2FATL

An anti-urokinase plasminogen activator receptor (upar) antibody: crystal structure and binding epitope
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
b'DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ATN-615, light chain
publication title An anti-urokinase plasminogen activator receptor (uPAR) antibody: crystal structure and binding epitope
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL01
4K71B 1K85A 4K9EC 1T1WB 4U1SA 2AJZB 2AXGA 4DN4L 5IFJB 1KPUA 4YHLL 3WIIL 4U33A 4RMWA 2R1XA 3HR6A 3QXTA 4LQFH 4NNPH 4TVPE 5T1LD 4M7KH 1NGXA 3ILQD 4JO2H 1G7PB 3B2VL 4GSDH 4XBGA 1P7QA 5J1TC 1F11A 4P2RB 4YFLF 4P2OA 2C4FT 4P4KC 2QSQA 3K4DA 4HIHA 4OKDA 5FDWA 4ODVH 1CFNB 3SDDC 2W9DL 2JJTA 2OR9H 4QRPB 3SOBL 2KQMA 4MXVE 5C71A 1A7QH 3F7RA 2VDRL 3CCHB 4OZFH 5DJZA 4TSAH 3VRIB 4O51A 1IE5A 4M93C 3QEGL 3WSQH 3IGAB 4LSUH 4UOW1 1HKFA 3O3UN 3SCMC 4PREA 1UC6A 5F3HA 1CG9A 3TZVD 5FM5M 5INDA 3AVEA 1PKQB 3ZTNL 2LAAA 3S97C 4LRNH 2Z31D 5CSZA 2ESVA 3MBEA 2NNAB 5I9QC 2Q6WB 3MUY1 3MLYL 2CDEA 1A47A 3QUKA 4HSQA 3HRZB 4GJTB 1OLLA 2VL5B 3ZE2E 2IADA 2Y7QA 1NEUA 1WIPA 5F9AC 1K4DA 3U4EA 1NLBL 3ZZ1A 3WUZA 4XCCL 3SDAD 1TZHB 1XCTA 4Z7WF 4OZ4A 3U1SL 1AC0A 1OY3B 3MJ7B 5IFAH 4ZOBA 5DD3L 4YHOH 3WN5C 3KPRA 2EIZA 1D6EB 4PJGB 5E7FA 3WIHL 1T83C 5E4EC 4I8DA 3VI4E 4WFHE 1U3YA 1ETZB 2GYSA 5GGVL 4H26B 4DUWA 4GO6B 3AU1A 1IAKB 2BX5A 5D2NE 4XPFL 3CFEA 2AJ3B 1KCRH 2AXHA 2XV6B 1RZFH 2YWZA 1NGZB 4HGWA 5KVEH 1CLCA 1FG2A 3AS3A 2XTJB 4M4PA 2IEPA 1X6LA 1DL7H 1SJEA 5C0IB 3P0VH 3L7FB 1WT5A 1OAKH 1WTGT 2DWEA 3IAPA 3BHBB 3GSQA 3X12A 4M7LT 1JGUL 2DMBA 1TVBB 5DR5L 4DGYH 3TESA 4L4VB 4PJAB 3OG6B 2Q7NA 2H1PH 2A6KB 2ITDA 5I19L 2EYSA 1CD9B 5CGMA 3TBWA 1PQZA 1FLRH 4WUUA 1WBXA 5CGYD 4G8GE 3MLVH 5BRZE 2O5YH 3NA9L 4GRWE 4PLKC 2HFFA 3LEXA 3REVB 1S9KC 1U9KA 3PABB 5IHUL 2HMIC 2UYLB 4R97C 1PVHA 3DMMB 4JM2F 5T5FL 2PTUA 5LQBL 1JRHI 5HVFB 3O3AA 5IW1A 5EBGA 1A6AB 2IFFH 2YA1A 3QQNA 43CAA 5I1AA 4JVUA 2AEQL 5F6IC 5JOPE 5L2KE 2LQRA 1RU9L 2XZQH 4I0PD 3MCLL 3GRWH 3KYKH 5EA0H 1A6WH 1DANU 3CZFB 4HV8A 4G9FE 1WTLA 1IM9B 2BSSA 4JDZB 1MRFH 3SKOB 3PGFH 1T04A 1K4CA 5T1DL 2COQA 2VDLH 1QFWI 3MNWA 3O6KL 4KTDH 2X10A 1CLYL 1JL8A 2DQHH 2DWDB 4XP9H 5DSCA 3UYOD 2X4PB 5K9JH 1CF8L 3ZL4L 4KK6D 1BP3B 3ZE2F 5C0AA 5C0DB 1IC4H 3DURA 1K5NB 3NBNA 4N5EC 4GAJL 1KXVC 4LNRA 4NUGH 3G5ZB 2BVTA 4R4BA 5TQ2H 2HWZL 5C0GA 4JLRA 4GRLB 5DVKA 4N0FA 5BVPH 5EZLA 4KKLD 4L4TA 3CU7A 3T0EB 3DRQA 2G9HB 2VLRB 5J13B 3KJ4C 1G7JB 1KG0A 5EFIA 5JO5A 1WWBX 4K2UH 1EEUA 5FA3B 3CFKA 2OTUB 1QLEH 2XFXB 4QY8A 2VJXA 3RX7A 3VI4F 1X5YA 4NO2B 1C16B 1BX2B 1BQSA 2PETA 3D3VD 1A5FL 1N59B 2GT9B 2NY2D 2GJZB 2DL9A 2C26A 2VITB 4YDJB 5HYSB 5GZOD 3FQWA 3G6DH 4FXKB 5FKPB 5L88L 1IEAB 5FECA 4XP1L 1HHKA 2VLLB 1UWXH 4Z7VE 2OJZH 2OL3H 1YZZA 4X4YA 4RBPH 1IRAY 1LE5A 2PW2A 1U8KA 3LKQA 3L3GA 1RUML 3HMWL 1FFRA 1MCPL 1OGTB 5D2LB 3T4AB 4UIMB 1S7XB 3ARBB 2PYFA 3UTSA 2IANA 5BV7L 2ZSWB 3HPJB 2DQTH 1IBGL 5ICYA 4OCSL 3TVMA 1I9EA 3I6LD 4IRSB 5JR1H 2OR7A 3LKSB 4GRWF 3MRRB 1MFBL 2QQQA 3RVXD 4WI2A 1QSFE 4DZBA 1OARL 4KTYA 4D3CL 2BOCB 4Z95H 5IMMA 1XIWB 5INCB 3TJEL 1BVKB 4U1MA 2HLFC 4W70A 5C3TA 1JZ5A 3TJHC 5ID0B 1FG9C 1LWRA 3SE8L 4YWGH 4CU6A 1S78C 5JDSA 5I1IH 1J8HB 2XZAH 3FB6A 3W9DB 2ZG2A 1H5BC 4EBQH 5C0FA 4HFUH 2FLRT 4HJGA 4ZFFB 3FT2B 5JIHA 4BFGA 4YBLC 4LHQB 1JV5A 2YR3A 4JFFD 2BY2A 1NCBH 4HUUA 1N6VA 5EOQH 1J0KA 1MCBA 1T22B 4RGMC 5IVXA 2EEDA 3KNBB 3GSNA 2ARJA 5LGJB 5LKNA 4HIEB 3VFWB 5I1GH 1Z0NA 5EUOA 4ZTOL 1JYNA 3U30B 5IB4A 3S3SA 1E6JH 1F8TL 1I3RA 1WWCA 4RZCB 5GGUB 1J05B 5AD0B 5MEOB 8CGTA 3O3BA 3V4VH 2ZUSA 4DFIA 4L1DA 4DUVA 2NPLX 4WW2F 3CFJB 4JG0H 4JQIL 5HDQH 3JV0A 4IDJL 3KYMA 4YR6B 3VXOA 2N7BA 3SKMB 4HG4K 3ME0A 4ZFOB 1JIBA 4ZAKA 4GMSL 4X6CA 2X6MA 2DQEL 2F8VA 2BVPB 3MV8B 2WWKO 5JIIA 4GRMA 4OZHE 2P5ED 4W6XB 5KN5A 2YUVA 2GTZA 3ZYOA 1A14L 2NY0B 4Z7VF 1H8SA 1NJ9B 2J8UE 5GJSH 3O3EA 2IAMB 1NQBA 4S2SA 4L3EE 3FJTA 3K2MC 2XQBL 4ZSOB 3TO4A 1NBQA 4D9QE 5C2BL 5C08D 3HAEG 4RMSA 3V9FA 1EGJA 3RTQA 4NQED 4I3SL 3KJ6L 2DICA 4Z8FH 1TVHA 4KZDL 3QWOA 5EOCL 5JXEA 1U8MB 2O26U 4HIIA 1IT9H 4K3DL 4NO5A 4KAQH 2FECL 4NNXA 3NCYP 1HWGB 2VDML 5HHOB 4YXHL 2VL4A 5ESVB 2CUHA 1QBBA 3T0VA 1DQMH 2QSTA 3BOVA 4JR9L 1UM5H 5DRNA 3BD4A 2J88L 2RQ8A 4XNYH 2D7TH 3TIEB 5FM5O 2GSGA 6FABL 5IIEB 2VLKD 1UT9A 3GMLB 4RFEB 2VXTH 1HNFA 2FB4L 3HAEA 3PP3H 5H2BB 3GIVB 3RUGB 5HGGS 2RFXB 1Q72L 3CXDL 5FFLA 4KKCD 1OL0A 1VFAB 4BA8A 2C1OA 3RPKA 4QKXB 4MJIE 3TN0B 3ZDXE 1J7VR 4MNHA 2XYCA 1A7PL 4O02L 4Y5XA 4JFEB 1IAII 3UO1L 5DFTA 5FGBA 3EHBD 1QNZH 3RIFK 1I1AB 3VFNA 4PJ8D 1LD9A 4IDLA 3CXHK 3ULVE 4JY4A 5FYKH 1K8IA 5E8NA 4ZS7L 5IK3A 3U0WH 1XCQB 2F53D 1RAMA 4JRYE 5CMAA 3E6FA 4XNXL 4EN3C 1BFVL 4WU7B 2NW3B 3U7YL 1INQB 1K6QH 1ND0B 3EIFA 5KSVB 2W9LA 5FYLH 2APBA 2OMNA 4U6XB 5E5MB 4WO4C 1FORH 1N3NB 1B6UA 1YYLL 1N5YH 1J5OL 3RZCD 3ULUD 5DS8A 2Q8AL 1EVTC 1J1XL 2GY7B 3W2DL 4DWHA 2GITA 4ZDHA 5DGRA 1LE9A 3NIFE 5B38G 4MXQD 1CN4A 4NP4H 1HDMB 3HMXH 3KR3H 2HLAB 4Y2DB 3N1QC 4RWYH 4N90E 2Z8RA 4YAQB 1MFNA 5GSRA 2XWBA 5EU4A 1BZ7B 2EDHA 4X8JB 3IXAA 4IIQC 4P2CG 3LEVL 4I18A 