2FATL

An anti-urokinase plasminogen activator receptor (upar) antibody: crystal structure and binding epitope
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ATN-615, light chain
publication title An anti-urokinase plasminogen activator receptor (uPAR) antibody: crystal structure and binding epitope
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL01
3VXSA 2FLBT 3V4UH 5LQBH 3BDYL 1RZFL 1XGQB 5BO1H 4D2NA 1C1EH 4HJ0C 3F7QA 3MOAL 2A77H 4MXWL 3ZE2F 2EEAA 4Y5VA 3RVVC 3VXQB 3MRNB 1KXQE 3VW3H 2JELL 4TPRH 3M8OH 5KVGH 2XRAL 4MX7B 5EZLA 2AK4A 5MEOB 3ULUF 3NFPA 2XI9A 2Z0BA 5F93C 1I1FA 2BFVH 1FL6A 4KKLD 3LKRA 4WO4C 5JUEH 1E4KC 4MDIB 4R6UA 4DJMA 1RURL 4MAUL 5AYUH 1KCVL 5HGHA 5JW3H 3OPZH 2O5XL 4WI4A 1UVQB 1YMHB 1KJMA 3OR7A 4F37K 3O3DB 4H88L 1MHHA 4ELME 5HYSB 1AFVH 1I85A 4WJ5A 3A6CL 1GRWA 3NCYS 5L2KD 2O61A 3UPRB 1E27B 5LCVH 2GY7B 1RUQH 1IZJA 2J12B 4FZEL 5C92A 2X1OA 3H9HB 4TUJB 1AIFB 4WW1A 3RFZC 1L0XA 5JO5B 2F54D 3ZKMD 5DRWB 3R1GL 2Y06L 4U0QB 4KRNA 3QXVA 2PW2A 1ZS8A 3FZUC 4FFZH 4U3HA 4Z78A 1I7RB 1ZE3C 5CKAA 4L8SA 4Q0XL 1G7IB 4OIIL 3UDWA 1MI5E 3UCRA 2EDWA 3BPCB 1CU4L 4UT9L 4RGOL 5BOPA 3MGTB 4J3TA 4ONHA 3HB3C 3STLA 5IMMB 3EGSA 2V9RA 3VFSB 1U3JA 5EO1B 4C4KO 2JB6B 4KQ4H 5C0NC 3V6OA 2X89A 4OV5B 4KQ3H 3TM6A 4IOIA 2H26A 3GI8L 5D96C 1YYLL 3RTQA 1DQJA 4M61B 1MLBB 4PJXA 4DUVA 5FGSA 4KZEL 1X4XA 2GT9A 1JNHA 4NOFA 3OBAA 4TOYL 5TF1L 3THMH 5GGTA 4ZUSB 3VG9B 4DFHA 5AD0A 1R6VA 4JAMA 4PJ8A 4XPGH 1U8HA 3I75A 3W11C 5CFHA 1A4JA 3D9AH 4CADA 1ZOXA 3C8KA 3OB0H 1JFQL 4LLDA 5C0AB 3WNPA 1LP9A 2BERA 5IWLC 2V9QA 3P9LB 1KN2L 1WGOA 3T4YA 2ED8A 4N8CH 3RWIA 3RWFB 4X7FC 4D9RD 3K1KC 1KG0B 1WIUA 4EN3B 43CAB 2X09A 1T6WA 1OTUC 4G6FD 2BHYA 4MD0B 5BXFA 3S97C 1KN4L 1NAMA 3QB7C 2ZJSL 3ROOA 3DVGA 2ERJB 2IG2L 5DZLA 1MSPA 2EO1A 1TZGH 2H3NB 5DD3H 5KVFL 5FUOL 3HC3H 3SKOB 3FAXA 4YXHH 1V7NL 1FE8H 1AGCB 1FNGA 1CBVH 1RUKH 4MAYC 4M62L 3EO0B 5F9AC 2YA1A 5DLMH 1A5FL 3MACL 2GJ6B 5ANMA 4PGCA 5F1OB 2GK0B 3BOVA 1JYXA 3L3IA 1HIMH 4PJAF 3O2DL 5SWZD 3PWJA 3MRGA 5FM8A 2QL1A 3FQXA 1L4IA 2W38A 3BDXA 2C3HA 4Y19E 2EH7H 3CDYA 1VEMA 3IXAA 4EI5D 4YDKL 5E8EB 1NANI 1QACA 3CDCA 3OXSB 1HYSD 5K93A 1MLCA 4JO3H 15C8H 1PKQB 4QHMB 3HTLX 5IG7A 4OZHE 1QFPA 5I15H 1ZANH 3DRTA 3QISA 4U1GB 5F9JB 4UNVA 1A2YA 3QDGE 4S0SD 8FABB 1ZA6B 4O4YH 3U9UB 4K3DH 4U1SB 4ZOBA 3TEUA 1X5IA 4NJAL 5EG6C 4L9LC 5E6IC 2BY1A 1HHGA 4JFFD 4K8RD 3HE6D 3GSXA 5JOPD 1KYOK 4H25B 1MREL 3VGDA 3KHQA 1ZLUH 5DJ2B 3FQRB 5AWNH 4GSDH 5D1ZC 5EA0H 1P4BH 1KSRA 4XCFH 4YDLB 3KXFB 2G5RA 3ZYIA 1AHWC 3L5WB 5HYJD 2VXQH 3QWQB 4IMKC 3TT3L 1KOAA 3OKOB 3VXUE 5C0CE 5HY9A 4ZD3L 2PXYD 1G7HB 2CLZA 2YHGA 3T77B 1RK1B 2YA2A 4OKVA 2BNQE 4G5ZH 1QEWA 3B6SA 5FM5O 1U3YA 3GSVB 4M7ZC 4WFFE 3SDCC 2IANB 2A6KA 5TFSL 3DRQB 4R7DB 1NC4B 3D25A 4MS8D 4NGHH 4X0KA 4ZSOB 3MLXL 3RY5A 3T2NL 3NACH 4NQVB 3ZDXF 2EEBA 2XNAA 5JORA 3F6IA 4QXUH 1A7QL 3V4UL 2VLLB 3BUTA 1HHKB 1YQVH 4QXWA 4NRYA 3MLZH 5I2IB 1C1EL 4JVUA 5DEFB 4L1DA 3PWUA 4ZPVB 4PJFB 5MENA 5DD6B 3VW3L 1I3GH 5DZOA 2YUXA 1OCWL 5CD5C 4I5BA 3DX9A 3BP4B 3U9PH 5E4EB 3NIFF 1A7BA 5JUEL 4KMTL 1GCFA 1DTUA 1FPTL 2AGJH 4RGNE 4XMKH 5AYUL 4M8VA 1TJIH 3OPZL 5C08D 5DRXA 1UA6L 2IADA 5LXGL 1U92A 2NW3A 2VDPH 4FQHA 2AEQH 2QKIA 2J4WH 1EZVY 3NA4A 3FT3A 4Q9BA 5ESVB 5CSZB 1KJ2H 3L3KB 5KVEH 5SX5H 3ARBB 3OF6D 4PB0H 5IV2A 1XGPB 1FZMB 3PQYB 2GUOA 3QEQA 5LCVL 2HT2C 4LKXA 1AI1L 2FYYB 2QSCH 4F9LA 2VH5H 1A0QL 5B39G 2R2HA 3QNZA 3EJZD 1OW0C 5D7IF 3GIVB 2DS4A 1C5DA 3G5ZB 3WV0A 3ARRA 4DKEL 2VLKA 4NBYB 1U3HA 4HJGB 2VZOA 2BNRB 4NKQB 1YN6B 5JW4Q 3IU4H 4GKSA 4D9LL 3BMVA 4PBVC 2Y25A 3DVIA 1TCMA 4F7PA 2WANA 4RRPA 4LAQH 1HINH 4FFZL 3RDTB 2XTLA 5E2VH 1B2WH 2FZ3A 2VL4A 4DVRH 3WFDH 1E0OB 5C0DB 4GG6F 1BGXH 1KTLB 1XGUB 5FA3B 1NMBH 2VQ1A 4Y2DC 4HK0B 4G6AD 2CGRL 1CT8A 4Y1AB 5F9WB 4QRRA 4IHOB 5FO7A 1YPZA 4X5WA 4X6FB 4HBQA 4I0PD 4HXAH 1ED3B 2MSPA 1VFOA 5DSCB 1VFMA 4BH8B 4ISVA 3BD4A 3AXLA 2V9TA 2P8MB 4NQDD 4G8IA 4NO0D 3THML 4OF5A 2B2XL 1Y6NR 3TVMD 3MFFA 2K7QA 2DI8A 2KZWA 4XPGL 3H0TB 1ZGLB 1RZIA 3D9AL 1LEIA 2FEDC 3NCEB 2WIIA 2NZIA 2PO6A 4F7CA 4XZUA 4FXGA 4WWKD 3P4OB 4N0YH 3S34H 1JPSH 3MLPA 4HK3N 4JRYA 1J05B 3QUXD 5D7LD 5LWYH 2W0FA 4KFZC 3MBEC 4OCYL 1QSEB 4P2RD 1S8DA 4XP4H 2ZOKB 4JDVA 4F7MB 4X4YA 4NN5C 4ZFOB 5K9OB 3LQZB 4HPOH 2NY4B 1LE9B 4WUKH 2APFA 1MCSA 3GMLA 4FNLL 3CIQA 4IOFD 1J1OL 4KRMB 25C8H 4YXLL 2XN9D 1BFSA 2PUQT 3MRCB 4KK5C 2HWZH 1X5JA 2D03H 2EDFA 2HJFB 3QULA 5DD3L 3S88H 3VA2C 5DDHB 3PWNB 3PDGA 3HC3L 4KHTH 4DZ8A 3X13B 1FE8L 2AQ3A 2X4UB 3KHOA 1TJHH 3PWVB 1QRND 2DQJH 1XFPA 5HVHC 1R3KA 3QIBA 2OZ4L 3WS6C 4I3RH 3DBXA 1A7PL 3TA3A 1C16A 3RNQA 1I7ZA 3QXUA 4M48H 1OAYH 2H2PC 5IMLA 2OL3A 1K2DA 4IEFB 4YHNA 4JO3L 5I71C 5JQHC 3L9RA 2NW2A 1TIUA 3NTCL 5KSAA 1CDCA 3MUY1 5E2TL 3HZYA 4IMLA 5I8CA 2V5SA 4AT6A 3QIUB 3QRGH 1EHLL 1DN2A 4AK1A 1CDHA 3D69A 3N9GH 1ZVYA 5I1HH 3O8XB 2QQLL 4LLYA 2WWKT 4D8PA 4WFED 3NPZB 3Q6FB 4OZGE 1MQKL 2VRAA 1HI6B 3NCFB 5HHPA 1FV1A 1U58A 2VDOH 1G7LA 5CZXC 5AWNL 4A6YA 5GZND 2BHUA 1R5IA 5T33H 4EVNB 3QR2A 1P4BL 4XCFL 4CAGA 2DIBA 4WDIA 3GJFK 4KWUA 4YFLF 3LN5A 