD1A 3C6LA 4MJ6A 2P8LB 4OQTL 4MAYC 3RGVC 3EYFA 4N90E 4MJ2A 2L7JA 1PD6A 5DTFA 2X2YA 4U1JB 4Y7MA 1DCLA 3FQNB 5D2NB 5C8JA 1HCVA 4KGJA 5FGBA 3F5WA 1V05A 1JYNA 2BNRE 5T1DH 2XZQH 4Y4HB 3PJSA 4PJHA 2ADGA 4PJ7A 1ZVHA 5H2BB 2X09A 1K85A 1E27B 1HWHB 2EDQA 4O9HH 3SQOL 3RUGA 4TOYL 1K8DB 3VFMA 5BZDA 5GGQL 4WWKC 2FEEI 4M4PA 5CSZA 3SDAC 3BYYA 2DLEA 4LSPH 5IR1B 3BKJL 1C5CL 2DJ4A 1ZT1B 3TV3L 4JG0L 1FCGA 5AAWA 4HFWA 1RULH 1A6AB 4WHTB 5SWSD 5I74B 4DN4L 3QWOB 4QTIL 2VISB 3MC0A 2ZPKH 3HMXL 4KMTL 5FYJL 2YC1B 1UM4L 4Z7VF 2DLFH 1IAMA 4MQXD 1TXKA 4OLYH 4PG9A 4OLWL 5C0CA 3CJJA 1MREH 1T1YB 3D25A 1IAKB 5HXMA 4UTAH 1FFPA 4ELMB 3BT2L 5D2NE 1IGMH 2P8MB 1WF5A 3GGWB 1HXMB 1N7ML 1G7PA 5KAQG 3PQYB 3V6OA 2CIKB 4U3CA 4F9PA 1FL3A 3QUYA 1KTRL 3FT4B 5FYJE 2FEEL 5DJYA 1SBSH 4DUVA 2VDOH 3F12A 2OSLA 3IDJB 1GGBH 3BWUC 1GH7A 1NAMH 5E8PA 3C5ZB 5BS0B 4PGJA 1MH5B 4HH9B 4PTTB 1MCKA 2EIBA 3BGMA 3QI9B 5JXED 2J3SA 5E4EC 1CGYA 4ZFOB 1D6EB 2MTPA 3SEPA 4L5FL 5GZND 4JKKA 3QJHB 3BKML 3C8KA 2APBA 3VFUB 5CGTA 4O9HL 3U9PH 4WW2B 3GNML 3RZCD 5HHVL 2AJXL 1N0XL 1ADQH 1EEYA 4PRAB 3EYQD 4JFDD 3HRZB 2YUVA 2QHRH 1FL6B 4DOHB 1A7RL 1MI5D 2VDRL 2DS4A 2DQEH 4OGYH 1NGXA 2E6PA 5C0JA 1DEDA 1S5IL 4M61A 2A74A 1G1CA 3MRGB 4JB9L 4YR6A 3M17A 5D93B 3DETD 1DL7H 4UIMB 1QLRA 3U7WH 1J0HA 3WO4C 3VXQA 4GAYB 1PDKA 2HA1A 3G5ZA 2AQ1A 5C0BE 4OLWH 2HLAA 4FP8L 5F7KC 5IJKA 2I9TB 5D1QD 5HVGB 1QG3A 4OZHA 4ZYKB 5C7XL 1F97A 4N8PA 3MJ8A 1ZXQA 1Z0NA 2ITDA 4U6YB 3V6OC 3QNXB 3RTQD 3VRLE 3DX8A 3RGVB 3S36X 3F5WB 3S3PA 1B4RA 2X4PA 2DIJA 3H42H 1CGUA 2IC2A 4M8VA 3K74B 4HIIB 4AEIL 3DVGB 3SDXA 1ZHBB 2OP4H 1H9VA 1DEEA 1PLGL 5FK9A 1QA9B 2NZ9D 4OCRH 2K9UA 1EBAA 1RHHA 1BFVL 5FA3B 4HEPG 1BVKA 3KXFB 3S36L 1ZHLB 4Z7WB 4UZGA 1X4YA 4PG9B 3LN4A 4OZIA 3BW9B 3TNMA 5FO7B 4YDIL 3GSWB 4PJ9C 5CJXA 3QO0A 5L8LB 3V6ZA 3C6LD 3MQIA 3DURA 1IFHH 1QD0A 2XQBL 1NCWL 5TQ2H 1HE7A 4CVZA 1N3NA 1OAQL 5JNYB 4I0PA 1NGYA 1CFQB 2Y36L 5DJ0A 3QDME 1B2WH 1QFWM 2DI7A 4PJGA 4KDVA 3CVIH 4NQUA 4ELMA 2NY4B 1XCTA 3CFKB 3LAFA 3U0PB 3CZFA 4FXGB 3RVUC 4OCNC 1D5BB 3ZYZA 4YEFA 5BS0E 2W0LA 1GOGA 5FB8A 5IB3B 2AV1B 4MLSA 1WBYA 3KPLA 4JO4H 4M6OH 2JCCF 3OGOE 4K8RH 1T20A 1BD2E 3SCMC 4LKXA 4BFIB 1YQVL 1QP1A 1FL5A 4NN7C 2NNAB 1W0VB 3EAKA 4NQTA 2J8UA 3ARGA 1CQYA 5DMIH 4WFED 3EZ8A 1I8KB 3AMKA 4NRXB 1U3JA 4DQOL 1HXYA 5D5MF 1NGZB 4MAYA 4DZBB 5C09E 5I1LB 3ULVC 3P3YA 4JRXD 2ZCKL 3ZHLA 3QQ3A 2MOVA 2YEZB 1VFAA 3C5JA 4HG4J 4H8WC 1MJ8L 2ENYA 4X7TA 1OF2A 3BIAX 4MDIA 4KHTL 3GMQB 1U8IB 1FCCA 5LQBH 3LS5L 3M17B 2FJGB 4F57L 3JWOH 5E7BA 3MJ8B 2BVOB 3KPSA 1PEWA 2QADB 3BP7A 4ONGL 3RIAK 1VEMA 5IM7A 4L9DA 1NCWH 5C8JB 5TQ2L 3HI1B 4G80B 3ROLA 2WBJD 2XXCB 4C59B 2C1OA 2HG5A 5BO1H 5LBSH 2QADD 5F3HB 3R4DA 5C07B 5J8OA 2EE2A 4PJEB 3MOQA 5D5ME 1EA9C 1KCKA 4JPVH 4I3GA 2BY2A 5D1XC 5E2UL 1S9VB 4DKEL 1Z9OA 1KG0A 4GMSL 4IDJH 4LOUC 5HYQA 5E6IC 5FDWA 3LPWA 2PO6B 3RZCA 4HXAL 1KCSL 2BY0A 3TZVC 5INDA 3DV6B 2DKSA 4WHYH 4N5UA 3U4EB 1MLBA 3OKLB 5D70H 5MI0B 1T1ZB 2WINA 3STZB 2GQHA 3WLWD 4APQB 1S5HB 1XGPA 3LOWA 4XP5L 4OM1H 4LFHG 4M6OL 4G9DA 2YC1A 5IVXF 3QR2A 3BW9A 1UM6L 4TSBL 5TGBA 5DO2D 1BFOB 2CD0A 1P6AB 3R1GH 4Q2ZB 5JOEA 1P84J 2JELL 3ILPB 3WDIA 1YYML 4UAOB 1EAJA 2R39A 3O3DB 4YPGB 2AEWA 3QT2A 1G9NL 4KK9C 3RVVC 3ULVE 3KYKL 3E6FB 1JHKL 1PX4A 1J0ZA 3IDJA 2MCPH 1Y18B 4XPGH 3UTTB 1XCTB 4LLWB 4OF0A 6CGTA 2DQJL 1DE4A 4FQIL 5CEYB 4UUJB 5DDHB 4GBXC 3G5XA 3OXRA 1NLBL 3RWIA 1YEGH 3LKQB 4LLMA 4JM4L 5L9DH 3LS5H 2VZ1A 3UTTD 1JI1A 4M1GH 4TUOB 25C8L 3JTTB 3HPLA 2V5SA 3I84A 5CEXA 3S34H 4WEBL 3QCVL 2AXGA 4P5KB 5T3ZD 4OJFH 4X0KB 1JMZA 3GJFK 2FO4A 3BE1H 3T0WA 4L1DA 3REWA 1KIQB 3QPQD 2QTEA 4JFPB 2X89D 5DGRA 4JPVL 3AM8C 4JN1L 4GSDH 3WLBA 3GB7B 4WU5B 3B5TA 3HUJA 3BZEA 1EEYB 3OR7B 1KEGL 4OGXH 2FLBT 1JZ3A 1G6RL 4R2GC 1M1SA 3EO0A 3T77A 5BQ7A 4J2XA 4MD5B 1D5ZA 2FJHA 4TUKH 4YBQC 1I9IH 5L7XH 5DA0B 2OXGA 2OCFD 3MPCA 1IGIH 3MMEB 4ZSOB 5I1CH 2GFBB 3RX7A 3PGFH 1RZ7H 4ZO6A 1AHWA 1WTGT 5IBTL 3N1PC 1K4DA 2I9TA 3VXTB 5JLZA 1FV1B 4WUUD 1TMCB 4XWOD 4Q97A 2P1YA 3QUYC 4JJHA 1DFBH 4WU7B 2AV7A 3F62A 4JFZL 1YYMH 1AD0B 3W0WE 3ROLB 3RY4A 1G9NH 2AAVA 4QRRD 3TYGL 2CUHA 1MRCL 1U8NB 3M1BA 2AKRB 1U36A 5DEFB 1E4XH 4HDIA 4X98A 5SWQB 2H41A 4X6FB 4L9LA 3IDXH 5E08H 5TF1L 1M7IA 5FKPA 1MPAL 3HC0B 3HR5B 2HWZL 4MMXC 1KNOA 2E7LA 4YXLH 1N6QL 2ATPB 3PGDB 4Z7WA 1LNUB 4HWEL 1KLFA 2EYSA 3SKNA 2WSKA 3MO1B 2DQCH 3KPSE 3X14A 5JXEA 4Q6IB 3WXVL 5ELIA 5C6WH 4CVZB 3BRDA 4NKMA 5J11C 1FRGL 1S7UB 3FT3B 4JN1H 4ZNCD 4RFOL 5AUMA 2R0WL 4UOW0 1LILA 1KEGH 2BOBB 3H9SA 1D5XA 5E99L 4OQ1A 1AKJD 4JM2C 4IS6B 2M26A 3QEGH 1AR2A 2IGFL 4ETQA 1QLFB 4FG6D 3UTTE 4UTBL 4X8JB 4IRJB 1YJDL 2AV1A 3BXNA 4JGJA 4QO1A 4DKFH 5DD3L 4TUOA 1DLHB 3SDXF 4BZ2H 1AC6A 4L29A 4RGOL 4RAUA 3OKDB 3WLBB 3K1KC 1UEYA 2X4QB 5B39A 2NY6D 4O2EB 1QRND 1MQ8A 5JW4N 5IJVA 1F90L 5EZOH 3OWEA 3O3UN 4PJFF 5FGRA 2F9BT 3D87B 4OAWA 5DJXA 2HH0L 2AS5M 4MD5A 1NGZA 4MAYB 5I1LA 1EMTH 1GC1C 3KPNB 4JHAL 4PJDE 3NAAL 1JNHA 5KANI 1WUNT 2HWZH 4YE4H 4JHWL 2NY1B 3MCLL 5BOPA 1ZA3A 1AI1H 4OF7A 4P9HL 