3A67H 4KJYB 4HKXA 2HVKA 2NXZD 5EU7C 3QQ9C 4Q6IA 2VISB 3B4NA 1TPXB 2J8UF 3BP5A 1RUAL 4WV1C 4JFXB 4LFHG 2XICA 3QO1B 4NC1C 3IU4H 4CKVX 3DETD 4L8BB 5EU5A 3L1OL 2ED9A 5FUZH 3LPGA 5B38A 4NPYA 3BZ4A 4JG1H 3VE0A 3I9GL 4MQSB 3MROA 3SJVD 4ZD3H 5IJVA 4G3YL 3VXUE 5KSBB 3OAZH 3FB8B 1PSKH 3CX2A 3EOBB 3L6FB 4JDVB 1EFXA 3H7BB 1IGJB 2A9MH 5DJXA 4PJ5A 1XGQB 3I6GB 4KRPC 4CNIA 2O5ZH 4GG6B 3WLWC 4DN4H 5JHLH 4GAGH 3JBG7 3H0TA 4P2QB 5T1KA 3HS0A 4ZUVB 1GZQB 3TNMA 1YQVL 1KJ2L 4YLQT 5D1XD 3ULSB 1XAUA 3QEHB 5EPMB 2D9QB 1CDJA 2ZCKH 1A64A 4OV5A 2VAAA 3ZE0F 4NRXA 1YEFL 2DBLH 3ZDXF 4LVEA 3DXAE 3BDXA 1T3FB 4N1HB 3PQYD 3SOBH 3W11C 3QCTL 2HKHL 4KUZL 2FX8H 1D5IH 1AQKH 3OR6B 1AHWA 3RWJA 3QEGH 5ENWB 3LPWA 1M05B 1BBDL 3EDKA 5C70A 2ZOLB 1AO7E 3ZTNH 2QJDA 5SWZB 2AI0L 1EO5A 3R0NA 1FL3A 3QFDA 3RJDA 1NEZG 1N7ML 4E41E 5HVHB 3EGSB 3LDBB 4WVRA 2YEZB 3QRFM 4UBDC 3BEVB 3DRTA 4KWUA 1QHPA 4PG2C 3EFDL 3PP4L 3WNPA 3FCTB 3JSSA 1NLBH 3KLAB 4IRJB 5E2WL 4BSJA 1DSFL 3U1SH 2L4OA 3NIFF 3E3QC 4YX2L 3JV6A 4O5LL 1FYTE 2EO9A 1J0HA 4F7PA 4BYHA 5JW4R 5KZCB 4K71C 1XF5A 3KLHC 5D5MA 4N0CD 4XNMA 3WIHH 5JORA 1NEZA 2X40A 4Y16B 1MHCA 1QSEE 2XPGB 2CDGA 3L3OA 4O00A 4JREC 1N0XL 1M71B 1OP3H 2EDDA 4I2XE 3FONB 4I1NB 5DVOA 3BKYL 2FGWL 4L5FL 4DN3H 1BGXL 1FC2D 3HE7D 3KYOA 4GBXD 2R4SL 2ZJSL 1B6DA 5DTFA 1NC2B 4YHIB 3DX8B 4OUOA 2F54A 2XKNB 1QVOA 1SJVA 1MWAB 5E99L 4Y5VA 1OGAE 2J6EL 3NCBB 5JOFA 4LK4A 4HWUA 1PEWA 1FO0L 4MLSA 4HK0A 3DX7A 5I19H 3GUTA 1MJJB 3OZ9L 5C0BB 2WV3A 3EYVA 2FJHB 4BZ1L 5HY9A 5FYKU 3MNVB 3DYPA 1LEKA 4EOWL 2AJZA 5D7IB 5I6XC 3NA9H 5IFJA 4JKKA 3SDCD 2NY3D 5IHUH 4U7KA 1N4XL 1G7PA 3HPLB 4KJPC 4RGNE 1T0PB 3BGMA 4HMEA 3BX7C 5DURB 3DVFA 2Y07L 3QUXA 1JFQH 3OJ2C 4U1GB 1YNTA 3QUMA 1RU9H 1CFNA 4Y1AE 4YFDB 4TUJB 4XRCB 1UACH 4NM8L 3H3BC 5MERA 3V6FA 2I25N 3CCHA 3VRIA 1YN7B 5F88A 1WVZA 5CEZE 4HKBB 4PY7B 3RDTB 3HZVA 3O6KH 4LHUB 4X7TB 1CLYH 4EI6B 2R0LH 5FCUL 3B5GA 1WFNA 1IQWH 1U41A 3GSVB 1CGSH 2NNAA 3K8MA 5B3JE 2Q6WA 4PRBB 4ZO8A 3HRZA 1LVEA 4HW6A 1L9NA 3D1MC 4Q9BA 4UDUB 5E6ZA 5K9OA 1KLUA 4G6JL 1AI1L 4OZFB 1TZHA 4P46D 3KVQA 4K3EL 2NY4B 4LCCA 4EZMA 5HDBF 3UJJH 5ALBL 3ZT7A 5TQ0L 3QZWB 1D6EA 3OJMB 4TUKL 5D72H 1A5FH 3UZEA 3HKFA 1ETZA 4Y4KA 4IBLT 1T1XA 2YZ1A 3HI5L 1IAKA 4L9LB 1FDLL 2AJ3A 2GK2A 4I3RH 1NGZA 1OTUC 3NFPB 4ONGL 4LVNC 1CICC 4NT6A 5C0IA 3K4AA 3LZFL 2NX5B 3BHBA 3RL2B 2PCPB 1D9KD 3HMWH 1MCPH 1Q1JL 1EZVY 2P5WD 4HWZA 4GUPB 1TVBA 3QDGA 5FYJU 3E6HB 1BREA 4FQ2L 4L4VA 1GRWA 3IETB 3OKLB 4PJAA 3DUHA 4K3GA 5ICZB 3W39B 4U7SA 1MFBH 2KL6A 3VRLF 4ETQB 3HZMA 3HI6L 1R3IL 3LCYA 1OARH 4D3CH 1I3GH 4KROB 3BPOC 2GEEA 4M8VA 3REVA 4LSDA 3PABA 3B9DA 4PJDB 1YPZB 1B9ZA 3DARA 4GRLC 3WFBH 2UYLA 4OD3H 3VG0L 3DMMA 1RZGB 4HIJA 3T0EC 1A6AA 4J12A 4TVPD 4FABL 4ONHB 5IHZA 4YE4L 1BMGA 1NBYA 3OKEB 2VZSA 5DJ0A 5ESAB 1EH9A 4XB8A 1VGEH 3CZFA 4JM2D 1E4WH 4X7CC 3KDMB 3FAWA 1GGUA 3LHPH 4WRLA 3SKOA 5IV2A 2VXUL 6CGTA 4D0CA 3K3QA 1C1EH 4L3CB 5AZ2L 4JFYB 1XF4B 2DWDA 5CLTA 2X4PA 2F15A 4N0UA 4WWKD 3MREA 3QUYC 1QBML 2ESVE 4S1RL 1BD2E 4GQ9L 3BRGC 5C0DA 4E9LA 1K5NA 3QIUA 3QXUA 3G5ZA 1UENA 4NIKB 3KGRA 2VLJB 5TPWL 3TIDB 2X42A 5D6CB 4P5TD 4MSWB 4JQIH 5I18L 5J06A 1PZ5B 2G9HA 4YK4B 1S9YB 2VLRA 3V5DB 1G7JA 1Q9KA 1S7RB 1YY9C 3BN3B 5FA3A 3MJ9L 2OTUA 2XFXA 2DQEH 1WISA 3QXDA 4HWBH 5EG6C 3L5XH 3KPRE 3BJ91 4I5BB 1C16A 4NO2A 1BX2A 4BKLB 3FMGL 3DNKA 1E28A 1TIUA 3O45B 4K7PL 4J8RB 1XIWC 1K8DB 1A14H 4RISL 3KPQB 5HD8C 1L0YA 3MUGB 3MRKA 3K81A 5C2UB 2VITA 3GSUB 4GXUN 5HYSA 3F58H 4FXKA 1KC5L 4WFHD 3ZYJA 2XQBH 3QXVA 1QKZL 1W0YT 2VLLA 3FO1B 4GKZB 2UUDK 4N5UA 1NCAL 3D39B 1BFOB 5I1CL 1RHHA 5GHWL 5BZWB 1ZXQA 2NY7L 4HLZG 4ZO6A 4NUJB 5KSUB 3MXVL 3MUJA 1OGTA 4KZDH 3T4AA 4RQQB 1S7XA 1X5KA 2WNGA 3ARBA 1I8LC 5B39G 1AXTL 2HAZA 2ZSWA 3HPJA 3VXSA 3QUZA 4LU5L 2DLIA 2VZOA 1KIPB 3UBXB 3OR7B 1NBZB 1UZ6E 3DJ9A 3LKSA 4JR9H 1NDGB 3G9VA 1GOGA 1YN6A 1MIMH 3PJSA 3HNSL 1CDGA 4UQ3B 2HRLA 6FABH 1RIVL 2FB4H 2BOCA 4G8GD 3CXDH 5BRZD 3CX5J 1BVKA 2OL3B 3JTTA 4WJ5B 5BV7C 5D7JB 5EO1A 2YPLA 3O6FD 5GGTL 4JRXD 1A7PH 1BLNA 4PP2B 1T89A 4YBQC 5DUBB 1J8HA 3W9DA 4RDQF 3UO1H 1DP0A 4MVBC 1I75A 4N9GB 1QLFB 3FT2A 2XXMB 3K0WA 2DYPB 5L2KD 3QEQB 5SWQA 1W72A 1YJDL 5FEBA 2I26N 4C58B 1QLRB 2CK2A 2CRIA 1JRHH 4G9FD 5IVNA 1TDQA 4BZ2L 3HE6B 4M6NH 3BH9B 5IEKB 2H26A 1JZ4A 3KNBA 4JGMA 3U7YH 3ZYIA 5LGJA 3VFWA 3L3JB 2K1MA 1HQRB 4R7DB 2QV2A 1YYLH 2AJVL 3MRNB 3PWNA 2P8MB 4O2FB 4RZCA 2Q8AH 5GGUA 1J1XH 3W2DH 4OZIE 5GGVY 3CFJA 5E70A 3MR9B 4YR6A 4WI8A 4Y5YC 1OTTC 3VH8B 3SKMA 2Y36H 4ZFOA 5D1ZD 5ITBL 3L9RA 2EH7L 4OGAD 5HYEA 3VDBA 5T1MB 2BVPA 2VXQH 1NANI 3STLB 4G6AC 3N1PC 4QT5B 3U83A 5ICXB 3OGCA 3DV4B 4F33B 1RUAH 3MRCB 4MNQD 4AEIH 4DKFH 3MV7E 4P0DA 1B2WL 1VFMA 1C5CL 2WAHA 1NJ9A 4EDXA 2YKLL 2IAMA 2AABH 3NTCL 3L1OH 2LV4A 1KB9J 3QCUH 5EO9B 4ZUUB 3RWFB 5A2JH 5D6DA 2OK0L 1YMMB 3VFOB 4Z5RB 5F6HI 1FH5L 4GKSA 4RFOL 2CD0A 1GC1L 4I48B 4G3YH 3UYPA 4M4RA 5JPNB 2Z4QB 3UTSE 4LDEB 5J1SC 4LIQL 1UZ6F 1U8MA 2OQJA 1F4HA 1Q0YL 5HHOA 4FQXB 4XNZC 2LTQB 5ESVA 1WSST 3QR2A 3Q48A 1G9MH 3ECBB 5TF1H 5L7XL 4HF5L 5EZJB 1JPGB 4ODSL 2I27N 3TIEA 2VUOA 2FD6L 4QWWD 