3G6AB 1OT2A 5IHZA 4LCCA 4NKOB 4YR6B 1TVDA 1S9KC 4KTYA 5DJ0B 2RQ8A 5J12B 3O3BB 1FN4B 2A2QT 4TVPD 1KPUB 2X4NA 4G6JH 5ECJE 3HR6A 4GW5B 4MCZA 5D7JA 4G5ZL 4Y2OA 4U6XB 4WW2A 1SY6A 1K8IA 1QHOA 4S0TD 3QQ3B 3QUMA 1FZJB 3L6FB 3ARFD 3QPXH 5AZ2H 1K4DB 3EYFB 4BKLA 5DA0B 4FFVD 4NZRL 4BSWB 4YPJA 2B39A 1MWAH 4MJIE 5TH2A 1G0YR 4POZD 4URTB 1N0XH 1LEGA 3DYOA 4OFKA 1SVCP 1G7QB 3HG1A 4JFFE 4LPCA 5DO2D 4I48A 1N59B 3MLZL 5DS8A 1D9KC 4CJ1A 1NFIB 1MF2H 2LU7A 3UTQB 2IQAB 3QUZD 4HV8B 3BQUC 5EN2A 5DRZA 3VH8B 2WINB 1ZT1B 4NC2B 4P2OC 4PGEB 5HYJE 4PP2A 4F7EB 2Z4QA 4PJGA 3FQWA 4TRPL 4KV5E 3BT2L 4NT6B 5EU4B 2AJ3B 5CEYB 3SGEH 2HVJB 1YEEL 5HDQL 2AGJL 3JV6B 4F33A 4XMKL 1MIEH 5LGJB 1QQDA 2DQUH 2CR3A 1G6RA 5CZKA 4WI8A 2FECI 3O6FA 2AEQL 4ZUVA 4UOJA 1EVUA 4DVBA 4EI6B 5JMOC 1DQQB 5ID0A 2HTLC 3OHXA 1PZ5B 3B5TA 3QG7H 3Q1SL 3BP6B 3MXWH 2VH5L 4Y5XC 5HHME 1P5UA 2VLJA 3I6GB 3KPQA 2EH8H 3CJJA 3GUTB 4KHXH 3JV0A 1IARB 1TJGL 1HDMB 2IFFH 5I0ZA 5GGQH 1ES0A 1EUTA 1HSBB 4JFXA 5C0RH 1OT1A 2IF7A 3HLAB 5AEAA 2Z8RA 4LAQL 2GIYA 2Q8BH 4Z7OF 4MXQC 3UPAA 1IZKA 3L5JA 4KC3B 4EDXB 1LK2B 2J8UF 5HHOA 4JN2A 3ZLQC 4J3XA 4LCIH 5C07D 1ULVA 1T1YB 5C08E 1F11B 5MEPA 4OLVH 1B0GA 2FRGP 3TNMB 3TYFA 2FIKA 1MY5A 2R39A 4YFEA 4V1DE 4HXAL 4MYWB 4YHOH 4CKVX 1MFBH 1V3MA 1P7QB 1RJZA 5MI0B 1JGUH 2BC4A 5GHWH 3KPOB 3OSKA 4WHTA 4LP5A 1TVHB 4QRPD 2SEBA 3QUYA 5D1QA 5I9QB 4PJHA 4BFIB 1QNZH 1KPRA 1LO2L 3KPRD 4PRIB 2DJUA 4ELMF 2ZSWB 3BWUC 4KVCH 3ZTJH 4FFWC 4L3CA 43C9B 1D5MA 3ULVD 3DETD 4FQ1L 3X3FL 3KLAB 2OBGA 3JXAA 4J12A 4PGZA 5FUCE 3VRIA 2Z93B 2QADC 4U2YA 3S34L 5HPOA 1JI1A 3UBXB 4WEBH 4JFDE 4OZFA 4X9IA 5INCB 1KIPB 1G9ML 3VWKD 2CMRH 3W9EA 5LBSL 3MXVH 2Y23A 1PEWA 3GKWH 1A6VL 1A47A 4WUKL 4R4ND 3MZGB 5I1GH 4ODXA 3BFOA 2R0LH 3B9KC 4O2EA 3DOSA 1IT9L 1TNMA 4K8RL 1EEYA 1U8NA 3QDMA 1WLHA 5F44A 4HIXH 4N9GA 4AG4L 3UZVB 4KHTL 4X6EA 4EJ1C 3V6FA 1RFDL 3GDBA 1TJHL 2DQJL 3JV4A 3IAQA 1VESA 4HHAA 3RWCB 1EGJA 4X8JB 3LKPA 4I3RL 5EUKA 3V8CA 1I8LA 4Q6IC 1PKOA 1YEFL 5IB2B 2E8ZA 2EXWC 3FB5B 4O5LH 2X1WL 3C8DA 4WU5A 4W70A 4C56A 4P46D 1XGTB 2FL5A 3ARQA 1PSKL 1F3JB 5FCUH 1WTLA 4F2MA 5CEXB 3WNNA 5HYEA 5C9JA 1JZ7A 5D7LE 5E8NB 4NDMA 4FQXA 4QOKE 3LY6A 3O2VL 1JRHI 2G2RB 3D3VB 5ICZA 5INDB 1FIGH 3MLSL 1D3CA 2IEPA 4OGXH 1YMMB 4P23A 2OK0L 3QRGL 5I75C 3CH1A 1I7UA 3DURB 1AP2A 2HN7B 3MV7B 2VDQH 3VI3E 2R4RL 4B7LA 3A0OA 5EFIB 3VFMB 3I50H 3ZKQD 4YHMH 3FO9A 3UTTA 5I1HL 2NQCA 4G80B 4Y16A 1HHHA 4UIMB 3U4EB 3PXJA 5T1KA 4JKPL 1R3JB 2MNUA 4R4FH 3CFKB 3TFKC 2VJXA 3MMEA 1B6UA 3IF1B 2VDOL 4UQ2A 1VACB 4YNYB 3ZKMC 1T1WA 5JQ6H 3DX6A 3IFLH 4CU6A 4PG2A 2UWEE 1A1MA 1NUFA 4OJFL 2K3TA 5D7IB 1XF5B 2ORBL 1T2QH 1N3NB 3MRPB 4JO1L 4PRBB 2I9TA 3ZYOA 5DVMA 3SE3A 5IBUB 2IBGA 4HUVA 4NRXA 3DMMA 4YO0B 1E4JA 2GTWA 3CUPB 3KJ6H 4NWUH 1M05A 3RGVA 4WI7A 5D96B 3MR9B 4P5KB 5E70A 4WU7B 2NZ9D 3C6LD 1JGDB 5E1HB 1FFOA 3O4LA 1G7JB 1QR1A 2BVQA 3OKLA 4U2ZA 1LD9B 4CNIA 3MRJA 4GG6B 4AIZB 4U1KB 4DQOH 1I3UA 4JPKH 5I73B 5H94A 4OM1H 3VMPA 3RNKB 1Z5LB 2DIJA 2W60B 1MH5A 4UV4H 4MD5B 3HI6H 4OZHF 1I8MB 4V2CB 1Q38A 1S9WB 2EYSB 4HKBB 1FZOB 5KSBE 5DJYB 2I9LB 5BRZA 1M7IB 3RZCB 1GGCH 4NQCE 2BVEA 1TQCC 5D9SA 1DCLA 2NR6D 3WXVL 3SGDH 2ZUVA 1HH6B 4LRNL 1T5XA 1MCOL 1NJ9A 4LCWB 1MIEL 1OD7A 5F89A 1FJ1B 1NBYA 2JJTC 3VXMA 1OB1B 3GMMA 1Z0NA 2X42A 5F7HA 1IAOB 1U8JB 3D2UD 4MAYB 2R1YA 2OMBA 4U6VH 1TZHA 5GSRA 4D9QD 3QG7L 2VDNH 1QUNA 2AVGA 5D5MA 2M2DA 1D7FA 3C2AL 5AZEH 5JTWA 2EH8L 3VFNB 2NTSP 4HX1A 2CK2A 2DM4A 3MV8E 3FFCB 3NIGF 3CXHJ 4YHIA 3RVUD 3E2HB 3L95B 4TNVK 2KBGA 5JXAH 3B43A 4GKZA 1CXIA 2IFFL 1SMAA 4TULL 1MAML 5ADPH 2FB4L 2XPGA 4YHPA 1KLGA 4HIEA 5MEQA 3ZHKA 5KW9L 5DC0A 2VSCA 4JFYB 5E56A 4AM0B 2W65A 1CD9B 4KTDH 4MHHI 4PY7B 2HKFH 2ED9A 2CH8A 4RGMB 3HS0B 2NY5L 4AQ1B 1ZAGA 3HMXL 3DX7A 3E6FA 2Y1VA 3P40A 3P0VL 5EU6E 2HTKD 5IHUH 4EI5C 4M3JA 3G04A 5HGBB 1CDIA 4S10A 3MRDA 3T4AA 1HYSC 2Q20A 3ZSSA 2L4OA 5E6IB 4G8GE 1PGRB 2V2TA 3QCVH 1VGEL 4YHOL 1FNSL 1YQ2A 3D39B 1IFHL 3KPPA 2PW1A 1D5XA 1RZ8B 3DLQR 2LV4A 3U30B 1CVSC 3WIHA 3CFEA 1G9MC 1ZHNB 1DFBH 5EC1A 1NGZB 3TO2A 5GHWL 4P5TD 1AHWB 4HZAA 3AMKA 3MRIB 2HJLA 3PGFH 4OCSL 1MFEH 2MMXA 3GHBH 5F1NA 3NA9L 1OF2A 5C0BB 1WBXB 5EPMB 5E4IA 4RMVA 1RHHB 1OWRM 1I1RA 5D7KD 2I24N 1P4LA 1IL1A 1JGEA 1UH3A 1F5WA 1OAQH 4XWGH 1T66D 1U6AH 2EYTB 4K3EL 4CN4A 3L3GB 4WEBL 5I66A 1WEJL 3LEVL 5IBLD 3SDCB 5E94A 1KJVB 4KK8D 3GSUA 4MNGB 4OCMC 1OGAA 5EZIL 4NBXB 5CEZD 4GJTB 5EU3A 3GRWL 1GZQA 2CMRL 5C07E 4MNHB 5MP6H 4AJ0A 4O2CA 5CD3A 4FXLA 2IFGA 4RDQG 2PXYC 2NY0D 3EDFA 3VG0H 3UTZA 3P0GB 1QA9B 4HGKC 3FTGB 2F5AL 1T22B 1QFWH 2JCCE 3HZKA 2AK1H 4M1DL 1RULH 2R0LL 3PL6A 3F7VA 3GJEA 5HPMA 1Y0LB 5ID1B 4LLUA 2VKXA 1UQSA 2ZG2A 4CGTA 2VDMH 1BLNB 1WBZB 4HD9A 1LQSR 5GS3A 4HS3A 4MS8C 1B0RB 1DR9A 4PV8B 3MUJA 2A6IB 4X6BA 4QRPE 3U0WH 5EUOA 1URLA 2DKSA 4JKMA 3U0PB 1EO5A 3O11A 3UTSB 2ATKA 5JLZA 4LSTL 4JFHD 2IPUK 5J56B 3KPRE 2G5BA 1BQHB 4I3SH 4F3FA 3L3HA 4R2GD 3D85D 1RAMA 2J8OA 4Z7UA 4LSDA 5AG8A 1FYTA 5DJZB 4HS6A 4TVPL 3MJ8B 3SKMB 5HI3D 5IROC 4YPGB 4WHYG 1H0DB 4P5MA 2YPLE 1DDHA 4LSSL 3NCJH 2VITA 1I1YA 2P5WB 4GMTH 1U8MA 1ND0A 