2D03H 2FJHB 3CC5B 1MJUH 4MS8D 1ZWIA 4U05A 3BP7B 4JPWH 1WTLA 1KJ2B 4P5TC 5CBAB 3B43A 3TCXA 3G04A 1DL7L 2BVQB 4LRNL 1U9KA 5DMKB 4M5ZL 4WTZG 5LWYH 5GS1A 4KZDL 2PYFA 4AH2A 2V17H 1ZAGA 1BWMA 1DQQB 5D71H 2X7LB 1ORSA 4JVUA 2IH1A 4K71B 4YHOH 1H3PH 2I5YH 2VLRD 4TQEL 3UCRA 1T7ZA 2CK2A 2FBJH 3DUUA 4Q6IA 3TJEH 1JF1A 2VO5A 5I8EB 4M1DH 1MOEA 3IFOB 4YDJA 2R4RL 4PV8A 4M7LL 3C5ZD 3MXWH 1FNGB 1JUFA 3EFDH 3KJ4B 5TGBB 3THMH 1D5MA 1U8KA 3KPRB 4P2OB 3A0OA 3U1SL 3N50A 3DVNA 3GSQB 4NQSB 4U6HA 1EHNA 4P4KB 4LFHD 4ERSH 5FECB 3BESR 1NCDH 3K81A 2UVFA 4L4TB 5KW9L 1JZ4A 1JV5A 1IFHL 3INUL 5D1XB 4XPHL 5F1OB 4CVXA 1RUAL 4IBLT 1ZT4B 5FYLL 1NMAH 1NUFA 2HLFC 3VXRA 1DR9A 4Y5YC 4PJBE 4PJ9D 1NUNB 3L95A 4I18B 5FUZL 2NCMA 1PAMA 4FRWA 4KROB 1GZQB 4PRIB 4HG4K 4OBRA 4K3DL 4HKXA 4JQXA 3EZJB 1OTSC 5FOBA 3VG9B 4I3RL 4V1DE 3KYMA 1FG2A 3HZKA 4RMWA 3O6FB 4JFPA 4N0UB 5KVDH 2W38A 1UH2A 1I8LC 3KPNA 4MZ2A 5EWIL 4R97B 2O5ZH 3TN0C 4WFGE 4XVSL 1CXFA 2ORBH 4LVHC 4OCMC 4LPYA 1CICA 4N1HB 1YNKL 3DSFL 5E2VH 2EICA 1NEZA 2Y5TB 4JFEA 2QR0B 4M1DL 3T0EA 1T7YA 4M48H 3IAQA 1LP9E 3GMPA 1Y6KR 1FYTE 3DPBA 5D2LE 2CRIA 3OJVC 5DI8A 5GGUB 1GGCH 2AV7B 2P5ED 1EO8L 4DKDC 4RRPG 4PJDF 1D6VH 1XAUA 2PYFB 3UPRA 3VI4F 1DVFC 4MSWA 4KK9D 3MGAA 2N1KA 5EUOF 1ONQB 3PL6C 1RUAH 5DEFA 3UO1H 4Y8AA 1KTKE 3OAUL 1AIFB 4OZFA 3RWDB 3GM0A 3E0GA 1ETZB 4PLJD 4YC2B 5E9DB 1QOKA 1L9MA 2PTTB 5FOJA 5I8EA 2A6KB 2F5BL 5D4QA 5T33H 4YDJB 4QRTA 4JFFE 2YK1L 2PETA 2OI9B 1EH9A 4ZXBB 3MCG1 1R3JB 4GMSH 1BOYA 1JF1B 1GSMA 4I3RH 4OD2B 1C08A 3O6LH 1KACB 2MNUA 5D7KE 4YUEL 3H0TA 4IMLA 1JUFB 3RNQB 3FO1B 5C0BB 4MB4A 2P5WD 3O4OB 4QRRA 4GW5B 4XBGA 1PG7H 4U6TA 4PGEA 2BOBA 2QSVA 3D0VB 4GS7B 3IDYC 1T89C 3SBWA 1A02N 1JF6A 5FF6A 4PJ7E 2HT2D 4H25A 5BXFB 2OZ4A 1X7QA 4FQJH 4Y2DB 4NRZA 5EUOB 3CMGA 2V5TA 2XTJE 1T1XA 3JVGC 4KGLA 1Z5LB 3KYKH 3L95B 2VXUL 2YA2A 5MEOA 3O6FA 3WSQH 4LCUB 5GGSA 5AZ2L 2X4UB 5SWZA 3RVVD 1YEGL 5L9DL 2ADFH 3UMTA 1OGAE 5CZKA 4S0TD 4XI5D 4FABL 1N8ZA 3CH1B 1NC2B 1ZANL 3PDDA 4NGHL 1I7ZB 2R69L 2A38A 3OB0K 4Y4HD 4LVNB 4IRZH 2CKBB 5JIPA 4LLVA 5GS0L 4OB5L 4TTDC 2FH6A 4HJ0D 4L4VA 4MB5A 1MWAA 4R26H 2F15A 5KSBA 2YUZA 3BH9B 4K7PH 2B4CC 3VWKD 4NYLA 2XFXA 1BOGA 2DQHL 4HPYH 5HHNA 4LSTH 3S97C 2D7MA 3MR9A 4C56E 3D69B 5F9JA 2LU4A 3VG0H 5IBUB 2H9GA 5CD3B 1MFAH 4GRWE 4WJ5A 3T0XA 4QOKA 2CXGA 5EZIL 1YECL 4O2CA 4KUZH 5DC0A 5BVJA 3RWDA 4QWWC 4A2MA 2J6EH 4Z76B 3HFMH 1MHEA 2JJSA 1TJGL 1A1NA 4UNUA 5D6CA 3O6ML 4HUNB 4GJTB 3IF1B 3REVB 3FN9A 4WI3A 4PJHE 4KQ3H 4YHLL 4NP4L 3TYGH 5ENWB 2X89A 3RUGE 1N6UA 3SGKC 5E0QA 5GSRB 1S9XA 3K80A 4J3OC 4W4OA 4OZFH 12E8H 2DI8A 1BQHB 4NUJA 3RDTB 2AGJL 3RL2B 3UJIL 5A43C 5MI0C 1CFVL 5FYKE 4I2XE 4XBGB 1LEIA 2H8PB 1RAMA 1GC1H 4MA8L 2QSCH 3RNQA 5HGDA 1MHPL 1DN2A 3SDDD 3VW3L 4CKVX 4JPKH 2ITCA 5TE6H 3SJVE 1JGLH 1G7IB 1P4BL 3MJ7A 1X7QB 5J9PA 3ULVD 1KB5H 2GJ6B 1PSKL 3R0NA 5C6TH 1K8DA 1R5IB 5F8QC 3HCVB 3D0VA 3T2QA 1QBBA 3QEUB 1RZKH 4K7PL 4G6AD 3HAEB 3IXAA 2W9EL 1YEJH 3Q1SH 1VDGA 1P9MA 4ZS6C 3BO8B 1T0MB 4LHUB 3W81A 4ZUUB 1T1XB 3QXDB 4AQOA 4DN3L 1C7SA 3DECA 1CICC 4EQ2A 5CEZL 3BYTA 1Z3GL 1A3LL 5EZIH 2VRAA 1TITA 2F53E 1N8ZB 3LN9A 3ZL4L 5H35A 4I9WD 2GT9B 2M1KA 2W65B 4P4KC 3KYNA 3TNNA 1ZLSL 5B3JE 4XXDB 3BH8B 2EDHA 4HUVA 2H32H 5F1NA 1L6ZA 1YMMB 4HKZA 4NQEA 4EIZC 5HHQB 3ARFC 3GMRA 4TVSa 1SJEB 3KHQA 3OKKB 4NO5B 3T1WA 5E56A 1RK0B 1U93A 2W60A 4JVPA 3UZQA 5KSAC 5J1AA 1ADQA 3NFNA 3VFPB 4E41A 1IAIL 4W6XB 3S9DB 2IQ9H 3P73B 3QIBB 2NYYD 4H20H 2V7HB 3C5ZA 3MV7D 5BS0A 1OP5H 1GAFL 1AI1L 1RD6A 5I1JL 3NABL 3GIZH 1MHPH 3DNKA 4V1DA 4P23B 4RQQA 5ANMB 4ZFFB 1JIBA 3A6CL 2X5PA 2L4OA 3QI9A 5F6IC 3WEXA 1IKNC 5HGGS 5C0EB 4U1GB 3PP3H 4J12A 1OWWA 5GRUH 4QRRE 1OGTA 4LOUD 2UY7A 5KSBF 4MA7H 3KPPA 3MRHA 6FABL 2DKUA 1H3VA 1JN6A 3SDYL 2ICCA 1A1NB 1HILA 5D6CB 3N1FC 1HINH 1KCRL 2OM5A 4CMHC 1ZTXL 3VRIB 4G42B 2WBJC 3BSZH 3UJJL 4YXHH 1DBML 3MLWL 4JFQB 1N59B 4OD2A 1Y6NR 1HKLH 2R56H 4JFHD 4LIQE 4XP9L 3K4ZA 4P46B 2EZ0C 1L7TL 4H1LA 1WT5A 4QEGA 5ALCL 5KVFH 5CKGA 2R0KH 1G7IA 5B3JF 4R9HA 4I0CC 3D85A 3MXWL 4YDVB 2OJZH 5I75B 3QEUA 4UV7L 3G5ZB 2QL1A 3RTQC 3LRSB 2AJ3A 4RX4A 1QRNB 2H32A 5JOFB 3IGAB 5IW1B 3MUJA 3LHPL 3W11D 3IVKA 3Q3GA 3V0VB 5MEND 2Z35A 1FAIH 1P5UA 2JCCE 4JFOB 3S96B 3U6RA 4AM0A 3KPTA 2J8UF 2IWGA 2DBLL 2R1YB 4JZJC 4ZFGL 4XAWH 5BW7C 1VKXB 4OZIB 1UWXH 4H20L 5DZLA 2AK1L 1DQJA 1HQRB 5AYUL 3ZDXF 2UWEF 5ERWB 4OFYD 4UIKL 1NAKL 2FBOJ 3BP4B 2IQAB 1UKTA 4GQ9L 3V4PH 3QQ9D 3T8XB 5GS0C 5JNYA 2JJTA 4NQDD 1FFNB 3QDJE 1KJ2H 3DX9B 2IEPA 1OOAA 2Y23A 2FATH 1M7DA 1AO7B 1WWBX 3I50H 4ZOEA 3WN5A 1U6AL 3ZE0F 2YKLL 2P45B 4UB0H 4BQBA 4AMKH 2ZJSL 2YPLA 4DUXA 4RA0C 3C2AH 3NIDF 4Y4KC 5I1EH 4YGVB 1RK0A 4J4PA 2JF1A 1FGNH 4FXGA 4RIRB 2JKXA 4LSQL 4X4ME 4WI6A 5C86A 3ARED 3MREB 1WCBB 1RZ8A 4RBPK 2BVUA 4NFDA 3F8UB 5SWZE 1JN6B 5I18H 2ESVA 2R0ZH 3BEVA 1NFDE 1I9JH 3ORJA 4XVTH 3Q48A 4ZAKB 4W4NA 1FIEA 5KVEL 2F54D 4L4TD 3HMXA 3KPPB 2WIIA 4S10A 2HAZA 2NMSA 1HSBA 4PJDB 3VRLF 3AB0C 5DQDH 4HSQA 2Q20A 4G8EB 2OK0L 4X7TB 2V2TB 4ZMAT 1A7OH 2Z31A 3QO1A 4NZRH 