2FATL

An anti-urokinase plasminogen activator receptor (upar) antibody: crystal structure and binding epitope
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ATN-615, light chain
publication title An anti-urokinase plasminogen activator receptor (uPAR) antibody: crystal structure and binding epitope
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL01
2ZKHL 3CFCH 4QTIH 1RUQL 3PGFL 4Y4KD 2R29L 2R2EB 2ZOLA 1L9MA 2X4UA 2A6KA 2XWBB 4HKXB 4M62H 3ZKXC 3D85D 3GHBH 4TOYL 1TVBB 5TE4H 1XR8A 1Q1JL 5IBLD 1A7RH 3EGSA 3ULUH 2GITA 4LP4A 2R2BA 4ODSH 4GJTB 3BQUB 3W0WE 1RUPH 4QTIL 3GZKA 3V4UH 4WI3A 1IM9D 5ECJE 1AGFA 4GKSA 3QWOA 3V4VH 3K0WA 3U0PB 2FBOJ 2YBRB 2D7QA 4M62L 3GHBL 5TE4L 4AK1A 5FO7B 5D96B 3VFRA 1HK6A 1QSEE 3ULUL 4U0QB 1HDMA 4ODSL 5CP7B 1OLLA 5ALCL 4CMHC 1FFNB 4FFVC 3QQ3A 4JFDB 1RUPL 3AS1A 2EZ0C 2YSSA 5F7WC 5I8EA 3V4UL 1L7TL 4R0LC 1DEDA 5TFSH 4PJ8C 3KR3H 1J1PH 1P69B 3C60B 3F7YB 3V4VL 1UKQA 4OAWA 3VDCA 5KOMC 2R23A 3JTTB 3VGHA 4YBQC 5IF0A 4DAGH 3CSGA 3BRDA 5F3HA 5GZND 1KENH 3PWNB 3HS0A 1NFDA 4OCLC 5BRZB 5MEND 3HAEG 1EERB 2X4RB 2C3XA 3DX7A 3LEXB 5EOTB 5TFSL 4ETYA 1MJ8H 4GO6B 3KR3L 1J1PL 1BOYA 3ARUA 4Z5RB 3ZT7A 3C09C 3X13B 4AEIH 3PWUA 1U41A 3RTQD 2YC1A 2NY1B 1MCRA 2JELH 5I30H 1L0XA 5T3ZD 3TPUA 4R2GC 5C07B 1KB5B 4OFYA 1KENL 3HUJF 1T1WA 2VKWA 3D39A 4EUPG 4PRHE 2FD6L 3MLYH 1W0VA 1XF4B 2EDXA 2XTJC 3S36H 3SPVA 4HUMB 4AEIL 3S4SB 5ACLA 3VXPA 5IMMB 1ZK9A 3NN8B 3RL2A 2JELL 5I30L 1T5WA 2VLJD 5DRNA 1TVDA 3HR6A 5IJVA 4GKOA 4OGZA 4P57B 3TYGH 3LN4B 3MZTA 1GJIA 1BZ9A 3CCHB 3IJHB 3WDHA 4LCWA 4N0UB 4I0PD 5I1AA 2HFEA 1CLYL 3QFDB 4ZSOE 5F96H 1WWBX 4FP8L 3MRQB 3ZO0A 4PJ7A 4I9WE 5BOPA 3V0WH 4KMTH 2V9RA 2VDPH 2VZ1A 2GCYB 5HGDA 1CDJA 4JEGB 2EH7H 1OP5H 1GIGH 3TYGL 1ZHKA 2VZSA 3TNNB 3O3UN 4EXKA 1ZWIA 3LKOA 3PHSA 4QRTB 3VH8B 1ZLWK 4JFXB 2QBWA 1AO7A 3DRQB 1A64A 5F96L 3DGCR 4NZDA 4I13B 4L4VD 1P7KB 4QCIA 4QRPE 3V0WL 2NNAB 4FQHB 4KMTL 4QLRA 4MDIA 4W4NA 1X5GA 2WWMD 2VDPL 3RNQB 5C0DB 2EECA 3STLB 4PJ5D 3V6OE 4NQDB 3EDFA 4ZS7L 2EH7L 1IL1B 2AEQH 1HHIA 5JOPE 1RZJC 4HEME 4X5XA 2EDYA 1N6QH 3UCRA 3QAZB 4LKXA 3CUPA 3EOAB 3B5HA 5DHVH 1NGZB 3FB8A 5HHQB 4LPWA 3LRSB 2WBJD 1S9VB 3BYTA 3T0XA 3UTSB 1K4DB 4NQUA 3H0TB 3QDJD 3RWJA 5B8CB 3ZL4H 4KI5C 2AEQL 4KTEL 4S1DC 4KK9D 1M1SA 2I24N 4WO4B 4RIRA 4LLQA 4MJID 3HG1E 5IB3A 1GGYA 4PJFA 2G60H 1VA9A 1N6QL 1KCLA 3MRKB 1I7UB 3TBYB 1NCTA 1YUHA 3SDAB 4X5WB 1AHWA 3L3DB 4HKBB 2ED8A 1F6AB 2YEZA 3MBEC 2IBZX 5HHOA 1QFPA 1JK8A 1XF1A 2Z8WC 1LQSR 4YX2H 3ZHKA 3GJFB 2C1PB 2FIRT 3GRWH 4FZEH 3AMLA 4JB9L 3CNKA 3HE7D 1WZMA 5HGAA 4HIIB 4PJEA 1PW3A 1U8MA 4PGZA 2RJMA 4J2XA 3VWJC 1J5OH 4WU5A 5JW3H 1MJJA 4H1LB 1U3HD 1IBGL 3KPNB 4NBXB 3PV6B 3JWOC 5DJCB 3CVIL 1B0GB 4MLIA 3H9YA 4YX2L 4K94H 3L7EB 1SYVA 3GRWL 4FZEL 4C56B 4L3AA 2H8PB 1AGDB 1KNOB 3MROA 2I07B 1ZSDB 1FL3A 5F1IA 1OB1B 2P7TA 1KIPB 5E6ZA 3QIUD 3H7LA 4JQXA 3WHXA 5KVEH 3C6LC 3RPKA 3BGAA 1J5OL 2VNCA 5JW3L 2Z4QB 1TVHA 1WBXB 2R1WB 4K94L 4PJIA 1KYOJ 1QVOB 5C0AE 4WWKA 5MENE 1X6NA 4HLZG 3W81A 3KYOB 5TH2B 3V0VA 5EOCH 2V7NA 1UA6H 5D7LD 1MRCH 2ZG1A 1PX3A 2OX5A 3KWWA 2IPUK 4ZYKA 4N8VB 1D9KB 5D1QB 3SHSA 4DGIH 4Y19A 5EIQA 4P5KA 1BEYL 1QPXA 1I7ZA 3QIWB 3VGAB 5FKAA 1EPFA 3SGJC 1Y18B 3O4LD 3M17B 4Q2ZB 4OZHA 3SCMC 1ZHNB 2P8LA 4QHNB 3EAKA 1OAKH 5EOCL 2ICCA 1UA6L 1MRCL 4HWZB 1C8PA 2V9TA 3PHQB 3SKNB 4ELMF 1LDSA 1CD1A 1QSFB 5C0CD 2C4FU 4DGIL 2VLJE 1ADQL 1FNGA 5FAAA 3GSNB 3L5WA 1AIFB 4HUWB 1KEMH 3C5JA 4U0RB 3H3BC 1CTNA 3FCTA 5HHVH 4L3EE 4XHJD 3MRLA 2FYYB 1OAKL 4JREB 1K3ZA 1SEBB 3V9FA 1LWRA 5EZJA 1NMCC 3I3DA 2ICES 4W4OC 4U6YB 5EU4A 4BH8A 4NPYA 3PIQA 1WFTA 1ORSB 5FYJD 3QUZD 5DS8B 4PPTA 1KEML 3E6HB 5F88A 5CD5D 2RCSH 3QJFB 2Z35A 3PP4H 2VTFA 5HD8C 2HG5A 5HHVL 2K3TA 4NQXB 3TF7C 4LKCB 2HVKA 5JW4M 4JFFE 3HE6C 3BO8A 2XRAL 4RWHA 5SWSA 5BS0D 2EIDA 4NYLA 2BVOB 3ZDXF 5GS1B 3KXFB 3GM0A 1A21A 4JVWA 4M7KH 2RCSL 3HMXH 1UEYA 3PP4L 3O8XD 5LGKA 4JFZH 5DD6B 1EFQA 5EU7C 5J0BA 1U3ZA 2PW1A 1NFIA 4GFTB 4YNYA 5E2JA 3MUGA 3VXRD 1FVDA 4XHQA 1JJUA 1M71B 1S9WA 3IAQA 5H2BA 4XC3H 4JAMA 4DGYH 1H15A 1AI1H 2D4FA 2OL3B 4I18A 3QDJE 3O4OC 3V6BR 4M7KL 3BH8A 3HMXL 2GK0A 3K7UA 3WLBB 4JFZL 3PHOA 1CICD 1BFSA 4R7DA 4EN3C 4S2SB 1HHGA 3RWCB 3FO2B 3QG6A 3SY0B 4Z7OF 2FR4B 3ARFA 1A1MB 3O6FC 5C0GA 4G8GB 4XC3L 3SE9H 1LP9F 1NAKH 4DGYL 4PRAA 1AI1L 3D25B 1YA5A 3MLZH 2ICWB 1TNNA 4XTRC 3SDDC 2VIRA 3RUGB 1XIWC 5ESQB 4I3SL 4XMKH 3WEXA 2H6PB 2ENSA 1I3VA 3DGGA 3NCFB 3AREA 1OTSD 1JHLH 4NCC1 4XXCA 5SWZA 5T1LA 5ABDE 2QV2A 1A3LL 3PP3K 3SDCB 3SE9L 2GJ6B 1NAKL 3WN5B 3IXTB 3MLZL 4Z7VF 3EFFA 3L3IA 3TIEB 2DQDH 3RIAF 4XMKL 1EV2E 3MREA 5J06A 2BSRA 5ETUA 2QR0A 2NR6D 2FECI 3U83A 1V3MA 1JHLL 2Q76B 2EICA 5IVNA 4L8SB 3E2HC 4A6YH 2PO6C 4HBCH 3CMOH 4KWUA 1CLZH 1MFAH 2AERT 3QISA 2CR3A 2DQDL 2AEWA 4AT6A 1KBGH 4TVPH 1UH3A 2FLRT 5HYEA 5I2IA 2XNAB 4KXZI 1WITA 3RIFK 1NCAH 3RWHA 1RZJH 2OS7A 4A6YL 3VXOB 1VFOA 4HBCL 2FO4B 5KG9B 4E5XA 5AAWA 3ZE2F 1CLZL 1MFAL 4HUVA 3O4LE 1KBGL 4WFHD 2VLLB 4LLYB 1U8QB 4TVPL 1WWWX 3U7YH 3AS0A 1NCAL 3SDXB 2ADJB 2FWOB 4PRPB 1RZJL 2ICWI 4KJWD 4EDXB 2EDQA 1F3RB 