2BOBA 4XNQB 3CGTA 4HCRA 4JFED 4I4WB 2P8PB 3MREA 2C7UB 4JFZH 1EDQA 2A9MH 5HYSG 3EOBA 3M45A 1SJXA 1ACYL 2VDQL 5I1AB 4NQSB 2B8OT 2A73B 1EO7A 4GS7B 1I7TA 3BEWB 4UT7L 5GGSA 2FNBA 4MQTB 4WY7H 2WBJD 2PYED 2DTSA 1S9VA 5HYQB 3EJZC 3DUHA 4OIAA 3MV11 3C9NA 5F1SA 1VA9A 1W72A 4QHUB 2DJ4A 2R29H 4XBGA 1KLUA 3IFLL 5DMIL 4Y2DB 2DICA 5I18L 4G9DA 4R96A 5D71H 3GJFA 3RKPA 1B4JH 5HI5D 5CLWA 3QQ9D 3BPOC 5I1EH 1K3IA 1KC5L 3RBSA 1AGBA 4X4ZA 3I3DA 5FUCC 3BKJL 3IDYC 4MJ6A 4JLRA 4ZNEA 5IHBA 1HYRC 3SKNB 3V4PH 4GBXA 1BVKB 4WUUD 2IGFL 4NWUL 3L3OA 2BK8A 3IKKA 2K7PA 4KKBD 3VI4E 4QTHA 4PGDB 3S5LA 2CLVB 3EFFB 3OX8B 2J8UB 3BVNA 4J4PD 4LLQB 2YD7A 3GMPB 5C6TH 4LSUH 3VXOA 4YX2H 4OZIA 4OM1L 5K9KB 2M26A 3W0WE 1QBLH 3IDIA 3K4AA 3OXRA 4KMQA 3U7YH 3EZ8A 5L0QC 1F4AA 3BAEL 3HI6L 3QWOB 3C5SA 1NKOA 4XRCA 5F7FA 5J8OA 1VFBB 3T04D 1JWMB 2Q3ZA 5FYLD 2YD4A 3MBEB 3TVMC 5DHYB 4NJ9L 1QFWM 1U91B 1ZSDA 1DQDL 2XG5A 4GG8A 4P57A 2CDGB 2EXYD 5DQJB 4Y4HD 1BFVL 3QI9D 2X4TA 3K8MA 4OZGF 5KSVB 4Z8FL 1KIQB 4H1LH 3IKCA 3QO1B 3L3JA 4MJ2A 3C09C 1F6AA 1PX3A 3IDGA 3L3DB 4Z76B 1EH9A 5I8EA 2G60H 5A2KH 5C0JB 1Q1JL 3CCHB 1UM5H 5HVHB 2CXKA 2IQ9L 3FO1B 4ZG1A 4JFOB 2DQFB 4IOFC 5FOBB 1VB9A 1X9QA 3GZKA 5T5FH 4UDTB 3ULVL 3TN0C 3O9WD 4LL9A 1KGCD 5FHAL 3CVHB 1T03L 4OLXL 4KKAC 3X14B 3OKEB 3MCLH 1UXWB 3UTOA 1MI5B 4QRUA 1Q9OB 5LVEA 4U1JB 1G84A 3HC4H 1DBJH 3CSBA 1JIBA 1FYHB 5T1DH 2P45B 4EUPA 1WCBB 1KUMA 3REVB 4WFGD 2DQEH 4HS8L 1SEQH 4GAYB 1IAKA 2R2CA 4ZTPH 4MWFB 1YEIL 4QT5B 3H9YA 3GSNB 1FL5A 1BBJB 5C09E 3Q6GH 32C2B 3C5JB 4OUUB 4LHUG 2EC9U 1NBVH 3DVFA 3UZQA 2FSEA 4KK6D 4D9QE 4DGVH 1H3PH 4KJPC 1J1XL 4KV5F 1JGVH 3P4MB 4G8EA 3F5WA 3G9AB 1CXEA 1BFOB 2F53A 4HKZA 2ZCLH 4NHCH 3VXSD 3BZ4B 3ZDYE 2CRIA 2FHCA 1XGQA 5F7DA 2J3SA 2VXTL 4QRSA 4XP1H 5DT1H 3T0WA 4POYA 3AU1B 5F7WC 2W92A 4PJCA 1D6EB 5JXEA 1OAQL 4MX7A 5T3ZH 1EPFA 4RX4A 2VZUA 2ZNWA 2AK4D 5MEOA 3GFUA 5GSVA 4KROB 5E5MA 1DVFD 4QYOB 3TO4D 2AEIT 2BX5A 2H32A 4M4PA 5EOQH 3I6KA 2XQYK 2BY3A 3CSYA 1EMTH 1RMFL 1EFXB 4JZJA 4Z7VE 9CGTA 3VG0L 4O2FB 4ZUUA 3V52H 3O3DA 2VO5A 1J8HD 2AK1L 2JIXA 4LGSB 4JRXB 5T1LB 4JE4B 1D9KB 4KVNL 1DJSA 1PVHA 4O02H 4M6AA 3UPRA 1E4XI 1E27A 4KI1A 1FG9C 4UINL 4P0DA 1I9EA 4FFVC 2IAMC 2DOCA 1KPVB 4XHJC 3ZYZA 3S4SG 1A6UL 1IVLA 5DRWA 4POZC 1NMAH 4Y19B 4DTGH 3ZT5A 4I3SL 4K3GA 5D7KE 3VXNB 2HLAB 3Q0HA 1FG2B 1I7RA 1G7IA 3G08B 1TZIB 1S7QB 3WMSA 1IE5A 3BPCA 4L4TE 1MHEB 1QSFA 4OZHB 2CIIA 5KS9A 4R90L 2DF3A 4M7LH 5EO0B 1W2KT 4P2QB 3PHOA 4XMLH 4HUUA 5IHLB 1EAJA 4GT7A 4Y5XB 4L4VA 1CE1H 4GAFB 1RZKH 1UYWH 2BMKB 1MRDH 3WCYA 2YPVL 5CINL 1CVRA 3VFTB 4NQXB 4OV5A 4NSKB 1GSMA 1FGVH 3RU8H 3ETBF 4M61A 5I8OH 1MLBA 3VGGA 4YHZH 4WY7L 5CP7B 5SWSE 3CVIL 3QO0B 4ZUSA 3QFJD 1IC1A 3CFCH 3SDDC 3E8UL 4H8WH 4PJ8D 3MUZ1 2W91A 3MJ9H 4GW1B 3U2SB 3KLHD 1M7XA 4P4RB 4OI7A 1CGUA 4QTIL 4C58B 4WV1C 3VXUB 5C0CB 5JDSA 5IW6B 1B4JL 5I1EL 3PIQA 4ZUTA 2BNQB 2IC2A 2A74B 5T3ZE 1BREA 1S7UB 1CS6A 5K9JH 5C8JA 4EN3A 1A6WL 2PTTA 2E9BA 4PJBE 3RKDC 2CKBH 5EOCH 3S35X 1IEAB 2J5LC 1CG9A 1IGYB 4L8CB 2RCSH 3PNWA 4JJHA 2AKRA 1AXSA 5C6TL 4YX2L 1XIWC 2CDEA 1ZHLA 3QCUH 1U8OA 3I02B 1QBLL 4HWBH 2VXSH 2DB8A 1AGCA 2QADB 1NCCH 5IBTL 4G3YH 1HWGB 4GRWH 1RIUL 4G6ML 1JCKA 1CLOH 1CL7I 3BISA 3EO0A 2D9CA 2GJ6A 3CZJA 1INEL 2GK0A 3C6SB 2ITCB 2E6PA 4U6HB 5HGAA 1T2XA 2ESVB 4JG1H 3VI3F 1KELH 2OI9C 35C8H 3DXAA 2XA3A 3GBNH 4JQVC 4XC1L 1EAPB 4Y5YA 2FATH 4L3AA 2R0ZL 2APXA 4RGNB 5DUPL 3SE9H 3ULVC 1F2QA 4AMKH 5E8EA 5BOZG 3OKNB 4PJ5E 3OXSA 3HA0A 5I6XB 4WUUE 3K8KA 5BJTB 5I8KL 1XH3B 3QIWD 1FSKC 2F5BL 1OAXH 5B3NA 1NC2A 2W9EH 4ZTOL 2G60L 3JTTA 5I30L 1TVBB 5F9JA 1MCNA 1GGTA 4OLYL 1J5OH 2A6DB 3EO1A 4Q6IB 3T0XA 3U9UA 4F9PC 1CD8A 2OP4H 5T5FL 3NCBB 4HQQL 4E41D 2QQNH 1S7WB 3HRZB 4DN4H 4H25A 4JHBA 2MJWA 1WBYB 1ZKAA 3FQRA 2HAZA 5DJ2A 4PRPA 3K81A 3QDJD 4LF3B 4MA8L 4NQEE 3KXFA 2PYFB 4HG4J 3L5WA 3HC4L 4FQLH 5CEZL 1FNLA 3MRHB 1N8ZB 3QZWB 5IJKA 5I75B 1A3RL 3BW9A 5GRJH 3SGJA 3TF7C 1SEQL 1NLBH 3FT2B 2ZUUA 2WQRA 4HZLB 5IVXA 2F15A 4M93B 4NRZB 3T77A 3U4AA 3FOLA 4CRPA 4S1RH 4ZTPL 4RZCB 4FABH 1H3GA 3DGCR 3RHWK 5KSBF 4TUKL 3UEZA 1UT9A 1ZV5A 3VFGH 4B41A 3ZL4H 3MNZB 2IANA 3L1OL 3DRQA 3D87B 1NC4A 3IVKA 1H3PL 4LQFH 2J88H 1FL3A 3D0LB 1MVFA 3WL9A 1NCAH 4LSQL 1BD2E 4N8VA 1IC4H 4MNQA 4NKIH 2Q86B 2A9NH 4NHCL 4R9HA 2VLLA 4TTDC 3D48R 1BBDH 1KGCE 2R2BB 4KXZH 1HQRB 5I2IA 4ZPVA 4L3EA 3SY0B 3F7YB 3IJHB 4PJFA 5MEND 1FRGH 3LD8C 1T80A 4GRWE 1A1NA 1N64L 2A1WL 3QXWA 4BZ1L 5BV7H 3WD5L 4KGJA 1FFQA 3FQTA 4WFHD 3BP4A 5E9DE 3T08A 3H7BB 4PD4J 4OFPA 5BVPH 4XXDB 4O00A 4BYHA 1F90H 1S9YA 4ZODA 2NXZB 4ZFZB 3UYRL 3MNVB 5CSZA 3QHZH 3L3KA 1AO7E 1KJ2B 1LWRA 5BVJA 5IEKB 1J12A 2NY7H 3LS4H 5FKPA 4Y88A 3PQYA 3QEQD 5E6YA 2FYYA 3ARDB 5FGBA 4WRLA 4P3DA 1ZWIA 3EYSH 3HCVB 5C6PB 3VMNA 1TQCB 3G5ZA 4R7NB 3H9SA 1V3LA 2JB5L 1U3HD 5F7UA 1NMAL 6FABH 1JF6A 1YN6A 1JNLH 3QNYB 2X7LA 1F3RB 3F12A 3O6LH 4OD1L 1NGPL 2P4AB 2EIZA 4NKMB 3RDTA 4Q9QH 1Z2KA 1PLGL 4JHWH 4JDZB 2YSSB 2D4DA 1OY3B 5C0DA 1AJ7L 2IALA 1ONQB 4D0BA 1LE5B 1KTLA 1MVUB 4LPYA 1FVCB 1XGUA 2GSGB 3ES6A 4GXUN 2FX9H 4Z0BH 1HHJB 2X2YA 3HZMB 2ZUQC 1CE1L 1RZKL 