2A2QT 2NX5D 3V4VL 2J88H 4XCFH 2EKSA 2MCG1 4DGVH 1MAMH 3GHEL 1QKZL 4ODSL 5D6DA 1R5VA 2AJVL 2P8LA 3WFDL 5JMOC 4P46A 1IT9L 3SN6N 4Y88A 3DSNA 1FO0H 3IGAA 1I3VA 5DTFB 1IM9A 2R29L 3DGGB 3Q3GB 1FNFA 1HDMA 4G3YL 2DWDA 4NO0B 4WNQB 3V9FA 4GH7B 1R24B 1H8SA 3UTPE 2HFFA 2Z93B 3LEXB 3W0WA 3JBG7 3AROA 3D3VB 3ARTA 5E6ID 4JQVA 1BZ7A 4YHYC 4P5MA 1LO5B 1T0MA 1DQJB 3OGCA 4DGIH 3TH3T 4NNXA 2JCCB 1U8MB 1BMGA 3QXDA 3MV9E 4HS8L 1L4IA 5D9SB 1DQML 3K2UH 2LV4A 4B41A 4KQ4L 4R4BA 4LSPL 5JQ6H 3GHBL 3KJ6L 1G6RB 4BFBD 1MRDH 3I9GH 5D2LB 15C8H 4H5SB 3ZKXC 5JIIA 3RY6C 3QDJD 5EOTB 3SDCA 4B53A 1AXSA 5I18L 3HUJF 1KXQE 2VWEE 3WD5L 2UYLA 1F4YL 3B6SA 4LNVA 5C0CB 4HZAA 5CJBA 4D3CH 4LDLB 1UM4H 2CDFA 1X44A 1J0YA 1T7VA 3GMRB 5EU6B 4N0FB 4ZUVA 1JBJA 4L8BB 7FABL 4FABH 1IE5A 2XQYK 5DRWB 4U1MA 3FOLB 3G6AA 1NCAH 4HK3J 5JZ7C 1DBAH 3RWIB 4ZG1A 4LBEB 3C60A 4G8GE 3IDIB 4OLZL 3QNZA 4U1KA 3UTTA 1RZ8B 3QZWG 3ZHKA 4D0DA 1CLZH 1QKZH 1BJ1J 1A2YA 3KPQB 4KJYB 5JOPE 1BP3B 2ZUQB 5HDOA 4RIRA 1NBYA 2H3NB 3RWCB 3HLAB 1U3HA 4LSTL 5L2JB 4GAJH 3ZDXE 5DMGD 2BVPA 3MFFA 3MRIB 4LAQL 2GTWB 4Y1AE 4E0RB 5JPNA 3QDHA 2YD2A 5SWSE 5CJXC 4MD0A 1UQSA 4L8CA 3E2HC 35C8H 3OR7A 3C8KB 2ESVB 4CU6A 4M6ML 4PRPD 1NBVL 1IC1A 1OQXA 1BZQK 4PJIF 1OT1A 4PJ7F 2MJWA 4PGBA 3WLWC 4HS8H 1XZ0B 4X4YA 1MUJB 2A83A 2Z91A 4G6MH 3M07A 5EORL 5EBLB 3K1DA 3AU1B 2OQJA 3O6KL 5T3XL 5ESAB 4K94C 4Y2DC 2EXWC 1CD8A 1VFMA 4P46D 1G7HB 2DQEL 3QHFL 3CXHJ 1HYSC 3WD5H 4GAYA 4PBXA 4YDVA 2X4RA 3NCYS 2HLAB 2AGJH 3UJIH 2NXYC 4HV8A 1IKNA 1MCOL 3PJSB 4PJHB 1FDLL 4XTRC 3W0WD 2ITDB 1F6AA 2VQ1B 1QLEL 3QIWA 2BY1A 4MYWB 3C5ZC 1IM9D 3IXTA 3QDGD 5T3ZL 5C0IB 2ADIA 2VLLA 4HIEB 5F7EH 1A6UH 1AR1C 3B2UD 3GK8L 4LLDA 5J56B 1YDPA 1PSKH 3QDGB 2IAMD 3QZWB 2BNRA 1RHHB 4AEIH 1AXSB 1YEJL 3Q1SL 1XGQA 4GW1A 2HFGL 1RJYB 4TPRH 1JFQL 3TN0D 4LCYA 4UNVA 3X14B 5TDNA 4H0IA 4OD3H 5SX5K 4I0PB 1LO3H 4XNUH 5IT2L 1CLYL 3FT3A 4ETQB 3MRCA 4KK5D 3P9MB 4R96B 2H2PD 2R15A 4I0PD 4OSUL 4X8JA 5HHMD 3GMMB 1J88A 2P24B 3EO1B 1HQ4B 3GKZA 5I76A 4LMQE 1Q1JH 5ACLA 1IGJA 2VDPH 2W9DL 1UB6A 3JV4A 4C56B 1G9MC 4F15B 1FVEA 3V6OE 1QSVA 1GXEA 2NY6C 3GMNA 5E4IA 5F97E 1UWXK 2BVPB 1T04A 4RDQG 4I2XB 3VFSA 1IEAA 4NCDA 1VESA 4GXUM 4ODTL 5CUSH 3VU2A 4CJ1A 5I71B 2HKFH 5GGTL 1MIML 2Q3ZA 4X4ZA 2Y7QB 3EJYC 1A6UL 1QSZA 1C8PA 32C2B 1P6FA 2GJ6D 2VQUA 1FGVH 3DUHA 2YPLE 3O8XD 2WQRA 2QQLH 2WP3O 2DIAA 4JFEE 1VFAB 3C5JB 1NUDA 5C71A 4XNYL 3T2OA 4MDIB 4HWBL 1ZLWK 5EBLA 1CE6A 4FS0A 4P2QB 3NH7H 4YXHL 2FJGA 1ROWA 2X4TB 1IM3A 5IVNA 5DFVC 1GHFH 1MCBA 1WC7B 5T5NF 4LCCB 3NMEA 1HDMB 4X4MA 5JOPD 2EKJA 2VQ1A 2KQMA 2X4RB 5DT1L 1DN0A 2ESVE 5HHPB 1JWUA 3RL1A 1MFDL 2QQKH 4OF6A 1TQCB 1XCQA 3KHOA 1NJ9B 1IGYB 3QUKA 3QDGA 3R8BB 3OZ9L 5FFLA 1JRHH 2AJUH 1KTDB 1X6LA 1OCWL 5C0IA 5CBEB 3VGHA 1HOCB 5E6ZA 1TIUA 3FQTA 2W9DH 1IVLA 1UH4A 1OM3H 3T4AA 1IZJA 3DURB 3RPIA 4KTDH 5GRVK 2ZSWB 4U6HB 5KVGL 5I71C 1LO4H 2B20A 1LD9A 4OM1L 5E6YA 5GGTH 1P53A 1DQDL 3NA4A 3VXOB 3RPKA 4PJIE 3ILPA 1K3IA 1KB9K 4Q9BA 5HDLA 3U0PA 4U1MB 1PFCA 5HHME 2WANA 2X4OB 3MV01 4HH8A 3T65B 1JV5B 4TN9A 1FZKA 3D85D 4PJAF 4H8WH 4LLWA 3JVGA 5F96H 2BSRB 4S1QL 4ZXBD 5DK2A 1YEEH 3RWCA 5FKAA 1Q9KB 3MFFB 4F33A 4Y4HC 5T1DL 4EDXA 1LWRA 4WVRA 5MENA 1U3ZA 3PABB 2OMBA 4TTDD 1JE6A 2ZNWA 2EE3A 5TFSL 2FIRT 1OWRM 3I2CH 4KKLD 3WIIL 3BT2H 2OLDA 1A1MB 3KYMB 3D6GA 1OW0A 3V6FB 5GGVH 1ZSDB 1G9MH 1XIWB 1UKSA 3EOTH 3BPCB 4JG0H 1H5BA 5C2BL 1FORL 5GRZA 2PO6D 4YNYA 2VDOL 1I9JL 4KJWC 5KZCB 1CFBA 2B5IC 4XC3L 1CE6B 3DXAE 1JZ5A 1NEZG 3LKPA 4U1HA 5K9QI 2OQJB 5DI8B 1G6RH 1QTYT 3CXDH 2GJJA 1NEZB 2Y5TA 4JFEB 3QI9C 5F9DC 2UWEB 4LCWA 3HNSH 5CD5C 2GFBA 3DJ9A 4FXLA 4UTAL 3T0EB 1QRKA 2XN9B 5DQ9B 4OFKA 1YEHL 5DVLA 5I1CL 4YDLC 4N0CD 4R7DA 3P9WB 4WU7A 3CDGA 3X3FL 3HE6D 2R2EB 2C3HA 4D9QE 3ARFD 1ITCA 3LCYA 3NPSB 2YSSB 2RAMA 4NQDB 5F1IB 1CDUA 1ADQL 1N0XH 2ADIB 4QHLA 3ZTJH 1EXUA 1NJ9A 5FGSA 1K5NA 2W92A 3QQ4A 5HHOB 1KFAH 4OGYL 3U4EA 5F96L 5HGAB 2VZVA 5E94A 2PTUA 4TRPH 2DQGH 3C60D 3F7YB 4KHXH 4WTWA 4TUJA 4G9DB 2CGRL 3QFJD 5D5MA 3L1OH 3BMWA 4RWYL 1X6NA 2ICEA 4PP1D 3SE3A 1AGFA 3X13A 3E2HB 4XNZB 4YXLL 1N6QH 5JHLL 2FX7H 2VSCA 3ZDZE 2YZ1A 1CL7L 3OJDA 3IRPX 3OHXA 5K9JL 4PG2A 2FB4L 5FM5O 1NCCL 4Y19E 1KEMH 2H2SC 4G7VH 1NC4D 1A7NH 3TJHD 1JHTA 4KKAC 4PGCA 1FRGH 5BXFA 4K94H 3MROB 3P4NB 4JB9H 5KN5B 5IHUH 1NMBL 3Q6FB 4FXKA 5HYJB 2KPNA 3G6JF 3L5WB 3T65A 4OCRL 2YD4A 1A4JA 3WKMH 1FYHB 2NXZC 2V7NB 4PY7B 1A7PL 5MEQB 1FNAA 2VXTL 3BISA 4BQ6A 1HYSD 1U0QA 2IFFL 3K8MA 3QXAA 1YEHH 1Z5LA 1OW0C 3BKCH 4F8TA 2Z4QA 5I6XC 1TVDA 3ARUA 5EO9B 3X11B 1XH3A 1NC2A 4O00A 4JGMA 1DBBH 5ILTL 1UCTA 1NAMB 3WL9A 3TT1L 4QXTB 1HZHL 1IC7H 4U33A 2BDNL 32C2A 3V95A 4DFHA 3UBXB 4NO0D 3UJTL 2QSTA 5GRWA 5DWUH 1D5ZB 1H5BB 4U6XA 4NYLB 2W07A 4EDWH 5C0NC 4YHKL 2HH0H 4KHXL 1T0PB 3VA6A 4G8GD 3NCFB 3UTPD 1XR8B 5EN2A 5I8CB 3FB6B 1V7MH 2ZCHL 5JLZB 1NDMB 4R7DB 1HSAA 1OTUD 4LLYA 5C08D 5ADPH 3VXSD 4Z0BL 3CH8A 5L0QC 1MCQA 4GQPH 1YQVH 3MCKB 2RFXB 4M1CC 5DK0B 4WHYG 3MGTB 5DJZB 1PQZA 1EO7A 2P7TA 5CSBA 4PD4J 5TE7H 4UILH 4HKBA 5ADOH 