2Z8SA 3ARDB 1MJUL 4XC1H 5IIEA 4ZPVA 5F9DC 1FNFA 4MA7L 4XWOC 3EYOB 1LO2L 3P73B 5H2BA 3C08L 3SY0B 3GIVA 4KRNA 5A2IH 1A1NA 4NGHL 3R06B 2FLBT 1KV3A 1VFAA 3ARVA 3O41B 4PJ9C 2ZUQC 3LEYH 3QCTH 2HKHH 3TN0A 3EJJX 4QGYA 1DEEA 5JHDD 3B9KA 1BBDH 4JFEA 3RWCB 4MJ2A 1IGTA 4JCLA 3Q6GL 4F7CB 2Y1VA 1M6OB 1I7TB 1I1AA 1FNEB 5BS0A 5ISZE 1TPXC 3CLEL 4M5YH 1VEPA 1XCQA 2IH1B 2CIIA 2FEDD 5CINL 1SBSL 4NOBA 1MI5A 4RAVA 1KCUL 4WU7A 2D7QA 2NW3A 3EJZD 3CFCH 3AREB 2OSLB 1ND0A 2CUIA 4FMKA 5KSVA 5EUOE 3FFCB 4JE4B 4BK5A 4M3JA 5E2WH 4OZIF 4U6XA 1OAUH 4QXWA 5E5MA 1DSFH 1IGCL 1T0MB 3Q5YA 4MDIB 4CMHB 4EQ3A 4ZOAA 4YX2H 3I3BA 1YQ2A 2R0WL 2R56L 1IQDB 1RK1B 4PV8A 4KKBC 1A0QH 4WHDA 4WEBL 5DO2D 3KLSA 2VDQL 2H32H 3QFJE 1XR9B 5C09B 2RR3A 3IDYB 2ZUXA 1TTGA 2HLAA 4Y2DA 1LEIB 3QRGH 4YHML 4YAQA 1N0XH 3QNYB 2QQNL 5TE7L 1BZ7A 1SM3L 4A6YH 1BEYH 2X44D 2FGWH 4KJYA 3MNZB 1IAIM 2D31B 4LEXH 1TJGH 3UYRH 3TV3H 2R4SH 2ZJSH 4X7EC 3P11L 4OQTA 4XPAH 3KPPB 3C6LC 2XWJB 3ALXA 5BQ7A 2BVUA 4N0YH 15C8L 1X4ZA 1HIML 4XPBL 2JF1A 5DMYA 1GAFH 4Z0BL 2J6EH 2QKIB 4L8BA 1ZHNB 1NUDA 3UTOA 3RVVC 3R1GL 1PAMA 4L3ED 2NY6D 3G04B 3FB8A 3EOBA 4JDVA 4D9QD 4BZ1H 5A2LH 1BJ1J 4YO0B 4QRRA 3SGEI 3U79A 4DVRH 1JCKA 5HVHC 3I6GA 4EOWH 1JZ6A 3CAFA 4GG6A 4QOKD 3PWPE 4QTHA 1GZQA 3S4SB 2CK0H 3SGDH 4IRJC 3O4LB 4YDLB 3QEHA 5EPMA 4L3AA 1R24B 4BQBA 4I9WE 5ANMB 2Y07H 1OF2A 1HHJB 2EC9U 4F9PA 3WXVL 1TXKA 1KLFA 3EOAB 2AJYH 1R3HA 1T3FA 4NM8H 4CBPA 1CT8B 1U3HB 5GS0H 1G6VK 2ITCA 3ES6B 5ENWA 2ICEB 4OAWB 5BJTB 1IFHL 2ZUWA 4ZFZB 4MJID 5CD5C 3SE4A 4XP6H 1BOYA 4ZUWB 2ZOLA 4X6DB 4U4BA 4YXLH 5FCUH 3C2AH 3FOMB 1TQCC 4QXTB 5T3XE 5DHYB 1WZ1L 1OD7A 4K3JH 1DBMH 5DMKB 3EGSA 1J0ZA 5HYQB 1VCAA 2YEZA 3WLBB 4R7NB 3ULVD 3CMGA 5EUOF 4P5MB 1HKLL 3BEVA 5HHME 1IAIH 1I9IL 4GT7A 2AK4B 3IFOA 4UU9A 1TJIH 3FCTA 1X5JA 2QQKH 2XQYG 1EEQA 4JRYD 2BK8A 2ZG3A 1AI1H 2HT3C 4FTVE 3RGVD 3EUUA 2GJ6A 4JANB 3P4OA 2VE6B 5B21A 5ALBH 3I3EA 2M1KA 2X70B 1V3MA 3HUJB 1I9JH 1A6VH 4TUKH 3LQZA 4RMRA 5C0ND 3QULB 4Y16A 1M71A 4GS7B 3DHJA 5JQHC 3HI5H 3P4MA 1RV6X 1ZS8B 1A4JB 1FDLH 4XP4L 4N90D 5IKCA 25C8H 5JDJA 1A7RL 4ONGH 5AYQA 1JZ3A 4WWID 1I7UB 3LZFH 3DX8A 5CP3A 2C4XA 4NN7B 3CVHA 5CJBA 1ED3B 5HVWA 4KZEH 3WD5H 1Q1JH 1QBAA 3IVKA 4F8TA 2WIIB 1PY9A 1BHGA 1ODAA 5I30L 4JZJB 5D71L 3VWKC 1FVDB 2V7HB 2VSCA 1MJJA 2HTLD 2YRZA 1QZ1A 3VXUD 2YXMA 3MNVA 3HI6H 2JB5L 1R3IH 1TENA 4HJJH 1VDGA 1YEDA 3CSGA 3O8XB 4DZ8B 3V7AE 3ZKMC 4OF7A 3S37X 4RAHA 4G7VL 3GJFH 4LKCB 3HPLA 3IDNB 1ZA6B 3HC4L 5EU7E 2PKDA 5I74C 2ZSVB 4Z78A 5C0RL 1R3LB 2DM3A 2DD8H 4TUJA 3OX8B 3K2UL 2X9WA 4NKOA 4QTIH 2VO5A 5KW9H 3BQUC 3JWOC 1YN7A 5HI4C 2A6IB 2VXUH 1KPRB 1QBLL 2JK5B 3QWRD 2AGJL 4HD9A 4HKBA 1CYGA 4PY7A 3RDTA 4X4XA 4X7TA 4EI6A 4XI5D 4ZXBD 1PLGL 4TVPL 5KVDH 3FB7A 5EU3B 3QZWG 4JDTH 3GSVA 5FO8A 4GQ9H 5JW4N 4I0KA 4N1CA 4I77L 1AO7D 1DFBL 3MA7A 4PRBA 5SV4A 3LV3A 2OP4L 4UDUA 4E41D 1ZEAL 4Z7WB 3BUYB 2B1HL 2XN9B 4J3SA 1EAJA 4OZFA 1KEMH 1YEJH 5E56A 3WO4C 2D4FA 1JWSB 3MJ9H 5GS1B 3Q2CA 4MJ4A 3DUSB 4BM7A 4KQ3L 4FQJL 4APQD 3FQUA 4I0PC 4UI2A 3SGJC 3QZWA 3WFEH 4EJ1C 1FYTD 3FMGH 1IKFH 4NO3B 5B8CA 4K7PH 5ID1A 3P30H 3QDJB 3NA4A 4PB0L 2EO1A 3O9WB 1QSED 3Q3GB 1TCMA 4S1DD 5CJOH 3NFPA 1KT2B 3UAJC 1K3IA 5E2JA 1YYMH 2JJSA 2YD2A 5I1CH 4KK6C 2DDQL 5GHWH 4JPKL 2NY7H 2CSPA 2NX5A 2XNAB 4P9ML 5DWUL 2PCPA 1QYGL 1CIDA 4JKPH 5DJ6B 3LKPB 4H88L 4GUPA 2EIBA 2VNCA 3H9SB 4JKWA 3WS6C 1AXTH 3IJYA 3OBAA 1F6FB 3B5TA 1OGAD 4JZNB 3E6HA 2CO7B 4ZOCA 4LU5H 3OKLA 4OCYL 5ICZA 4OLZL 4WW1B 4POZC 5JA8B 4ETQA 4R0LC 4K55A 4FQHB 1RIVH 4LVOC 3A6BL 2JJUA 5E8DL 1X44A 4HUMB 2IPKB 4NRZA 5IGXL 4EQ2A 1YPZA 2NY2C 3SE3C 2QADD 1RZGA 3PF2A 4LSRH 4P2RE 3EYUL 2MPAL 5GZOC 3QIWC 4ONHA 3OL2A 2Z91B 4NQCB 4RGND 1Q9LB 4HS8L 2NTSP 4QRPE 4KKAC 5GS2D 3LH2L 2JIXB 2MHAB 3KDMA 1H5BA 1YJDH 4Y1AD 2DKMA 3BPNC 1ZAGA 5F93C 4NBYB 3VXRA 4BZ2H 1ORQA 3MO1A 5J1AA 3B5HA 1PKQE 1XF4A 3MA9L 5CEZD 4EI5B 1MFDL 5TF0A 5DQ9B 3V6OE 4X83A 1R6VA 4ZFGH 1B4JL 2VLJA 3F6LA 3VWJB 3GRWA 4Y4HC 5D6CA 1KFAL 5LCVL 5DJCA 4OFPA 5GS3A 1PZ5A 1CR9H 3L5WA 1JWMA 4YDVB 3V5DA 1E0OB 1F4YH 3DUUB 1SYSB 5HDOA 2EH7H 1TNMA 2KZWA 5CJXC 5KAQF 4LDOB 3WJLC 1AQDB 3MOBH 4R8WH 3BESR 1AXIB 4PJ7B 4PJGE 5DRXB 3UTTB 3ULUH 1EHNA 4XGZB 3O45A 2DLFH 5E24E 1KTLB 4J8RA 3QH3B 1K8DA 1PJ9A 2H6PA 3RAJL 3KPQA 2CQVA 3MUGA 4DKDC 3VDCA 1B2WH 1OCWH 1C5CH 1MCQA 2DJUA 2YKLH 4HKJB 4PB9L 5D7JC 5C0CB 3NTCH 1P4LB 3IJSB 4KK5D 2XTJE 1CFQB 3T0AA 4HHAB 2OK0H 4GKZA 3FO1A 3TT1L 1W0VB 4Y19B 3D39A 1BFOA 1T5WA 4UOJA 5BZWA 3C87A 3OKMA 5KSUA 2C3GA 4W4OA 3IKCB 1QUNA 4RQQA 2G75B 3U4BH 4LIQH 5HHXL 3WNKA 3IFLH 1GSMA 4L4VE 4PJAE 1Q0YH 1FGNH 3P2TA 4OIAA 1SY6L 1KIPA 1S9WB 1O7SA 3OR7A 1NBZA 1N64L 4OLYH 3SGKC 4PP1C 4V1DB 5DI8A 5L7XH 4JO1L 4ODSH 2ARWA 4UQ3A 1DVFB 1RK0B 4LPUA 5ESQB 4BH8A 4NGHH 1WBYA 3GMPB 5IESH 2OL3A 4WJ5A 5IMLB 2BJML 3B8YA 3O6ML 3U7AA 3RX5A 2P45B 3M17A 1L9MA 1AJ7H 4PP2A 3RJQB 4F9LA 5DUBA 4NQSA 3CPLB 2NYYC 2QL1A 4N9GA 5DC9B 1A7OL 3QI9D 2DYPA 4YPGA 3QEQA 1P6FA 1HH9B 2G60L 4U1HB 4J23A 3CLEH 1QLRA 1QACA 5D96C 1SEQH 1NCWH 1WCBA 2LABA 5CINH 3BH9A 2V2TB 5IEKA 2DQJL 1IL1A 4HUXB 4B53A 5EBMB 5E8OB 