4Y1AA 2AW2A 4GW4A 4IHOA 4QRRD 4K3JL 4X6FA 4N8PA 1ED3A 4NP4L 1B9ZA 3MRFA 2ZCKH 1H9VA 1JPGB 1BQSA 2A38A 4OZGB 5ISZA 3RVWD 3W81A 4JJ5B 4XPAH 2OR8A 2VISB 1FGVL 3RU8L 2ARJQ 1RZ7H 4FQPA 5FYLL 4JHZA 3UJIH 2ICWJ 5FYJH 3WYRA 4KTEL 1S7RA 4ODSH 3MO1B 5ITFB 3LQAL 3GKZA 5J6GB 4H8WL 1JHLH 2F8OA 4I8DA 1QFUH 5HHVH 2F54A 2JCCF 3RVUC 2AXGB 4GRLC 5FYKH 3H3KA 5I1KL 1MFAH 3S3SA 2PO6D 2YOCA 3P4OA 3O3UN 5C7XH 3TBSB 3V4VH 1J05A 1N7MH 5DWUH 2BNUA 5E5UB 1VERA 5IESL 4F7MA 1GAFL 5K9JL 2EKSA 2P44B 3OAZK 4ODUB 1MJ7H 3FL7A 5K9OA 2RAMA 3X3GL 1INDH 4I2XE 3WFCH 1LE9A 2HTKC 1E28B 4X7DC 4RSVA 2Q8AL 3VWJD 4MJIB 2DLGA 5D93C 3V6ZB 3V6OE 2WBKA 4DK6A 1FBIH 2HJFA 4JFFB 4LLWA 5DMJB 5DDHA 4EBQL 3QCUL 1XF2A 5DMKB 1DQML 5KN5A 5DZNA 3V8OA 4PJXE 4OGAD 4HLZG 4H5SA 3PWVA 3DV4B 1QKZH 4P5TC 1MRCL 4DW2H 1DANT 4G7YL 3G5YA 1CIDA 1BZ7B 5HYJB 3OJMB 3QIBD 1NGXB 3ROLB 1WIPA 2EDEA 5DMGC 5KJRH 4X7SL 2X4QB 4FXKB 5D6CB 2CUHA 3TA3D 3UPCA 3GBNL 5GQBA 2FATL 1LP9E 3RVTC 1OSPH 1CFNB 3UBXG 4R8WL 4AMKL 5DA4A 1X4ZA 1WVZA 3ZKXB 4MA1C 4GXUM 4ONFL 3MROB 5DFVD 5DQDL 3MFGB 3UC0H 4KK8C 2VUOA 2JJSC 1AQDB 1YEDB 5KSAD 3NOIA 2C4FT 4MSWB 2FH6A 3BN9D 3IGAB 4LPXA 5HHMB 4X4XA 3WKNA 3CX2A 2J1KA 2NY0C 3MCG1 5IF0A 3VFUB 2YS4A 3O8XA 3KPSA 4TSCH 3MRKA 1DE4B 1PJ9A 1A6AB 3AREA 3FQNB 2DAVA 3Q6FA 3C87A 4NNYB 2QQNL 1JTTA 2Q1EA 4MQSB 1HI6A 2OJZH 3BP7B 2E7BA 5IB1B 3VI4F 5ESAB 1SBSL 2AJXH 1OTSC 2NY3C 3FONB 3OAYK 1AGFA 1X5AA 5FYJE 3N85H 2P46B 4HT1H 1HKFA 5SWZA 4OUOA 2UZIL 1TTFA 4NKOA 1S5IH 1S7XB 3DUUB 4YR6A 1CDJA 1WT5C 3VD5A 5FYKE 5KTEH 5DJ0A 4GQ9L 3O3BA 2HLFD 2ARWA 5HI3C 4RNRB 5JHDA 4V1DB 1VDGA 2VERN 4S1RL 3VCLB 5BQ7B 5D7JD 1JV5B 3LIZL 2JJWA 1EO8L 4RFNC 4U6XA 2RGSA 5F71A 1KTDB 5DURD 1Q0XL 3QQ3A 5I1LB 1FZJA 3L6FA 3RIAK 4NYLB 3EYFA 2W9DH 2CDFB 2VR9A 1KXVC 3H9ZA 2J88L 3GNMH 5T3XD 4M1GH 1MWAB 1OD9A 4KI5D 1IC4L 4NKIL 4BQ6A 1G7QA 2QHRH 1G0XA 5F9OH 1OARL 1XF1A 4PJ9C 2XZQH 1NFIA 3IDYB 3HE6A 2WBJC 3QYCA 4YBHA 2D0HA 2NY2D 2IQAA 4CDGC 4HV8A 4JFDB 2DBLL 4GAGH 3VH8A 5I1IH 2X9XA 1ZT1A 1A6TB 4J1UA 3EOTH 3DSFH 5IT2L 4KJYA 5EOCJ 5EU4A 4NT6A 1MJUH 5IBUG 2AJ3A 4OLUH 2YRZA 3JV6A 3QQ9C 3MJ7A 5LGJA 2QR0A 2EDKA 4B53A 3I3EA 2J7LA 2R1WA 5JR1H 4UU9B 3KLSA 4EI6A 4HKXB 2AJVL 1Q0YL 2NY7L 3RAJL 5GGTL 5KOVC 1H8NA 3TVMB 3BP6A 2J8HA 3DGGB 4J4PC 3EYSL 1DL7H 1IEBB 3CK0L 3AY4A 1RZKC 2XQBH 1JN6B 2Z92B 4Z0XB 1GC1L 2H6PB 1NBZB 2I07B 4B0MM 5SWQA 3BX7C 1FC1A 4LK4A 5A2LH 2DL9A 3MRLA 1JNLL 1OM3H 4HAGA 5HDOA 1F02I 1T0NB 1X5LA 5MENE 1VFAA 3O6ML 4ZNCD 3P11L 1Q9LB 1UZ8B 4QOKB 3WJJC 3VXPA 3C09B 4EDXA 3WLWC 3H2WA 4M9PA 4RA3A 4H8WC 3P73B 1RY7B 3ZDYF 1NAML 4ETQB 2LU4A 4Y4HC 4WGWB 2FX9L 2V7HA 4CMMA 1F11A 1JUFB 1QOKA 1J0HA 1ZHKB 3RRQA 4K94L 4JG0H 1Q94B 4QXTB 2QQQA 4XBPB 3TN0B 2ADFL 1P7QA 3NZHH 4HWEH 4K2UH 4XCYA 1UWEL 4UNUA 5GIRA 1ZLVH 1YC7A 2VE6B 4OTXL 3UJIL 3BN3B 3EYQD 4KUZL 1IGIH 4ODSL 5KG9B 3KPMB 4Z7VF 2VLKE 5D1QD 3PG2A 1JHLL 3ALWA 5FKAB 4KDTA 3BH8B 2ZSWA 3O9WC 3TZVB 1B88A 3S35H 2OL3H 4PTTB 3KLAA 1DBAH 1Z9MA 1R5VB 2BDNH 1LO4L 3V4VL 4XPHH 4N0UA 5D72L 1ZK9A 1KIPA 5DUBB 1MJ7L 2B5IB 4JO4H 1OTTD 2QEJA 3FB8B 1BM3H 4OQTL 4BFGA 1YPZE 1JWUB 1OLLA 3B2VH 2P42B 4HDIB 4I0PA 2Z31D 2PCPA 4YBLC 2HFEB 4A6YH 4KK6C 3BRDA 2UVEA 5KSBB 5F1IB 5FHBH 5ALBL 1QPXA 4NQDA 1NDGB 4NQCB 4NO0A 1IKFH 3RWCA 4HH9A 4DGYH 4XNYH 1E4KA 4X8JA 4D0DA 4NM8L 2G75B 3H6JA 5KJRL 3DI2B 5EIVA 1MFDL 5IB2A 3GMQB 2JTDA 5DGRA 5J1AA 2AJSH 4M7KH 4U33A 4JM2A 2QBWA 1FAIH 2C4XA 4OD3L 1OSPL 4MD4A 4Y5VC 2GYSA 4NFDA 2VKWA 4P9HL 1UWGH 3GMOA 4WWKA 5CEXA 4GKNB 4JRYE 1SY6H 1VADA 2VC2H 1P6FA 1N5AA 4FQXD 1FFNB 1EJ6A 3D3VA 4Z5RB 2IAMB 3HNSL 5T3XH 1T20A 5ERWB 3V2AR 3HMXA 4U1IB 3BRFA 3HE7B 4F15C 3DURA 2HN7A 3MV7A 4HUXB 4BA8A 4LDLB 3MV8B 2CLRB 5EFIA 3VFMA 3B9AA 3KNBB 3UTTD 1I85C 4B50A 1YYMH 1U8IB 4Y16D 5HDLA 5T1KD 1A6PA 1R3JA 3CFKA 1QD0A 3GBML 3CZFB 3I9GL 5E2UH 1TXKA 4PJBF 1CIUA 4JY5H 3IF1A 3LS5H 4OB5H 4XI5D 1BQHG 3C60D 4YQXL 5GPRA 2DLFL 3N85L 5SX4I 1JRHH 1KTRL 1RV6X 4HT1L 5EU6B 1NGWA 1HSAB 2FEEI 5D7IA 1XF5A 3PABB 5IFHL 3M1BB 1HHIB 2FHBA 4N0FA 1CLZL 4DKFL 4L8SC 3QQ4B 3DIFB 4JVPA 1V7MH 1LO5B 3LZFH 4G8GB 3F7RA 1Q9KB 2OSLB 3T1FB 5TPWL 3P4LA 4OF8A 1PY4A 5IFJB 5IVZB 5C0GB 4XPFH 1I1AD 3T2QA 3O45B 2WLYA 2Y6SD 2DQCL 1OP9A 1DZBA 4HWZB 4WU7A 3WLBA 3O4LD 1G7JA 2NXYC 3SDDB 5J7CC 1LD9A 4JKWA 2XIDA 4AIZA 4U1KA 4JR9L 2I27N 4ZS7H 4WV1B 5GS1B 3V6OC 2VLRE 3JZ7A 4OLZL 1U8KA 3RNKA 1WJ3A 4JHAH 2W60A 3AROA 2QHRL 3WNLA 1P4IL 4N68A 1T0MB 3RTQC 1LDPH 2XZQL 1OAZH 1S9WA 1RZGB 4HKBA 1CGSL 5DJYA 3RZCA 2ZKHH 4JRWA 5BRZD 4PJ8C 4AENB 5I1IL 5EIQA 3BP5B 2DQHH 1B3JA 3GM8A 1QG3A 4Q7DA 4RAVB 1HH6A 3ARTA 1U0QA 4K3HA 3UBXI 1A4KB 1D6VH 1FJ1A 1A7NH 2JCCB 1CFVL 4M6NH 1XIWB 4ELKA 4PGBB 5KZCD 5IIEB 2ZG1A 4HWNA 4MZ3A 4P2YA 3C5ZC 4DCQA 3M17B 5EWIH 1IAOA 1U8JA 1J0ZA 1UCBH 2YD8A 3GSRA 4S1SL 4TN9A 5DJXB 3LV3B 5AAMA 5T3XE 2UY6A 2OI9B 1Z9OA 3A6BH 4KI5E 4P4KD 5GGUB 4MLIA 3VFNA 5ILTH 4K94C 3FFCA 3HG1E 1FLRH 2AEPH 1MPAL 2GJZB 4UB0H 3KYNB 4F8QA 5ITBH 4JDTH 3TBVA 3Q5TA 4JFYA 2GSIB 5D4QA 1HILA 1XZ0B 2YPLB 5E03A 2Z8WC 1U8QB 3QUZA 1HNFA 4QCIB 1ZGLP 2FR4A 1FSKB 2FECL 3LRGA 4X9HA 