1K5NB 1NCNA 3CPLB 3QQ4B 1PYWB 1IQWH 1KTLB 1WQVT 2NZIA 4JG1L 4M4RA 4EI6B 1S7RB 3SGDI 2UZXB 4HGWA 5F21B 2EXWD 4FZ8L 3NZ8A 3AFLA 2ZCKH 4MCYB 4KV5F 1H3XA 1A7QH 2OX5A 3ET9F 4LL9A 3KLHD 1UCBH 5GSRA 4XBEH 1NDGA 4BH7A 4NJAL 1I8IA 1QLEH 2WLZA 4XBPA 5LQBL 1Z9SA 3QFJA 4WI2A 5DJAA 5B4MC 1KSRA 2Q87A 3B5GA 3BKCL 3Q2CA 1VPOL 3B9KB 5ID0A 4WW2C 3JWOC 3TJEL 2J4WH 2QQQA 4MMZC 4YFLI 3WFHA 3DRTB 2VLKD 2OJEA 2W0FB 2CJUH 3SDDC 3MROA 3P4NA 4U3HA 3TT3H 1IC7L 3LN5A 2Y6SC 4X7EC 3F7VB 3AS0A 3HE6A 4XP1H 3LRGA 3UBXG 2FZ3B 1B0RB 3O45A 4EDWL 3FB5A 5I0DA 4YHKH 1NSNL 4Y1AD 5DHVH 2GSIB 2HKHL 3FO0H 1YNTB 1H0DB 2GW5A 3O8XA 5CGYD 2VB5A 3WIFB 3FB8A 2APFA 2Z31D 4XP5H 1X3DA 3FOMA 2YD3A 2YRZA 5LBSL 1H15A 4IRSA 3T1FA 4LCCC 3S35L 2VLRE 1V3MA 2NTSP 4JKPL 4YX2H 5C09D 1I1FB 3FO9B 2VN4A 5KTEH 2CUIA 5J0BA 4HCRH 4X9IA 2CUMA 2GTZA 4LQFH 4L9LC 1J05B 2ZUUA 1J1PL 1WGOA 3PWPD 4CVWA 1KCSH 1DQLH 4Z7NE 5BVPH 4GAGH 1GGIH 5CIPH 4PJIA 1LO2L 2ZNXA 4X6DF 3EDEA 4X9BA 1I1AB 2MSPA 4POZD 3ZYIA 1FP5A 4W6YB 1UCBL 3T3MF 3NZHL 1YY9C 2K1MA 5I8KH 4YPJA 1I9EA 3VXNB 1MIMH 3OKNB 3ZKND 5J1AB 5F1NB 2F8XC 1QPPA 4JM4H 2YPKB 3OX8B 2XWTA 3HZVA 3PL6A 3QRGL 4F2MB 5GGRB 4CDHA 3F58L 1BGXH 3Q5YA 2CLVA 3RUGF 3VFGL 4K3JL 1FE8H 5HJ3A 1U8HA 3U4BH 2NW3A 4ISVA 3VDCA 1UM5L 3BE1L 2EDXA 2D4FA 2Z92B 3PV6B 5IKCB 4HGWB 4E41E 1F00I 1KLUA 4GKSA 1WFUA 1T6WA 1S78C 3HNVH 3QA3A 3TN0B 5GZNC 2C4XA 3O4LD 2P7TB 3NACH 2AQ3A 3JUYA 1HILB 3EBAA 5CEZD 3EYUL 3S34L 1I9IL 1A4KB 2VTFA 4N0YL 3L9RA 4HXBH 4ZQKB 3GJEA 1MHCA 3O0RH 3VG9C 2HVJA 1CICD 2ED8A 4XXCC 5DD5H 1NL0L 1A6PA 3VE0B 2XA8L 3FQUB 2GK2A 3MXVL 5DMYA 1KPUB 2BNUA 5ACZA 1JYVA 2YK1H 3VRIA 3BI9X 3MBED 3MLPA 4ZS7L 4LQFL 2CDGB 2HJLA 4HW6A 1DDHA 4M3JA 4AL8H 1JHLL 3FO1A 3LQZB 3VDBA 4Z0XB 2ICES 2NY0C 2DQDL 4L8SA 5ID1A 1E27A 3P4OB 4RSVA 3V79C 1MRCH 3FJTA 5EG6C 2N7BA 4LSVH 1TNMA 4FXKB 3VXRB 5L2KD 3NZHH 3UTSB 4S1DC 1MAJA 4FMKA 4XAKD 2PF6A 4NC1E 3RVXC 3VXUE 5HYJD 5HVHC 3O11A 3LKSA 5L2KB 5IHBA 4LNRB 3V52L 5K9OB 2IFGA 2IADB 2BFVL 1TDQA 1FNEB 1ZKAA 4QNPF 1U41A 1EIBA 4JDZB 2CXKA 4P99A 3MLUL 5DA4A 2V6HA 5E2TL 4L8DA 1NGPL 4X6BB 1KB5B 4JAMA 5TDOA 3SKOB 2OS7A 3CLEH 5KS9B 4LP4A 2R0LL 4O58H 1F4XL 3HAEH 1J0KA 1L0YA 2EDOA 4PFEA 4YC2C 5DJDB 4LSUH 4Z95H 1SY6L 4G6JH 2BOCB 4Y19A 1UA6L 1RZJL 1RUML 5EFIA 4WENB 2VC2L 3IKCA 3SOBH 3FT4A 1I7ZA 3GMLB 3WFBH 1NFDA 3O0RL 4LLVB 4E9LA 3KLAB 5IESL 2CLVB 5DD5L 1L7IL 4X5XA 3WXVH 2D0GA 1CK0L 3MXVH 1FORH 2Q1EA 5AD0A 2VQTA 2XWJA 4KKLC 3ZTNH 2GJZB 1FZJB 1YQ2A 4Z7NF 2EDBA 4XC3H 3MV11 2R0WH 4YWGL 4NN5C 5C08B 2P8PA 2JB6A 4UDTB 1LEKA 3ZSSA 3QJFB 3RJDA 4U49A 5DRXA 4Q9QH 3PNWA 3VG0L 3QEGL 1CD0A 2PYED 1XIWC 1ZA6B 4HBCH 2NY2B 3VD5A 1MFAL 3H9SD 3ILQD 3WO3B 3SPVB 1CGWA 4I3SH 4I77L 5F72S 4RGNB 3PHSA 3NCYP 5GHWH 1A6AA 3HRZA 3MRRB 5D7SH 5HGHB 2J6EL 5F9WC 4Z7OF 3MCLH 2HFEA 4RGOH 3BN3B 2QV2A 1A4KA 2RGSA 5AG9A 3DXAD 3H7BA 3MODL 3V2AR 4XTRD 1R5VB 2IAMA 4NC1C 3KXFE 1DANU 1AJ7H 1LQSR 2DQGL 3V5KA 3NCMA 3EYFB 5DR5H 1P9MC 3OV6A 4UIMA 4GW5A 1F4XH 3L1OL 1UGNA 5D2NA 5CHNB 1SY6H 4G6JL 4P49A 3TO2A 1S7TB 1FNSL 2FX7L 4RZCA 4ZPTB 4HT1H 5IROC 4HIIA 4X80H 3TPUB 4YHOL 4XB7A 4QRPA 3SBWC 5DMJB 4Y4FC 2A1WH 4CL7A 3VW3H 1L7IH 2DM2A 2VDLL 5GJTH 5ETUB 3GSVB 1BVKB 4NM4L 1V3KA 3UTQB 3C9NA 3ZTNL 5IHUL 1AY1L 1AD9B 1RZKL 5HY9A 2IBGA 1DEEB 3QFJE 4NO2A 3THML 1QO3A 2HMIC 1QA9A 3EDFA 4X83A 3BPNC 3U1SH 4CU8A 2UZIL 3UDWC 2AJZA 2IFFH 4I0PC 3L3OB 5E03A 4P2RB 1AXTH 1LP9A 5HDBE 3PHOA 3UEZA 5CP7B 2I5YL 5D2LA 4PY8J 5GHWL 3UROR 3MUGA 3T0BA 4CGTA 5JXEC 5KSUB 1ZEAL 2GY5A 4Z78B 4J1UA 3ZKMD 2ZUWA 1YMME 1MY5A 4WHCA 3VXUA 5ISZA 4BH8A 1D5BA 3VFVA 3U0WH 1K6QH 1HH9B 1EO5A 1S7SB 4YIQA 4D0DB 1MH5A 2P8PB 1J18A 5KVMC 4XVJH 3OAZH 4ERSL 5AD0B 1FH5L 1UXWB 2A73A 2XWJB 5DR5L 3C60B 5IMMB 4NRYA 5B38B 4XPHH 3A6BL 4KMLB 4L4VE 5BVJB 2PYEE 1YNLH 2GITB 2VMFA 2H6PA 3MBXH 4Y16D 4QRSB 4AIZA 1KENH 1S7WA 3WFCL 3KR3L 1H3WM 2F53D 4PJBF 5C0EA 3VFUA 1JZ2A 4PJBB 3H9ZA 1AQKL 2C5DC 3A6CH 4WWID 1FL5B 3GBLA 2GK0B 2BMKA 1RZKC 3RA7H 5BW7A 4D0BA 4JANA 1U92B 3KG5A 2BRRH 1I9RH 1Q9WA 1UH3A 4M48L 4XPBL 3DIFA 4D9RD 4YQXL 3ALWA 5ACZB 1SVZA 4X4YB 2IBZX 2HJLB 3K2MC 4OM0L 5EO0A 2AXFA 3IFPB 5EC1A 2HG5B 2EIZA 2AVGA 1DVFB 4PJHF 5DHYB 4KRPB 3U82B 3QDJB 2R56L 1JPTH 3D39D 2ADJB 3V4UL 5ALCH 3UTSA 2R0KL 3OAUH 2Z0BA 4LLQA 2CRYA 4FNLL 3WHXA 4OLUL 4O51B 4O4YL 2HJFB 1KPRA 1OPGH 3IVKB 5JHDB 3DV6A 1YEDB 3QDGE 1XFPA 4B7IA 4LHUA 2ZUVA 1EO8H 4XP1L 3DYOA 3K0WA 3S96A 1ZLWH 3WFEL 4AM0B 2PR4H 3VJ6B 3U6RB 1UXSA 2M2DA 4NPYB 4PJAE 3BVNA 4X6CB 4RISH 3KXFA 4JEGB 4EBQH 3SGEI 2X1WL 4F9PC 1KIUA 4ZOCA 3M8OH 4HWZA 1A6VL 5MEPA 1I8KA 2X42A 1Q94A 1HHKA 4PJ5D 4RMRA 3RVUD 4HUWB 3NVQA 2E7MA 3S35H 1NANI 3VXSB 4HX1B 5KSVA 4U7SA 5A1AA 1FFNA 1AQKH 5AWNH 4P2RA 2X9YA 4CMHB 5I15L 3EJZD 1KYOJ 1Y18A 3C60C 4EVNB 3B9VA 3HS0A 4P3DA 1Y0LB 3MRBA 4YQXH 4X6EB 4BH8B 5ISZB 1ZVSB 4GRLD 5GGRY 3L7FA 1I7UA 5E7FA 1JP5A 5CLWA 4CMMB 4D0CA 3VGAB 1FYTB 3MLYL 1QBLH 3QRGH 3DV4B 1EVUA 5IROA 3REWB 3JTTA 2F5AH 3BPOC 3QPXL 3RY6A 1J1OL 5MP6H 4Z77A 4JO3H 3VFGH 4R2GB 4OD1H 1VGKA 