5IB1B 1I1FA 3DVGB 3S35H 2DLEA 3L3JA 2R1YA 5CD3B 1HQRA 2CMRH 4R7DA 2NW2B 3MRNA 4UINL 1OPGL 3LB6D 1MNUL 4JQVC 2P8MA 4O2FA 1G7MB 4JVWA 2R0WH 2ESVD 1BD2D 43C9B 1BZ9B 3B9EA 3V6BR 3FZUC 1OWRM 1XGRB 2NY5C 1NGYB 3T0EE 4D94A 4KKCC 2VLRE 1Z3GL 3TWCL 3PHOB 4YHMH 3T77B 4J2XA 2AK1L 2VQ1B 2VZ1A 2AV1B 4PJGF 4ZQKB 2QQNH 5TE7H 5T1MA 2FYYB 4WUKL 2AAVA 3RBSA 3VXNB 3ARPA 4P4KD 3QJHA 3ARDC 3STLA 4QT5A 5DD0H 3VXPB 3S36L 4JFDD 2R9HC 4F33A 1EXUB 4X98A 1U8QA 2A6DB 3KPTA 1F00I 1FAIL 2VZ3A 3QP3A 4YZFE 2X9YA 4WIQA 2WZPD 4C4KT 3FQXA 4HUVA 15C8H 4OF6A 4XPBH 5C0EA 2V9QA 3WNNA 4OLUL 4Z0BH 4FXGB 3V6ZA 4HIXH 5EO9A 3RWFA 1ZHBB 5C8JB 3SCMD 1YMMA 4Z5RA 3VFOA 4JFOB 4I48A 4LKXB 3ARQA 4RA0C 5JPNA 4AT6B 1G7LB 2AERT 5FXCH 4NZUH 4PJAF 5D2LE 3RZCC 4AEHL 3C6SA 3I85A 5AG8A 2HFGL 3QJFB 3RL1B 5E6YA 4X4MA 1WITA 1B3JA 2ED8A 5HHPA 1U58B 5BXFB 3ARGB 1WEJL 5E5UB 1GGCL 2ADFL 5EZJA 2K7QA 2H9GB 2YWYA 5AEAA 4XBEL 4R2GC 3FO0L 1FRGH 1GC1C 4FQQB 3C2SA 1JNJA 3IFPB 4CMHC 1UEMA 1VKXB 3FRPG 5DFWH 2NXZC 3P73A 4H25A 1I1YB 3SY0A 4X99B 3LN5B 2XXCB 4EDWH 4OD1H 3GGWA 1L0QA 1QSVA 3R06A 3O41A 1JNNH 3D69B 1J8HE 1MCEA 2H2PC 4XBPA 4XXCA 2V17L 4F7CA 1M6OA 1ONQB 1I7TA 4OT1L 1XGTB 1YEGL 5CZXC 1WZ1H 1X3DA 5DJDB 1RZ7H 3FRPA 1A7NL 2IH1A 5IFHH 4HXAL 3WFHA 2E6JA 1I9IH 3AREA 3EOTH 4HAGA 3FFCA 4DEPB 3PGDA 3LVEA 2I9LB 2HVJA 5FB8B 3VFVB 1MREH 3S8WA 2ZUTA 4GLRH 1IQDA 4QXGL 4XVJL 1YNKH 1OAZL 4PLKD 3ULVL 1XR9A 5C09A 2HMID 3P0YH 3VXMB 3RWEB 3QNYA 2VN4A 3G6JB 4GAYB 1MCNA 3MV8E 2XKUA 3N9GL 4XP4H 2V2WB 4YZFF 2D31A 1T6WA 3T3MF 3L3HB 1RJYA 3NFNB 4Y8DC 1OQOA 3KPPA 2XWJA 3MYJB 5E00B 4MNGB 1G6RL 3MV7D 4JB9H 4ZSOE 3ZKSD 1ZHNA 2H32B 3GI9L 5D2LF 3DBXA 5D71H 1EO8H 4UT6H 1T66C 3MV11 5EOTB 4N5ED 4A6YB 2NY1C 4FFWD 1F4AA 3PL6C 1FBIH 2JB5H 4YNYB 1IAOB 4FQLL 5HHOE 2WANA 3UTSD 4XPHL 4JY6A 4LRIC 4KVCH 4ODTL 3S4SA 1QR1B 3ZTJH 4G7VH 3CGTA 5IQ7L 2GIYA 1PG7W 2F58H 3HC4H 2DQGL 4PGEB 4TULL 2ICES 5SWSB 5ANMA 1RUPH 3RUGE 3QQ4A 2AJSL 1CDUA 1HHJA 3HE7C 4IMLA 4TNWF 3EOAA 1ORSA 1NBVH 2EDFA 1L7TL 3K2UH 1CT8A 5SX5K 1U3HA 1DQJB 3NZ8A 3ES6A 2ICEA 4OAWA 3G08B 2AGJH 3IRZA 4JFEE 3HCVB 4X6DA 3V79C 5ADOL 1PLGH 2P8PB 4TVPH 3FOMA 3RNKB 4QXTA 3ZSSA 4M9OA 5DHYA 1JZ8A 1INEL 3OXSA 4OTXL 5AZEL 3VD7A 5DMKA 4I77H 4JJHA 4R7NA 4DKAA 1V5JA 2UZIL 4NN7C 3L3DB 1FN4B 1M4KA 4NQXB 5ISZD 3QDMB 1ZEAH 2AK4A 3SDCC 5DMIL 5ITFB 4Y2OA 2FBOJ 1EIBA 3LKRB 1G7IB 5J3HD 2W07A 4JZJC 3MODH 5AYUL 2EYRB 4A2MA 4JN2A 1U93B 3GKWH 2VE6A 3VFMB 2X1PA 2DIAA 2X70A 4WHYH 3HUJA 2A73B 4G8FB 3LY6A 5I1KL 1U36A 1F45A 2DI8A 4PS4L 5TE6L 1B0RB 1Y18B 3ISWA 3QFJD 4PB0H 4G5ZL 1MCFA 1ZS8A 4ODUB 1A4JA 5E6IA 1B0WA 3TBVB 1S78D 3F7YB 4F8QA 5GGRB 2A38A 3N85L 4LBEB 1RUQH 4CVWA 2DDQH 5C07A 2FR4B 4JPKH 2OZ4L 3FQTA 4P9MH 2CKBL 4LGPB 4XCNB 7CGTA 1Y0LB 1RMFL 4H88H 1ZT7A 4XC3H 4XCFL 1NDMB 2FATL 1S7TB 5GQBA 3MRLA 4PRNB 3GSXB 3WIHA 5B4MC 1WZKA 4YDKL 3WUWG 5KSBE 3BWUC 2V7HA 4G42B 2FGZA 4OLZH 3TEUA 2OXGA 4L9DA 1P53A 3RTQD 4OKVB 3NIDE 5T3ZE 1X5ZA 1RZKL 4FP8H 3L3IA 7FABL 3O8XA 4P2QE 4DZ8A 5IGXH 2IBBA 4PGDA 3W0WA 1OP5K 2W65B 1CFVL 3DSFH 5DC4B 1AGDB 3RUGF 1NLDL 4LKCA 3PWPD 3IDNA 2M26A 1BF8A 4X5XA 5J8OA 5FO9B 3SGEH 1EJOH 4KTEH 3MPCA 4G6KL 3VFTB 3A0OA 1R3LA 2YD1A 5GS1C 3U0TB 3WUWA 2BC4B 2KDGA 4OSUL 1FCCA 1MHPL 4LLMB 4HS8H 3HNTH 4I9WD 4YHNA 3OX8A 1R0AL 1CU4H 3K8LA 4Z7QF 4B0MM 4FQCH 2A6IA 1C5DA 2JK5A 4AQ1B 3RY4A 1JUFA 4M6OH 4LCUB 4YDIL 5DHVH 5SV3A 5AWNL 2PYED 2X4NA 4PJCA 3MA9H 1HHGB 1CXEA 5SWZE 3GJFB 2PO6B 1QSZA 1T20A 5CZKA 1E4XI 1KGCE 3M8OH 2MTPA 5T3XD 3MUHL 2I5YL 1R5VB 1LDPH 1B4JH 5DYOA 1XZ0A 5DA4A 1KFAH 4M43L 5LCVH 1DE4A 2XN9A 4LLDA 5HHMD 4Z7NE 1CL7I 4KRMB 5TDNA 2C9AA 3FAXA 1JWSA 5CEZL 2NXYC 5M95B 4ORZC 4KDTC 4FTVD 3BO8B 5TFSL 4OV6F 4M1CD 1MLBA 1A3LL 4JM2C 5AG9A 4NO3A 4Q9RL 2DQFB 4F58H 5EC1B 1KB9K 1U95B 4PJXB 4W68A 5DMGD 3Q3GA 4JFFB 3VG9B 4HEME 4R26H 1KT2A 5I1EL 1G9NH 1X5LA 3FT4B 2PXYB 4WWKC 2ZKHH 3ARFB 5IW3A 3LPFA 3GMRB 3KPLB 2XNAA 3V5KA 4F2MB 1CFBA 3BVNA 3GB7B 2ZG1A 1CVRA 3IFNL 3LKPA 1G7HA 5DJ6A 5GRWA 1IM3B 3LRSB 3WFCL 4HULB 5KSBF 3H9SA 4AIOA 4EN3D 4RX4D 2MMXA 5GZNC 3P9LB 1KB5L 4K3HA 4K8RD 4JZNA 1JHKL 5DZLA 1SY6H 4AEFA 4PUBL 3BW9A 5C0BE 1N64H 2YBRA 3I6KB 4UB0L 4GG6F 4WW1A 4WO4D 4WENB 4OM0H 4FQHA 4XMLH 5D7IE 5JZ7C 2O93L 2JE8A 3VGFA 3VWJC 2VXVH 4FNLH 4LLWA 5T1KD 2BJMH 4LSPL 4H8WH 4CVXB 4MS8C 2XY2A 4MAYB 1Q9LA 1GIGH 5DEFA 4PJEB 1WAAE 5FHAL 3BMVA 3KXFD 2VDKL 2JIXA 1ZHKA 4CDGC 5C08B 4EEEA 3EO1B 2HRPL 4QHKI 4JO3H 4NQEB 3QXAB 4PGJA 2DQJH 4FN0A 3CFBB 4ODHL 2NLJB 4XX1G 4PJBA 4WDIA 2QQLL 4EI5A 5AAWA 1G7QB 4LPTA 5DQ9A 1Q9WB 5ACMA 5K9QG 2EE3A 4M61B 1OPGH 1P1ZB 2HH0L 4ODBD 1S5IL 2IPTL 2R2CA 5JUEL 3UDWA 4KRPD 4HH9B 4Z7NF 3PWUA 1DLHB 5E2VL 2WUBL 2VLKB 4J4PA 4D0BB 3UC0L 1Z3GH 3KPNA 1JTOA 4C56D 3TWCH 4KY1L 1KEGH 1AGFB 1W0WB 2Q87A 3DUUA 4JKLA 1AQDA 2BY1A 4OI9A 4MCZB 4PJ7A 2CR6A 4PJHB 3UTTA 4CMMB 1A2YA 4XGZA 3K80A 1UYWH 3S36H 5EBLB 5EH1A 5IQ9A 1JHLL 4DCQB 3QH3A 3X3FL 1FAIH 4WU5B 4L8SC 5HBBA 5C1MB 1NGPL 4PJ8B 4HKJA 4FZ8H 4OLUH 1P4LA 3IJSA 1T21B 4PG9B 1CFQA 4CN6A 5KSAB 2E9BA 4HHAA 2F53B 3MRIA 1MAML 5F8QC 4DW2H 4XCYB 5L8KB 4Y19A 2NX5E 