1HK6A 1L6XA 4OT1H 4PJGE 1NEUA 4U7MA 2BXYA 3LN4B 4L5FH 4NO2B 3T3ME 4APQB 2BJML 3LH2H 1NBQA 1UB6A 2FJFB 1S78D 5HGBA 1F3DH 3ARYA 5E6IA 1CQKA 4JG0L 4GRWF 1ZA3A 1C12B 4AIXA 4HC1A 2R2EA 4AEEA 2XXCB 4HWEL 2D0FA 4K2UL 3E3QE 3BPLC 1JNNH 4P49A 4NN7C 5C0EB 3LMJL 2VLJE 1AHWA 2E27L 1RUML 3QEGL 4PRDA 2IMNA 1L7TL 3MRIA 1GZPB 2EKJA 2XKUA 3X12B 5C0BA 3RX7A 1MCLA 2Z9TA 1WBXA 5EPMA 1S7SA 1RHHA 1YEGH 1UH4A 3S35L 2OL3L 5HVGB 1WZKA 2Y36H 1SJEA 2EE2A 1AGEA 1DBAL 1PZUB 4HUWA 1GHFL 2MQ3A 2FWOB 3AC0A 5F3BB 4DAGH 2APBA 4YIQB 4LVEA 3HR5B 2X6MA 1BX2A 4HMEA 1KJVA 3DVNB 4XPHL 4XVTH 5HHOE 4MNGA 3WN5A 3P3YA 1OGAD 4N90D 1KB5H 4NC0B 5LKNA 2CIKB 2RFXA 4UOW1 2FJHB 1BQLL 4JFQA 3VFWB 4ZFGH 1QA9A 5JPMA 3OTTA 5L6YH 1MCDA 1T22A 1ERNA 5SX5K 3W0WB 3B2VL 3PL6D 2BVOB 1CF8L 3PWLB 5ID1A 5H2BB 3MV9E 2P7TB 1BLNA 1WBZA 4BK4A 1FORL 3MLUL 5EZOH 1YNTA 5HJ3B 1B0RA 1G7PB 1ZT4A 2A6IA 3U0PA 1JPTH 4ZDHB 1HQ4A 4PJHE 4KUCD 4M8QA 2Q7YB 2VQUA 3MYZA 3ZKSD 5EZJA 4MA7L 1F4XH 1EEQA 3IU3B 1LMKA 4TSBL 4NCC1 1FAIL 5ETUA 4ERSH 2DBJA 4YPGA 4CBPA 4GMSH 4F7TB 1UWGL 2Z8SA 5IB5B 1DBBH 2ADGA 5B21A 2KUTA 2P5WA 1YNLH 3QUML 3V0VA 1LNUB 4A2MA 1XEDA 4I4WA 2P8PA 4LSVH 2H8PA 2C7UA 2FX7H 4KRPD 3VWKA 5T3XL 1FVEB 5I17B 3S3PA 4LVHC 4YDJB 3KAAA 1X5YA 5I1AA 1IMHC 4ONOA 3QDME 2A73A 1IKNA 4PREA 4XVSH 1JP5A 2FO4B 2HT4D 1OQXA 3AB0C 3BEWA 1HN1A 4LSRH 4ODTH 5E8DH 3C08H 3IJYA 3ZHLA 4F9LC 4YZFE 1FGNH 3KR3H 4JY5L 3LS5L 3ZT7A 5DD1L 2AI0L 4QHUA 4RQQA 1U3HC 1N5YL 1NLDL 1GPOH 1JRHL 5GGSY 4NM4L 3U36B 1FH5H 4HJJL 1G6RL 3BZFB 4C56E 2FHFA 2VQTA 4PLJC 4NZJA 5C09B 2IWGA 1J10A 3QHFL 1BVKA 3MOBL 4GBXD 3CC5A 3O4OC 4XCEB 5I1JL 5IVOA 4TYUA 5DHVH 4TUOB 3RX5A 1LP9F 3MUGB 3EFFA 3H42H 2M1KA 3QUKB 2J8UA 4LEOB 3REWB 4LLQA 3GMPA 4N1EA 4ZS7L 4GRLB 3UTTE 1FFRA 2QSVA 5K9KA 1A8JH 5E99H 4XXCA 4ZXBB 5F96L 3RVWC 5I76B 1X5XA 2CUMA 1LDPL 1VFBA 5FAAA 1JWMA 1IRAY 1NEZB 1WWCA 4UUJA 1IGFL 1ADQA 5E08L 5L88H 4X7CC 4OFVA 4NNXB 4PV9A 3HAEA 2EE3A 4C83A 1XCTB 4LU5H 5IP4A 4Q2ZA 4YGVB 1YY8B 3VD7A 5DQJA 5I16B 2PO6C 4YXKL 4Z7VB 1QLEH 4NZTL 4ZOEA 5KSVA 3P9WB 3FCTB 1A3QA 3GEWB 2DJSA 1XCQB 4H1LB 5CBEA 3SDAD 2XG4A 3NAAL 3OKKA 4I0KA 5D7SH 5HDBF 4LNRB 5CGYC 1UCBL 3L3DA 3QXTA 4Z76A 4K23L 5C0JA 4NUJB 4P5TB 4YFLI 2PNDA 3C6LA 4NQUA 1KJ3L 3FO1A 4JFOA 3TJHD 3IDNB 2GI7A 4HUKB 2YUZA 5GJTL 2DLEA 2IBZX 5L9DH 1KFAH 3CVHA 1NSNH 2V2XB 3CDFA 3X14A 4MA1B 3OKEA 4OD2B 4G7VH 5ITBL 1AE6H 1UXWA 5IOPB 3E0GA 1MCKA 4L4TB 1HZHH 2ICWB 4KRLB 5CCKH 5CJQL 2GCYA 2ARJA 3QIBC 4LNVA 4Y4KC 3INUL 4PPTA 4M6OH 3TA3C 4OT1L 3W39B 1SYSB 4BUGA 1WCBA 4HGWB 2YWZA 4KK9C 2CR6A 2NY0B 3REVA 1ZTXH 3QCTH 3HI5H 1YEJL 4GAYA 4JVWA 2DWEB 3SBWA 3VXME 3SE8H 2R56L 4QT5A 3WSQH 5DFVC 4HIHB 5J13B 2ATPB 1L0QA 2EECA 3GSNA 4XC3H 1YN7B 5CZVH 32C2A 4ODHH 4F80A 1Y18B 2UZXB 4JPVH 5KSAC 5SWSB 1R5WA 1UADC 1CLCA 2K1MA 4RBPK 4Z6AT 2VAAB 3BN9C 1D5BA 2NY3B 3JTSA 3BSZL 3DYMA 5D5ME 3WKMH 1RVFL 3O6KH 4U05A 1EGJL 4QNPE 3M07A 5KVDH 1BFOA 2F53D 4ALAL 4CL7A 4HH8A 2IH1B 1RJYA 5D2NA 3TBYB 1AY1L 1RUAL 4W4OA 2EDLA 1KEML 1UKTA 5ACZA 3G6JE 3AU1A 3ET9F 3FO2B 4ZO6A 3NH7H 4RX4D 4RFNB 1J0IA 3WHXB 4F57H 2FGWL 2B1HL 2HA1A 4U31A 4HCRH 1HXMA 5EU5B 4NBZB 4PJBB 1IAIH 1JGLH 3U82B 1M4KA 1IGJA 4EDWH 2XZAH 4LCCC 3LKSB 2HLFC 3BIKB 1QLFB 3WXWL 1WICA 1KLFA 2EE9A 5IGXH 1G7MB 4MA3B 1F58H 3BIAX 5D7JC 4JRXA 4PJ9B 4WW2C 3KLDA 1OPGL 2WBJB 5EBMB 1U93A 1BJ8A 4P3CH 4MVBD 1S7VB 1CE6B 1KCUL 1Z3GH 1W72H 1KPVA 4M02A 1IC5L 2XWJA 5DJ8A 1FFPA 1JPTL 2MFNA 4KI5C 5HTSA 3GJFH 4EQ2A 5FGRA 4XVUD 3PJSB 3BDYH 4D0CA 1RZFH 1I9JL 2AABH 3L7EA 3QJFB 3BKCH 3VXNA 2HLAA 2Y9RT 3NIDE 4PJ5B 5TE6L 3WUWA 1FG2A 4S1QH 4AQOA 2ZP0T 3HI1A 4ERSL 4GMSL 2XRAH 1YNKL 2OR7A 3ISWA 1QSFD 1MHPL 4YHLH 4WI9A 4Z77B 5EOTB 5EO0A 1OGAE 1X5HA 4P2QA 3CFBA 4HIJA 3H3BC 4AH2A 1PYWB 4Y5XA 1GIGH 1RURH 4MAUH 2BMKA 1KCVH 2O5XH 3TH3T 4XPBL 3WO4C 5I1DB 4NQXA 3O6FC 2F8XC 4H88H 4NSKA 3MJGX 3SPVB 3T09A 3VD3A 1NAKL 2JK5B 2NLJB 2C9AA 3A6CH 1JNJA 1RIHL 4LSRL 1BWWA 5CP7A 5GRWA 1YY9C 4PJ7A 3QO0A 4NQEB 4OZ4A 4YDVA 3LEXB 1NGYB 1P6AB 4GW1A 3U2SA 5JNYB 3T8XB 1E6OH 1XMWA 4JCLA 1QYGL 5KSUB 3R1GH 1T04B 5C0AD 2Y06H 4Q74A 4Z7UE 3NBNA 1FH5L 1FYTE 3D85A 2BOCB 5IW6A 4G9FE 3V5KA 3FMGH 5EIIB 5J11C 1Q9WB 3EIFA 1F3DJ 1CGXA 2BNQA 2BHZA 1VSCA 3IFPA 4OIIH 2A74A 3DTXB 4EN3D 2R69L 1CU4H 2CUIA 1TQBC 2X4PA 3KPLA 4RGOH 4UT9H 3PUCA 2I60H 3OV6A 3QHTC 4UMGA 2CKBB 1IEAA 2GTZB 1BD2B 3IT8D 4BH7B 5J57B 5DRNB 1P9MA 2AJUH 2F58L 4YUEH 2NYYD 5EBLB 3I02A 5JW4N 5E99L 1IAIM 1F00I 3MA7B 1YYLH 4ZQKB 4GRWB 3U1SL 4PJIA 4KMLB 3CPLA 4KZEH 1HCFX 5J9PB 3HMWL 4EIGB 3NABL 3EYQC 5ALCH 3MYJB 1A3LL 2X4OA 2GJ6D 2XKSA 3QUYC 4EUPH 2ESVA 1ROWA 5D1QC 5E9DB 5F6HJ 2DLTA 1U36A 4NO5B 2R4SL 5IB3B 1JFQH 3L7FB 3BHBB 1UWXK 1CFTA 3OKNA 5MHSE 1KN2H 4ZNEE 5E1AB 3QAZC 1T2JA 1AO7B 1IGCL 4NHUA 4YBLB 4FQQA 4R97C 4BFEA 1EUUA 3WIHL 1NC2D 1KYOJ 1ORSA 4XNMB 1OTTC 1KNOB 4WHDA 1KN4H 3LDBC 1FHGA 4Y4FB 2ZJSH 2ZWLT 3VE0B 3UXFA 2YBRB 2A6DA 4ZAKB 4FMKA 4Q6IA 5E2WH 2A0LC 3TWCL 1S9XA 4MB5A 4QWWD 5FUOH 2WUCL 3HN3A 3EFDH 3JVGA 4LLVB 4Y5VB 3HRZA 1NSNL 1V7NH 1MJ8L 3TGXA 1KCKA 2WUBL 1MCCA 4IIQA 5A2FA 2EYRB 4CVWA 