3T0DA 1NEZB 2PYEE 1HQ4A 2V2WA 3F6LA 4G6MH 3DVGA 3UJJH 1ND0B 1NLBH 3MRDB 1N3NA 3SEPA 2UYLB 4ONHB 6FABH 3BD4A 1U0QA 4I3RH 5DJZB 4Q6YA 4JQIH 1CFQA 3B3IB 4GW4B 3RGVD 3HZKA 1F6FB 1UXWA 5E8NB 2BERA 4Z0XB 3U7YL 2BNQD 4NO2B 3LPWA 5CZVL 4NFBA 2D0FA 1XGTA 5FYJE 4G6ML 3UJJL 2ZOLB 1NLBL 2JCCA 4JZJC 1T20B 2X4UB 4LMQI 2A6KB 5C0JA 3JWOH 1T66D 1G7JA 4P59H 6FABL 4I3RL 3HC0A 3JVGC 5LBSH 4JQIL 1XR8B 1FLTX 1EK3A 4LFHD 3H2WA 4P2QD 5T5FH 3EGSB 1H3UA 2GITB 2IH1A 2R2BB 2JJSC 4JM2A 3O81A 3WHE1 3QUMH 1T83A 4WV1C 2LTQC 3F5WA 1AGFB 4GKSB 5DVOA 2HTLC 3QWOB 2WQRA 3FQWA 5C0BA 3NOIA 3J7HA 1JF1A 1S5IH 1U8LA 3JWOL 4P59L 2FBJH 4BM7A 4MD0A 5LBSL 2UUDK 5CCKL 5DFVC 3VFRB 4UDUA 5T5FL 4FQXC 1WK0A 1A8JH 1E28A 2VLKA 1HDMB 1IC4H 3UBXA 3VG9B 1YC8A 2LU3A 3QQ3B 3QUML 4JJ5A 5I8EB 2YSSB 4AZ8A 4HC1H 4RCAA 1SY6H 1R5WA 5DJDA 2VDOL 4IOIA 4KJPC 4OAWB 1S5IL 4LGPB 3W9EA 5H37G 2R23B 3GKWH 4HQQH 1WIPA 5IF0B 5F3HB 4QOKA 3N9GH 4U6XA 1IC4L 3HS0B 1NFDB 4GAGH 3TWCH 4S1QL 3RA7H 4I3GA 2R0WH 1BD2D 3DX7B 2LVEA 5CEYA 1BQHG 1I9RH 4L5FH 4HC1L 1KJ3H 3S96A 3JUYA 1SY6L 2Y6SC 4JRYD 1LO2H 4J3UA 1AH1A 5KN5B 1CD9B 3PWUB 4RRPG 35C8H 5KSAD 2YC1B 3IXAA 1I1FA 1MI5E 4DEPB 5CSGA 3TPUB 3GKWL 4HQQL 3WD5H 1F8TL 3IJYA 1X5AA 1UCBH 3N9GL 3TWCL 1Y6MR 5L2JA 1OAZH 2AK4D 3RA7L 1T1WB 1HHHA 3EO9H 3D39B 2R0WL 1I9RL 1KJ3L 1FV1A 3SPVB 3W0WA 1LO2L 4ELKA 3VXPB 1BZQK 1L4IA 35C8L 1ZLVH 3RL2B 4BELD 2KUTA 1H3XA 1T5WB 2DMBA 3C60C 1DL7L 4LCCA 5DRNB 5IJVB 3WD5L 5TDOA 1J86A 2WUCL 4HIXH 1KPUA 4U7MA 1CGXA 4D0CA 2NLJA 1BZ9B 1OAZL 4G6AC 4PY8I 1SVZA 2X5PA 2UWEE 4LCWB 3TZVA 2JE8A 4J3SA 1T1YA 5I1AB 2HFEB 2HYMA 1G9NL 3F65A 2ICEA 5T3XD 4PJ7B 5JXED 4H8WC 3TBWA 2ZUTA 5HGDB 2NY1C 5MEOA 2XIDA 2Y1VA 4HIXL 3S6CA 1ZHKB 1LDPH 2FIKA 1I9EA 4DN3L 3U4EA 1ZWIB 1GOFA 2CRZA 1AO7B 1QEWA 4MJ5A 2DRUA 2DYPD 2UV3A 2OJZL 4QCIB 1PY9A 5SX4I 2YKLH 4IMKA 2VABA 4LSQH 4MDIB 5DK0A 4RX4D 4H25A 4HUUA 4L3CA 3HTLX 4XNYH 4WFHE 2I25N 5I8OH 3QXVA 1ZGLP 4JPKL 1LDPL 1MCWW 4Q6IA 5FM5M 3O9WD 1HHIB 3STBA 5IB2A 4U1SA 5C0IA 3ROOA 1YDPA 4PRHA 3RVWD 1OARH 5A3ID 2YKLL 5FO8A 4LKXB 2YN3A 4IOFC 3CUPB 4UV7H 3CZJA 4LSQL 3FB8B 4U4BA 4KUZH 3UTQA 1BZ7A 3RWJB 5I8OL 4KROD 2OZ4H 2BNQE 4JO1H 4KAQH 5C6TH 4L8DA 4KKBD 4RIRB 1AR1C 1JV5A 4IRJC 3VA2C 5IB3B 2G2RA 3WXWH 4PJFB 1KIRA 2P42B 1OARL 1JVKA 4YBHA 3KJ6H 1GPOH 5D2NE 1YUHB 5EU6A 1AHWB 2YEZB 4K3GA 4P99A 1BQLL 4KUZL 4P2QE 5HHOB 4OFVA 1JK8B 3VRLE 2OZ4L 4KAQL 3ZSSA 4Y4HD 2VZOA 5C6TL 5HGAB 1YPZA 1TZGH 4PJEB 2EKSA 1ZOXA 1U8MB 2NXZB 3U30C 2AXFA 1GPOL 4WU5B 1MJJB 3M8OL 5GQBA 3GSUA 3KJ4C 1FFPA 3WFEH 3ET9F 4YC2B 2ADGA 1XCQA 1I7TA 4I5BA 3PWLA 4YHKH 1T7WA 1DTUA 3P40A 3MROB 3OKKA 4K71B 5GGVY 1FL3B 5F1IB 1NC4D 2P7TB 2BY3A 3KG5A 1JNHA 3WHXB 5CILH 3QO0A 3WO3B 3UTTA 3H8NA 2MCG1 2ZWLT 4DZ8A 1X44A 2IEPA 5B4MD 3VI4E 3D2UA 3WFEL 5C70A 1KELH 1X6LA 3IJSA 3H9ZA 1TVHB 3OJ2C 5SX5H 4FMKA 4FFVD 4PJIB 2HP4A 4PD4K 4WWKB 2ID5A 1LEIA 4YHKL 4L29A 3H3PH 3WL9B 2X44D 3V0VB 1I1AD 4NQTA 5D1ZD 2V7NB 1U8IA 4S1RH 1MWAA 4JRYE 3KWWB 5CILL 1BX2A 4ZFGH 4XVSH 4Y4KA 2BP3A 4F7TA 4R9HA 4YBQD 4Y19B 3L5HA 4Y5XA 3B5TA 3TVMA 2P8MA 4P5KB 4YR6A 3T4YA 1KELL 5I73B 2BRRH 4K23H 3D85A 4MA1B 5FKAB 1KTLA 4OZFA 3ULUF 4UV4H 2AK4E 5J1TC 4QRSA 3OZ9H 3H3PL 4OZHB 2P8LB 3UTPD 4TUJA 4YHYC 1OP5K 4OM0L 3S97C 4S1RL 5CINH 3R06A 3BPOC 4BUHA 3KDMA 2FL5A 2XA8L 2DD8H 1ZE3C 3V5DA 3OXRA 1IM9A 4KJQC 4RWYH 4XVSL 1CD1B 5CEZD 4IIQC 5KSBE 3S34H 2CLZA 4Z7NE 1YYMH 3LEVH 1FNGB 1BM3H 3L5WB 1MY7A 3IKCA 3K8LA 3C5JB 3NCEB 3P0VH 4RDQG 5FK9A 2BRRL 4K23L 1G7IA 1F11A 4ONOA 4UV4L 3FCTB 2JTDA 3OZ9L 2PTTA 3FT2A 4H0HB 3MRLB 2C5DC 2I9TA 5EZJB 1H3TA 3QO1A 2DD8L 5EU4B 5T3XE 4BH8B 3QQ9C 3PIQB 2P47B 4NPYB 3S34L 3IDIA 2B20A 3LEVL 1BM3L 3P0VL 5D1QC 1VEPA 3O6ML 5F88B 2WV3A 2Z35B 2AXJA 3ZE0E 1HZHH 1X5LA 2HG5B 3QIWC 4GKZA 4XVJH 2HVKB 2JJUA 5MENA 4MYWB 1T21A 1C1EH 5ANME 3BO8B 1A1OB 5JHLL 5SWSB 3I3EA 4NYLB 4UOW0 5KANG 4XNQA 5IBTH 3RBGA 3RTQA 5GGSY 4GMSH 3FQNA 4NQCD 4XGZA 1M7XA 4XVJL 2PW1B 1NFIB 4Z8FH 3P2TA 1C1EL 3W82A 1Z9SA 4YNYB 5HHMD 1C5BH 4HG4J 2DQHL 3MUGB 1JYNA 4JREC 1DLHA 1CZ8H 1FVDB 3CDYA 1S9WB 3HI5H 5H2BB 4JAMB 2AVGA 5IBTL 5LWYH 1H15B 4GMSL 3EO0A 4I18B 5ITFA 1P9MA 1A7OH 2R0LH 3BH8B 2GK0B 1UJ3A 1AGEA 2YPLA 3PHOB 4B50A 2LQRA 4R7DB 3WLWD 4Z8FL 3U4BL 3QG6B 1EVTC 2WP3O 4LGSB 4XZUA 3ARFB 3WFCH 5C0GB 5BVPH 5LWYL 1F58L 4PRAB 4Z76A 1PZUB 2HLAA 3G08A 2R0LL 1A7OL 3VFOA 5F9AC 4S1DD 4NC2B 2DI8A 2Q7YA 2VIRB 1P5VA 1F3DH 3WEXB 1VESA 5J9PA 3FN9A 5IJKC 3DGGB 1OAQH 3AREB 4EJ1C 3QB7C 1FVCA 5CP3A 2DQCH 2EE2A 2JB6A 2ZNXA 5T1LB 2J88H 3FTGA 2GUOA 1I3GH 5TE7H 4L4VA 5BVPL 3MBED 4H8WH 4TTGA 3ZKQD 1PEWA 1JP5A 1VKXA 3EFFB 3L3IB 4PJ5A 5D2LA 3JXAA 1VACA 4IS6A 4MNQD 2F15A 3MREB 4KGLA 2BSRB 4FZ8H 4JQVC 5ETUB 2QR0B 1OAQL 1RD6A 2VR5A 2DQCL 5E08H 2J88L 5HDBF 4NJ9L 1I3GL 2NY3D 4OIIH 5TE7L 2DJSA 5I76A 3ARBD 4H8WL 4LNRA 3EFDH 2HVJA 3MYZA 5TGBB 4X7EC 5IVZA 2VUOA 1PEZA 4OGYH 1EEZA 2WBJA 3TH2T 1OAYL 4QKXB 1XZ0A 4AT6B 3QDJA 2A77H 3QUYD 3OKNA 2YD5A 3A0OA 3TFKC 2QLVB 4FZ8L 2GHWB 5E0QA 5I2IB 1IGTA 4HV8A 3C5ZD 4MJIA 5D7KD 3VFSA 2GFBA 4BSWA 5E08L 4KJYA 4OIIL 3EYOB 3KS0H 2JJTC 