4TRPL 3O11B 5DXWA 1KF9B 3F7VB 1T2XA 1A3QA 3LN4B 4AEHH 4P9HC 3RWHB 3IKCA 5FGSA 4UBDD 2G75A 4HWBA 3DOSA 1XFPA 3JWDC 1MJ7H 2ADGB 4FFZL 4GG8A 4ZUSA 4YHYC 1YEEH 3U36B 2Y72A 3ARZA 2BVYA 1XF3A 1EHXA 2QSCL 5I17B 4YHKH 5D7IF 3VGDA 5KJRL 1KNOB 1NGXB 1GGCH 2W38A 3MZTA 4V1DA 2W92A 4Z7UB 2R2EB 4XBGB 3FO0H 1F11B 4OGAC 4NWTL 4WW2C 5CIPH 2Z9TA 4ZNCD 2WBJC 1DVFA 1RK0A 2HFEA 1ZV5A 3MLWL 2E7HA 4HIHB 5ESQA 1KUMA 2WLYA 4PJDE 4U1JA 3GMPA 5GGSB 1RULL 3STZB 3V4UL 2MFNA 1RZIA 4MMZC 1Z5LB 2A9NH 1WAAF 4S1QL 3U4AA 4PJ9A 5F7WC 3LS4L 4P2RD 2V17H 3QIBA 5INDB 12E8H 4OT1H 1JI2A 1P9MA 2R4RH 5CSZB 3CXHJ 4U1HA 4QRPD 2A74B 2L7UA 2CDEB 3QUKB 5I0ZA 5L0QB 1A7NH 4HXAH 2V2TA 2OX5A 5D1QB 1V3LA 5FK9A 1ITCA 2B0SL 5EOCJ 4HUXA 4PRIE 1K4DB 3BP4A 5E8OA 5EBMA 5IB1A 3DVGA 5FV2A 1XCTB 5CD3A 4JZOB 4NO0A 2LU4A 2NW2A 3BD5A 4QRTB 1OAQL 3T2NL 1ZT4B 3O2VL 4JFQB 43C9A 1BZ9A 3NOIA 5D1XB 4MMXC 2PF6A 3T0WA 2I60L 4U1LB 4XVJH 1OAZH 1XGRA 3ULVH 5D8JH 5IMKB 4NQDE 4RMVA 2ZUUA 3W9EB 3UCRA 1MCLA 3PHOA 3T77A 4KJPD 1JNHA 2AV1A 1MCIA 4DKEL 3SE9H 5A43C 1RZJL 5F1SA 3PQYB 3CFEB 2FYYA 1A02N 2AW2A 4HGWB 2BHZA 1MQ8A 1FG2B 4OCLC 4WFEE 1U2CA 4QEGA 1SJEB 3RU8H 4OJFL 3VXPA 3MV9D 4JCMA 1EXUA 1CGUA 3U46B 3KAAA 5JXAL 1CDHA 3X12B 5EU6D 2RHEA 2BY3A 3NCEB 2FEDC 5KVFH 4KMTH 5T33L 4S0TD 5C8JA 3L95B 3GI9H 4LLAA 4NJ9H 2B4CL 3AB0B 4CU7A 2VABB 5A1AA 4AT6A 1G7LA 3TBWB 4H0HB 1PQZB 2EDKA 2VKXA 4JPWL 1WBXB 1UKTA 4W81A 4FRWA 3QJFA 1LHZA 3RL1A 4FQLH 5DO2C 5D7LB 2JELH 2V9RA 3LEXB 4L4JA 1EHLH 3LRHA 1F58L 4TOYH 4ODTH 1U58A 2CIKB 1RUKL 5IVOA 5T5NG 4R90L 3SDYL 5IW1B 2H9GA 3O3AB 4PJDF 1YPZF 2DQGH 3ARUA 3D85D 3IFPA 43CAB 1YNLH 5I1AB 1UCTA 5IF0A 1IEHA 2AJSH 4HUKB 1I1YA 3OTTA 4X99A 3LN5A 3UXFA 1X4XA 1A6UH 1OM3L 1JYWA 4HV8B 3UTZA 5LBSL 1WFTA 5D70L 3P9WB 4GBXB 5DRWB 2R2BA 4OGYL 2Q3AA 1K4CB 3D69A 4M7LL 4KU1A 4PJIE 1OTUD 1CICD 4IMKC 1CXHA 4UTBH 1MY5A 1HXMB 1HSBA 1UKQA 1ONQA 5DSCB 2IGFL 4UILH 5ADOH 3QEQE 3VW3H 3HR5B 4Y4FA 5C0AB 1INEH 4OTXH 3DURB 3NAAL 5DJDA 1IM9D 2AXFA 5F7DA 5GRVL 4LNRB 4OBRA 4Y8AA 2UZIH 1FFQA 4UDTA 1Z9SA 2WINB 4L4TB 1CLOL 3DRQB 3BKJL 2I9LA 1HK6A 4XHJC 1Z9OA 5FB8A 2D4DA 3VFSA 4PLJC 1BVLB 2NY3B 2A0LD 5AYUH 3CFKB 1KACB 4QY8B 1CTNA 3OKKB 4GRLD 3N50A 5TE6H 4X5LA 5CEXB 3WMSA 1UEYA 5FGRA 4PFEA 3T0ED 3G6JA 5GRZA 2VLRD 1NMAH 3U2SB 3FQWB 2PUQT 2V2WA 2ZOKA 1OAYH 5GIRA 1HHKB 4YXKH 3L3HA 3NFNA 4HQQH 4MGXA 4HLZH 1V05A 5CILL 5DD5L 1LE5B 3H2WA 3TZVA 1U8KB 2OZ4H 3L3GB 4D9LL 3MYJA 1FFNB 2CKBH 2IBZX 2Z31A 1NAML 5GRVK 2PYFB 3UJIH 4XCFH 2IANB 1VSCA 5DT1L 2H32A 1NAKL 5E2TL 5ICYB 3TVMB 5DQJB 4KJQD 1FL5A 3QUYD 2NCMA 4U49A 3MLUL 1W72H 5EOTA 3RGVC 3SDAA 3ZE1E 4YNYA 2Y23A 3V0VA 2V6HA 3PDGA 4RFNC 5DD1L 4FMFA 5EWIH 1CFVH 1QR1A 1A1MB 4HS6B 1NLDH 3QB7C 1YY9D 4IRSD 5BOPA 2J6EA 4PGEA 2LVEA 5E9DE 5JDSB 1FO0A 3FB6B 1P6AB 4ZNEE 2YD7A 4OSUH 4HJGB 4XB7A 3Q1SL 3V5HA 1R5WB 5FUCE 1XIWD 5HD8D 1DQJA 4HUUB 4OB5H 1V8HA 3WV0A 1F4WH 1TMCB 5I2IB 2D0FA 4DK3A 4LL9A 5IVXB 3G08A 2PTVA 3HCVA 5MHSE 1S3KL 1H3VA 2HT2C 4YDIH 5A16A 1D9KB 3GSNB 1B88A 1ADQL 1LP9A 1N5AB 2P5WB 2V5RA 5DUPL 2J4WH 3RNKA 2HJLB 2M8XA 1P4IL 1HINL 4ACPA 4PRHD 3MMEA 4KDWA 1LGVA 2XRAH 3L3DA 2I5YH 3LN9A 3TCXA 3QDMA 2IG2L 1QO3B 4G80A 3VXOB 3KYMB 2A83B 3FFCE 4M43H 4O9HH 3UPRB 3PGCB 1GCFA 3LKRA 1G7IA 3O0RL 1A22B 3LD8B 1RY7B 3NPSB 1DLFL 4X6CB 2EYRA 1U93A 3VI3E 2DRUA 3AFLA 3VFMA 5J56B 4C59B 1DDHB 1P84K 3LAFA 1KN2L 4GRMB 5TFSH 1J11A 1EEZA 4HJ0C 1OSPH 2AJUL 4G8FA 5E5RB 5KN5B 1HILA 2X4TA 3FL7A 5FYKE 1A3LH 2DQIH 2NQCA 5T3XL 3KPSE 1P4BL 1IGIL 3VFGL 2FHBA 4TNVF 4Q9RH 4R9HA 5L9DH 3SGJA 2X1XR 2WK2A 2D0HA 3IDJB 5F71A 4ODUA 3O3EB 4M5ZL 4KJWC 3ZT5A 4S2SB 4NZJA 4YBQD 3TBVA 1JPFB 2UZXB 3F7YA 3TO4B 5I1EH 4MVBD 4XI5C 4U6YB 4YQXL 3MV8D 1ZE3C 4LSVL 2VOTA 2Z0BA 4CVZA 1KBGL 4XPTL 2FR4A 1TVHB 1AGBA 3QISA 4XCNA 3RWGB 1FV1A 2NY0D 3IFNH 1KIRB 4HIIB 1S7TA 4HAFA 1KB5H 3C9NB 4XCEA 5DK2B 3WEXB 4P49A 1KCVH 1XH3B 1Z6JT 3ZE1F 3WS6A 4UB0H 3GMMB 2ERJB 1WCQA 5IB5A 3S34L 2PO6C 3NZHL 4OKVA 4O2EB 5IBLC 5I66A 3MQIA 4IHOB 2P24B 3MRGA 3HAEB 2QSVA 2LFGA 4R0LA 4LP5A 3MYZA 4TSCH 3T1WA 2X4OA 1JHTA 5CZVL 5HHOD 1WWWX 3BAEH 5H37G 1IAMA 1NKRA 3O4LE 4K8RL 2ZNXA 4MNHB 3D3VA 3H42H 4KK8C 1WV7T 5ANME 5FO9A 3QPQC 5JPMA 1X4YA 3U0TA 3VGAB 4KVNH 4G6AD 5FHAH 2R0KL 3TFKC 3VFNB 1PEZA 1LD9B 1RZKC 2VDKH 2PTTA 4JY4B 2HYMA 2APTA 2DQUL 4GW4B 3AM8A 2J3SA 2HRPH 1CGYA 4QLRA 3E6FB 3F65A 4LCUA 1UWGL 3GO1H 1AY1L 4X6DE 3RVTC 5DZOA 5J6GB 1HHGA 4JFED 4U2ZA 4NOFA 5J12B 2QQLH 5EIQA 5HYJB 1IZJA 1M7IA 4OFYD 2ICWA 2F19L 2PXYC 2A6JB 3S88L 1TZGH 1MQKL 1S5IH 5JUEH 1R5VA 4P2YA 1NCDL 1ACYL 3C60C 4OGZA 5FKAB 2FHCA 5KVGL 4Q58C 2WUBH 4JAMB 1NFDA 1OWWA 5CWSA 5FYJE 1CDCA 5GSRB 4AM0B 2XWBB 1EHAA 2B5IC 1IKNC 4BQ9A 5DHVB 5IW6A 2HVKB 3O6FB 3VGHA 3RY6C 4M1GH 4JRXB 4UV4H 5CJXA 3NH7L 3TT3L 4Q0XL 4K9EH 3BXNA 1JHLH 2QR0A 3X14B 4HXBL 4OCXL 1NGPH 1U8OB 1U95A 4PJXA 5B38B 4JFFA 3BZ4B 5H35A 1IC5L 3VE0B 1YECL 3D0LB 1W8NA 4N8VG 4N8CH 3SO5A 1CE6B 1MAMH 3V52L 5K9KB 2PR4L 1TETL 1WGOA 4P23C 5BOZG 3P0GB 3KPLA 1JK8A 1NUGA 3MJ9A 4F2MA 4FG6C 5I1LB 2VRAA 4WFFE 5J11C 2MCPL 2E6PA 3WYRA 3LRSA 3O3DB 1F4XL 3THML 