4Q9RL 5B38G 4LF3A 1HZHL 2D9QB 5CCKL 3KXFD 1A5FH 3MACH 2PYFA 4CN1A 1L0YA 1FL6B 2H32H 5CS7A 3O2DH 5IQ7L 1UM4H 1I8LC 3MRHA 1I3RB 4L8BA 4XX1G 5FM4A 3IFOA 4HLJA 3QZWA 4GLRH 4HXBL 3TBTB 3PV7A 3FT2A 1N26A 4HZLA 3QI9A 3SE8L 4WJ5B 1M6OB 4FQXC 1NL0H 5CZVL 2IAND 2OTUA 4JPVL 1NC4D 4P23C 2VZVA 4GO6B 3D0LA 1OQOA 7FABL 3DX8A 2W0KA 1OHQA 2XY2A 4PRHE 4IRZH 3QEUA 2PW2B 4Y16C 3SCMA 1SJHA 3EYUL 2BVTA 2R2BA 4WW2F 4Z78B 4L8SB 5TQ2L 3RY6A 5FUZH 4ZFFB 3F7YA 3PGCA 1MREH 4BQ8A 3GIZL 1HNGA 2VZSA 4XI5C 1W0VB 3NH7L 5FOJA 5M7QA 2OXGA 5BV7B 4HCRL 4LMQE 4I2XB 2NXYB 4G8FB 4ONHB 5FV2A 5JOEA 3G5VA 1JGLL 3STLB 4R4BA 3EGSB 1VEOA 1HOCA 4AEHL 1GGUA 5DC9B 3VGEA 2BSSA 4C54A 1WSST 3SE3C 4ZFZA 4EOWL 1OSZB 3DMMC 2H26B 1GGIL 3IDMA 3SDXA 1T89A 3ESVF 5IGXL 1DLFH 3P4NB 3RGVC 3RTQB 3E1F1 1DQJB 5DJAA 5D8JL 4M03A 5JW5B 2Y6SC 2GAZA 4BELD 2GT9B 3PQYD 3NZ8A 3P0YH 3ARDA 2ZPKL 2AQ2A 1Z3GL 3HCVA 3T3MF 3UAJD 1JZ6A 3MLXH 4QF1B 3T2NH 3LB6D 1W72L 3I75B 1A4JB 4R7NA 3ARGA 3TYGH 1LP9B 1MEXL 3LSOA 2BNRD 1A7QH 3QNYA 1TCRA 2N4IA 3MODH 4J2XA 2AABL 4PJCE 3K4ZA 1P84K 3BKCL 2X9WA 3HPJA 4S1QL 3RWIB 3RDTD 4RMRA 1IILE 2XWBB 4IS6A 4JDZA 4WI6A 5DEGB 3C5ZB 1OCWH 4YHLL 1ONQA 1MVUA 1DVFA 4DOHB 3V9FA 1FVCA 3B83A 2GSGA 3TO4A 2ZG3A 1E4XL 1MNUH 2DD8L 2EZ0D 3DVGB 4KMTH 1HHJA 3SJVB 2DLIA 1FPTH 1GIGL 4Y1AD 2ADJA 1TPXB 5E6ZA 3O3EA 2C3XA 1UA6H 5LXGH 1DBKL 4MQ7B 1MCPL 4J7RA 3FT4B 1J8HA 4QXGL 3QPQD 1FNGB 4OZGA 5ISZD 2VISA 1FNEA 4WHCA 4PGCB 1AI1H 4XWOD 1X5GA 1A0QH 3PWJB 4RAUA 4ZYKA 4Z7WA 4M9OA 3GK8L 1AD9B 3PWPE 1V3KA 2HH0L 4DKEH 1E6OL 3IXAB 2AXGA 1CR9H 3IDXL 4D9LH 3FMGL 1BEYL 5EBWB 1T21B 3TBSA 1QSFE 4BJLA 5KS9E 3Q5YA 5EDXA 5IB4A 4QEGA 5LAXB 4BM7A 4ODUA 4PJHF 5EO9B 3DRTB 4MLSA 1QO3B 2I60L 2NY4D 1UJ3A 4LIQL 4L4VE 4XVJH 3QA3B 4GH7B 5HHXL 1DQLL 2CGRH 1S78C 3FRPA 1JWSB 1I9IL 1L9NA 1C08A 4X83A 4E42B 3V6ZA 2AJUL 4XB8A 3EYVA 2A6JB 1ITCA 2ITDA 4YUEL 4YHYB 1UJTA 3QEHA 3GBLA 3GSXB 1KB9K 5FK9B 4HFWB 4LEXH 3DV4A 4GUPB 4R0LB 1NFDF 1F2XK 2B2XH 5ALCL 1CTNA 1MRFL 3QFJA 3EUUA 2G9HB 3ZTJG 5AYQA 4NKDA 2X4QA 2VDRL 5D6CA 5GS2H 5HY9B 3FB6A 5HD8C 2LTQC 1VCAA 2CLZB 1JVKA 3IXTB 1ZLWH 3CXDL 1RIVL 5IQ9B 2YPKB 1QEWB 4YZFF 5KANI 3I85A 3B6SB 2Y07L 4OCYH 4MSWA 1QLRA 3VDAA 3IGAA 4WENB 1QHPA 3ULUD 4YC2C 2RIKA 4UT6L 4FNLH 1CL7L 2XNAB 1J1OH 4U0RC 3VFUA 5E2WL 4YXLH 3O8XD 3PL6C 4GXVL 2AV7B 3KPSD 1DE4A 2D2OA 1K85A 1A6AA 1IM9B 3ARED 3RWGB 2O93L 1YUHB 3P9MA 1VKXA 3EFDL 3MRBA 3BJ91 3BP7A 2MCPL 5IB1A 5ESAA 3O0RL 2OQJB 4I5BB 4IRJB 4YBQC 5D2LB 3FONA 2AP2A 5KOMC 4M3KB 2OZ4H 3DXAE 4N5ED 4Z95H 4Y7MA 5B22A 1A7PH 1T7XA 1UM4L 1S7XA 3DUUA 3U7WL 1H5BA 1JHKL 3FJTA 5K33A 1U92B 1IQWL 4UI2A 4FQHB 2NCMA 1MUJB 4RNRA 5JHDD 2QHLA 5IV2B 1ACZA 1JV5A 1DUZB 2RHEA 3JUZA 2Z35A 1WQVT 1NL0L 2XTJE 3NTCH 4LKXB 5I1LA 3QIWA 4NCDA 5E2TH 1VEPA 2R2HB 4KRPC 1EHLH 4YEFA 1CXHA 2VLKB 2E7MA 4LHUB 3RI5K 2N7BA 1MWAA 2YMXH 4OQTA 5F70A 5GGVY 2NY1D 4GKSB 4L4JA 3BKML 4HKJB 2QQLH 4IRZL 4LVOC 1BOGA 2HT4C 4E41A 2M8XA 4U4BA 2FZ3B 1MQKH 3AM8A 2CPCA 5FUZL 4PRPE 1IAMA 5DYOB 3ZT6A 5JHLL 1FNFA 1TMCB 3QDJA 1P7HL 5CKGA 1N4XH 5F7YC 1K3ZA 2VIRB 1NCBL 2ILLA 1CT8B 2C1PA 5FO7B 4RMWA 3L5XL 4QY8A 1WZMA 5IVXE 1R0AL 2Z91B 5GRUL 3T1WA 2FLRT 4OQ1A 4GBXC 3CLEH 4ISVB 1DLFL 4XBEL 5DD5H 2DM2A 1CGYA 4HKXA 4TNWK 1MHCB 3AXLB 2V2WB 5H8DA 3TCXA 4UIKL 1AKJB 3P0YL 3FQUB 3DROB 3O2WL 3J8F7 2V5MA 4HMCA 5DK2B 1FVDB 4NZRH 1OWWA 1IEBA 4CMHC 4MNQE 1JN6A 2CXGA 4ORZC 2Z92A 2HJKA 1LEIB 2PTUA 5BMFH 4QO1A 2H6PA 1NBZA 2I07A 2WIIB 3TYGL 4F7CB 5KBNC 3H7LA 3MODL 4FXGB 3S4SB 2VABA 3BKYH 2EDQA 4L3EE 4KAQL 4JRYB 4DEPC 3QJHA 1ORQA 3I6LD 4QOKA 4QNPF 3KG5A 3P73A 2LVEA 2HRPL 4ETQA 3GMLB 4TRPH 2OYPA 3BT2H 1MNUL 1YEEH 5HDQH 4CVXA 3G6JF 1JUFA 2KL6A 4E9LA 1ZHKA 3R4DA 2JF1A 3QULB 3TN0A 3WS3A 5DVOA 4DZ8B 4UTBL 1P7QD 3W2DL 2BSTB 3KPNB 1R3KB 2VE6A 3Q1SH 1C8PA 4HUMB 2BVPA 4Y4KB 1JHTB 4H0HB 3TA3B 5KG9A 3H9SE 1C16B 3KPMA 3W9DB 4FG6D 1EK3A 3RNQB 1I7ZB 3LKOB 5FKAA 1YEHL 5DVNA 1TJGH 3BH8A 1CR9L 3TZVA 5IMLB 3BMWA 5A3ID 5EULV 2HFFB 4EIZC 4PTTA 2OL3B 1K2DB 1R5VA 1FZKA 1EXUB 2F19H 5AUMA 4P59H 2NW2B 3BE1H 4UBDD 5KVMC 3HZYB 4HMDA 4IMLB 2Q76A 5DUBA 3GHEL 3JWNC 4PIRF 2MKLC 1WCQA 2HP4A 1YECH 4XVJL 3S96A 2Q6WB 3NIDF 3JV5A 3NPSC 3AVEA 2VLRB 1IBGH 4HDIA 2QSQA 4BSJA 2OLDA 5ISZE 3RVVD 5L2KE 2NY6B 1U58B 5E00B 3TPUA 4A6YB 4LEXL 1YEKL 3LRHA 3TLRA 5F1IA 3GMRA 1F4HA 4XMPH 4DKDC 1AGDB 1NDGA 4WDIB 4NQCA 2UZYB 5M95B 3LN5B 2BRQA 3U4BL 1RZJL 4PBXA 5CJBA 1JBJA 2HMID 2F54E 4LCCB 2G75A 2P5EA 3IDJB 1LO2H 4UDUB 4JM2D 4X7TB 3T65A 5B8CA 1M7DA 3X11A 4FQ1H 2IH3A 3X3FH 4LCUB 5TE4L 4BSVB 5JXEC 1HXYA 4WW2B 1K8IB 3I84A 3E6HB 3SGEI 2LQRA 1XGRB 1FFNA 4Z5RA 3D3VD 3CH8A 4KDWA 2FX8L 1G9MH 4CJ0A 5LBSH 5ERWA 4S11A 5JOFB 4Z7UF 1WC7B 1A6VH 3HE7A 3GSOA 1IGTB 4JZJC 5TH2B 3MV7D 3VWJA 1LEGB 3MV8A 2CLRA 2J6EA 4AYFA 3LVEA 3HG1B 2W0LA 4U1MB 3KNBA 3TV3H 4I48B 1U8IA 1IT9H 4K8RH 2EC9T 4K7FB 3DECA 4MVBC 4AG4H 5EN2B 1RFDH 1KTKE 4KJQD 3QDHA 3FB7A 2NX5B 1KCSL 3GSQA 4MDJA 4XT1C 3S8WA 2YD9A 4PP2B 2Z4QB 2XICA 4JN1H 2XKNB 4Z95L 1A9BA 5EU6A 5FO9B 1HSAA 1YEFH 4KKCD 3WFZA 3V79C 3GSWA 3PABA 3M1BA 4I77L 1HHIA 5FA4B 