4JPWH 2ZNWA 3NPSB 4E5XB 4YFLF 2YD1A 4OGYL 3RVXC 4HUVB 1NANH 2A77L 2NY5L 4YHNA 1CFNA 4N1CA 4X6CF 1ZT1A 4W6XB 4X7TA 1LEKA 3HE7A 4YDLC 5IHZB 3VD5A 5CEZE 2WUBH 1JPST 3F7PC 3MC0A 3WIHA 2X9YA 1HQ4B 2V2WB 4JHWH 4QT5A 2F53E 4JPWL 3DVGB 1N3NB 4L8SC 1U3HA 5TE6H 2GTZA 3VD9A 1KF9B 5A16A 1CFQB 4PB9H 1CXEA 4NNXA 3HZKB 1UXWB 3QUXA 4L1HA 5H35A 5ICYA 3OKLB 4YXHH 5E94A 4GRMA 4OLYH 4TSAH 3LSOA 2WUBL 3EYFA 3QIUA 1JHTA 1DCLA 3FO1A 4JHWL 1XGTB 1FCGA 2JCCB 3T1FA 3EDEA 3N1PC 5C0JB 5TE6L 1G7JB 3MX0A 4WGWB 3HC0B 5C0NC 5T5NG 4X8JA 4HWBH 4AIOA 4NC0B 5FCSH 4PB9L 3VFGH 2VXQH 3HUJB 4YXHL 4JM2B 4OLYL 2KH2B 4TSAL 2HT2D 5D7LA 3F5WB 5EB9A 5A40E 3FQWB 4PD4J 5C0BB 4NQCE 1JF1B 3Q48A 1MCOH 1U8LB 1JPGA 5HD8D 3JV6A 1UM5H 4MD0B 4OCYH 4HWBL 5FV1L 4KGJA 5HSFA 4UDUB 1UYWH 4POYA 3GBNH 5F1KC 3VFGL 2VXQL 1E28B 3HE6D 5DJXA 2VLKB 4YEFA 3UBXB 2E8ZA 1P5UA 1I85A 4Y8DC 5HHME 2W9LA 5KS9E 4JJ5B 2HTKC 2R39A 2V5YA 1R5WB 1MNUH 5GXBB 5DJDB 3H9SB 4IOIB 5C0CA 3TP4A 2VZUA 4XCFH 1MCOL 3W9EB 1UM5L 4H1LH 1IAIM 4OCYL 1UYWL 4QOKB 4Z7QF 4OLWH 3EKCA 4QHLA 3IDYB 2XWTA 4U6XB 3RVUC 1WFOA 1E4KA 4GRLC 2W92A 5CEYB 4XAWH 1GZPA 3S96B 4Y5YA 1XH3A 1MNUL 4YJZL 1JGUH 5LGHH 3IXAB 1ZANH 3QUZA 1I1FB 1E6OL 2QSQA 3FHQA 2BNRD 2GIYA 2HFGL 1FFRA 3IJYB 4OLWL 5L2KE 2VLMD 4C55A 1HHHB 5AZEH 4WEBL 3SGDI 4NUJA 4XAWL 1PG7H 3D0VA 1FV1B 5A2FA 3OV6A 1CDIA 5DWUH 3W0WB 1JGUL 5LGHL 4XTRD 4ELKB 5BS0A 4XP6H 5JHDD 4JKMA 1JF5A 5SWQA 1ZANL 1FCCA 1LILA 1DQTA 4LCCB 2VH5H 4MNQE 3HC3H 5TDOB 4MCZB 1KPUB 4Y2OA 3BMWA 3O8XA 4YHIA 4D0CB 2DIBA 2NLJB 5E6ID 1IKFH 2V2XA 4G8IA 5FYKH 4YXLH 3RHWK 1Q9KB 5JOEA 3MOBL 5AZEL 3TZVB 5FUCC 3MRRA 4TN9A 1T1YB 3IAGC 1FNAA 1PG7L 4MA7H 1WTLA 2XZAL 3CX2A 3P9LA 5DWUL 2ICEB 3BVNA 3VXRA 4PJAE 4R7NA 4XP6L 4G43A 3TBWB 5KBNC 3UBXI 4LRIA 3BD3A 3DUSA 3KPOA 2B0SH 5MEOB 3CSPA 4ELME 2FIKB 1Z2KA 3QZWG 4YXLL 1IKFL 3U4EB 1CICA 1K4CA 1IGJA 3C6SB 5D7KE 4MJ5B 1QEWB 3BESR 1YNTA 4U2YA 4LK4A 3KYKH 3CLEH 4KK5D 2VABB 5DK0B 4H25B 4HUUB 4D94A 1CIDA 4L3CB 4K7PH 1E4XH 2B0SL 1VEMA 4C57C 2GY7B 5GS0D 3O2WH 2BVYA 4Q6IB 3L5JA 1QFUL 4OJFH 4AQOA 4KVNH 4UIMA 5IB2B 4U1SB 3KYKL 4NZRH 5C0IB 2Q8AH 3ROOB 1E0OB 1YDPB 1T6VN 4PRHB 1PQZA 4N8PA 5FO8B 4K3DH 5HPMA 3BIKA 4PLKD 5J8OA 1MELA 1BZ7B 32C2A 3O2WL 3UTQB 1B6DA 1EEYA 4PJGF 5EOCJ 5HYJE 4L8DB 4OJFL 3LB6C 5C08E 4PGEA 1DEEA 4HMDA 1JV5B 1T03H 2G2RB 2Q8AL 1KIRB 4NZRL 4XC1H 1LGVA 1G7MA 1X9QA 2DIAA 4K3DL 4DKEL 1WC7A 2Q86A 1JPSH 1GGUA 5EU6B 2FECL 4O51A 2EO1A 4KXZH 3TCXA 2EDNA 2OL3H 4JN1L 2IG2H 4HSQA 1WWAX 5IHUH 4NRZA 2D9CA 3A6CH 4K3HA 1OLZA 1YPZB 1T03L 1NL0H 4Y16D 3MCKA 2EKSB 4X7SH 4XC1L 2W91A 1INDH 1B6UA 2AXFB 4NNYA 3T0AA 1I9JH 2ATPA 3MOQA 3MGOA 3WYRA 2J2ZA 4R4FH 3GSUB 5TF0A 1WAAF 1FFPB 4KI5F 4Z7OE 3D9AH 2OL3L 1XCQB 1I7TB 4I5BB 3PWLB 2IG2L 4YGVA 3BPLB 4LSTL 4BZ1H 5IHUL 4PBVC 4U33A 1IT9H 1LP9E 3A6CL 3OKKB 4MXWH 1NL0L 4M8VA 4QYOA 2NXYC 2AQ3A 4X7SL 1JNHB 2GSIA 3DYPA 2NX5B 2NW3B 3BDYH 1CT8A 3QO0B 3OQ3B 1O7SA 3UTTB 1I9JL 4PB0L 5DFVD 4DZ8B 4R4FL 3BOVA 5HI3C 3MA7A 3D2UB 4QXTA 3IJSB 2NY4B 1ZLVK 3D9AL 1T6WA 1INQA 4MHHG 5HYSA 1AHWC 2YUXA 3O3DA 4FFWC 3RGVA 3CVHH 4BZ1L 1LEIB 2I5YH 4OCWL 3IFLH 1IT9L 4L29B 4ODWA 4JKWA 4MXWL 3CIQA 4UBDC 3WXVH 2BNQA 3VD4A 1NEUA 1U8IB 1MWAB 3U9PH 3BDYL 1BX2B 4P9MH 4HPYH 4PJXA 4Y4KB 4F7TB 1MJUH 3DUHA 3GKZA 2AXHA 2NXZC 4Y5XB 4ODVH 3TVMB 2P8MB 2BNRE 3L5IA 4LDOB 4YR6B 3T4YB 3FQRA 1K6QH 1WVZA 3D85B 5CSZA 4DW2H 1KTLB 4OZFB 2VLME 4TNWK 1W8NA 1CXKA 2Y4SA 4P2QA 4QHUA 4K8RC 2ADIA 3IFLL 1CVRA 1J8HE 1RJZA 2Y6SD 4OZ4A 3WXVL 3FRPG 3R06B 3U9PL 4PJCF 3KDMB 4R4NC 2FL5B 3V5DB 3OXRB 4P9ML 1IM9B 4HPYL 1RU9H 3U7WH 2CLZB 4ODVL 1TNMA 1SEQH 1EAPB 3EJZD 3IKCB 1YECH 2HA1A 5FK9B 1K6QL 2LAAA 4DW2L 1G7IB 1F11B 4XX1E 3MRJA 2BSTA 4KPHH 2I9LA 3SN6N 2PTTB 3FT2B 4V1DD 4TYUA 3VMPA 3FB6A 4JKPH 2CQVA 2DWDA 4NO0D 4WWKC 2I9TB 3QO1B 5EUOE 2VLRD 3HHRB 3DWTA 1RU9L 2YD7A 3VFWA 3U7WL 1DVFD 4DTGH 4C59B 1SEQL 3BI9X 5ILTH 1YECL 4G6AD 4KPHL 4ETQA 1ZHBA 1IC1A 1AD9A 4MA1C 5GGTA 5HDQH 5LQBH 5MENB 4JKPL 3VFPA 1YEIH 4PGBA 1T21B 5J13C 2X1OA 3BIAX 1BD2A 3W11C 3GIVA 4PBWD 4JRYA 4DTGL 5JZ7D 4XNQB 5FDYA 2IQ9H 5KSAA 2PXYD 5ILTL 1QR4A 3FQNB 5C0RH 1SYSA 2X4QA 1BLNA 1CGYA 3Q1SH 5F9WC 4HK0A 3HZVA 4XGZB 1UENA 5HDQL 1EX0A 2AK4A 1UWEL 1YEIL 3RY5A 1JNNH 5DHVA 1DLHB 3EUUA 4GBXC 5JMRA 1JYVA 2IQ9L 5IIEA 3EO0B 5ITFB 5C0RL 3VDBA 1CR9H 5CGYD 4WW1A 4UU9A 4M3JA 1UJ3B 1AGEB 1IVLA 5MI0B 2YPLB 1J0KA 3VFUA 4Q0XL 2GYSA 2RGSA 2J7LA 4Z7WA 1NEZG 2O5XH 2L7UA 5JIIA 1JNNL 4XZUB 2V6HA 3DX8A 1SBSH 5I17A 1FNFA 1DBJH 4TNWF 5JXEA 4Z76B 2HLAB 3G08B 3VFOB 1TJIH 1U93A 2Q7YB 4NRXA 3CU1A 3CH1A 5J9PB 1QFWI 4XMLL 5SX4H 4HJ0D 5SX5K 2O5XL 1CGWA 2EDDA 5I1IH 1FVCB 2PW2A 2JB6B 4DFIA 1UC6A 4F57H 5HHXH 3FTGB 2DYPA 2GUOB 1SBSL 4LNVA 4L4VB 5ANMA 5M94B 3BAEL 3GUTA 2NZ9C 4O02H 4RX4A 5J89A 1P53A 1TJIL 1VKXB 3BD5A 4PJ5B 4XBGA 5D2LB 4I2XE 3F58H 1VACB 4MAYD 4IS6B 4X0KA 5GHWH 5L8JB 1S9XA 3GO1H 1F4YH 5IEHA 3QRFM 2DN7A 3O9WA 5DEZA 5I1IL 2WANA 4F57L 5DDHA 5HHXL 1MFEL 4OM1H 3GSXA 5I76B 4LNRB 2EDFA 1D7FA 2HVJB 3SKJH 1JI2A 4O02L 5IVZB 4D9QD 1EEZB 2P4AB 2WBJB 3ZDYF 1CIUA 3F58L 3H9HA 1XZ0B 2R15A 