3TGXA 3RWDB 1D7FA 4CNIB 3I02B 1MPAL 3BRDA 4UV7H 3QHFL 4L8DA 5GGRY 4ELMB 1X5XA 2RGSA 5KJRH 3I6KA 5J57B 5EORL 5I1HL 4S10A 1FP5A 4OLWL 2D3VA 4N8VA 5D1ZB 3F7QA 1J1OL 4KKBD 3MTRA 4JQXA 2AJXH 2Q8BL 5T3ZD 3MGAA 4WCYL 1RPQA 3BEWB 4P2QD 2P5EA 5IOPB 4MA1B 1T5XA 4X80H 5ACLA 2XWTB 5E8PA 1BVZA 2XZCH 4MNQB 4R3SA 4MAYA 4F57L 1QFUL 2VQTA 3QG7L 4LMQI 4PRDB 1PG7L 1S7VB 3CDGA 1FL3B 1CBVL 3C6LD 1CK0L 4OIBA 4X6DF 5C08A 2DTML 3DIFB 5GXBB 3EO1A 2IALB 4NQEA 3DRTB 5BMFL 3QXAA 5DHXB 2JTDA 5LWYL 1OHQA 2NLJA 5KSAC 3BKCL 5ACZB 1ZLUH 1QA9A 3TA3C 1G7QA 1Q9WA 3V95A 1MEXL 3RA7H 4KV5E 2AQ1A 4M61A 1IC7L 3BUTA 4GKNA 5SWZD 1OAQH 2BHUA 3CVHH 1NH6A 1VA9A 2GAZB 3OKDB 5CCKH 4U1KA 5HGBA 2J8HA 1EO7A 1KGCD 4Z7WE 3LKOB 4F7PB 1QFOA 4HH9A 4ZYKB 2YA2A 3H3PL 4IRZL 2XN9E 5D5MB 3CDYA 4MQTB 1DLHA 2EYTA 1NEZB 2VLKA 4D0BA 2DIBA 5GGQL 5EZIL 2CDGB 5F7FA 5HXMA 1AGFA 5TH2B 3HUJF 1W0WA 3H6JA 3IT8D 1OVZA 1MCOL 4IRJD 4DKEH 1CGVA 1ZANL 4W6YB 1T4KA 4HC1L 1U3JA 1G1YA 4MCZA 5LXGL 2YN5A 4H0IA 4P2OC 5JHDB 3GKZA 3QI9C 5EBLA 4M7ZB 1B4RA 3QDJE 4LSQL 1P69B 1VB9A 4DCQA 4WU5A 2BFVL 2AKRB 2JJTC 1QVOB 1DBBL 5JXAH 3C09B 4PJ8A 4Y5VB 4ERSL 2GJJA 1S5HA 5CJ8A 5F1KC 5EN2B 3VRJB 4PG9A 5CD5D 3V0AC 4HX1B 2OI9C 4PBWD 2F53A 4HK0B 1ZGLM 5KBNC 1IGFL 4XCYA 3DX7B 4LPWA 1M1SA 3EFFB 3O11A 5C0JB 3F7VA 1EEYB 1ES0B 1NC2D 5HY9B 3RWHA 1XGUB 1WLHA 3MBEC 2WWMC 1LEKB 4HGMA 3TYFA 5IHLB 5L0QC 2ADGA 1FSKB 3RZCA 4Q74A 3U36A 3BGAA 5E08H 4Q9QL 1F58H 2BVEA 5I17A 2HT3D 3U9UA 1KNOA 1GZPA 2BP3A 4R90H 3SDYH 4Z7UA 2R2EA 3ALWA 3BGMB 4MQ7B 5C0BD 4E42B 1NGQL 3QUXB 4U3CA 5I71C 4HH8A 5DUMH 4XNUL 5DJ8B 1YNTB 3QUMB 4S1SL 4QCIB 5GGSA 1OM3H 3STZA 5K9QI 4OLXL 5MERB 2QHRL 2YPVL 4KQ4H 5LBSH 3V6FB 1EJ6A 1E4KA 3WDJA 5F88B 1Z5LA 1J0JA 4M7LH 4OZHB 4NQCE 1DQQA 1ROWA 4KDVA 3HZVB 3BMWA 4N1EA 1VERA 5DURD 1UVQB 3DO7B 2IGFH 2Q86A 1WT5C 3SJVA 5JQ6L 4GXVL 4LCIL 2EICA 2A74A 3M45A 3GIZH 1Y6MR 3IDIB 5CIPB 2AEPL 5D1QA 1OOAA 5K9OB 4MJ6B 1L0XA 2J5LB 1KLUB 4KV5F 1RVFL 2VB5A 4LLYA 3BKJH 3VWKD 4LHUD 2BVQB 1P2CA 4JKMA 4QOKB 2ZCHH 4JZOA 1LO0L 2R29H 2ZZUT 4QRTA 1ZT4A 3PIQB 4LCCB 4JFQA 3HNVL 3H3KA 5D1XA 2APWA 4U1LA 3RI5K 1CE1L 1F3JA 5IMKA 3ZKMD 3W9EA 1JPTL 3WKML 3GHEL 3MBXH 4Y4KB 1T1XB 3BSZL 3CVIL 3PQYA 2BSED 3QCVH 1Y6KR 4NWUH 2UVEA 2FECI 3BIAX 4NT6B 4G8IB 1QTYT 3JVGA 4MJIB 5CILH 5DD5H 3U46A 5DJAA 4D9LH 1J12A 3BQUD 3GHBH 5CJQL 5C0CE 5HI4D 2GTWB 4BUHA 4HWZB 1NAMH 3WKNA 3NIGE 1L6XA 3IRPX 3QDGB 4U0RC 2CDFB 3KHOA 3L95A 4KXZI 4Y19E 1RZJC 2GKIA 4PIRF 1UM6H 5D93C 4RMTA 3NN8B 5GPRA 2VABA 1JPST 3MLUH 1DBJL 3HZMB 3E8UH 4M6ML 1PX3A 4EXKA 5D7LA 3BPLC 1NL0L 1HZHH 3UZQA 1T1YB 1QRNE 2MCG1 2CIKA 4HIJB 2G5RA 5MEPB 3O2WH 2B4CC 3BH8A 5IHZB 5F72S 1T6VN 2OS7A 4K94C 1NBYB 3EKCA 5DJ0B 3K1DA 1YUHB 3Q6FB 1MF2H 4LP4A 4GKOA 4XVSL 3Q1SH 3EW3B 1LK3L 3JV4A 4KROD 4XVUD 4X4ZA 4POYA 5IV2B 4GBXA 1KCKA 5DRWA 4D0CB 3OKOB 3IF1B 1MCJA 2ILLA 2E9WA 1S3KH 1NMCB 4GFTB 4HS3B 3UAJD 1HXMA 4PRPD 1A3RH 4NDMA 5DUPH 4N0UB 5CKAA 4PV9A 3MREB 3HG1B 1L7IL 1UXWA 1P4IH 3HR5A 1DUZB 4NBZB 5EC2A 5I8KL 1HINH 4TN9A 3JUYA 1NSNL 4K7PX 4LARH 5DFVD 5CBEB 3QIUB 1QPXA 4FFWC 1YC7A 4F15B 3ROLB 4ENED 3O4OB 4OUUB 3TLRA 2IG2H 4O58L 2WINA 2GQHA 2OTPA 3LSOB 2RB8A 2Q3ZA 5D7SL 5JW3L 4LSTL 3DVIA 4NBXB 3TH4T 1Q9KB 3TVMC 5F7HA 4POZD 1BVLA 4PRID 2H8PB 3V7MA 3QXDB 4OZGB 4ZPTB 3OKKA 3ZLQC 4RRPG 1KCSL 2GHWB 1U8JB 1X5HA 1E28B 3DI3B 4XWGH 5FUOL 5T3XH 1P4BH 5CEXA 1IGIH 1JI1A 3VFGH 4PJ7F 3WL9A 3MRKB 1WFUA 2YPKB 4NQDD 4KMLB 3U2SA 4NZTL 3QIWD 4KHXL 3GM0A 4FQPA 4KKNA 3NCFB 2ENYA 3MLRL 4KKAD 1RHHB 5IT2L 3NIGF 4WFED 3O81A 1KBGH 4XPTH 1DQLL 1FFNA 4J3XA 2VXSL 4AQOA 4AYFA 4BSVB 2WUCL 4RRPA 1AO7B 1T03L 3VXSB 2GK0B 3QUZB 2CLRB 3BT2L 4ZFOL 3MLPA 5DQJA 4E41B 5L8JB 5J3HC 2CGRL 1HCFX 4TNWK 4NN5B 5LGHL 1YN6B 3FQRA 3NZHH 3PJSB 3OB0K 3AAZB 4P46A 2V2XB 1CGWA 4YJZL 5JA9A 4Y4HD 5DF0A 1PGRB 5I8EA 1AXSA 3JTTB 1DQDL 2Y25A 5DQDH 4Z76A 5ADPL 4LCWB 3OAUL 8FABB 1A1MA 4HS6A 5EO1B 4BFBD 2YPLB 3BZEA 3ZTJG 5B39B 2KQNA 1BLNB 1HXYB 3I75A 4ZAKC 3NPSC 3MOQA 1Q8MA 4PY8J 1QSEB 2R0KH 5JW5A 3FOLB 1R5WA 1I9RH 5ERWB 4I4WB 5SWQB 1W72B 4I2XB 1MCRA 1DBAL 2RIKA 2DQUH 4RMQA 1Y6NR 4IS6A 5I2IA 5F7UA 2IBGA 2P7TB 4JFZL 5D7JD 1AY1H 2H26B 1CFSB 1MH5A 1D9KA 5I16B 4OLVL 5GSVB 5L2JA 1N5AA 2P5WA 1X6NA 2YD8A 4JVPA 3TO4C 4MXWH 4R96B 2HJLA 5A40E 2E7LA 2IFGA 1F6LL 2F19H 3RTQC 2R15A 2DYPD 3PWNB 4HCRL 5LAXB 4K07A 5CBAB 1MQKH 4U6TA 1P5VA 3TCLB 1QO3A 2A83A 3HE6D 1KXQE 1Q38A 4O2CB 3UPRA 3PGCA 4FHBD 5HSFA 4LNVA 4LAJH 1SJHA 4PP1D 3IYLW 3MRDB 3BE1L 3L9RB 4MA8H 1FNGB 3T8XB 1ZVHA 1DDHA 5J9PB 1M7DB 1HH6A 2BNQE 5HHVL 5CEYB 2FBJL 3OGCB 5F3BB 4WHYG 3VGEA 3TT3H 4D8PB 5BZDB 4Q0XH 1KYOK 3VXME 2FO4B 1CD0A 3G6JE 4HXBH 1P5UA 3IDJA 4OCXH 1C5BL 4EDXB 3CLFL 3IDMA 1MHHA 1JPFA 5CHNB 1IC5H 4JHAL 4Y5XC 1YECH 2VIRA 4GKSB 4U6YA 2ENSA 2NYYD 3V52H 1AE6H 5FGBC 3E2HC 1BQUA 4UTAL 3SGDI 1UKSA 4MNGE 3EOYG 3RWGA 4LDLB 4ELKB 1KIRA 3EDJA 2OQJB 3RP1A 4ONFL 4KI1A 3C9NA 1KIQA 2E27L 5DK2A 4IOSD 3WEXA 5J0BA 1XH3A 3DO3A 1KELL 4P5TA 2GY5A 3R4DA 3GMMA 5DK3A 5J12C 2XOTA 4O2EA 3NGBC 2IMNA 3WJJA 4ZPVB 3P4NA 1ZOXA 4IHOA 2P24A 1KTKE 1J1OH 1C7TA 4OQTL 