3WO4B 3O6FB 4ZUVB 4MMXC 1LO5A 5IR1A 4G8GA 1PSKH 1VGKB 4D9RE 1JI2A 2QV2A 2VAJA 5GZOC 5IVZA 3O45A 1R3HA 5TQ0L 3O2VH 2VMFA 3DNKA 3MLSH 2VLJB 1EA9C 4QKXB 2OK0H 3KPQB 2B1AL 3SDYL 5GS1A 1ETZB 2R4RH 4J6RL 2YMXL 3KPSE 4ETYA 4M00A 2ZCHL 1ES0B 1CICB 2EO9A 4CU7A 5J11B 1T0MA 4JKPH 4JO2L 1DN0B 1RZGA 4M1CC 3VG9C 3K74B 3RZCD 4AENA 5HHOB 1TQBB 2Y5TA 3RUGE 1N4XL 4PUBH 5SWZE 1IC7H 1I8IB 5C2BH 3DO7A 4CVZA 1J1PL 4OJFH 3MLTA 3SOBL 2MPAL 2VL5B 4RAVA 2ORBH 1T83A 1A4KA 4LCWD 1RJLB 2QJDA 5JHDE 4JO1H 3WJLA 1T7ZA 4KZDL 4PGBA 3IRZA 3MV9B 5IIEA 3CLEL 2L7UA 3M17A 5DD5L 4EN3C 3P30L 2R9HC 2BC4B 2EDTA 4MAYD 1EX0A 4HULB 1UEMA 4I1NB 4DN3L 1A6ZB 5DJXA 3DV6B 5GS0D 2SEBB 3QUYB 5F7LB 4JQVA 4PJHB 4OAWA 5CJXA 5IW1B 3OL2A 4G6KL 1FC2D 2VNCA 2NYYC 3FFCD 1RJCA 5BMFL 5B39A 1BJ1H 4XPTL 5TDNA 5B3JF 3BKYL 1NEZG 5IMOB 5JOPE 3EYOA 3QAZB 3K1DA 1XZ0A 2YPLA 3MCKB 4R97B 1U8QA 4ZOAA 3GB7A 5D70H 5F3HB 1U8PB 4ZPTA 4Y5YC 1NFDB 2R1XB 3LDBB 3LN4A 1WISA 4FTVA 3ARUA 4FA8A 3WXVH 2DN7A 4APQA 1NMCC 4ODXB 3QDAA 4H1LG 4LRNH 5A16B 5JDJA 2AERT 1T1XA 2FJFA 2DQIH 1MCOH 3RWHA 4IOSD 1L6ZA 4O2EB 5E6ID 1U8NB 3QDMB 4XX1E 1DSFL 1C12A 1BZ9B 3D39D 5J06A 3V6FB 2XTJC 5CSBA 4UTAL 3AS0A 3LRSB 3JV4B 3RPIA 2H9GA 3N1QC 4HHAB 4PP1C 1YDPA 3BZEB 1CK0L 1HWHB 2HFGH 4XCNA 3C2AH 1EEZB 2EDYA 3EJYD 5C0BD 4WU5B 3RA7L 4C56B 2FL5B 4TULH 2VR5A 1MAMH 3VGHA 3ECBA 1BIIA 2FB4H 4WGVB 5C9JB 5KW9H 2F19L 1FDLL 2FWOA 3EO9H 4P59L 4FQXB 4QHKJ 3KYKL 3BE1L 4FOMA 3HR5A 3OG6B 2GKIA 3MLYH 5ICZB 5CGMA 2YXFA 3SDCD 1JJUA 2NY5H 4P23B 4LSPH 3ULUL 3HMXH 2UUDK 4JB9L 1KB5B 5TDOB 1I7UB 3P0VH 3SGJC 2FJHA 1YECL 4PJCF 4PJAB 2UY7A 2HKHL 5BS0A 1T4KA 3FO9B 4NQTA 5DJ6B 1IM3B 4G43B 3W0WA 1IBGL 5T1KB 5H2BA 3WFBL 2P7TA 3MMEB 1P1ZB 1VGEH 2BSRB 1FNSH 3PHQB 3FRUA 5LG1A 1IFHH 1A1OA 3TPKA 4U1HB 5HJ3A 2WNGA 3RL1B 3KPTA 3U46A 4XMPL 2Y72A 4JREC 3UTSD 4K07A 2X70B 1PG7X 3WDIA 1S7TB 4OCSH 1MY7A 3NA9H 3IU3A 2EICA 4IRSC 2I9TB 2DTMH 4WTZG 4WNQA 3WFHB 3L5HA 1QSVA 3DMMB 4OIBA 2GTWB 1M05B 3RGVB 5IB5A 2XZCH 3EHBC 1TETL 1VFUA 4K3EH 4N0UE 2P5WD 1OAUL 1WEJH 3LEVH 3SGDI 3T3PE 1LNUA 2YN5A 5DMYA 2HT2D 1QR1B 1KENL 2BVQB 3OKLB 5EZIH 3GRWH 3K46A 5D1XB 4K7PY 1FVEA 4X80H 1DEEB 4JEGB 1J87A 5H94B 4YDJA 4RFEB 2WZPD 3QFDB 3TESA 2F5AH 4PLKD 3EOYG 4M1DH 5HGDB 4E5XB 3TV3L 5DK0B 5KS9F 3DHJA 2FO4A 2Z31A 3QNXA 3AS3A 3AMLA 3CD4A 5FGBC 5CWSA 4NQDE 3UAJC 1V05A 2YA0A 5D9SB 4OSUL 4LSTH 4WO4B 2AXJA 4Y2DD 4JN1L 3VDCA 1LK3L 1T5XB 2MTPA 3U36A 1NJ9B 1NBYB 3VXMB 4U1LA 2HVKA 2XACC 4TVPH 3RDTC 3H3PL 4I13B 5HBBA 4LSSH 1UXSB 4XCEA 4P2RE 1TZHB 1YJDL 4TUOA 1UKQA 3BDBA 5DHVB 4D3CH 4KKLC 5CMAA 4I9WD 4JFPB 3QUKA 4LEOA 3REWA 1AQKH 3ULSA 4HX1B 4GRLA 2FEDD 1ACYH 2XN9E 4P3WA 3G6JB 2E9WA 3QPQC 4YHPB 4ZXBA 4HIEB 5I76A 4H26A 2FEEL 4PG9B 5C2UB 2W65B 4UT7H 4LVNC 3BUYA 5C0IB 4Z9KB 4XWOC 1QRNE 3UO1L 2P8LA 3C60A 3QH3B 4NNXA 1TENA 4PUBL 5DMIH 1IC7L 5C2BL 5I18H 1CFQA 4YGVA 1KIRA 1QBBA 3MRDB 4Z7VA 2BRRL 1KC5H 1X44A 3F7PC 4FQCH 4FFYL 4HC1H 3BKJH 2V2TB 1NDMB 4KPHL 4LBEA 4E0RA 1XCQA 3QRFM 3K2UL 3KPPB 2IGFH 1D5XB 5T1MA 4LNRA 3CFEB 4HK3J 2FBJL 1I1AA 1KXTB 3D6GA 5CIPA 5EC1B 4NUJA 4I18A 3TO2B 2NNAB 3NFNA 2HJLB 1QFWI 5BW7A 5F1NB 3IDNA 1OF2B 1BPVA 1K5NB 2LTQB 1CDGA 5CBAA 2B4CL 3WDJA 1PBYA 3MRMB 1P4LB 4WFEE 2V2XA 3TBWA 1W8OA 3BAEH 5IOPA 1FCGA 2YKLH 5JZ7D 1JZ8A 5I66B 3GSUB 5D70L 4NJ9H 1JTPA 5F9DC 5EU3B 5CP3H 3U7AA 1SYSA 1DQDH 3OAZH 2YEZA 4HGWA 2YUVA 1B90A 1XAUA 5ENWB 1K6QL 1YA5A 3UTZB 1BFVH 2DWEA 3HZKB 4TNVF 2DQIL 3PL6B 3F7VB 2LE9A 4LLUB 4TVPE 4Z8FH 5I74C 4HIHA 3NMEA 2ATPA 1YN7A 1UKSA 4X99A 4DUXA 3VA6A 5E8PB 1Y18A 4HS3B 5SWSA 1CD1B 1A14L 1NUDA 3VXTB 2VAAA 1I75A 1RU9L 1SQ2N 1Q1JH 4NFBA 4KJWD 2IQ9H 4PRAA 2G5BB 2HFGL 5IVXF 4X9BA 3CLFL 3CDGA 3L3HB 5JPNB 1OL0A 3O8XC 4FZ8H 4P4KA 5L2JA 1LO3H 3U0TA 4Z7UB 3AREC 1FYTB 3HRPA 4HS6B 3ULVH 4G9FB 2EC8A 2D7NA 2NMSA 2EDBA 5FHAH 1T03H 4OLXH 4P5MB 3V0AC 1EVTC 4JGJA 1S5HB 4PJDE 3NCYP 4X98B 3EO9L 1U8MB 1ND0B 2BOBB 4KROD 4N5EC 3MLYL 4JQXA 3B2UD 4NUGL 4WI5A 2VZ3A 5EU5A 3RL2A 3MREB 4KRPB 3V0WL 3HZVA 4LSPL 5DJCA 5BCAA 1KT2B 1E4WL 3HPLB 3BIKA 4HS8H 5J12C 1MAKA 4PB9L 4IDJL 2FJGB 5IEHA 1LEKA 1M71B 1CXLA 1G7MA 1SYVB 4MA3A 3PDOA 1YEIH 4F58L 4L9LB 4QRTB 1EBAA 1I4FA 1I7TB 4JRXD 4PJ9A 3G6DL 5EBMA 2YK1L 3MLRL 4M5YH 4MCYA 4ODWA 4PRNB 3RWJA 5E2JA 5D1ZB 1DQTA 1J1XH 1OP3K 1W72B 2EEDA 5JIHA 5SV4A 2FH8A 4XBGB 1KLUB 4NC1C 2CK0L 1I1CA 1IGML 4XP6H 3EDKA 4G9DB 6CGTA 1WUNT 4AL8L 1TITA 3GJFB 5C0BE 2NY1C 3BD3A 3UMTA 4NNPL 2HRLA 3RWEB 2VXTH 1FO0A 1H3UA 4PJ5A 5DR5L 5F1KC 2DTML 4JLRB 4K8RC 3HE6C 4MJ6B 4I3GA 5EC2B 4GBXB 3L3OB 2XZCL 5A2IH 4Z77A 1C7TA 1VPOL 1BP3B 1T3FA 4M7ZB 4P2QD 1WWBX 2ZUXA 3TNNA 5J1TC 4TQEL 4HFUH 1CQYA 3BVNB 4XP5L 4CMHB 1NUNB 3VXOB 1KV3A 1RMFH 4X80L 4RCAA 4Q58C 4MZ2A 3LEYL 3SPVA 5EORL 2OTPA 4ZUWA 1BJ1J 1I8KB 3HFML 4KVNH 4U49A 1KIUA 3C5SB 3GO1H 2Z8VC 2AJYH 4DEPB 2VTFA 4G42A 2AEWA 4MXQD 1I9RL 4O9HL 1YJDC 4UINH 5GRYA 1ZSDB 4PYHA 3RIFK 3HAEH 3MJ9A 1A6UH 4GG8B 1C5BL 3T8XA 3DHMA 1NH6A 4M7JH 4P57B 4OF7A 3IDUA 5C0CD 1H8SA 1MFCL 1XGYH 1U95A 2X4TB 2BOCA 3VJ6A 2ICWI 3DSNA 3ULVE 5EIIA 4U6TA 4XH2A 2RR3A 1OVZA 2C5DC 