5GHWL 3QDJB 4LL9A 3GO1L 1F4YL 3OKNB 1FYHB 1CS6A 1MCFA 1IGTB 4HV8B 3MGAA 4MJIB 3VFSB 2GFBB 4BSWB 4KJYB 2NW2A 3CDCA 4XPHL 4OM1L 3IDMA 4XXCC 1VB9A 5CSBA 4PJDE 1PLGH 3RX8A 3SKJL 5KZCD 4EOWH 3OKMA 4TNVK 3CFJB 3MFGB 1X5HA 1OGTA 1F2XK 3R8QA 3U36A 5KJRH 4YHNB 4OF8A 5JLZA 2YRPA 1CFNB 2FEDD 4Z7UA 1ZT1B 4X7TB 1LEKB 3ARDD 3HE7B 2OP4L 1N8ZA 1FJ1A 4U2ZA 3MLSH 3S37X 1Z9LA 4L8BA 2Q6WA 7FABH 1NBVH 4QT5B 2EIEA 4K9EC 2PKDA 1PLGL 5F6IC 2YA2A 5IHLB 4EOWL 3RX7A 4JM4H 2GTZB 4LVNC 4UNUA 5A16B 2YD2A 4NNXB 1ZKAA 4V1DE 5H37H 3QUXB 5H35B 5ICYB 1CFSA 2PTVA 5E94B 5BQ7A 4J7RA 4GRMB 1NC4A 3LSOB 2HT3D 1RIVH 3EYFB 4I77H 4NN6B 3QIUB 1JHTB 2D03L 3FO1B 7FABL 1NBVL 4RMSA 2PETA 1F97A 2DM2A 1OT2A 3MJ9H 3T1FB 4KQ4H 5DHXB 5JO5A 2MKWA 3NPSC 2A6JA 3JV0A 4X8JB 4ZS6C 3ULVC 3W9DA 5D5ME 1JRHI 3OKOB 4KRLB 3RX5A 5E8DH 4L4JA 2VDNL 1REIA 3WDIA 4R0LA 4BQ6A 5IK3A 1I1AA 3FQXA 5D1ZA 3B9AA 5D7LB 1RIVL 4I77L 3ARZA 3GMQA 4AMKH 4Y1AD 3MJ9L 4KQ4L 1I1CA 3OR7A 5IVXF 1JPGB 3A67H 4WCYH 4KK6D 3JV6B 5E99H 3QDGD 3SGEI 5FYKD 5E8DL 1Y6NR 4QHKJ 4PJBF 5DJXB 5DURD 5CBEA 5K9QI 2FDBP 2J8UA 2EEBA 1FZJA 5CJOH 4AMKL 3P4LA 4YO0A 2CO6B 4UOJA 2NQCA 2X70A 5C0CB 3MLVL 2DQFA 4ZOCA 4WCYL 5L8LB 1H3PH 5E99L 3B6SA 1B9ZA 2EXWC 4K8RH 3VXSA 3B83A 4QHLB 2XWTB 4OI9A 4LVOB 5A2JH 4F7PA 2FX9H 1GZPB 2OYPA 4Y5YB 1CI5A 1XH3B 5CJOL 3WSQH 3HB3D 3RGHA 1XGUA 4UDTA 1T83C 1C08A 3LS4H 3QUZB 1H3PL 1I1RA 3LN9A 4HWNA 3OKYA 5AWNH 2R9HC 1AJ7H 4CVWA 4JFHE 4NUJB 2FX9L 3D0VB 5JIKA 1M05A 5GGRA 1YEHH 3WSQL 1YEKH 5KW9H 5BS0B 2WIIA 3LS4L 5SWQB 3K8KA 4NQCA 1QRKA 5IKCA 1XAUA 3ISWA 3O8XB 4YHIB 2DTSA 2V2XB 5AWNL 3Q5TA 3MRRB 4A6YA 5IQ9A 5D6DC 1PKQE 4KZEH 1JZ5A 1YEHL 3P9LB 1NCCH 3BVNB 3GIZH 5DZNA 3VXRB 5KS9A 2WAHA 1YEKL 5KW9L 4ZO8A 4FFYH 3RZCD 4G43B 1KCVH 1GSMA 5DXWA 3KPOB 1GH7A 4BK4A 4YE4H 4ZO6A 4NCC2 1TJHH 2R4RH 1RUMH 5DEGA 5DFWH 1CICB 1K4CB 1IGJB 5CLTA 1LO4H 3WKNA 2CJUL 4HZAA 1YNTB 4BFGA 3QP3A 5HDOA 3GIZL 3L5XH 1CXIA 3I3BA 5F9OL 3LKNA 4FFYL 1KCVL 4ONFH 4X4MA 3TFKD 1RHHA 2Y5TA 2DMKA 3INUL 3UYRH 4LCCC 1CGVA 1TJHL 2R4RL 4P2OC 4F9LC 1QSVA 3FOMA 1GXEA 4GRWB 1LO4L 4LRNL 4G9DA 4UIMB 4W81A 1H5BC 2E6PA 4LIQH 3L5XL 1PQZB 3RVXD 2XT1B 5HPMB 3BIKB 3V4PH 3MBEA 3MV7D 4ONFL 3F12A 5HVHC 2AAVA 3EW3B 3D18A 32C2B 3UYRL 1EEYB 4MNQA 4OCSL 4ZO7A 3BMVA 5D7IA 8FABA 1VGKB 4WI8A 4PGEB 1DEEB 3EJYC 4DKDC 1JTPA 1U42A 2WM0A 4LIQL 1G7MB 2X4SA 1WC7B 1Y6KR 3ARBA 2Q86B 5A2LH 2MCPH 1TIUA 4JPVH 5C92A 3MLUH 4PJAA 3DROA 5F1SA 4B7IA 4O51B 2RB8A 3WV0A 2I60H 3U0TA 3ARPA 1NCUA 1G0YR 4X7DC 3QUYA 5DD0H 5DJ6A 4XNXH 3IFNH 4NRZB 5F7LB 1T2QH 2GSGA 1UQSA 3MCKB 4IJ3C 4JGUA 3C5ZA 2IAMD 4Y1AE 5C0ND 4NNYB 4P46D 4Z18A 2ATPB 2DLIA 3MGOB 3MLUL 1KUMA 1FP5A 3QDGE 2I60L 1A7QH 1C5CH 1PFCA 5FYKU 3B2UC 5F89A 4YGVB 4QNPE 5DD0L 4XNXL 1Z9OA 3IFNL 3DX9A 1T2QL 3GHEH 2VDMH 4HC1A 3CZFA 4QYOB 1LEGA 2GSIB 1EBPA 1JPFA 1CT8B 5ADOH 2ZG3A 2LE9A 4XBPA 1MRDH 3PQYD 1YMMD 5E2TH 3BWUC 3SGJA 3GSQA 2EDLA 3MA7B 1BBJA 4QXTB 1A7QL 1C5CL 1U6AL 3MV9A 1INQB 5HYSB 2Q7NA 4RGMB 3O3DB 4ODWB 2VDQH 4M4RA 1CDYA 3GHEL 2VDML 2BNQB 2BZDA 3T0VA 2D7OA 2HMIC 3SE8H 5ADOL 4K9EH 3TA3D 1PSKH 3OR6A 4PJXB 3DETD 4B5EA 1MRDL 3NCYP 4N90E 5E2TL 1ITBB 3V5HA 1KLUA 1NLDH 3RVUD 3HI1A 5CSZB 4FXGA 4P2QB 3WO4B 4QHUB 4BA8A 2ADIB 1RJZB 2YHGA 1AR2A 3V6OC 4OZ4B 3BDBA 3MCLH 3BPLC 3GMNA 4ODUA 5C09D 5ENWA 4P49A 3SE8L 4K9EL 5F7FA 5F97E 1EZVY 3VMNA 3BKCH 1AXIB 1YN7A 3DV4A 1JF6A 2BVPA 2IC2A 2HLFC 1I8LA 5DD1H 2OI9B 4GG8A 3ULVH 1ULVA 1NLDL 3T04D 3EYSL 4WEMB 3AVEA 1RZFH 3MRJB 1RAMA 2BSTB 3PABA 4Z77A 3IS1X 3NIDF 2I9LB 3NFNA 3HE6A 2A6DA 4O5LL 4P9HC 2DL9A 3FB6B 3MCLL 4YHLH 3GMPA 1XF2A 3G5ZA 3VFWB 4X6CE 3UXFA 5M7QA 2R2CA 2KBGA 4OLXH 4K2UH 4XPGH 5BV7B 4WJ5A 5CGTA 4DK3A 4JG0H 5ADPH 1RZFL 2IFGA 1ETZA 4ETQB 2DQIL 1ZHBB 4UQ2A 1AD9B 1A6VH 3MXWH 3CK0H 4A2LA 3VFPB 3TJEH 4ZNEA 4ZUSA 4PGBB 1BD2B 1CDGA 3GIVB 4CN1A 5CJXA 4YHLL 4JRYB 2VXSH 2COQA 1NCWH 1CDCA 5EN2A 3MRPA 1WCQA 5KSAB 1NJ9A 4K2UL 4XPGL 3T3PF 5SV4A 1QBAA 1SYSB 4JG0L 5ADPL 2X4QB 1BLNB 2W60A 4S1SH 4HK0B 3HZVB 4Z78A 1N5YH 3V79C 4JLRA 4LSVL 1A6VL 3O3AA 1KG0A 1B2WH 2AK4B 4AG4H 3CK0L 4UIKH 4Q9RH 5DHVB 2VXSL 3OF6D 3P4MA 1NCWL 5IIEB 3SDDA 5JHDA 1EFXD 4KKLC 4U6HA 2C7UA 4CN6A 3U46A 4EI5D 1V7NH 2OZ4A 4WW1B 1IGYB 4UU9B 1XGYH 4S1SL 1QOKA 1N5YL 3VFUB 5J3HD 1GHFH 5E6IA 1B2WL 4Z7WB 4AG4L 5JQHC 5I71B 1VGEH 1J0YA 3VMOA 2AJ3A 3KS0J 4Q9RL 5GZNC 3MV8D 4OD1H 3DX8B 5I17B 5EUOA 4IRZH 3QDMD 3QBTB 1MREL 1V7NL 1ZMYA 4EVNA 1U93B 1Q0XH 1ZGLA 4NRXB 1XGYL 3RTQC 3CH1B 3PV7A 5KVGH 5C2BH 2BNUA 2PW2B 3OXSA 4IEFB 1PAMA 5GRXG 2ZUXA 5HGGS 5I1DA 5ISZD 2DKMA 4GAYA 4OD1L 2JF1A 4DUXA 2DYPB 4AEHH 2IBBA 4Z7QE 3JTSA 4IRZL 1G1CA 5ANMB 3GUTB 3HZYA 1QACA 4XBGB 1Q0XL 1J7VR 4X98B 2DI7A 4X0KB 4M6AA 3SE4A 1S9XB 1P9MC 3VRJA 4MGXA 5C2BL 3JZ7A 4WHDA 3O9WB 1UJ3C 5DDHB 4AEHL 1OGAB 2AV7A 2NCMA 3LIZL 3GSXB 5E9DE 1HNGA 4I0PC 1YMME 3O11A 5BOZG 5FUOL 4ZTOH 2IAND 1L0YA 3UBXG 3H9HB 3S3PA 1JIBA 3VGGA 2DKSA 4GOSA 2NXYD 1N26A 4LLMA 4KROB 5LCVH 3HNVH 5FDWA 3PXHA 1JHKL 2E9BA 3P77B 4ORZC 1JZ3A 1FG2A 3Q5YA 5HI3D 3IDMB 5EG6C 2NYYD 4OKVA 3F7VA 4MSWA 1ZT4A 4ZTOL 1J05A 2ERJC 3OKMB 