3FZUD 4M1CC 1A1NB 2ZNWA 4KGJA 5F89B 4FFYH 4Z6AT 2WQRA 4FQXD 1GGBH 1T7YA 3S35X 4IJ3B 3ZE0E 1SVCP 2DL2A 5MI0B 4LSSH 1ZTXH 1S7QB 4OF0A 1WBZA 1AR1C 1DEEB 5SWSE 3VMPA 2UWEB 5DMGC 3B9KB 1KB5B 4HEPG 3TYGL 4F57H 5IROC 2EKSA 1FGVL 1IGTB 1QFUH 3ARDD 3A6OA 4I18C 1YA5A 2R1WA 5E9DD 4Q6IC 1IARB 2R9HD 1PG7H 5BS0B 2ICCA 1CK0H 5D2NA 1LK2B 4GW4A 5T3ZL 3MC0A 5T5NF 1D5BB 4TTDD 3GI8L 2CIIB 5CSGA 1MI5B 1P7KB 4RAVB 4CADB 3X3GL 4K8RC 4WTZG 3U7WH 4CU8A 3GSWB 5J6GA 2W1NA 3H9HB 4NCDA 5MHSD 4MQXD 4ZOEA 5HYJA 2GSIB 2A6JA 4P3CH 1IC7H 3QDME 4Z9KB 4PV8B 2W60B 3PE9A 1KULA 4UMGA 1WZLA 1JZ2A 5FKAA 1IMHC 2DQDL 4ZUTB 2OMBA 2P49B 4JAMA 4MAUL 4QO1A 5E2UL 3SBWA 5GGQH 5KVMC 1BPVA 4G8GA 3RPIB 3MSPA 5BRZA 4AM0A 4R2GD 4WTZA 5DHVA 1VADB 2C3VA 4HC1H 5LXGH 2B2XL 3G6JF 3O6FA 4JRXA 2IQ9L 1CVSC 4NHUA 3E0GA 3X14A 5BQ7B 4X7SH 1DBBH 3QAZB 5FYKD 3MLTB 3KPSD 1U8OA 5L2KA 4MA1C 5I75B 2CR3A 3I3DA 2H2PD 1AHWC 3T65B 4L8SA 4JY5H 3D0LA 4G9FA 4WHCA 5DVNA 5K9KA 1CE6A 3AS1A 3PG2A 4NZRL 4L1HA 5CZXD 3C5ZB 1CZ8H 4HUWA 2ICWI 4TVSa 1UB6B 5I1LA 3MCKB 4QRRB 1F42A 1OAXL 1VPOH 3O3DA 3RWDA 4GAFB 1RFDL 3I02A 3SKJL 2EDYA 4YHLH 3WIIH 4QTHB 5BCAA 4ELMA 3U9PL 3TPUB 3OXRA 3B2VH 2DOCA 4P3WA 5C92A 3GSOB 5F1OB 4WI4A 4U05A 5D1ZA 3V4PL 1NGQH 1OF2B 4HMCA 2I9TA 5GRJL 1R3HB 2EDNA 2W9DH 4OLXH 1MWAL 2YPVH 3BEWA 2VDRH 5IOPA 1FNLA 2ITCB 3QQ3A 3SDDB 1LNUB 2XWTA 4JFDB 5A3IC 2R8SL 2AP2A 4MNQA 4HPYL 1GGIL 3UJTL 5CFHA 3D9AL 3O4LD 4UAOC 4M93B 1SY6A 4RSVA 4YC2C 4L29A 4PRDA 5SX4H 3SCMB 1S7VA 3J8F7 1HQ4B 1QFHA 4M7ZC 3DIFA 1FIGL 3MLYH 1NMBL 2CJUL 3DX6B 2IALA 4JRWA 1UZ8A 1DEDA 1WIUA 2V5SA 3GNML 4Z7VA 2AEPH 3C09C 4Y5VC 5I9QB 3IFOB 4NFDA 4UU9B 2D2OA 1J10A 1FZOA 1CL7L 3R8QA 4XCCH 5ACZA 1KLGA 1VEOA 1QG3A 1LO0H 1T66D 1JGLL 4BJLA 2NY1D 2GJ6B 2GAZA 3OKDA 3P4OB 3PL6D 5HI3D 3UTQB 3KYNA 5DD3H 3LKOA 4ZYKA 1NC4B 3T2PA 5KS9B 1J8KA 4HT1L 5F7NC 3LQZB 5HDBE 4G43B 1FSKC 3T3PE 2OBGA 3WN5B 4FZEL 5TH2A 5BW7C 4XXDA 5GGVH 1X5AA 5E4EB 3P4MB 5IEHA 4XPFH 4KGLA 5DJYB 5IKCB 5FYJD 3VXQA 2F9BT 2EE2A 4NNPL 4M7KL 4JO2L 5JHDA 3QUXC 3SKNB 1MJ8L 2AKRA 1H15B 2DBJA 3CVHB 4PJXE 3SEPA 1JGUH 3L7EB 4ODVL 2N56A 5EN2A 3VRJA 5DR5H 1Q94A 3IVKB 2JCCB 4HX1A 1A7QL 1UJ3A 5F7YC 1U91A 3RBGA 3EFFA 5C0JA 1DBJH 1EEYA 1ES0A 2P46B 1XGUA 3V6OC 1JF6A 1YEDB 3JWOL 1KCLA 3VRLE 1QD0A 3IAGC 2A77L 4FXLA 4JFHE 1ZLVK 4Q97A 5T5FH 2X2YA 5LQBH 4J3TA 2DLGA 4MQ7A 1A9EB 3LQAC 4R97B 4Z78B 1V3KA 5LG1A 3MXWL 4Z0XB 3KPMA 4E42A 3RRQA 2AEQH 4LCCC 1JTTA 2YRLA 5DJ8A 1I4FB 3MCLH 4QCIA 3SO3B 2C7UB 5F6IB 5IFAL 5HTSA 4NKOB 2NMSA 1U0QA 5T1DH 4Y4KC 4OZHA 4U3HA 1YEKL 4X4XB 4OGXL 3IS0X 4PJEE 5FM4A 1UVQA 3DO7A 5GJTL 4NM4L 2XTJC 1N6UA 1CF8H 3FB7B 2Z35B 3ZL4H 5I8KH 5FO8B 1RJCA 1KCRL 4IOIB 5C08E 2DMCA 3RVUD 2J8UA 5KVEL 4GAJH 1R3KA 4MHHG 4L3EA 2X1QA 3IDIA 3MA7B 4NQEE 5CIPA 3RX8A 1DL7L 2ATPB 2HWZH 3LV3B 1OAKL 4MJ6A 4O58H 5B4MD 3BJLA 2VDOL 2XZZA 4NKIL 2BVQA 4LSTH 4QOKA 4H20L 4MX7A 1F3DJ 4DGYL 3MGOA 1SHMA 2YD6A 3PIQA 3KJ4B 3T3PF 5DVMA 2H1PL 3GK8L 3U6RB 3FQUB 4BQ6A 5IG7B 3FHQA 1FLRL 4ESKA 2VLKE 4X9HA 1HI6A 5MENB 5B8CB 3BWAB 5JNYB 4C83B 1C7SA 1KJ3L 2BMKA 3VCLB 5ID1B 4U2YA 2X09A 4ZS6D 3FN9A 1X5FA 1QQDB 2QTEA 3DMMC 4ZO7A 4NZTH 3WDIA 1VFBB 4KHXH 4ALAL 2GI7A 1IC1A 5L88H 4PJHE 3CC5B 4G8IA 4XP1H 3MLRH 4FFVC 4F7EB 3K1KC 3DTXB 4PJXF 4P4RB 4N8PA 4MJIA 1MCKA 5ALCL 3WXWL 1RUMH 5CUSL 2BCKA 2XZQL 2GTWA 3GRWL 3QDJD 5IBUG 1AKJD 2ATKA 2WUCH 3O9WD 1PZUB 5BV7H 2CDFA 3AMLA 3IJYB 1T03H 1MRFL 1IBGH 4OCSH 1NMCC 3PGFL 1H3WM 5ISZB 3NN8A 3IJHB 2CGRH 4NHCL 3ZKND 1O5DT 4JRYA 4U0QB 2A0LC 3VMNA 4L8CB 3QIUC 4XP9L 3ULUE 4F15C 4NRZB 3NPZB 1T7XA 3TJEH 1T1YA 3T1FA 1DQDH 1S9VA 1H3GA 5ADPH 3B6SA 5C86A 4MB3A 4Z7UE 5MEPA 4NN6B 5J13C 3TBSA 1G6RA 1NAMB 4UQ2B 3SE8H 5BVPL 3WS3A 2NXYD 3QFJB 1YUHA 3Q6FA 4KFZC 4NCC1 4K2UL 4O4YL 1G1CA 1CDYA 3BIKB 1QLEL 1H5BB 3SKUD 2CPCA 1D5ZA 1I7ZB 1TLKA 4PJEF 3BP7A 3BZFA 3OKOA 1JJUA 3IF1A 4YBLB 3VXRB 1AC6A 1ORQB 3EAKA 2E8YA 3MO1B 5J1AB 4OFVA 4HS3A 5EB9A 4RGMB 3RVWC 4AEEA 1U8LB 4PGBB 2W0LA 4NQCD 4KJQC 4ZTOH 3HG1A 1DUZA 3G6DL 3JUZA 5CBEA 5IVZA 3IXTA 1F8TH 2JB6B 3ROLA 4ORGB 3KHQA 2V7NB 4YFEA 2OJZL 1HSAB 4OUUA 5LGKA 5GZND 2XTLA 2NZ9C 1JMZA 2OL3L 2JKXA 3ARBC 4IDJH 3UPAA 5DJCB 3LSOA 4HFWA 3L5WB 4DUXA 3WHXA 3QUZC 1JWMB 1CXLA 4XZUB 1HEZB 4IRSC 3ZHDA 3BE1H 4GMSH 2EE9A 2H8PA 3B2UC 2DQTL 5DRZA 4NN5C 1MOEA 5JZ7D 4OZGA 4ZPTA 5I76B 1I85A 5JR1L 4RGOL 3ZDZE 1U8JA 1FZMA 4JHZA 3VWJD 2BXYA 3HC3L 2H6PB 4PJHF 2F74B 1EUTA 2YPKA 1C5BH 1A1OB 4MS8D 4X5WB 4Z95L 5A2KH 4JHAH 3T04D 1MRDL 1A6TB 3QWRA 5D9SB 5C2BH 1T5WB 2PYEB 3OKMB 4I3SH 1WF5A 3KJ6H 5I1IL 4ZXBA 2XZAL 4NCC2 1S7WB 1V7ML 2CH8A 4NFBA 2APVA 1H9VA 5EOCH 4BSVA 4OIIL 3VXTB 1UWXK 4K3DH 3RIAF 1AO7A 5C0CD 4MD4B 2E27H 2GK0A 2VDMH 4YXHH 3L5HA 2CLRA 4RBPK 5FF6B 4E41A 5EOQL 3ULUF 1H0DB 5DI8B 2J88H 4YBHA 4WUUE 2WLZA 1I3VA 3MRFB 3U30C 3VFRB 3GM8A 3AAZA 4ETYA 2V2XA 5I1GL 5F7EL 5D7LE 3EYSL 3RGHA 3HB3D 4KUCF 4Z7UF 1XGPA 4BH8B 4KXZH 1Q72H 1WBYB 3CZJA 4EXPX 1RJZA 4FTVB 1A8JH 2EDBA 4APQA 4LCWA 1J87A 8FABA 1UH2A 2OZ4A 3AY4C 2W0PA 2CKBA 1FYTA 3LS5L 5B39A 1QRND 3M17B 4JG0L 1HXYA 4O02H 4ZG1A 3BYTA 2MJWA 4YFLI 1FGVH 