1WIOA 2D31A 4P2OC 4PS4L 3FMGH 3MRHB 2NY2D 4WI7A 4Z18A 3KJ4C 4ZD3L 3C2SA 3BEVB 1KIQA 4LVNC 1PKQB 2QJDA 3GFUA 2IAMC 4PRDA 3IDNB 5AZ2H 3UTZA 4N0UE 5HPMB 3NACL 2CLZA 2CO6B 1BFOA 4XCNB 3TP4A 2IAMB 4Q9RL 5E8OB 1WWAX 2CKBL 5EBMB 5AZEL 4PRIE 3MMEA 4ZSOA 3WNLA 2PYEA 2BVOA 3KPSB 3D39E 5GS0H 5JW5A 4OB5H 2C1OB 5AWNL 3VWJD 1IM3B 1XCQB 4KK8D 2I07A 3W9EA 1ED3A 5C0ND 3ARWA 5E9DE 2GKIA 3CFBA 3WNOA 2YZ8A 3VFWA 2JJWA 2VLRB 3B3IA 3W39A 1ZHNA 5JW3L 2K3TA 5JHDA 2QSQA 3MOAH 4HDIB 4Q0XH 5CZXC 4OI7A 3I6KB 4M43L 4M7ZB 4NO2B 1YECH 3MLVL 4WHTA 4LGSB 3O4LA 3S4SB 5CWSA 2ZKHL 3CDFA 3MLYH 2DBJA 1F11A 3LEVH 5J1TC 1GC1L 4HKJA 2F5AL 3FL7A 4JKWA 5J89A 2MKWA 2A9NL 3ILQC 3L3OA 4NCC1 4ZTOH 1LP9B 2F74B 3IFLH 3FMGL 4RBPH 1F3DH 4DUWA 3TC9A 2DL9A 1EHAA 4HQQL 1UACH 2DYPA 5F3BA 4BELD 5FHAL 2YA0A 3O8XC 5DJYB 1FLRH 5GS1C 1BQHG 1A0QH 3NTCH 3JWDH 4Z95L 5E8PB 4QF1B 3B9EA 3DI2B 3WNKA 3R8QA 3P11H 1G7LB 2GSGB 4XH2B 4F58H 3L7FB 3NCJL 5E8DH 4GBXD 3U9UB 1W0WA 1A3LH 1DBAL 4U1KB 2A0LD 1WCBA 1JGLL 4DW2H 1CU4H 1OAXL 3I6GB 1E6OH 1YUHA 1TJHL 5I1KL 5FKAB 1WVZA 4PV9B 2D7TH 2EEDA 3SO3C 5LGJB 3HAEG 5JPNB 4EUPH 4N9GB 4ZAKA 3OJMB 1A22B 4MQXC 1R3IL 2YPVL 1C7TA 4FQLL 4ELKB 1NPUA 5AG8A 1FG9C 4NWUH 4D0BB 3GSXA 4ODXB 3NIFF 4WUUA 1RJLA 3QUYD 5TDPA 2AEPL 3BZDA 4TNVK 3K7UA 5EULV 3FO2A 4JFDA 5D2LF 5D7SL 1I1RA 5L2KE 1BHGA 1JZ7A 1MAKA 1AHWB 2VLJD 4O2FA 5FO9A 3UXFA 5JDJA 3G04B 1QSED 3CC5A 3MV7B 1UWGL 2VH5L 3CDGB 4M5YH 3QFDA 3VXRE 4U6YA 1OTTC 3O6KH 5ACMA 2VLJB 4YHPA 2EH7H 5DRNB 2FHFA 1Z9LA 4J3VA 5D7IF 2PXYC 1X5JA 2YSSA 3H9SE 4NDMB 4WDIB 1YY9D 2VR9A 1KLGA 2DI9A 4AEEA 1WZLA 1QFUL 1IAIH 2IPKA 3SDXB 3I85A 4P5MB 1RVFL 1MCOH 4X98B 3HPJA 3PV7A 3QIWB 1PY9A 3OKDA 3VXUD 1U8MA 2MQCA 5JHDD 3C5SB 5D9SA 4O2EA 3F6LA 1HK6A 3FN3A 5I1JH 3NABH 1VGEH 2B4CL 4TSAH 1IAOB 1EEUA 2ICEB 5T3ZH 2NY4D 1UB5A 1MFBL 4YHMH 1FJ1B 5E5MB 4K71C 1W2KT 1QRNE 1DJSA 2H1PH 3D39A 4R0LA 3L7EB 2P5WB 2LFGA 1ZGLB 2D0HA 3N1GC 1OSZB 4HIHA 3D0LA 3RY5A 5D1QC 3BDXA 1NC4A 4NHCL 5I1GL 1X5LA 3STLA 1AGBB 2VAAB 2XG4A 2YXFA 5IMOA 5GQBA 1TETL 1ZWIB 4J3XA 1JVKA 1UJ3C 2MQ0A 4KUCF 4IRSC 3Q5OA 1NMCC 1RPQA 3P2TA 2KL6A 1W8OA 3O2VH 3OKMB 5MEQA 1ZEAH 1YMHA 1LO3L 5IT2H 3DBXB 5IVZB 2YXMA 3G08A 3HN3A 4FG6C 5AYUH 3CCHB 5D96C 5EIIB 2J5LB 1F13A 1BD2B 3MSPA 2WBWB 2Z4QB 4FMFA 4IRJD 1HYRC 4ALAL 3HE6C 2FO1A 4PRIA 2NNAA 3P0GB 3U0TA 1EBPA 3C6LC 5FA4A 5I73B 3HG1B 2YN3A 1KJMB 4WY7H 1RVFH 3MBXL 1U8PB 4PUBH 1R6VA 1C5DA 1NFIA 4U6XB 4W70A 5DUMH 4G8FA 5BZWB 4F7TB 2BX5A 2Q7YA 1D5MB 2YEZA 1S7QB 3U7YH 1D9KC 1MELA 2B4CH 3WS3B 3BQUB 4GKOA 5SWSA 4P4KA 3ZYJA 3LV3B 4Y16C 3FQRB 1MFBH 5EH1A 2DQFA 4XNQB 1YZZA 4OZIF 3ZSTA 1MJJB 3HRPA 1C5CH 2OR9L 1CLOH 4PY8I 1Q38A 2C3XA 3I50L 1CG9A 1WC7A 4HWBH 3L3DA 5EZLB 4PR5A 2W59A 1CDBA 2CR6A 4QTIH 4XPFH 2ZJSH 3N9GH 5JMRA 4GKNA 1CFNB 4G6FD 4XP6L 3DWTA 2OI9C 2PTTA 2SEBB 2XKUA 3T0AA 3DMMC 1GIGH 1ZLUK 2VLLB 1DQQA 1JPTL 4GRLC 5E00B 4KJQD 1EHLH 3ARQA 1TNNA 3FHAA 1MFDH 4N0UA 1FJ1A 4JY5L 4D9RE 1ACZA 3DRQB 3KS0H 2KZ1B 1YEIL 1IAOA 2VR4A 1OCWH 4ODSH 1RZIA 1TPXB 3RI5F 1AGBA 1D3CA 5D8JL 4WFGD 1J11A 4ZSOE 3AS1A 4NQCA 1J0IA 1A6VH 3WXWH 1S3KL 4P5TA 4HIHB 2Y6SD 2X1OA 5DVMA 1TQCC 4YHZH 4NZRL 4RFEB 3MLXH 3PGCA 4XCCL 1KT2B 5D1XD 4UUJA 3GMMA 2DJUA 5DDHA 1CVRA 3O8XB 3WIFA 1MRFL 2AI0L 5MEOB 2PUQT 3GMOB 3BOVA 5CEXB 4H0GA 3KVQA 5HYSA 4BA8A 3KJ6H 4Z5RB 5JHDE 2FIKA 4G3YH 1U3YA 5GRYA 4TNWK 3CDYA 2CLRA 1U42A 2WP3T 3GZKA 5JIHA 1S5IH 1CTOA 4MJ5A 2A6KA 2DIBA 1F4YH 1HEZB 1MCWM 1U8PA 2NR6D 1C5DB 2JTDA 3C87A 1YEFL 4PP2B 2Y06L 3O6FC 5LCVL 1S7QA 3HG1A 1I1AA 4MB3A 1MCPH 3MOBH 4MD4B 2XWBA 3DVIA 2V2WB 5D1ZA 2XFXB 3TFKC 1KCVH 3LQAH 1MRDL 1UC6A 3PL6D 1BWWA 5D7JA 3CFCL 2J12B 4F15C 3L6FB 4PLJC 4PPTA 1XF3A 4JFYB 1CGTA 5JIKA 2YD9A 3ESVF 2VKXA 3QFDB 1WSST 4LAQH 1EDQA 5D8JH 5KANG 4GKNB 1CS6A 3K4AA 5IKCA 1DP0A 3S5LB 1BF2A 1OARH 1S9YA 3ZKMC 1HHJB 4YDIH 4NM8H 4NZTL 3L3DB 1ZHKB 3ROOA 4X6FA 2WLYA 5GGSB 4JZOA 1B3JA 4KMQA 3IKKA 3X3FH 2EDFA 2SEBA 3NGBC 1VFBB 4HS6B 5DUPH 4GKSB 3UYRH 2VSDA 5IVOA 1KNOB 3RWHB 2NTFA 2EDYA 2FR4A 3CVIL 4ZOAA 1QBAA 4XNXH 3FB7A 1TJIH 1R3JA 4ORGB 1I7RA 2EDNA 3OAYK 1MF2L 5J3HD 4FQPA 4WFHE 5GSVB 3L7EA 3CFDA 3LKOB 2I9LA 2CDGA 3CMOH 3BAEL 2CSPA 4CW1B 1NBVH 3ECBB 1EZVX 3LRHA 4WW1B 4RFEA 3P4OA 2Y06H 4LVEA 1Q0YH 2Z8RA 5IMOB 2O5YL 5CZXD 4OTXL 3QCUL 2MPAH 1T66C 4S0SD 3NPSC 4DFIA 3LQZA 1BIIA 4EZMA 2DTSA 4LEXH 4URTB 5F7EL 1GGUA 4Y5XA 1DSFH 1KCVL 3OF6A 5EBGA 4WJ5B 3GI9L 4H25B 3MJ7B 4NWTL 3RVXD 4O02L 4LMQI 4Z5RA 3CX2A 3QXVA 1KUMA 5KJRL 1AHWC 3BXNB 3CFCH 3L5WA 1JWSA 4S1SL 1ITBB 1RIVH 2F54A 2CLRB 5DSCB 3PWNA 4JRYE 2BSSB 2HFGH 1LE5A 3IJSA 3EOBB 3B9KC 3U0TB 4KHTH 3TNNB 3EYSH 4WO4B 3O2WH 4TVPH 3RBGA 4E42A 4NM8L 4N5EC 2BNQB 4DW2L 1UEMA 5E1HB 2CKNA 5DJ2B 3MZGB 5I74C 1AFVL 4P5TD 3DOSA 4NO5A 4NKQB 4HULB 1HHGA 3SE8H 5CMAA 2UUDH 4L4VB 4DK3A 1PG7X 3NFNB 1LDPL 1YMMA 2EDLA 1TJIL 3GMLA 4UU9B 3EDDA 4WWKB 5FUCE 1FZOB 2EEBA 2ZG1A 2EDTA 3WUWA 2E9IA 3CMOL 4MXVE 3HI5H 3CVHH 4JQXC 4JZNA 2GUOA 1HSAB 1XF3B 2MKLC 4LLYB 4XHJC 2R2EA 2ZCLL 2RFXA 5DK0A 