2BNQD 2L0DA 3K3QA 1TTUA 3L3JB 1DEDA 1LDSA 3DTXA 1F6AB 3IDGB 1JE6A 4M4RA 1A9EB 3V95A 1II4E 4R90H 5IK3A 5GS0L 4D3CL 2WM0A 5F88A 3V7AG 3SE4A 5DD0L 4X5XA 1AQKL 5DRNA 3WE6A 3OKDA 2YPVH 5CINH 3WNMA 4PRHB 1GL4B 3KYMB 1OP5H 5EBLA 3MA9L 1AXTH 3MLVL 4HWBA 1J0YA 3MA7A 4QRUB 5MI0C 5E24E 4YGAB 4Z7NE 4PJEE 3CVIH 5TF0A 3JWOL 1CFSA 2D7PA 3E8UH 2ESVD 5K9QG 5E9DA 4XNZC 3NFSH 4KDTC 1WIOA 4QTIH 2X4RA 1BECA 4NO5A 5IB3A 4RGND 3LPFA 2R8SH 1C7SA 4LHJB 2B4CC 5A3IC 2X41A 2IJ0C 3NPSB 3L7FA 4U1NB 1D5ZB 1IAKB 1QP1A 3BHBA 5LGHL 1AXIB 2Y7QA 4LKCB 4FQCL 4NFCA 4HC1L 4JZNB 3PP3K 2FCBA 1AO7A 2W9LA 4UBDC 1NCWL 1CDUA 1QVOA 3MGOA 2EIDA 1A6WH 2O5ZH 4N5UA 3QG6A 4XNMA 1W0WB 3F5WB 1KNOA 3OAUH 4Y4FA 4G6AC 3VE0A 2BY0A 2YBRA 4ZAKA 5B4MD 5DTFB 5F7DB 2EXWD 4QRSB 4I0PC 4PJCB 4NPYA 4LLVA 5BZDB 4PYGA 3UJTH 5IBTH 4XAWL 1SM3L 1RIUH 2EYRA 4G6MH 2YKLL 1WWAX 3QXAA 5GSVB 3KDMB 5K59E 5E5MB 2ICEB 4LFHG 4X7EC 1INEH 1XF4A 2H32B 2HMIC 3I6KB 4NN5B 3T0EA 3CSYB 1I3RA 4XC1H 2D7TL 3TBTA 2R0ZH 3LAFA 4JM2C 4JZJB 5DUPH 4ZUUB 3HUJA 2X1PA 2JIXB 4WWKC 4YHKL 3OJDB 1M6OA 2P47B 4ELMB 4ENED 1TDQA 3SDAA 4J23A 2L7JA 3MC0A 3QUXC 2PF6A 3TFKD 4X6DE 5I8KH 3RUGF 1H15A 3ILQD 2F5BH 2NY5C 4ZTOH 2I25N 5I30H 3CU1A 3TJEL 3PWPB 4OLYH 2BSED 4N0RA 5ICYB 4FZ8L 4LASL 1LO3L 3ZTNL 3SCMD 3STBA 4HQQH 2W1NA 4ZFFA 4K7PL 3LKQB 4KJQC 1QSFB 4NO3A 3VXRA 1W0VA 2CIIB 5KS9B 5I71B 4JGMA 4MA8H 3IS0X 3PHOB 3CX5K 4HUUB 4I2XA 5CEZH 4G8FA 3ZE0E 4L4VB 4KKCC 4LARL 3WEXB 2O5YH 1A3RH 3PP4L 4OLEA 5FECA 1K8DA 3OKMA 2PR4L 3TIDA 2NXZD 1OSZA 1WZ1L 3D18A 1PG7H 1JZ4A 3P4NA 2GITA 4TUKH 5JW5A 5FV1L 3L1OH 3ARDD 4M5YL 2VR4A 2YD6A 4FQJL 4QF1A 4HEPG 2R0KL 4LSQH 5I73C 2V17H 5D2NE 4RRPG 3ARGD 5JDSB 4XP6L 1UCTA 2P43B 2D7QA 1BHGA 4XNUL 2IPKB 1JMZA 3PIQB 3OJVC 4Q9CA 4ZUTB 1ODAA 4X9GA 4WCYH 1X7QB 2XWBA 3VXQA 3IB4A 3MRNA 5DEGA 3C5ZA 1N64H 3RZCC 5C8JB 2A1WH 4BZ1H 5GZNC 3WD5H 2PTTB 4HUNB 1CG9B 3PNWB 5I19L 4HFUL 3SJVA 4MDIA 2AKRB 1AXSB 3HNTH 2HT3D 2CDEB 3OQ3B 3UYRH 1UVQA 1YMHA 1ZHLB 4MQ7A 1U8OB 4JRXE 3LHPL 3B8SA 1A22B 3FT4A 4OCRL 5HYSA 2C3GA 2PTVA 3GO1L 1JF1B 5J1SC 2AJYL 4OCNC 5MERB 3ARFC 5GS0C 5HGAB 3WFEH 3BQUB 3UJJL 1ADQL 4OFYD 3DXAB 3H9HA 4P2OB 4TUJA 1AIFA 4Y5YB 1AD9A 4ZS6D 3BD5A 5JO5A 2JB5H 4M7JL 1NMCB 2DYPB 3E2HC 3C2SA 3PGDB 5FFLA 3D0VB 1XGYL 4C55A 1CLYL 4OD1H 5DO2C 1NGPH 4H20L 3FO0L 5EBWA 4OCWH 2P48B 1PLGH 5DEZA 1T21A 3QUZC 4RGMC 4J3WA 3JWOC 1NC2B 2XTJB 5LAXA 1AJ7H 4P2QE 3AFLA 5EO9A 2GFBB 3BJLA 3JTTB 5FCSH 1QO3A 5CEZE 3MGTA 3QA3A 2XY1A 3F58L 4PS4L 3EO1B 4ODVH 4C59B 1JWSA 3QDGB 4MJID 4E42A 3R0MA 5IMMA 2EDNA 4K3JH 2DQGH 3VFSA 2A6JA 5EO1A 2JB6A 2QLVB 3BGMB 4NP4H 3CVHL 5FK9A 1ZVSB 3HNVL 1AXTL 3T3PF 4HFWA 4PRPB 3U30C 4PGJA 1JMXA 4PJ7E 4GUPA 4R0LA 5FYLH 3VGBA 5DK3A 1BJMA 4KTEH 2G9HA 2EDJA 3LQAH 3BPNC 3EJYC 4KXZI 4JFHE 3BW9B 3NFSL 3OJ2C 2R8SL 1X6NA 5C0AA 5I1KH 5IVXB 2ID5A 3IXTA 3P9LA 3U79A 3FOLB 3NIGE 5IQ9A 5TJWK 2YPKA 1RUPH 3GMNB 5H35B 4CN6A 3GSNL 4MQXD 3AS1A 3VFVB 1A7OL 3RWFA 1DP0A 4HEME 3WNKA 5IESH 3WN5C 1GAFH 1KG0A 3VFPB 3IVKB 43CAA 2O5ZL 3X3GH 1FL3B 4JFEE 4MD0A 3WL9B 4JM2F 4JREB 5HHMD 5ABDE 3TT1H 4KU1A 4N8VB 1QR4A 3OAUL 4MNQB 2Q8AH 5LQBL 3ARVA 5BO1L 2AV7A 2H3NA 4IRSB 1IM9A 2ZOLB 3RWGA 3WNOA 2AXFB 1BF2A 2A77L 3LPWA 1YUHA 4L3EB 4EBQH 5FYJU 1DQMH 3SKOA 1A1NB 2P24B 4TPRL 3UJTL 1W0YT 3M8OL 5KVGL 4PJIE 3PV6B 1KBGH 5J3HD 2PYEE 2OQJA 4IRJA 1RK0B 3FQTB 1V5JA 5D2LA 1PEZA 1MRCH 5FYKU 3ZKND 4G7YH 2CD0A 2ESVE 2BFVL 3WUZA 4X7SH 1JYNA 3WBDA 2DMBA 4XTRD 5JW3L 3TP4A 1UM6H 1S9YB 2ZUYA 2Q87A 4RIRB 3DETC 1MUJA 4R8WH 4PY8I 4V1DD 5FO8B 1AFVL 3B9KB 5BVJB 4ONFH 1FNAA 5DQDH 2DWDB 5FKPB 1PKQA 3RVXD 1DUZA 4QHMA 1RUQL 4ZO8A 1JZ2A 4P3DB 1LILA 1ZWIB 3VWKC 2UWEF 3H9SB 4LHUA 4R4NC 3TCLB 1BZQK 8FABA 1ZA6A 5GISH 4PLKC 2X7LB 3SKJH 5DVKA 1IKNC 3F12B 4OCXH 4U1SA 4HKJA 2KDGA 3VFOB 2MQ0A 1HH9B 4GS7C 3O81A 1OOAA 2EIZB 4WWID 3RHWF 4S2SB 4DFIA 5DYOA 4LRIA 1NANH 4JFDD 1SBSH 3H8NA 2H1PH 5DI8B 2IALB 5FYLE 4D0BB 2R15A 1N6VA 5K9QI 1AD0B 3ES6B 3QXDB 1L7IH 2VIRA 1G9NH 5ICXB 3RY4A 2UZIH 1A02N 5FXCH 4GW4B 2H2SD 4HGMA 2O5YL 3OKOA 4GQ9H 1MCRA 4KQ4L 4P46C 3MRFB 4KQ3L 4UQ3B 1G7HA 3D1MC 2Z91A 4X6CE 1EEUA 2VDKH 1PG7L 5ISZB 1RK1A 5A40E 3ARSA 5L2KB 3ZSTA 3LIZH 1MHCA 1EO8H 4LVNB 2V2WA 2VXUH 1Q0XH 3SO3C 3GSVA 1AKJA 1S7RB 3FQUA 3DROA 4R7DA 5DK2A 1FVDA 3MBXH 4ZSOA 2CO7B 5IMKB 2F54B 2V17L 4NQVA 5TE7H 1AR2A 3QQNA 4XXCC 1HHKA 3S4SA 1OARH 1Z6JT 4N8CL 5DEFA 4WCYL 2BNUB 5IM7B 3IETB 8CGTA 2DBLH 5DD6A 4QOKD 1BQUA 2EKSB 3EOAB 3QSKB 3CFDB 1DUYB 5IT2H 4X9FA 5F7KC 1PY9A 4WFGE 3HNTL 1F8TH 1TZGL 2CO6B 2KH2B 2WSKA 4LLWB 1CN4A 3SDXE 3TN0D 1XF2B 2GEEA 4PJDF 5ESVA 4TVSa 5KN5B 4YXHL 3C8HA 1B6DA 4KKAD 2XXMB 2PN5A 3B3IB 1CBVL 1RUKL 4H5SB 2AJVH 3ARBA 2BSTA 4MB4A 1Q0YH 3KPNA 1XGPA 3RAJH 1FZMA 5GGTH 3G5YB 2NZ9C 3C6LC 3JBG7 5DLML 5D6DC 4Y4KA 3WFEL 1JHTA 1HIML 1G9EA 3CK0H 1TLKA 4OFIA 3CAFA 4YAQB 3W9DA 3GIVA 3LKOA 3VXSE 4MGXA 2EH7L 1GC1H 4HJGA 3TZVD 2BNRA 4OZFG 1O7SA 2HFFA 3BO8B 1EXUA 5JZ7C 5I74B 1BIHA 15C8L 2WP3T 4OCWL 1HEZB 3K7UA 2YZ8A 3O6MH 1P69B 2X4SB 3P11H 2AK4E 2E7LA 2V5RA 3PHSA 4P9MH 4G6FB 2CKNA 4KJPD 5I15L 1ZANL 4X4XB