2VQUA 4FFWD 4HLJA 1G7QA 2GJZA 1OGTB 3MFFA 1G7PB 2EEAA 3G5YA 3E0GA 3U36B 3ESUF 3UZQA 4D2NA 4HS6A 4UBDD 4LASH 2WWMC 5JLZB 3B5GA 1WT5C 4Z7UB 3HNVL 4LPCA 1NCDL 1XMWA 3EYVA 5C09E 1N8ZB 1FJ1B 3PG2A 4Y16A 2OR9H 4MMXC 3VFVA 2QL1A 4L8BB 4M6NH 2Q6WB 3WDJA 2CMRH 3JVGA 4LGRB 5B39A 2XTJE 4K8RD 3C9NA 4ZO9A 3R4DA 5JW5A 1RJLA 1Q9OA 4LASL 2WBJC 3RUGF 4R4ND 1IKNA 1CFSB 2A0LD 4RFEA 2CUHA 4WV1A 3GI9H 1JBJA 1R24A 3QSKB 2DWEA 1NC4B 1Q8MA 2YWZA 4KK9C 3CJJA 4QXGH 2Y36H 2CMRL 4RMRA 3K81A 2YZ1A 3NVQA 4L9LA 4FQXA 5JO5B 2A6JB 3CFIC 3W9DB 1LO3H 2CDGA 4XP5H 2GEEA 3IU3B 4QWWD 3U48A 4R0LB 3GI9L 3C8KA 5IK3B 1I1AB 3FQXB 3MUY1 4OFPA 5D1ZB 5EO9A 4ZUUA 2ARWA 4QXGL 3GMQB 2V2TA 2Y36L 4PJGE 2P44B 5DQ9A 3OR7B 3WHE0 4QRRD 4PJDA 3O0RH 5HBBA 1U3HC 4XP5L 1T89A 1GGIH 1WFNA 3W11D 3U79A 1FAKT 5DO2D 5CBEB 3LQAC 2I26N 3FFCD 1X4YA 2J8UB 2OSLA 2NY2D 1FZJB 4GT7A 4YO0B 2MOVA 2X70B 4NN6C 2DQFB 3MJ7A 3QIUC 4FOMA 3O0RL 5DJAA 4BSVA 2XG4A 3B6SB 5LXGH 3LZFH 3VXSB 1GGIL 3EBAA 4TTDD 4N9OB 3LPGA 4V1DA 4PJHE 4F7PB 4NO0A 5DZOA 3SDXF 2VLRA 1QFWM 4HUKB 1XGUB 4UDTB 3QDME 3SKMA 1C08B 2ED7A 5K9OA 4PJ9D 5CJ5A 3LOWA 1KGCD 4ONGH 4M1DH 5DUPL 1RZKL 3FHAA 4YBLB 4HW6A 5LXGL 4G80A 2CUMA 3LZFL 2OQJA 1V3JA 5IESL 5D5MA 4P9HH 4YEEA 3T65A 5AG9A 3TJHC 1OP3H 5ISZE 5K9JH 3EHBD 1M05B 1I85C 5GGRB 4K7PY 1MWAH 3AY4C 4LLWA 3K1DA 2WIIB 4KKAD 4HT1H 2N4IA 2PXYA 4GG6E 4NQCB 4ONGL 5IKCB 4M1DL 1QYGH 1J0HA 3NGBB 4U1KA 5EC1A 5GRWA 5DMIH 4P9HL 4OZFH 4YPGA 3ZDZF 4A6YB 3GSVA 5K9JL 5J6GA 5D7JD 5IQ9B 4OUUA 4XHJC 2XXCB 4LVOC 2ZUWA 5HHMB 5KS9B 1MWAL 3SQBA 2X4OA 2IANE 2YA1A 4HT1L 4Y5YC 4FG6D 4PJCE 3K4DA 1EHXA 2Y5EA 5J1SC 5EWIH 1AE6L 5DEGB 5DMIL 5F1OB 5CD5C 1U3YA 2Y07L 1RZIA 1QD0A 2ZCKL 5EULV 1EUUA 4HIEA 3NIFF 3LKNB 3LEYH 4NWUH 4M6OH 3MRIA 1QFWH 3HPJB 3LHPH 5FGCB 3ARTA 1ODAA 1HEZA 3IAPA 1RHHB 3TV3H 2Y5TB 2EYTA 1N0XL 5EWIL 1PKOA 3VFNA 3FOMB 4IRJA 4PY7A 3KLHD 3P4NA 4CDHA 1OSZA 1OSPL 1X4XA 1NFDF 1CFVH 1H8NA 4G9DB 3O8XC 1MCDA 4LLVA 3DHJA 2AP2A 3LEYL 4NWUL 3UZVB 3MBEB 4M6OL 1QFWL 3LHPL 3F12B 5FHAH 1FFQA 2E8YA 3D18B 3I02A 2IADB 5T3ZH 4MAYA 4LRIC 3E6FB 4MNQB 2HN7A 4Y89A 2D7TH 3QPXL 4X6DE 5D7IB 8FABB 4JKLA 3S7GA 4UUJA 3U1SH 1HI6A 3HAEA 4F8QA 3DNKA 2F5AH 1CICC 3RKDC 4CADA 5FYLD 5GRZA 2NY3B 1WTGT 4FQ1L 4OUOA 1BBDH 2X4SB 1PKQA 3ARBB 5D72L 1T7ZA 3QQNA 3IDUA 4NT6A 5FHAL 1DLFH 1JGDA 3WNPA 4PJAB 3DROB 4POZD 2IPUG 3LKSA 1IC5H 4HMEA 4ZD3H 1S7SA 3ALXA 5T3ZL 2BRQA 1KC5H 1AQDA 2X42A 3QUYB 5E8OA 3ZMRA 2D7TL 5DJ6B 5ID0A 4JHAH 4OSUL 1CE1H 3EYQD 3C6LB 3KHOA 3QWRD 3U1SL 2GSGB 4OCXH 1MFBH 1NCNA 1T4KA 1UQSB 2F5AL 1SQ2N 5F93C 3C5ZB 2XN9D 3E8UH 3D0LB 3VXUD 2Z92A 1MLCA 4M7ZC 2FX8L 3QULA 4H26A 4QRRE 4PJ7F 1WICA 4ZS6D 4CL7A 1DLFL 5DVMA 3ULVD 4PYGA 1A7NH 5I1LB 3AB0C 3T2OA 1IC5L 5IM7A 5CJBA 3V7MA 2VSDA 3ARYA 2X1XR 1KC5L 4IBLT 4OF5A 5F89B 1HKLL 4ZPTB 3VE0A 4JHAL 1NGQH 3DX9B 5IUSA 3QNXA 1MY5A 3FFCE 3ARDA 1MFBL 3CZFB 3EZJB 1LEGB 1JMZA 3E8UL 5E2VL 1JPFB 2VDLH 4IDLA 5CP3H 3TBVA 4XBPB 1A7NL 4LVHB 1DBKH 1VADA 1BBJB 3PWPD 3MV9B 1IILE 1S7VA 2G9HA 1NGQL 1PBYA 1WEJH 1C7TA 3MOAH 1HE7A 4IIQA 3O3BB 2X1PA 3K80A 2VDLL 1QQDA 2W59A 3OR6B 1JRHH 2NY0D 4KVCH 2J8OA 4JANA 1CCZA 3V5HB 3PUCA 1DBKL 2EXWD 3ZT6A 4UT9H 3LPFA 1KLUB 3HI1B 1TCRA 4ODXA 4FXGB 4XNMA 5CIPA 3G04A 1FAIH 1WEJL 2ORBH 3ZDYE 3GMNB 4ODUB 5GZOD 5ENWB 5I1CH 1W0WA 4PJFF 3SGEH 4PY8J 1JRHL 3MXVH 3DV4B 4Y8AA 2BVPB 4KVCL 4KJWC 1FC2D 3V6FB 3GI8H 4GG8B 4UT9L 4WUUD 2H2SD 1FH5H 3QDGA 3PABB 4TSBH 4Z77B 1QBMH 1QP1A 5ERWA 4XMPH 3RWFA 3NFNB 1FAIL 4U1NA 3HE6B 2A6DB 4RGMC 2ORBL 1VEOA 4WFGD 3RGVC 1W0YT 4PJEF 3BZEA 2BY1A 2A38A 5DJ2A 5I1CL 2FGWH 1NGYA 3FZUC 3GMPB 1XF2B 2AQ1A 3G5ZB 4KTYA 5JQ6H 3MXVL 3RWIB 1OAXH 2K9UA 3GI8L 1ZVSA 2AQ2A 3OB8A 4WJ5B 1NUDA 1ZHLA 3IFOA 5D2NC 4TSBL 1ETZB 1QBML 1T66C 4XMPL 1U58A 4UQ2B 1NGWB 1S7WA 4TQEH 5DJ8A 3OAZK 5HHNA 1S7QA 4ZUSB 5TQ0H 3LQAH 3DVNA 4X9GA 1A9BA 2FGWL 3DXAA 2DJ4A 4GS7B 4R8WH 2X9XA 2VWEE 5HPOA 5JQ6L 5I19H 5C07D 5EN2B 1OAXL 3WIHL 3KNBA 3MRPB 1NJ9B 2VO5A 4UTBH 2W60B 4OD3H 5E4IA 4HCRA 4Z78B 2ZUYA 4PJIF 4JLRB 1UZ8A 1D6EA 3O3AB 4TQEL 4U3CA 1KG0B 4JRXE 2Y23A 5TQ0L 3LQAL 4NBZB 4BFBD 1FDLH 5K9QG 1RZ8A 4JDZA 4R8WL 2WZPD 1LE9B 3P4MB 5I19L 5DC9B 3GMMA 3SDDB 5JHDB 2P43B 2ZPKL 4U05A 4U6HB 2C7UB 4UTBL 3U46B 4P2OD 1KJ2A 4OD3L 5BV7C 1H8OA 1WSST 5DMYA 4KFZC 1QSED 4NQVA 4OZHF 3BKYL 4OTXH 3QXUA 4GW1A 1FDLL 2AJ3B 1V7MH 4HIJA 5EIIA 4KY1H 4C83A 1MCJA 1QLFA 5EUOB 4KHXH 3D69A 3WNOA 4PJBE 3RZCA 2R69H 3G6JE 3WFBH 5I8CB 4EVNB 1ZAGA 1ZGLB 5KSAC 1QSZA 4ZG1A 3EJYD 5SV3A 1LE5A 3L3KA 4NKIH 4FNLH 4OZGE 4OTXL 1IAKA 2XN9E 4ZUTA 2BNUB 3QXWA 3OXSB 1V7ML 1MQKH 5I1DB 3AXLA 4GAYB 4AEEA 2WLYA 4HDIA 3JTSB 4KHXL 2MSPA 2R69L 1NMAH 3HZYB 4XCYA 1C16A 4MLSA 4MNGA 3TEUA 5FYJH 4CUCA 1YEEH 3D3VE 3LQZA 4XCCH 3VRJB 4NKIL 4JKKA 1B90A 1KCKA 5HI5C 5JORA 1MQKL 2X1QA 2AV7B 3HMWH 1VFBA 3JV4A 3DO7A 3O11B 3IF1A 3S36X 1NMAL 2VB5A 3PWPE 3V5KA 3MV7A 1BECA 3B2UD 4X7CC 3GJEA 5FYJL 3CVHA 4WO4D 1DN2A 4XCCL 4FQJL 4LLMB 1A22B 1MRFH 5T1KA 5FDWB 1J9CT 3T3MF 2YK1H 3NZ8A 5EO0A 3RJDA 1FG2B 4G3YH 4OKVB 1R5IA 3F7VB 4ODHH 4MSWB 1ZT4B 3S5LG 1J05B 4I9WD 3CFDA 