1IKFL 2AQ2A 3VI3F 2F19H 4QHNB 3TO4B 4MJIA 4TULL 1HHJA 2NTFB 4I5BB 2KQNA 3WEXB 3GI9H 3QUMA 1FVCB 4P4KD 2Y4SA 4G9FB 5TE7L 4UILL 5ADOL 2RCSL 4KY1L 4S1SH 4GRLA 1XMWA 1CXIA 3CXHK 3NCEB 1UFUA 2A77L 1JYWA 2APXA 1NDGB 4BH7B 4N8CL 3TEUA 1J1XH 3KLDA 3X13B 2HLFD 4IHOA 1QPXA 1U8KB 2NY3C 2DQJH 3KPRA 1CXEA 2X9XA 2XNAA 1I1YB 1QSEE 3H9HA 3L3JB 4Y5YB 1LEIB 4R7NB 2Z8VC 1SYSB 3QXUA 3BEWB 5CJQH 4JPIA 4OGAD 5HGDB 1I4FB 3B8YA 2Y1VA 1IGFH 2J4WL 4U1IB 3Q6FA 4U4BA 3D3VD 5E6IB 2ZG3A 1Z6JT 4Y5VC 4Y4FD 3UTSE 5F7UA 1LDPH 4QRQA 3WO4B 3W2DL 1A4JB 4GSDL 5T1KA 2V7NA 4RMTA 3I02A 1OVZA 4GS7C 4G6AC 4YK4B 3HI5L 1SJHB 4K9EL 5A16A 4ZS6D 3V0WH 3MACH 5J6GB 4TSCL 3VFNB 5KVGH 3PWVB 1IGIL 2EO1A 3H6JA 4HMEA 1I1FA 2G60H 4WTZA 1AD9A 5HY9B 3BDYL 3FN0H 5JUEL 4HFWB 4JFXA 3VXPB 5A2JH 2EYTB 3QWOA 4QGYA 4X6DB 1XGRB 4KRPD 5LXGH 5ERWA 4JDTL 5ITBH 3ARGC 3AAZA 2OL3B 3GI8L 1F6FB 2RBLA 2PW1A 1N2RA 4RGND 4NKDA 5HHQA 3GSNL 4Z7QE 3ARRA 1U8OB 1FZOA 1NCTA 1QFWL 4JQVC 1CD1B 3BP5B 1OAZH 4KVNH 5F88A 2EE9A 2W60B 3FT2B 1YEEL 1T21A 4KTYA 1E4XL 3QIWD 3VXUB 4UAOC 1YJDC 5CP3A 2XWTB 3PL6B 1XR9A 4JFYA 2WIMA 1J5OH 4H26B 1U95A 4J8RA 4Z7VE 3SCMB 1DQDH 5C70A 1HH9A 5K93A 3QWQB 5IEHA 3PIQA 2ZUXA 2DKMA 3ETBF 5JW4R 4U1LB 1BAFH 2RIKA 3WIIH 3LB6D 4U0RB 3W9DB 2EXYD 5GGVL 2HRPL 1A7RH 3GBNL 4JZOB 2WIIB 1SHMA 3QJHA 4NT6A 2XIDA 4NFCA 5DHVB 4Q9CA 5EDXA 4JDVA 3TA3A 1QQDA 2FHBA 3MLZL 4K9EH 3NCCB 3V0WL 1MSPA 4PRPB 1N59A 3VD9A 4EUPG 2GCYB 5IP4A 4LCIL 1Q9WB 1KIPB 4N0YH 2V2TA 3B4NA 9CGTA 3E6HA 4X7CC 5D7KD 5C0BA 3EW3B 4EUPB 4LEOA 1XGTB 2N4IA 3QDJA 3EOTL 5HYSG 4DGYH 4U1IA 2RJMA 1EK3A 1FAKT 5DVOA 3HMWH 3LQAC 1R24A 3W0WB 2E27L 1BBJB 3HE6B 4ZS7H 5C0AB 5ID1B 1IM9B 1JHLH 1U3HC 4L8SC 3ZYOA 4JN2B 3JTSB 3VFMB 1S3KH 5BZDB 3PQYD 1D6EA 5TJWK 5D7LE 1LO0L 3LEXA 1JJUA 4LSVL 4QRQB 3HZYB 1IC4H 1MLCA 3O3EB 4LCWD 3D9AL 1S7VA 3MLXL 2YS4A 4XCCH 1J5OL 4UQ2B 1ZT1A 2R1XA 5GIRA 1N6VA 4YE4L 4WI4A 4WW2A 4LRIA 3SQOH 4FQ2L 4OFIA 3WKNA 3KGRA 1HSBB 1AP2A 3CNKA 3WNNA 4XMPH 4NC2B 4HX1A 2WUCL 5KSVB 4LKCB 1R3KB 4U31A 4FZEH 2HRPH 3GSWA 2FNBA 4HUMB 3DX6B 3TV3H 4PJAA 1NGXB 3CVHB 1EUTA 1QR4A 3ZE2E 4JVWA 4K94L 2ZUTA 1P7HL 4F7EA 2CGRH 5EBWB 3OXSA 2C26A 4ZODA 4LBEA 4C58B 3ULUH 4IMKC 3L5HA 1T22B 3HZVB 1R3HB 3MLZH 4KZDH 1CT8B 1RUMH 2I60L 1HIML 5GS3A 2NX5E 1MCPL 5IEHB 5BRZE 1QNZH 2I24N 3ZDZF 4LHJB 3UP1A 3ULSA 4J3WA 4C56D 1QVOB 4IIQB 1J10A 1H3PL 5IESH 1ZVSA 1KEML 3IU4L 3RJQB 5E5RB 1A7NL 5DFWH 3BGFC 1FZMA 4HPOL 3HMWL 3FQXA 1BZ7B 4MNQE 1MFNA 2J8UE 4QHNA 2BJML 4S1RL 4YWGH 4S11A 4WW2F 5EOCH 3IJYA 1I3RA 4XNMB 4WFFE 2VXTH 2WBJA 2WWKO 4JZJB 3BZFA 3RHWF 1PY4A 1MVUA 3AUVA 4WRLA 3MV9D 5ENWA 4L5FH 4XCNA 4I3SL 1H8OA 2D7OA 4I77H 3TVMD 3EHBD 2QBWA 4FTVA 1XF1A 1JZ6A 1WICA 4J7RA 3V5DB 4GBXB 4NHUA 3H9HB 3L3JA 3BD3A 2AJXH 3CU7A 3UDWA 5I16A 5FUZH 4FQXC 2ERJB 2HP4A 4EIGB 3FRPG 4D8PB 3CZFB 3EJJX 5FAAA 3I3DA 4G43B 1WAAE 1VEPA 3QDMD 5DWUL 3W9EB 5JXAH 4P9ML 1TVHA 3CFIC 3RZCC 1IQWL 3EYVA 3VH8G 5E6IA 4F7CA 3IXTB 4YZFE 1QACA 4OZHE 1A2YB 4KJYA 5D70L 1EJOL 4GKZA 1MWAH 3CUPB 3TPUA 5EWIH 2YD5A 1ZS8A 4HF5L 3MRIA 3RWJA 1LK2B 4NZUH 2FJFA 2UY6A 1CBVL 5CWSB 2DTMH 1HNFA 2P46B 3CD4A 1DSFL 2VUYA 1MJ7H 1SYVA 3OKOA 3VCLA 4ZO9A 2DLHA 2JELH 4M62H 5KG9B 2FGZA 1C12B 3DTXA 4QOKE 2N56A 2BNRB 2OP4L 4IOSD 5EC2B 5T3XE 4GRWF 5TDNB 5IVXA 4APQC 1PLGH 3RQ3A 1EGJA 1MUJA 4Y19B 3TT3L 3AMLA 4HUVB 1RJYA 1B90A 5IWLA 4WV1B 4KJQC 2B1AL 1OSPL 3GMQA 5ECJE 4F37K 3QIBC 2EDEA 3AU1A 2VLME 4PB9H 1A14L 2E9BA 4JRXE 1NSNH 2PXYB 3FFCB 1IGCL 2NXYD 4KROC 4QHUB 1WV7T 4MGXA 3BIKB 1K9TA 4U0RC 2VIRB 1U95B 4J8RB 3SCMA 2Y36H 1I8MB 4FFVD 2CJUL 2IH3A 5ABDE 2A0LC 3U0WL 1LEKB 1F42A 5DK3A 4HCRL 3LKQA 1WBYB 4FFWC 4ENED 3HPLB 2VJXA 3HNTL 2VOTA 4K7FB 5INCB 4M9PA 1FZMB 2GITA 1W72H 4XMLL 3T4YB 2C4FU 4WFFD 1BJ1H 4L8CB 2VDMH 3ULUF 3GSXB 4ODXA 1P7QB 4C4KO 3MJGX 2C3GA 1T04B 1RSFA 3SGKA 4NO3A 1IQDB 4HIJB 4BFEA 4N9GA 1S8DA 4NQCD 4JKPH 4YX2L 3UYPA 1CBVH 2ZSVA 3AY4C 3V6BR 4YO0B 2VXQH 1RJLB 5TDPB 1DFBL 3ARPA 1INEH 2DOCA 5FO9B 1T83C 4JFZH 1A8JH 5EOCJ 1TTUA 5E8EA 5DXWA 1UM5H 1TVHB 3FAWA 5C0GA 4ZNEA 4GAGL 1E4WL 3QI9D 3D2UB 1QSFD 2AXFB 3IFPA 1L0QA 1UKQA 4F7MA 3IDXL 2P24A 1QRNA 2H32B 1HQ4A 1AGEA 3TBTB 1ZS8B 1VSCA 1U8LA 3D18A 5JTWA 2C1PA 3V0VA 3JTSA 3TFKD 1IGJB 3TBVA 1IGCH 2MQ3A 4HWEH 3TIEB 4WCYH 5GS0D 2IF7A 3OJ2C 5HYQB 3QUZA 3MRNB 4LLDB 4GRMB 5GS2D 4OF8A 1QFPA 1ZANH 4NGHH 4R6UA 4YH6A 1D9KA 1NL0H 5INDB 4LHQB 3AS2A 1MCCA 1W0YT 1TVBB 3MJ6A 3T4AB 3QZWA 4JRYD 5EUOE 5FKPB 1KPVB 3VJ6A 3O2DH 4L3EB 2NPLX 4MA1C 1B0GB 3G5VA 5HHOD 1XF5B 1XGQB 1HOCA 4L3ED 4RISL 4QT5A 3OAYH 3AVEA 3ZDYF 1NC4B 4G5ZL 4ONHB 3X12A 4OKDA 5F9OH 4IIQC 3MNVA 1KELL 1GOHA 2KH2B 4ZO7A 5EBWA 1OSZA 1UVQA 5SX4I 4XMKH 1F4WH 5DJCB 3UZVB 1LHZA 4X5WB 1Y6MR 3MJ9H 3FZUC 3HFML 2LTQB 4BZ1L 1WZKA 2EDKA 5D7LA 1WBXA 4CNIA 2IBZY 1INEL 4QHUA 1GZPB 4O5LH 4I48B 3MRMA 2BRQA 5EU4B 3GSNB 3QWRA 4JM2B 5C9JA 1F90H 3EGSB 1CQKA 5E2TH 1JWUB 3IJHB 2DQDH 4IRJA 3CLEL 4ZDHA 3ZTJG 4G8IB 5DLML 2YN5A 2R0LH 4L9LB 1QSEB 4Q6YA 4Z7UA 4B0MM 4PJGF 4P59L 4XCEA 2XZZA 3VRJB 