4NQSB 3WE6B 1LMKA 1QSEA 4WFGE 3FOLA 5JOPD 4YPGB 4I4WA 5ERWA 4I2XA 2NY5L 4GLRI 2P7TA 4ZS7H 5T3ZH 2NY0C 2DM4A 3QT2A 1WCBB 4XNXH 3TF7C 1BFVH 1CFSA 3X3GH 1IL1B 2IAMC 3BDBA 5I16A 3IU3B 5GSVA 2E7MA 4DK6A 5D6DC 2FO1A 1I1FB 3DVNB 1T7WA 4R96A 5C0AE 2R1YB 1NKOA 4F7TA 3S36X 3ZKXB 1J5OH 4QRUA 5LAXA 5CAYB 5CBAA 4WO4B 5EIIB 4TNVK 3MX0A 4X6FA 3VU2A 2IH3A 3TCLA 1WJ3A 2YUXA 4L4TE 3G6AA 1EMTL 4OD2A 4O2CA 4MAUH 3HZKB 5E2UH 3D0VB 3MRDA 4NFCA 3ZDZF 4KAQL 1FNGA 3T8XA 3KYAA 3EJYC 2OM5A 2WBJD 3LEVH 5J9PA 1M7DA 3QJHB 2B2XH 5CEYA 2Q20A 1IKNA 4IIQB 5F3BA 4XNYL 4D8PA 5BZDA 4X98B 1U8QB 2FO4A 1QPPA 4HUVB 3FQXB 3KXFB 2VXTL 5C0EB 1JYXA 3V6ZB 4X6EB 3TN0C 3CDFA 4WV1B 3WBDA 5CHNA 5TJWK 3I9GH 4GQPH 4AMKL 4U31A 4H5SB 4U1NA 4DVBB 1I1AC 2APFA 3HI1A 3OPZL 3ZDYE 3C6SB 1QNZL 4ELKA 2IANE 3LQMA 3T2OA 3SKJH 5FYKL 4EVNA 3GMQB 1SYVB 2FSEB 4KRPB 5HHPB 3U0WL 5C6TL 1YQVH 1KJ2H 4UT7L 1JZ7A 4V2CB 2RCSL 1K6QL 4DGVL 2X7LB 4C56B 3TBTB 5I1DA 4H25B 1QSFD 1YEFH 3GGWB 3SDXB 3BGFB 5F89A 3FTGB 1U8HB 3CU1A 1MWAH 1HWHB 4KUZH 1S7QA 4Y2DC 4RA3A 3ARGD 3PP3K 2UWEA 4HPYH 1KB5A 4XBPB 3HMXL 3KR3L 4WTWA 4RWYL 1LILA 4NKDB 4EUPG 1A21A 5HI5D 2D0GA 4BUGA 2AI0H 1CD1A 1II4E 1N7MH 1LK2A 1FIGH 1D5BA 5IVXE 1NMBH 2CJUH 5HJ3A 3QAZC 1P7KA 3G5VB 3WFHB 4CADA 1NPUA 3EFDH 3PP4H 5I75C 2P5WE 3BDYL 1MCWW 1ERNA 3GSWA 3H9HA 3PGDB 5HYFA 2HVJB 3IU4L 2GSIA 4TPRL 2KKQA 3BPCB 4JG1L 1MFEL 4O5LH 5F1IA 2BZDA 2W60A 4ZUTA 2CRYA 2FL5A 3I50L 5FDYA 1XF1A 1CWVA 3C5SA 4FZEH 4RDQG 4X6CE 3RPIA 3CFDB 2O5ZL 3FFDA 5JHLL 1IEBB 4GAGL 5IWLA 3BKYH 1VADA 5IJKA 3QWQB 4JREB 4L5FH 1BGXH 1RJYB 2EXYD 4F9PC 1MJ8H 1WUNT 2BNQD 1DANT 2FX7L 2ZCKL 3DWTA 4DFHA 5EUKA 2M2DA 3MLTA 3QI9A 4KI5C 5E99H 3JTSA 3VXMD 2DBLL 4CJ0A 3T65A 1FO0H 3VJ6B 4OI8A 5C7XL 2VZVA 3ZDYF 2FX8L 3SE4C 3DBXB 1D5IL 1AQKL 1VGKA 3PHSA 5FYJL 1JGDA 3OZ9H 3C5ZA 5IMOB 2FJGA 1E27B 2Y5TA 3P9MA 1UB6A 3MCKA 4PJFB 3FRUA 4PYGA 1FFPB 3ZT6A 3LDBC 4C55A 32C2B 4MD0A 2FNBA 2IMMA 3JWOH 3OAZK 1BD2A 5TGBB 1N4XH 4JY6B 3TPUA 5I6XB 4XHJD 2A77H 2O5XL 3D5OF 4PLJD 3OF6D 3HFML 1R5IA 2Q76A 3S9DB 5DA0B 3GSOA 2G2RA 2EEAA 3MXWH 3QQ4B 4IMLB 1U6AL 5IR1B 4YHPB 1B90A 1ORSB 4P4KA 2MOVA 1BFSA 4WTXA 4Y16C 3NZ8B 3SDDA 3MV9B 1KTRL 1LNUA 2YK1L 3PDDA 4JFDA 3C5JB 2HKFL 1YEKH 1S9XA 3W5MA 4OGXH 5EU6B 4AIXA 5SWSD 2X1WL 5GJTH 3EDDA 5IVXF 4NM4H 3SCMA 3OXSB 4AENB 1DTUA 4X9GA 1HQ4A 4RNRB 4NC2B 4LAQL 4M48L 3DX6A 4LCYB 4DN3L 3CH8A 2HA1A 2BNRB 1SMAA 2W59A 2VDOH 1EPFA 5HYJE 4G6JH 4NKIH 3EBAA 1MFAL 2D7OA 4H20H 4K3EH 4JN2B 4X9IA 1FNAA 3IDUA 1PX4A 4TUOB 3DPBA 3UTQA 3GK8H 2DN7A 5TQ0H 4YGVB 2L7JA 1NC4A 2UZYB 4IOFD 4X6CF 5KS9A 2F5AL 1BIIB 3D85B 1EV2E 1YEIL 3QDMD 1P7HL 4G43A 4EIGB 1KJ3H 3WN5A 3BP6A 1YC8A 1T83A 5DK0A 5GS0D 4MD5B 5DJYA 5E6IB 4ALAH 1JF5A 3PWVB 4JRXE 5IB2B 1I8IB 1K2DB 3GBML 3SKNA 4MDJB 4U1GC 1OP3K 1MVUA 2Z93B 4LVNB 1CICB 5C07B 3SO3C 3D2UD 3FQTB 1H15A 4MXVF 5ALCH 5FGCB 1JFQL 3TNNA 3WXWH 5CUSH 3L7EA 1ZT7B 2WWKT 4HLJA 1UACL 2HT2D 1GOHA 2JCCA 3MRLB 1QRKA 3SPVB 5JIKA 4G8EA 4FQ2H 1GOFA 3RDTC 2BHYA 5EO0B 2X89D 4PJ5E 35C8L 4NHCH 4FOMA 4D2NA 3BISA 2DKUA 2R0LL 3L5JA 3L3IB 4GW5B 3QNXB 1IQWL 4R4ND 1CGSL 2EXWD 4ELME 4PGDB 5H37H 3W0WB 3VG0H 5LVEA 1NCCL 3BPOB 4OZIA 4X5XB 1A9EA 4FABH 2K3TA 4Z0XA 4YE4H 2NY4C 1S7UB 3WUWB 2W91A 1I4FA 3B43A 4HJ0D 4YEEA 1N2RB 3EO0B 4O4YH 1GL4B 1CD8A 2C7UA 3Q0HA 4YHNB 4X9BA 2EDOA 3UJJL 2GUOB 2LE9A 3DXAD 5FOBA 5B8CC 3VD4A 4MNQE 5DC0A 1C5DB 4QF1B 1JUFB 4KJWD 5D72L 1QP1A 4L9LC 4J3VA 2UUDH 5FV1L 5AZ2H 2X4NB 4PJCB 3MV7A 4CJ1A 2OTWA 4TYUA 1T20B 2Z35A 1QBMH 4S1RH 4I3RL 4IOIA 2JJSC 1RURL 1H8NA 1HYSC 3QUYB 2ATPA 2ZP0T 5TPWH 5DYOB 5HGHB 1XZ0B 4R6UA 3WIFA 5I18H 3LKNB 1DE4B 1H3XA 2YUWA 5BVJB 1HHHB 4LLDB 3KWWA 1BQHG 4F7MA 1J1PL 5TDNB 2OCFD 2PO6D 3OKNB 5IBLD 2VQUA 2YUZA 3DYMA 3U6RA 1FPTL 1OP9A 5D5ME 2HJKA 5A2FA 5IG7A 2H3NB 1GXEA 4RGOH 1MLBB 2HT4C 3PV6B 1FAKT 5MENA 5JNYA 3BWAA 4KROC 4C83A 1XF2B 3HC3H 4XVUC 5JLZB 3VCLA 4RISH 1QQDA 3MZGB 4KK8D 1I3GL 3QPQD 4NN6C 1H8OA 1KC5H 1VFBA 3WFBL 4LVHB 3CC5A 3MRBA 4OD3L 4TQEL 5JHDE 1QKZH 1MRDH 1BQHA 2D7MA 4F7EA 3DTXA 4P4RA 4OCWL 3TFKD 2R0ZL 1NCAH 2F54E 2R23B 1AR2A 4NQVA 1AP2A 5DFVC 3V5KB 4OI7A 3QEUB 3BVNB 3IAQA 3MXVH 1V7MH 2WW8A 4ENEC 3EDEA 1G7HB 4OIIH 1VGEL 4PRHB 5K59E 1ZGLA 5TDPB 1E4WL 4M6AA 3RVTD 3FO2B 3LHPL 1BWWA 5ISZA 3NVQA 3BW9B 3IJHA 4XAKE 2YBRB 1C1EL 2PXYD 3UX9B 3ARFD 4L8CA 4LASL 4LHJB 5F1NA 4ELMF 3HNSH 1OD9A 3GFUA 1LDSA 5F7EH 3EYSH 1MCHA 2YD3A 3ARXA 3R0MA 4ZO9A 3C60D 3RFZC 3C8DA 1J0IA 1WQVT 4LLWB 4MHHI 1MCSA 3DX9A 4YK4C 3LS5H 5J6HB 3FO9B 1NAMA 2KUTA 2VDNL 2VDPL 4UQ2A 5GGTH 4MWFB 4JFHD 5BV7B 3QFJA 2HJFB 5F6HJ 3HN3A 5DEFB 5E95B 3AROA 3MACL 2EZ0D 4HGKC 1XR8A 3BIKA 1ZHKB 4LGRB 1I7ZA 4XHQA 5K93A 4HWBL 3L5XL 2NY5H 3M1BA 2E9IA 4BH7B 2Z8WC 1FLTX 1U8LA 4PGBA 4MAYD 4PJBB 4WDIB 1F97A 3F58L 4P23D 2RJMA 2AJVH 1U92A 4FG6D 3UP1A 2JB6A 4ORGA 2ADIB 2V7NA 3T0DA 4GXUM 1NGWB 1HSAA 4W4OC 3PWUB 1EMTH 5EULV 4QOKE 3KPNB 4XZUA 3X11B 5D5MF 1HEZA 3CD4A 5ITBH 3RKDC 4Y5YB 5F7MC 4C57C 3PWPA 5I76A 1ADQA 3HLAB 4NRYB 1A2YB 1P84J 4P9HL 3V8OA 4CGTA 3QG6B 1MIML 1DUYB 5IQ9B 1PYWA 3JWDL 4A2LA 2F74A 1A1OA 2ADJB