1G7QB 2GJZB 3MFFB 5J11C 3G5YB 4HJGA 2CPCA 5DZLA 4HS6B 1F4WH 1FO0A 4PRID 2J6EA 1MRFL 3MV01 1RVFH 3D5OF 3EYVB 5JW4R 1X4ZA 4YDIH 3ZT5A 2YK1L 4Y16B 5BZDA 1IAMA 3BN9D 3VFVB 5TPWH 2IAMA 3O9WC 4G3YL 4ZOEA 1WLHA 4ODHL 1DQMH 5GIRB 2FZ3A 4P46A 5B39B 4WWID 4WUUE 3QT2A 5A3IC 4MB4A 2HJFA 3C9NB 5CJ8A 5JW5B 3N50A 4JFDE 1RJLB 1Q9OB 1F4WL 4WTXA 4PG9A 4ZNCD 4OB5L 3MPCA 1RVFL 4RFEB 4ZXBD 4WV1B 2LTQB 1R24B 1FC1A 4YDIL 2DWEB 4KROC 5IV2A 5TPWL 1RMFH 2DM4A 4KKBC 1S7UA 1DQML 2D2OA 2GTWA 3PQYA 4L9LB 5T33H 3CX5K 1CD8A 4FQXB 5BRZE 2VXUL 5JA9A 1CXFA 1S7TA 5IG7A 4MCYA 3S98A 1SJEA 2CDGB 4X99A 3VXQA 2VDKH 1GGBH 3C8KB 5D4QA 3TH4T 4N0RA 5CKGA 5EO9B 2QSVA 4JCMA 1D9KD 2GK2A 1SJXA 3K8MA 1YEDA 4ZUUB 4Y4HC 1J87A 1RMFL 1U92A 3HG1D 5C07E 2V2TB 3CAFA 3MRGA 4U7KA 3UDWA 3TA3A 1I3UA 4E9LA 5DQ9B 1R3JA 3NCJH 4G7VH 5T33L 3QNZB 4HMCA 2E7HA 4PJDB 1J1XL 4O9HH 4M1GH 5ICZA 4PUBH 5JR1H 4GRLA 3CSBA 3DHMA 4JZOA 2VDKL 1GGBL 2OK0L 4CMMA 4YHZL 2OSLB 3CFCL 4QXWA 4JO3H 2WMPA 1QNZH 3NCJL 2X09A 3MJ7B 4LLUA 4DVBA 3UTOA 5DJAB 4BSVB 4JFEA 4O9HL 4N0UE 4M1GL 4PUBL 3Q2CA 5JR1L 1U9KA 3MJ8A 2BCKA 5GRJH 1RFDH 4XNZC 5B4MC 5JW4N 1A7RL 2ITDA 2HH0H 4V1DB 3ULSA 4NO0B 2VLRB 2WW8A 4JO3L 4DN4H 4KKLD 1I1AC 1WZLA 5D1ZC 5IWLA 1QNZL 1YNLH 2GI7A 5EBMA 3SKMB 1HYSD 1MVUA 4U1JA 4KV5E 4M6MH 5K9OB 4KKNA 1KLFA 1JWMB 2OTPA 1ZEAH 4G80B 5GRJL 1RFDL 3BKJH 2HFFA 4MXVE 4RMTA 1MCLA 5D5MB 2HH0L 5C0AD 3T65B 4MJ6A 5T1DH 4E42A 1T5XB 4DN4L 1FSKC 2FEEL 4NQDE 3WJLA 4PTUA 1YNLL 3OG6B 4LLWB 2DLEA 1U8NA 3ZTJH 2ZSVA 2JCCF 4M6ML 3HNSH 2PXYB 2YPKA 1VFAA 3DOSA 4DAGL 3BYYA 3I2CH 4U1KB 3BKJL 4KKCC 5EC1B 2EO9A 5C2UB 4YPGB 5FKPA 1CVSC 3HPLA 2VERN 5T1DL 4JM2F 2IMNA 3GSVB 5J6GB 4QF1A 4UT7H 4OUUB 1MJ8L 1A7BA 1HSAA 4QRQA 2X4OB 3OF6A 3R0MA 2A83A 3DSNA 3HNSL 3RDTD 1EFXA 3T0WA 4EI5A 2A9NH 3I2CL 4GH7B 3K74B 4LPTA 5HDLA 2C4XA 4TULH 3MRFA 4YBLC 5D9SA 6CGTA 1JYWA 2VN4A 4J8RA 4L3ED 5L8KB 1RZIB 5GISH 1S7XA 2GW5A 3PL6D 3MLYL 4UT7L 3M45A 4HIEB 1UB5A 1RJYA 3MV8A 5MEQA 4PJHA 2PYFA 3S36L 3IS0X 2BY0A 5HYSG 3MRIB 5DF0A 1FNHA 1HEZB 3BJ91 3DBXA 4ZAKC 2A9NL 3L95A 5BV7H 1VFMA 2EDTA 3QPQD 4LOUD 4PRIE 4R4BA 2EYTB 3MBXH 3VFNB 3S37H 2V5SA 4TULL 4IRJB 4GUPA 4PY7B 3B8SA 3NGBC 3P4NB 4JDTH 2OTWA 5GISL 4Q97A 4YHMH 5GGTH 3QEUA 2CGRH 1YEJH 4LLVB 1IEHA 1FZOA 4JFFD 5JXAH 5E4EB 4BKLA 2CLVA 25C8H 4C56E 1K5NA 2XI9A 1Q38A 3PDGA 3I02B 5BV7L 4MXQD 5I74B 4GG6A 5GRUH 2KL6A 4MAYB 3SGKC 3MBXL 1EAJA 1GIGL 4ACPA 1UADC 2HN7B 4LP5A 4WU7A 3SKOA 4JDTL 4R3SB 2VMFA 4UUJB 3U30B 1HI6B 3HAEB 4YHML 1QPPA 5GGTL 3T3PE 3S8WA 2CGRL 4CADB 1YEJL 5FXCH 3NCYS 1BQHA 3MJ9A 3WLWC 4YWGH 5JXAL 1H9VA 4DZBA 1PKQB 3JV5A 3KJ4B 25C8L 4TUKH 3ZKSD 4NT6B 3OWEA 4RRPA 3NAAH 1WBZA 2IANA 4OT1H 1EXUA 3LKSB 5EORH 3SOBH 5JIPA 1S7SB 2BY2A 4Y5VC 3CFEA 3WIIH 5GRUL 1GL4B 1AQDB 1HNFA 5E8OB 3PGDA 4X4YA 5IVOA 5ID0B 1PZ5A 2YRLA 3W39A 1GYAA 5BQ7B 5I1HH 2VR4A 2XQYK 3N06B 1R5VA 1T4KB 2D3VA 1IM3A 3ARWA 4C54A 3VD3A 3T2QA 4YWGL 2Z92B 1MLCB 1F45A 3E3QC 4MWFA 4TUKL 3QULB 4H26B 1XFPA 1QRND 1Y0LA 1IGIH 1VSCA 2NZIA 4OT1L 5T3XH 2RFXA 5EORL 1T7XA 1P6FA 2XZQH 5IM7B 3SOBL 2XY1A 1AC6A 3WIIL 5KAQF 3ZL4L 4S0TD 4PTTA 3PE9A 1FNSH 3O2VH 3VE0B 1B4JH 1QSFE 1BQUA 3QNXB 1CE6A 4XXDA 5I1HL 1NANI 3MO1A 2KKQA 2R0KH 2G60L 2Z31D 1AKJD 5E2UH 1OP3K 3TBVB 1IQWH 3VRIA 1KJVA 4X4ZA 4RGND 1IGIL 2NY3C 5T3XL 1VADB 2N7AA 5E1AA 3ARBC 3GBMH 2XZQL 4DOHE 1A5FH 1T7VA 1BAFH 4YHYB 3O2VL 1FNSL 1S7VB 5IB5A 2G9HB 1B4JL 3BPOB 1VDGA 2ARJA 3QUYC 1U8KA 4X6DA 2JB5H 4IIQB 3NZHH 3P30H 2R0KL 1QQDB 5E2UL 1IQWL 4KUCF 3Q6GH 1X5IA 3C5ZC 5INCA 1E4WH 1V3LA 4OBRA 4JANB 4F7CA 1A2YA 3GBML 2Y7QA 1A5FL 1TCRB 1RJCA 4ODXB 1ES0A 1BAFL 2F19H 3QCVH 4XNMB 4RNRA 3G04B 3NH7H 4NZUH 1CN4A 1FG9C 3CX5J 2JB5L 3W2DH 4EQ2A 3P30L 1BWMA 5DD5H 15C8H 4HGMA 5KVEL 3SO5A 5F7NC 1GGTA 3C8HA 1E4WL 2VL5A 1HH6A 4QRRA 3IDXH 5LKNA 3WJJA 3QDGB 2F19L 3TJHD 3QCVL 4LVHC 3GSOA 5ERWB 3RWFB 1Q9WA 4OZIE 1G84A 5EBWA 4U1NB 4LHUG 4NZUL 1R0AH 1PY4A 4H5SA 1CLCA 3W2DL 5DURB 1YPZF 3MACH 3BZEB 3MRHA 5DJ2B 2A74A 3FFCA 1H8SA 4X83A 1NGYB 2ZUSA 1KTDA 2P46B 2FHFA 1WFUA 1MFNA 5I1EH 2PYED 3F7QA 1MLBA 1ZVSB 3QI9C 1MPAH 3VCLA 2H1PH 3HN3A 1ZHLB 3IFOB 4M7LT 4UT6H 5JDJA 4LDEB 4CN4A 1DBBH 1R0AL 4HFWA 1S7WB 2EIZA 5DJ8B 5HHNB 1F4AA 1S7QB 4Y4FC 2CSPA 3DVNB 1A9BB 4GBXA 3MACL 4BQ9A 4NC1E 3DXAB 3ZE1F 1KEGH 2HT2C 4JZNB 5I1EL 3KNBB 4OFYD 3BHBA 2ESVD 1CBVH 1YYLH 4PJ9A 4PP1C 3SQOH 2H1PL 2YMXH 1H3WM 3T8XA 2PCPA 1H3GA 1I8LC 4UT6L 4DVRH 1DBBL 1UZ8B 1D6EB 1MQ8A 2OJEA 3TYFA 2DLTA 4JY5H 2QHRH 4RAHA 3GFUA 3P9WB 1K3IA 4PLJD 1RZ8B 4JDZB 1KEGL 4HS8H 1Q9LB 3GMMB 4K3EH 4L8CA 1YYLL 5CGMA 2YMXL 4G6JH 1KJ2B 1NBZA 4AM0A 1BFVH 5B3JE 4NQVB 4LARH 1IFHH 5HY9A 4GW1B 3EYUH 4JY5L 2QHRL 2JIXD 4HIJB 5EIIB 3CXDH 5D7JA 3DUUA 2D0HA 1MCQA 4C83B 1QLFB 4HS8L 3D69B 3MZGB 3VA6A 4K3EL 1NBYA 3RZCB 1A1NA 3KPRD 5CJXC 1IGCH 4GS7C 2QJDA 3RWGB 5CEZH 2ILLA 3X12A 4G6JL 2D4DA 4P5TC 4P2YA 3GEWB 1LE5B 1BFVL 3L3KB 4U1GB 3RKDD 4LARL 1IFHL 3N85H 1IAKB 4ZUTB 3ZKMC 3CXDL 4NN7B 4ZOBA 3AXLB 1OTTC 3ESVF 4G5ZH 8CGTA 4G42A 4HDIB 3O41A 1QRNE 4NNPH 1IGCL 1CGTA 1C16B 3HC4H 4XCYB 5CEZL 4MNGB 1MI5D 4BFIA 