2VNCA 5MHSD 4F33B 5SWZD 3E3QC 3EYOA 4MXQD 5C3LD 4UQ3A 2EE6A 4GUPA 3V52H 1ZGLP 1BAFL 4MA8H 2DQUH 2B1HL 4PJDA 3PHQA 3RZWA 3ZLQC 1Q72H 5FA4B 3LD8C 5F7LB 2R9HD 1PKQA 3WS3A 3EOAB 4KI5E 5TE6L 4W68A 2OTPA 1OLZA 2ZWLT 3T77B 1IGTB 1GGYA 4Y89A 2E7BA 1QLRB 3O2DL 3D2UA 5I16B 4PBWD 1G7JA 1F02I 2FGWL 4JY6A 4LSDA 4P2QA 4IS6A 5E8EB 3TBTA 4TYUA 2VC2H 3FFDA 4GLRH 4GG6A 4X9GA 4AZ8A 1G0YR 3QG7H 3TBVB 5F9OL 3RGVA 1P4LB 1CFNA 5CEZH 2R2HB 3IT8D 4Y4KA 1AGEB 3E8UL 4K23H 1JGUL 3FRUB 3BIBX 1FVDB 4RDQF 1U8LB 3MJ9L 5DYOB 4BZ1H 1T7WA 5SWQA 1YPZF 1GPOL 1T0NA 2FRGP 4HS3B 5C0RL 4W81A 2IALB 5DQJB 1X5GA 2FCBA 5C6PB 5I9QC 1A6TA 3I6KA 4HWZB 2FEDC 3B9KD 4KDWA 2D4DA 2YMXL 3LPFA 4LAJH 1MFCL 3GJFA 4HWUA 4FFZL 4JO1L 3K8LA 5JORA 5H8DA 3LIZL 4P57B 2XQYG 5I73C 2ZKHH 1UVQB 5FYLH 4NQXB 2VUOA 4Q58C 3LEVL 4P23D 4QY8A 2BXZA 5DC4B 5J1SC 3HS0B 3TYFB 5FUOH 3HTLX 3FOLA 4LSSL 3IFLL 1D5XB 5LGHH 4DVBA 5F7DA 3HHRB 2RB8A 1F3JA 1AY1H 5KN5A 4QYOB 1ORQA 1E6JH 3QIUD 4NIKB 2IH3B 4G8IA 1X5KA 1GZPA 4FQXD 3KPLB 4WO4C 43CAA 5C9JB 3VFRA 1Q9KA 4L29B 4R4ND 4E0RA 3C8DA 4ONOA 3ARBC 1QZ1A 1DUYA 4X80L 1J8HB 1XF2A 1VGKB 1U91B 1AXTL 4OFDA 2X1XR 3DMMD 1AGCA 3GEWB 1BQLH 5C09B 3U79A 1J12A 4HBQA 1OAXH 1O7VA 1TJHH 4PV8B 5D5MB 1I1AD 4P48A 2BJMH 3V7AG 2DF3A 4S1RH 2DYPD 1K6QL 5I6XB 2YPVH 1G7JB 5I9QB 3RRQA 3LKPB 3TJHC 1IEBA 1NDMA 1P5VA 5KZCD 5CCKL 5T1LB 4OZGA 3FFDB 4GG6B 1FAIL 1MCIA 4FQ1L 1G7HA 5HDQH 1EMTL 3P4LA 1M6OA 3NAAH 5IG7B 1MIEL 1T2JA 3BHBB 3KPRD 1A9BB 2JJUA 3WFCH 7CGTA 1TZIA 5BS0D 2D03L 2UV3A 3HR6A 5T33L 1S9VA 2XKSA 5KSAA 2C7UA 2BCKB 1OGAB 2F8OA 4HS3A 3ARDB 1PEZA 2GIYA 2VLRA 3B3IB 3W39B 2EH7L 1MCSA 4HLZH 4PRNB 4XVJL 3SGJC 2QKIA 5BJTA 1NFDF 1FVDA 5MERA 3N85H 1I9RL 1ZHKA 4OUOA 3O6LL 3ES6A 3BJLA 3OR6A 3NOIA 4APQA 5I1DA 5J11B 1MI5B 3O4LB 3CFJB 3GSOB 1CR9H 1VFBA 4HS6A 2YD8A 1FFQA 2YKLH 3ARBB 5D72H 2ARJA 4KK5C 2AW2A 4AMKL 4QHKI 5BRZB 1UB5B 5HHMB 3RU8H 4NZUL 2HT4D 3UBXA 1CICB 3O6FD 2FLRT 4ONHA 5BRZD 4KZEH 5GSVA 2NY7L 3RA7L 5L8JB 4P57A 3KS0J 5LG1A 4GLRI 1E4KA 2R4RH 2FECL 3VXRD 1JTPA 3TO4D 1EFQA 3FB6A 1QUNA 2O93L 2VAAA 4U6VL 1YN7A 2XTLA 2Q76A 2GSGA 3G5XB 3OXRB 3FB8B 1NGWA 4OM0H 2BC4B 4NNYA 5IEKA 4MSWB 1AR1D 3B2UC 1NANH 4QYOA 2LTQC 4KDTC 3OB8A 2NQCA 2XZAH 4MA3A 1BECA 1JWSB 1NMAL 3RWFA 4QOKD 1RUQH 4E42B 5F7YC 4AYFA 1CGSL 3V4VH 3RHWK 5KOVC 3S98A 4JRWA 3BZEB 1I8IB 4ELKA 1NAMA 2QQNH 3WL9B 4MZ3A 1AGCB 4WO4A 4F7PA 3WFEH 2PR4L 1B6UA 1RFDH 4FFVC 1MCEA 3BUYA 5EZJA 2FSEB 5HVFB 1IGTA 4M1CD 4MJIE 1VCAA 2V9TA 3P4MA 2BSED 4R90L 3DRTA 1HHGB 1S7XA 3L3GB 4EOWH 3GIVA 2FHCA 3GMPB 1G6VK 4ZPVB 2EXYC 5EN2B 3LN5B 3RU8L 1IEBB 3OX8A 4JR9L 3KWWA 5IIEB 4LCCA 2JK5B 1H8NA 2V2XA 5ESVB 1J1OH 5MP6L 3QHTC 5I15H 1AD0A 5HD8D 1ZMYA 3HC3H 1YYLH 2O26U 1A47A 3WFZA 4KQ3L 3BZ4B 4R2GD 4PR5B 1E4WH 3ZKQD 1H15B 2VDKH 4JREC 3CFJA 5ICXA 3GJEB 1D6VL 2A6JB 4JO2H 4I5BA 2VLKA 4XP6H 1DBJH 1BLNB 4IOIA 2IMNA 2IMMA 3MO1A 1TTGA 3QPXH 1G7MB 3REVA 1NLDL 2B8OT 5E5MA 3GSOA 4XB8A 2BHZA 2AJSH 2NY5L 2R2CA 4LIQL 1RUQL 3MUY1 1CFSB 3ZZ1A 3D0LB 1YEIH 3GGWA 1IZKA 3B8SA 3BH9A 1CLZL 1NGQL 3QCTH 3STLB 4F2MA 4UOW1 4U1SB 4PGEB 4OT1H 1RFDL 5L8KB 3KPRE 4NJ9H 3O41B 4XPAL 1QLFA 4NZJA 3RTQA 2VITA 5J9PB 3FFCE 4OCYH 5LKNA 5E1AB 1AO7D 4NRZB 3MLVH 5I75C 4EOWL 4XPTH 3CCHA 5D6DC 3HA0A 3ZL4H 4NNYB 3FOMB 3JV0A 4QKXB 3QA3B 2OR8A 5JR1L 4UT6H 1CXKA 2Z31C 1P4IH 4AIOA 2A9ML 1FNEA 3ZKNC 1L0XA 5GRJL 4JFDE 5GGTA 4WV1C 4Z7VA 4EQ3A 5IHLB 3L9RB 5J6GA 2HN7A 2XA3A 1HEZA 3SKOA 3LKRA 5DLMH 5ALBH 1N2RB 3QHFH 2VDKL 3SO3B 4M43H 1FPTL 5C0AD 4OCSL 1NMCB 5CILH 4ETYA 5IHZB 1S7XB 2FX8H 1DZBA 3BP5A 5F88B 4LDEB 4EN3A 3GIVB 1YEFH 1EEZB 2R2BB 3OKNA 1DDHB 5D1ZB 3KWWB 3TLRA 3NFSH 4Z0XA 2UWEA 4LCWB 5E2WL 5EU3B 1G1YA 3QXWA 5DRZA 1MCJA 4HHAA 1B4JH 1INDH 4IRZL 1KJ2A 4M03A 3QEQD 3T08A 2NX5B 3PNWB 4EXPX 5C92A 1XR9B 1UWEL 2JK5A 6FABH 1REIA 4MXWH 5GS1B 5D2NC 1FLRL 5KSAB 3SE3C 2XZCL 2F8VA 4BQ9A 4NJ9L 2YD6A 4FQLH 2DLGA 5BMFL 2BERA 1Z0MA 4NWUL 3J7HA 4MNQB 2ZOLA 4D9LH 4OCYL 3SPVA 4NZTH 3V8OA 4GMTH 5H35B 1SJXA 3E8UH 4K23L 4ZQKA 3IDUA 2PO6C 5KVFL 1CU4L 1C16A 3KYNB 4OLVL 2W1NA 2GCYA 4JY4A 2FR4B 5DUPL 1GPOH 3U36A 3VH8A 5C0RH 4J4PD 5DD0H 4P3CL 1MCHA 1G7MA 2DICA 1QQDB 3VGGA 4I9WE 1R3IH 2VH5H 3G6DL 5CINL 3IU3A 2P42B 4JM2D 4PJGB 5CD5D 5J6HB 4YHLH 2NXZD 2FX9H 4PRHA 2CIIB 1RUKH 4J23A 1G0DA 4PJ8C 2HVKA 2ITCB 2AP2A 4JO1H 2VITB 5C9KA 3EFFA 5FYJU 1NFKA 5IOPB 3AC0A 3NIGE 3SJVA 2EECA 5I30L 3MV8D 3QDAA 3QIWC 2APVA 2HKFL 4UBDD 5IW1A 3U2SA 5DJ6A 1T4KA 2OTWB 1ERNA 4R4FH 4ODWB 4QRPB 3VGFA 4JN2A 1ZK9A 3DYPA 4LEXL 1ZA6A 5GGVY 1T3FA 2XYCA 3CLFH 5HSFA 5FOBB 1KB5L 1TZGL 3QXAB 4OI9A 5DSCA 3R06A 3GSVA 3QIBD 3CAFA 3LB6C 2AEQH 4MXWL 5HGHA 4LKCA 2W9EH 4XWGL 3DX6A 1U2HA 3PWLA 4KC3B 1JTOA 2F53A 4F7PB 2E8YA 4HK0A 1U8JA 3C2AL 3C6LB 3C09B 3WIHH 2VYRE 1I7TA 5H94A 1KBGH 3O2WL 4TVPL 1VFOA 3V5KB 3OG6B 2QR0A 3O2VL 4KI5D 4UDUB 1SQ2N 1SJEA 4KKAD 5KSUA 3KYOB 3SGEH 1U93B 2Y07L 2ZUQC 4X5XB 1AFVH 3VGAC 5B8CC 5DD0L 5LGKA 1ACYH 3SE8L 5IB5A 1FYTD 4KVCL 5IMMA 4Y4HA 5DHXB 4ALAH 2ADGB 2DLTA 5JOFA 3HG1E 1FZJA 4NUGL 1JGEA 3U46A 4PJ8B 4XWOC 5C07E 5C08A 5CSZB 2NX5A 1OM3L 3I6LD 4K2UL 2WW8A 3IJYB 3ROOB 5DQDL 2DRUA 3AXLB 4AIZB 2BMKB 5I30H 3OKLA 2ZCLH 1GAFH 2VLKB 3HE7B 4LARH 2K7QA 1QHOA 3CIQA 5KS9F 2DL2A 2VXVH 1B6DA 4IOIB 2VERN 4TULH 5C0AE 2AJVH 3WFDH 3WS6A 1KCUL 4HFUL 4MVBD 1IJ9A 1I7RB 1RU9H 3BX7C 3NIDE 4PRBB 5IB4A 1S9KC 2OR9H 5CJOH 4XWGH 4FQCH 5CGYC 1BPVA 2P5WE 1J1XL 3E6FA 4BUGA 1WJ3A 4LSRH 1DBMH 3MLWH 5EO0B 1KXVC 1FLTX 2O5XH 4U3XA 1DQTA 1L9NA 2HJFA 5H2BA 3DGGA 4LLMB 4ODWA 1T89A 5DUBB 3NIFE 4RGMB 5IUSA 5FYLE 2FJFB 1WAAA 2HFFB 2Z93A 4F7CB 3VWJB 3R06B 4JY5H 5JQ6L 2QHRL 4LLQB 1ACYL 4JRXA 1BF8A 15C8L 2VDRH 5D7IE 3MNZA 1HHHA 3ABZA 4PJBA 4XPFL 1QO3B 1YY8B 2DAVA 5B4MD 5HPOA 5IVXB 1INQA 2HN7B 1GIGL 4PJXB 4FP8H 5EU5A 1ZGLM 5BCAA 4WV1A 2Q8AL 1A5FH 5IBUG 4ZFGH 1NCAL 5BQ7B 5K59F 1QEWA 2G60L 3IETB 2DQIH 2XTJC 4OGZA 5JUEH 2P47B 1AO7A 4J1UB 1CCZA 4BK4A 4JDTH 2XACC 1CXHA 3LKNB 5HHNB 1EERB 4PJCF 4ONFH 4PJCA 1SEQH 4PTUB 4Y4FA 4S2SB 4L8BA 1BZ9B 3DX7B 4MXQC 5DEZA 2EIDA 5HJ3B 3DX8B 1UXWA 2FATL 1E4XI 5IB5B 4H26A 1AQDB 35C8L 2AK4D 4O51A 5L6YL 1GL4B 1I8MA 4YHZL 1E4KC 1N4XH 1FYTA 2H6PB 5T1MB 4P2QD 5F9AC 2O5XL 4NNXB 4MJIB 1C1EH 3TBSB 3DV4A 2ENSA 4YLQT 3HE7A 5FEBA 5JHLH 3VMNA 1ZHLA 4TOYH 1B2WL 2OMNA 4MD0B 3BRFA 1JPSL 1P2CB 4Y4KD 1NCCH 3QUZC 3DO3A 2G2RA 3RKDD 4DOHE 1JPST 5FDYA 1I8LA 3S7GA 4OFPA 1LE9A 1KPUA 4M61B 1F58H 2DQTL 4XVTL 5JPMB 1XZ0A 1YC8A 5F70A 1A3RH 1QYGL 3ALPA 5J6HA 1KIPA 5IW6A 5IB4B 5LCVH 4V2CB 5GRXG 4DAGL 1G7QA 4HH9A 1CTNA 1V3LA 4GG6F 5K59E 4K8RL 3ZDYE 1ZLVK 2NXZB 1KYOK 4OCWH 3ZE2F 3N1MC 3ZMRA 1NUGA 5IB1A 1SVCP 2P49B 2DQIL 4YXKL 3GK8H 1R5IA 2G5RA 4ZUWB 3T3PE 2DWDB 3LZFL 4NO0A 4EEEA 5FYKU 1N7MH 5JW5B 5IQ7L 2O61A 5FB8B 5LAXA 2XN9E 2VL5A 1A1OA 4NQVA 3HLAA 4ONFL 1SEQL 2Q7NA 2I07B 4ZUTB 1FO0L 1T20B 3QAZB 4XNXL 1JL8A 4XPAH 5A16B 4EJ1C 5BV7L 3S4SA 1V7NH 2XI9A 2DLIA 1UXSB 3ZT6A 4JAMB 2PNDA 1OTSD 1HHHB 5GIRB 5L6YH 3OL2A 2IBBA 3PWLB 1KPVA 4XNUL 4L3EA 3MRGA 3KPMA 3L5IA 1JNHB 5FCUH 3QQ3B 2CLZB 4UT7H 3V7AE 3HB3D 4OSUH 4GAFB 4LCYB 4PBVC 4XMPL 4ODHH 5ESAA 4RAHA 3QULB 4PGDA 1BZ9A 4OFYA 3QSKB 5D7LB 4EVNA 5IM7B 3EJZC 2LE9A 1XIWD 4NN5B 2EC9T 5F3BB 3BAEH 1RIVL 5EU4A 1F58L 3IAGC 4JGUA 2NY2C 2X4PB 5CILL 1PKQE 2GJZA 3QIBA 4LVOC 5FM5M 1BD2D 4DJMA 1AKJB 4D3CL 3N1QC 3JV5A 1MHHB 3ULUL 1WISA 5DO2C 5DD6A 5CUSL 2O5YH 3NFSL 5FK9B 4OTXH 4FN0A 3VRJA 4PJ8D 1IC5L 1ZV5A 2GTWA 1ND0B 4YXKH 1YDPB 1CDHA 3W5NA 2WZPD 1OP9A 4LLAA 1FVEB 5KOMC 3IU4H 4NWTH 4XT1C 3TNMB 3RX8A 3R1GL 4BKLA 1F4AA 4LQ1A 5KJRH 4X7FC 3TBSA 3BPLC 4ZFOL 4NQED 1J7VR 4PV9A 1I3RB 1LE9B 1F6LL 4JDVB 3HZMA 3PWUA 3QXTA 4M8QB 1BM3H 3EUUA 3HE7D 1CFTA 1NCBH 1UZ8A 1U8QB 3U7AA 5HPMA 3NH7L 3S36H 4PRBA 4KK8C 2Z91B 4RAVA 4L3CB 4CRPA 1W72B 4Y5VA 5E8OA 3CVHL 4EUPA 25C8H 1FBIL 1FHGA 4ACPA 5IFHL 4CAGA 2XQBH 3QCVH 1IARB 1WIUA 1JTTA 3TGXA 2NY1D 4R96A 1MCDA 4AK1A 2BP3A 5C08E 3PUCA 3FKUS 4JY6B 1T03H 1RZJC 5F3HA 1WITA 5C07A 1LVEA 3G6DH 2JE8A 2AK4E 5KTEL 5IB1B 2IPKB 2WBKA 4I18A 4OLXL 1VHPA 2Z35B 4P9HC 3CK0H 1T0NB 4P2QE 3U83A 3EDJA 4MQ7A 1W0VA 43C9B 4BK5A 2OL3H 2R1YA 3HI6H 4X0KA 2OK0H 1ZHNB 2B39A 1AO7E 4KAQL 3K46A 3GMNB 3NIGF 5BVPL 3KAAA 2OTUA 1E28A 5B38G 1FDLH 1HQRA 1MLBB 1MWAL 3L3HA 4P46C 1U2CA 3N06B 4HF5H 5HD8C 4XGZB 3PGFL 2IANA 4UV4H 4JLRA 1OAKL 4L3AA 1PX3A 3IAPA 3PXJA 1TZGH 1P1ZA 1KF9B 3P0VH 3MUGB 3LMJL 3MUZ1 1FE8L 4F37F 4JJ5A 3LPGA 4NC0B 4H8WL 1BVLB 5AAMA 3HI1A 4G80A 3VFVB 1BJMA 4HJ0C 3VXTA 1OTTD 1NCBL 1CT8A 3KDMA 1FV1A 3MV8E 3QYCA 3BKYL 4PTUA 4TVPE 4DVRH 4CUCA 1MHHA 2B1AH 2WM0A 3CSPA 4PJEA 2ICWB 5FV1L 2JJSC 2D7NA 1GGTA 4YHYB 1B88A 1DTUA 4DVBB 4OV6F 5D7IA 5TFSH 1UZ6F 5HHPA 1ND0A 1F3JB 5MENE 5IMLB 1C5BH 5FHBH 5B8CB 5CIPA 4QTHA 1J9CT 1YUHB 1KCLA 4KVCH 3W82A 2V5YA 1S5HA 1XGPB 5LXGL 4I2XA 3VFSB 3RVTC 2ATPA 5T3ZE 4OLXH 1RUPL 4YFLF 1SMOA 4M8QA 1Q1JL 2BXYA 2H2PC 3H3KA 1EZVY 4G8FB 3T0VA 4JZJA 3WN5C 3F7PC 3GSNH 2C3VA 1CVSC 4RAVB 3KLSA 5FCSH 1RHFA 4MNHB 3D39B 2Z8WC 1X5IA 2VAJA 3DIFB 3HNSL 4TSCH 3WBDA 2FEDD 3LV3A 1ZGLA 2R4SL 1BEYL 1EAPB 3V5DA 1YJDH 1JK8B 2JB5H 3OF6D 4XVUD 2VXVL 3ARXA 3BQUA 3MRKB 1CN4A 5EC1B 4FHBD 2E7CA 4XI5C 3GI8H 1K4DB 4PREB 2W91A 2BFVH 1TZIB 2DMBA 4KTEH 3P0VL 4OQTH 4ZUSA 2LU7A 3EYVB 4PGZA 4RRPA 5CJOL 3MLUH 3VGDA 3QEHA 3MUHL 3S3JA 3GSRA 4HK3N 1SEBB 2FECI 2VL5B 2P5EB 1QR1B 3WHXB 5EIIA 2PXYD 2VDQH 5MERB 5BJTB 4XPGL 5DURB 4OCLC 3VWKC 4LSRL 4F80A 4DVRL 2J2ZA 4Q74A 2ESVD 2VXSL 1M7IB 1TFHA 4U1NA 1FFOA 1UA6H 1RZJH 4NQEE 3VFOA 3BP6B 3QQ9C 5CSGA 5CBEA 4R8WL 1U58A 1D9KB 3QIUB 4P9HH 2EYRA 2E3VA 1WT5C 1OP3H 3BKJH 2CMRH 1MI5A 5K9KA 4X9HA 5ITFA 1D9KD 3OZ9H 4HD9A 4A6YA 2E7LC 4JPWL 2UYLB 1JRHL 4YNYB 3VXSA 1TZHA 4DCQA 2HTLD 4BUHA 1RULL 1XGUB 5SWSB 4M5ZH 5FYJH 5LWYL 4IRJC 2DLFL 4OLYL 4P3DB 5C0BD 3H9SB 4NQCB 2DM3A 2H26B 3SGDH 5L7XL 1KIRA 4MQTB 1T66D 5CBAA 1FZKB 3SQBA 5IVXE 1YMHB 1RZ7L 5D1ZC 5HYSB 4TQEH 4EN3D 1DLFH 3RVWD 1A6WL 3S35X 1YA5A 3MLTA 1SBSL 4OKVA 2VZOA 3RWFB 2E27H 3TT1H 3IJHA 8CGTA 3VDAA 1DUZB 1BQSA 3PG2A 4FZEL 3ZE1E 2R1WA 1EUUA 3UJTH 4QTHB 5E94B 2A6DB 5DJ8A 4A2LA