4I8DA 3LQZB 4JN2A 4RGOH 1RK1A 1WZKA 5C6WH 3N85L 3I85A 1E4XI 5JORB 1S9YA 5E6IC 5D7SH 2KZWA 4G5ZL 5DSCA 5K93A 3QIBD 1VFBB 3JV4B 4RGNE 4NNPL 4O2FA 3DO7B 3IF1B 5F7DA 3V5KB 3HC4L 3MV7B 2SEBA 1EBAA 4RA3A 3GJEB 5C0EA 3CVHB 3EDDA 4RGOL 2V17H 4YDLB 1D5MA 2F54D 2KPNA 5T1KB 4JDVA 2BK8A 2C1OA 1T1XA 5HVFB 1DSFH 3NZ8B 5EO0B 5D7SL 4FQQA 1HSBA 3N1GC 2EH8H 1R5IB 3T4AA 2E7BA 1KPVA 4KDWA 4S0SD 3CFDB 4M7JH 4KK5C 3ZDZE 4LVEA 3G6JA 4JG1H 4HJGB 1MCEA 3NACH 1N0LA 2V17L 1FO0B 4LEOA 1R3IH 2PTUA 1MCNA 5GS0C 4H0GA 3SE4C 1XGPA 1DSFL 3QWRA 5BZDB 4OZGA 1YEFH 2IAMB 4NHUA 3VXUA 1SVCP 3OHXA 3CMOL 2FZ3B 4P46B 4NM8H 1P7QD 3RI5K 4M7JL 4JG1L 5TDPA 2HJFB 3NACL 1PG7W 2F5BH 1NQBA 3NIFE 5FFLA 4PG9B 4PLKC 1BVKA 5MHSD 1R3IL 1DQDH 4R96A 5I1JH 1NDGA 3N1FC 4KZDH 4PS4H 2XA3A 3VFTA 1DP0A 3TPKA 1C12A 5C0FA 5IV2B 1YEFL 2HKHH 3QA3A 1U91A 4DKFH 3LQMA 5DI8A 1S7UB 4B53A 3MRMA 3L3GA 2NMSA 4D3CH 1F5WA 2GTWB 1NMBH 3PQYB 1NFDE 4ZUVA 2APBA 1OM3H 5FGBC 2J5LC 3PWPA 2WK2A 1S7TB 2F5BL 5IG7B 5MP6H 4MCYB 5D2LF 3QJHA 3NA4A 4MZ3A 1HIMH 1SJEB 1OD7A 4G7YH 4HF5H 4X99B 3VXQB 3ZHDA 3S35H 1F00I 1T1ZA 5JPNA 3FZUD 4PS4L 3ALPA 5GSVA 4WFFD 5E5MA 1YEDB 4DKFL 1X5YA 4S10A 2DS4A 3MRGB 4NBYB 3TA3B 2ESVE 4Y16C 1UKSA 4D3CL 1CFTA 2YR3A 5FYJU 1NMBL 1R3JB 2EXYD 2EYRA 1O7VA 1OM3L 1B88A 3D39E 2L4OA 3P0GB 5MP6L 5GRVL 4NN5B 1HIML 2P45B 4N1HB 5ICZB 4LPXA 4G7YL 4GRLB 4HF5L 2IJ0C 4JZOB 3DMMC 3RQ3A 2P5ED 4IM8A 3V6ZA 3S35L 4CMMB 3CFBA 1IKNC 5DMKA 1OVZA 2BOCA 4HD9A 4W6WB 4LLUB 4DVBB 1ITCA 4LCWE 4JFEB 4WUUA 4L9LC 1K85A 2E9IA 1DFBH 3MJ8B 2BCKB 3FT3A 2ITDB 3ULSB 3IETA 3V7AE 1XT5A 4E41D 3KPRE 5EBMB 1AP2A 1TMCB 1OHQA 1MVUB 4U1JB 1HH9A 1GOHA 2FBJL 4JPIA 1AO7E 4F80A 1DFBL 3RIFF 4BJLA 2HFFB 5D6DA 4MJ6B 3VXMD 4E42B 1T89C 2VKXA 4HK3J 3S9DB 1FFOA 1URLA 3RI5F 2HT4C 4PTUB 3HA0A 1U8NB 3K2UH 2ZSVB 4WHCA 2YPKB 2D31A 2K1MA 1VFAB 2ATKA 4OQTH 1OAUH 1G0XA 3EJZC 3JSSA 5FKPB 3HPLB 4GAGL 4A2MA 4LCIH 1TTUA 3GK8H 2X89D 3SE3C 4QHMA 4LLAA 3HLAA 5FB8A 4HPOH 1W0VB 4GXVH 4QF1B 4L5FL 3SO3B 3TT1H 3KLAA 4XWOC 1HSAB 4U3XA 3FKUS 4QRQB 3K2UL 2A83B 1EFXB 3WIFA 5J57B 1YY8A 3G6AA 4P3DA 1CTOA 4EI5B 1DVFC 4P2OA 4F9LA 4JO4H 1NUNB 3ZZ1A 4PJFE 1UCBL 1OAUL 2F54E 5HI5D 2VQ1A 3FFDA 4KRPD 2RAMA 1NCBH 4U1MA 3MRFB 5D9SB 3ARFD 3MUJA 1QSEA 3GK8L 1H5BA 3EO9L 4J8RB 5F6HI 3ZKND 1S7XB 1UB5B 3TT1L 1RJYB 3MV8B 5MEQB 4PJHB 5HHOE 2PYFB 1FIEA 4AIZA 3QFJD 5DVLA 3DSFH 3EO1A 1DBMH 4PLOB 4OF0A 1CFBA 1CQYA 3DBXB 5JZ7C 4JO4L 4PJEE 3L95B 4PGJA 4R4BB 2PXYC 1HOCA 5M95B 4GUPB 2FATH 3O3EA 2OTWB 3LKOB 4PYHA 4BFEA 3BRFA 2Z0BA 4IRSC 3QEUB 2NNAA 5CMAA 1FZOB 4YPJA 4WUKH 3RNQA 4BKLB 2XQBH 3BGFC 3DSFL 2CLVB 2UVEA 1EHLH 4XCNA 1DBML 1K5NB 1KN2H 1O5DT 2EKJA 3GB7A 5MHSE 1EZVX 3B9VA 2DLHA 2DQJH 2PF6A 4J3XA 3SKOB 4WU7B 1YY9D 2FATL 4K7FA 3G5VA 1K2DA 5CGYC 2AEPH 3VD7A 1IC7H 4ZDHA 4EI6A 3D87B 1BQHB 4X5XB 3IRPX 4WHYG 2QKIA 2XQBL 4DZBB 1MUJA 4APQD 5MEPA 1EHLL 5KSUA 5DD3H 1KN2L 2HJLA 1WBZB 2IANB 4XNYL 1EXUB 4N0CD 3CFEB 3VFMA 2DQJL 3PGDB 4X4YB 2NXYB 1Q72H 3WUZA 1PZ5B 2AEPL 4WFFE 3W39B 1IC7L 4Y19E 1R5VB 4LLQB 1IM3B 4OFIA 3B9DA 4HJ0C 1VENA 4LCYA 4WY7H 4MWFB 4KRNA 2X6MA 4UV7L 4ZSOA 5DD3L 1Y0LB 4OZHE 1F4HA 5E4EC 2RFXB 2BMKA 4X80H 2Z91A 1T7YA 3GSRA 5CZKA 5ACZA 2P5EE 4PTTB 4JO1L 4PRIA 5I74C 1CE6B 4MAYC 4XXDB 2NTFA 3MO1B 4HXBH 3WXWL 3MMEA 2R8SH 4WY7L 3KJ6L 1R3KA 1KJVB 1EHAA 5E8EA 4K55A 3ECBA 4QRPA 2B8OT 5E1AB 4X80L 2WIMA 1ZXQA 4PGCA 3MRBA 3V6OA 1SYVB 5IB5B 3WS3A 3BSZH 5GS0H 3QZWA 1OPGH 4GRWF 4ZXBA 3R8BB 1TZGL 1U8KB 4HXBL 4LQFH 3IYLW 4X6DB 4E41E 4OGXH 5DUMH 2HAZA 1HWGB 1K9TA 4Q9QH 5INCB 4UB0H 4F7CB 5DK3A 1A2YB 2K7PA 2VN7A 1XF3A 3FL7A 4JM2D 1EUTA 1BHGA 1ES0B 1JNJA 3OKDA 2AJYH 2M8XA 4RNRB 5HI4C 4P3CH 5SWSE 3VXME 5GS0L 1DUYA 3K46A 5CZXD 1YQ2A 4LQFL 4RMVA 2LAGB 5C0BD 4OGXL 2FEDC 5DUML 1D9KA 2UWEF 3B9KC 4M1CC 3ARDC 1F2QA 3HG1A 4ZYKB 1Y18A 1HH6B 2VL5B 2Z9TA 2F8VA 3MTRA 2NTSP 4Q2ZA 4QRRB 3TT3H 3ZYZA 1I7ZB 2AJYL 3GSOB 3C2SA 1Q9WB 3AS2A 4U6VH 5EBWB 5J13B 4J3VA 1B3JA 1DANT 4FQ2H 4H5SB 3H9SD 4URTB 3MRHB 2A74B 3FFCB 3VU2A 2NY2B 1KTDB 5DA0B 4ZFGL 5L7XH 1AFVH 3GSNA 3K4AA 2FSEA 2HT3C 5L6YH 4ENED 4QOKD 2F53D 2J8HA 1MLBB 5F9WB 3TT3L 5ITBH 4KKCD 4P23C 3VCLB 1XCTA 5I9QC 2MMXA 2WBWB 4U6VL 1F02I 5BW7A 5CJQH 1QLRA 1RUAH 4HFWB 2EIZB 1EA9C 4U6YA 2DLFH 4HUNB 1FNLA 4CU6A 4N0FA 5CINL 4GBXB 5I6XB 3QFJE 1CF8H 1AFVL 4RWYL 3QDAA 4MJ4A 3IDNA 5L6YL 1KCSH 1YYML 3BHBB 5ITBL 3H7BA 4PJ9B 3TBSA 2XV6B 3MLRH 3T8XB 2PCPB 5CJQL 4KK6C 4WTZA 2OJEB 2VXVH 3QWQB 3TYFB 5F9JA 5H94A 2DLFL 5C0AA 1WIOA 3U0WH 3ROLA 2FJFA 1UG9A 4KRMB 1CF8L 3IRZA 5TF1H 1CK0H 2V5MA 2ZUQB 3HZMA 1ONQA 4OLUH 5GGQH 4ZAKD 4LPVA 4PJXF 1KCSL 2E5EA 4P48A 4L8CB 4QTHA 4AIXA 5IROA 2AJVH 3MLRL 1NBZB 2HRPH 1WQVT 4AM0B 1HZHL 5F72S 2VXVL 1UVQA 4N1EA 4ESKA 3FB5A 4MQSB 4OZIA 4WI7A 3U0WL 3VRLF 4P4KC 3HKFA 5D7JB 2C9AA 1WBYA 3DUUB 5TF1L 1CK0L 4EQ3A 1JUFA 4EXPX 5GGQL 4OLUL 4J12A 3NFSH 2X7LA 1NBYB 2EDOA 1A1NB 1YJDC 1ACYH 2NPLX 3X12B 3RDTA 3CC5A 3HB3C 2AJVL 3PXJA 4XBEH 1ED3A 2VLJA 2HRPL 3MR9A 2C3WA 2CRYA 4CAGA 4TSCH 3OTTA 4M00A 4GKNA 4LSPH 1CL7I 1HHGB 4L3EA 4I0PA 3PL6A 4F15B 3FRPA 1C5BL 4RBPH 3CGTA 1CZ8L 4G42B 3O41B 4M8QA 4RFNB 3HI5L 2AEIT 1AQKH 1ACYL 1EO7A 4GAJH 5AYUH 4XBEL 5DJYA 1UWXH 3KPQA 4JVPA 2CK0H 4BFIB 4JN2B 3OAUH 4TSCL 3RBSA 1ZVYA 2LV4A 4LSPL 5DMJB 1BFTA 5L2KD 3LD8B 1S9YB 5SWZB 5AUMA 1J12A 5DSCB 1PG7X 3WFCL 4AJ0A 3OKEA 4JFFA 4O2FB 1AQKL 4KHTH 5F7DB 4R26H 1JZ6A 2SEBB 1K8IA 4GAJL 5AYUL 3EOYG 5L88H 3ZYOA 1WT5A 3T0ED 5C0EB 3RZCC 2BFVH 2LVCA 3BP7A 2CK0L 1RQ5A 2VJXA 3OAUL 1D5MB 4KQ3H 2O5YH 4U3HA 5CLWA 2JCCE 4JDVB 2C1OB 1T1XB 3MNWA 4U1GC 5F6IB 1D3CA 4FQQB 3LV3A 5FA4A 1HSBB 3UO1H 3T4AB 4NN7C 2WWKT 2EEDA 4KHTL 4LVNB 4R26L 3HUJE 1KPVB 1E27A 2VSCA 5KSBF 4UI2A 1ZTXH 3I6GA 3G6JB 4Z7NF 1LMKA 2BFVL 1EJOH 3O6LH 2H41A 2YWYA 5E70A 2FB4H 4LEOB 2O5YL 1DDHA 4LDLB 2NY6D 5C0BE 2EC8A 4Z7WF 1XGPB 1A6TA 2IPTH 2LU7A 3RWHB 3WKMH 4OZGB 4ZFOA 4NHUB 3VXUB 5CS7A 3UO1L 5EPMA 3UPAA 1HN1A 1NSNH 3Q0HA 3EFDL 3OHXB 4F7EA 4WRLA 1QRNA 2VLKE 2W9EH 3G6DH 1ZTXL 4LLYA 1U8QA 5TDPB 1EJOL 3O6LL 4K7PX 5JUEH 2APVA 1W2KT 3DJ9A 1BVKB 1DQQA 3I9GH 4IMLA 4R96B 2NX5D 1MH5A 1NDGB 3H9SE 3HRZA 2D9QB 2X41A 3VFTB 4EIZC 1C12B 5C0FB 3QA3B 2DM7A 1U91B 2Z31A 5DI8B 1AKJA 2XKNA 3D2UD 1NSNL 4QOKE 3VWKD 1EEUA 3DVFA 3MRMB 3L3GB 1NBQA 4TOYH 2W9EL 3G6DL 4ZUVB 3PWPB 4YQXH 1OW0C 5JUEL 1EMTH 3QJHB 4NO2A 3TESA 3I9GL 3CH8A 3OSKA 1T1ZB 5JPNB 4V2BA 3S4SG 5GSVB 5HYJD 5E5MB 5C08D 1T20A 3TVMD 3HAEH 3QI9D 1CFTB 2NY0B 2IAMC 3AU1A 2EYRB 2J4WH 1S9KC 1MHEA 4YQXL 4P46C 3KPPA 1EMTL 1KFAH 5ALCH 4Y4FD 2AI0H 2H32A 1I8KA 2IH1B 3V6ZB 1L7TH 3VJ6A 5E6YA 5KANI 4LAJH 3CFBB 3OG4B 2RQ8A 2B39A 4E0RA 4EUPH 4PP1D 5DMKB 2BOCB 1D5BA 5K33A 2E9WA 1FHGA 2J4WL 1T0MA 4OV6F 4WUUB 5F70A 4CW1A 1KFAL 1RI8A 3VH8G 5A1AA 3ARGC 1MF2H 2AI0L 3IFPA 3O4LA 3FT3B 4Z7UF 3IETB 3AY4A 5FOJA 2CRIA 4N68A 4HJJH 2VQTA 1KCUH 1AP2B 4C58B 4CVUA 3V8OA 2Z93A 2PYEA 1HH9B 3UDWC 3TA3C 4WNQA 4JPIB 3DETC 4MAUH 4C4KO 3RAJH 1MF2L 3GBNL 4AH2A 1FGNH 2FD6H 3LKQA 2X1WL 4NN5C 4WW2A 1GVIA 3MLXH 1FFOB 5KN5A 1J1OH 4HJJL 3OAYH 1KCUL 3MSPA 3D48R 4OBSA 4P5TD 5D1XD 4XCFL 2ESVA 2D31B 2E27H 4MAUL 2ATKB 4NP4H 3RAJL 3ZKMD 1FGNL 1RIHH 5L2JB 1OTTD 2E7MA 1CLYH 4LSDA 5CIPH 1IZKA 4YDKH 1HHKA 3MYJA 4FP8H 3MLXL 2O5ZH 3HLAB 1J8HD 4QHMB 5FB8B 1J1OL 3IT8D 4X9IA 3KLAB 1FVEA 3L7FA 3BUYA 3T0EE 5IWLC 2YPLD 3WIFB 3RVTD 1YY8B 2E27L 1LVEA 1NGXA 3G6AB 5K59F 4P3DB 2F74A 4P2OB 3DI3B 5EZOH 4NP4L 2VQ1B 1I8MA 3FFDB 4NZJA 3VG0H 1RIHL 4F37K 4U1MB 1QSEB 2N56A 1H5BB 4YDKL 5DT1H 4U1IA 5EU6E 3RY6C 2O5ZL 2JIXA 4H1LG 5C3TA 2J8UF 5TQ2H 3QHTC 5C86A 5HVHB 4AIZB 1SHMA 2D7NA 2DF3A 5E1HB 5IW6A 3I6KA 3EO1B 4ZS7H 3N1MC 3KPRA 1QTYT 3WJLC 2VH5L 5A43C 1YPZE 1VERA 5EZOL 3HC3L 1HOCB 3FRUA 3BH9A 3VG0L 1SJHA 3O3EB 5FYKL 2Y25A 5DT1L 5GRVK 4F58H 4G9FD 1LD9A 2M26A 4MA7L 5CMAB 4RQQA 5TQ2L 4FQCH 4NKMA 1YJDH 3SO3C 4XCNB 3MRNA 5EBGA 2OCFD 1BOGA 4KTEH 4DQOH 3GB7B 3QR2A 3ZE1E 1MI5A 3TC9A 2NX5E 4EI5C 4IJ3B 3G5VB 1K2DB 4K7FB 4Y0GA 1PDKA 3UTTE 2FLBT 4HCRH 2FNBA 5DK2A 3ELAT 4N8VG 4ZDHB 3FOLA 4F58L 5J3HC 4EI6B 3ETBF 5DRZA 3CLEL 4FQCL 2QKIB 3QIBA 1MUJB 1YJDL 1QHOA 5MEPB 5KSUB 2HJLB 1HXYA 3B4NA 4OQ1A 4K7PL 1JZ4A 4DQOL 1E4XL 3FQTA 4PP2A 4JB9H 4S11A 4M3KB 3VFMB 2A73A 1KJ2H 2G5BA 1BJ8A 2F54A 3ZDXE 4HCRL 1U8HA 4KVNL 2IFFH 4HLZH 5E5RB 2UWEA 4LCYB 4X6BA 1IBGH 2XY2A 5KS9F 3ZLQC 3CVIH 4ZSOB 4CRPA 3REVA 3U6RA 2BMKB 3V2AR 2F8OA 2Z91B 4N5EC 3GSRB 5ACZB 1ZS8A 1KJ2L 3TN0C 1CGSH 4PRIB 5DR5H 4LAQH 3JBG7 2NTFB 2Y72A 3UAJD 2IFFL 1A9EA 3MMEB 4JVUA 3TO4C 1MCWM 1N4XH 1R3KB 4X7FC 5E8EB 1JPSL 2X4TA 3ECBB 2X40A 1P7QA 4QRPB 3RHWF 3QUXD 4F37F 3DMMD 4LLDA 2ADGB 4PGCB 3MRBB 1NGPH 1CGSL 1M4KA 3WS3B 4NZTH 5DR5L 4YDVA 2AKRA 2BVUA 3QZWB 4LAQL 4ZXBB 1W72H 4FTVD 4Y2DD 1CYGA 3QEQD 1INDL 5ICXA 1N4XL 1BEYH 5DRXA 4OD2A 3GGWA 1DN0A 3CPLA 4HWUA 1CGUA 4HX1A 2JK5A 2NYYC 4JFPA 1T80A 1XF3B 3WL9A 3OKDB 1GRWA 1I9IH 1NGPL 5F8RC 4I4WA 4BQ8A 4NZTL 1DUYB 3L9RA 5D7IF 4QY8A 3ZHLA 1W72L 1BQSA 4NKQB 5DUBA 4Z7VE 5T3ZE 1IJ9A 1ADQH 3HG1B 3AM8C 4NO5A 1II4E 5D2NA 4XB8A 3LKRA 4PJAF 1I9IL 3WE6A 4U49A 3QQ4A 3CVHL 3TH3T 2E7CA 2I5YL 4QRSB 1AGBA 2P5EA 1FO0H 2HT4D 3DYOA 4TUJB 1OTUD 2FHCA 2J6EH 2A0LC 4R97B 3CFKA 2OXGA 4QGYA 1MJUL 4J4PC 2FSEB 2YPLE 2P5WD 3TCLA 5J4MA 5B3NA 1XCTB 3KPLA 3KLSA 1P1ZA 2QQQA 2EDHA 1JPTH 4DOHB 3RIAK 2Q1EA 1QLRB 1BVZA 4BQCA 2BC4A 3BN3B 4XWOD 1FO0L 2B4CC 3ZE2E 2J6EL 3Q3GA 4ZODA 4XNUH 1G9NC 2XRAH 4N0FB 2F8XC 3ARVA 2PN5A 4QWWC 4E41A 2DOCA 3AROA 5FUZH 3IDNB 3IDIB 2CKBA 5C9KA 3H7BB 3QG7H 5FGSA 3TBSB 3BX7C 1JPTL 4ZQKA 3WJJC 4GKZB 4L4VE 5DYOA 5F9JB 5H94B 1A1OA 5C0AB 4G9FE 4WI5A 4XNUL 2OMNA 3VXMA 3ROLB 1FORH 2FJFB 4PJ5E 5D2LE 5DC0A 1A6WH 5EZLA 3A6BH 3HZMB 1U8OA 5DO2C 1ONQB 5FUZL 4AL8H 4UTAH 2NY2C 3RTQB 5GPRA 2CDEA 1JE6A 3FT4A 4QTHB 3O2DA 3QG7L 4BQBA 3PDDA 4GLRH 4M5YH 2XACC 1UEMA 4IRSD 1UVQB 3FB5B 5LQBL 4OZIB 4XPFH 2X89A 5GGRY 4TTDC 1FORL 1WBYB 3ME0A 1A6WL 1JUFB 3A6BL 1ZLSH 2X7LB 4AL8L 5I6XC 4UTAL 5KSBA 3T77A 5B22A 2V9QA 3RDTB 3CC5B 4I3SH 1ED3B 2VLJB 43C9A 3Q1SL 4MJIE 4M5YL 3MR9B 4PJ9C 5E24E 3PGCA 1IAII 4GKNB 1D5XA 2IALA 3QNYA 4XPFL 4L3EB 2ZP0T 1A3LH 4I0PB 3PL6B 3DO3A 3X17A 3EZ8A 4M8QB 1ZLSL 3QFJA 1INEH 1EIBA 3EHBC 2A2QT 2EC9T 3IGAA 1EO5A 2GKIA 4JR9H