2FATL

An anti-urokinase plasminogen activator receptor (upar) antibody: crystal structure and binding epitope
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB ATN-615, light chain
publication title An anti-urokinase plasminogen activator receptor (uPAR) antibody: crystal structure and binding epitope
pubmed doi rcsb
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fatL01
1NFIA 4RGOH 1G6RH 4NQCD 1DUZA 5F1IA 3TN0B 1TCRA 4U6VH 5MHSE 1E6OL 4DGVL 5H35A 4DVRH 3JWOC 2MQ0A 5DDHB 2IALB 3VFUB 5C0BD 4JKPL 1R3LA 4PR5A 3OX8A 4Y2DD 1BQLL 4QRTB 2J5LB 1IBGL 3QDGE 3M1BB 5E4EC 3U4EA 4ZNEE 3C60A 1YQ2A 1TJHH 1A1NB 3U2SB 4KKBD 1MIML 3MUZ1 2BRQA 2P8LA 3HR5A 2APXA 5DD6A 5SX4I 1IE5A 2Y5EA 2HFFA 3L6FB 2V17H 1ITBB 2GJ6E 2VLKD 1XF3A 4PJBE 4OAWB 5FF6B 4XX1G 4HMCA 1X3DA 1WEJH 1OP5H 3J8F7 5CMAA 3P3YA 3DETD 4Q9QH 1MI5A 5ADOL 2HH0H 3PF2A 4G6FB 4K3EL 4R8WL 7CGTA 3R1GH 1BREA 3GSVB 4WEUD 5LGJB 2EDWA 2JK5B 4JFPB 3RVXC 1NL0L 3VGGA 3QT2A 4KROB 2R0WL 3KPQB 3HG1E 4RAVB 2O61A 2R1XB 5HJ3A 5EB9A 1H5BA 4OCMC 4PJEB 3QG6A 4UTBL 5ECJE 1ZKAA 2PTUA 5FAAA 2Q8BL 2LFGA 2R1WA 2EO1A 4LKXA 4WW1A 1SJHB 3HI6L 2FLRT 2XTJD 1DJSA 5IB3B 4FTVE 4NYLB 1FC2D 4ELKB 1V5JA 3QFDB 5E8NB 3LOWA 5BMFL 2HMID 1T03H 2E9JA 5CZKA 5GSRB 1N7MH 4UNVA 4I0CC 1RK1B 3MRKB 1I1YB 3MLUL 3TZVD 3MROB 3T0VA 5IWLC 4GKZA 1K5NB 4QCIA 1FQ9C 2QKIA 1SYVB 5C0DB 5IESL 3JUYA 1HZHL 3ZHDA 1DVFC 5HHOD 4PD4J 3W11C 3UZQA 1SVZA 3HE7A 1RURL 4H1LB 1A7OL 4NM8L 3SKJH 3GJFA 4WUUE 1I1AB 3GSRB 1N5AA 2EH7L 2CKBA 4OZGB 3P0VH 1S5HB 1HOCB 1X5JA 1X6NA 4OD3L 4L4TB 3TN0A 2DQEH 4FFYL 1T5WA 3H3PL 1K9TA 4NUGL 5DC4B 5DDHA 5FGBC 2AS5M 3I50H 3G04A 5JPNB 4OLXL 2VABB 1LO0L 3V9FA 4NQXA 1A6VH 4RAUB 5T3XL 1NCAL 2AQ1A 3BGMB 4MDIB 4O2EA 4X6FB 5D1XD 5KW9L 3KPLB 4Q74A 4MMXC 1MY5A 1FP5A 1BEYL 2QTEA 5IFAH 2X4QB 2X4RB 2E7LC 5IVNA 4IRSB 2X1OA 4DVBA 4RSVA 1T1ZB 4WNQA 1XGQB 3KS0H 3PHSA 5I19H 1ZEAL 3E0GA 4YNYA 3HNVL 1MEXL 1LHZA 2OLDA 1E6OH 1BX2B 1LK2A 1PG7X 4DGVH 2YBRB 2VDOL 4O58H 3OMZA 2GY7B 3UYPA 5H8DA 1IQWH 4XXCC 3S36X 4JKPH 4LLDB 3GSQB 4P3WA 1UM6L 1A1OB 2AXGB 4RAVA 3K2MC 3UBXB 4WENB 3KYAA 2DI9A 2F54A 4A6YL 3ILPA 4PP1C 1BIHA 5A3ID 1MIMH 3OR6B 2IPKB 5K9OA 2NX5B 5D8JL 3B5HA 2GK2A 4PJGE 2ATPB 3BP7A 4LLYB 3LHPL 2J2ZA 5AYQA 3RIFK 4XI5C 4RA3A 5L8LB 3RU8L 1JK8A 1B0WA 4NYLA 1PYWA 4QO1A 5IB2A 1NEZA 1ZVSB 3DXAB 2A1WL 3MV7A 5ADOH 4F57L 4K3EH 1NGPH 4R2GB 3B6SB 1NGZB 3MRKA 3UTPE 2AJVH 5BOZG 1NL0H 4M93C 4Y5YB 3MUY1 3WO4C 5SWZD 2AJSL 4S1DD 5HVHB 1K5NA 2DWEB 4FQXC 1SYVA 5C0DA 3T8XB 2NR6C 1J7VR 4K71B 5EFIB 3SJVB 2X5PA 1V3LA 4NHUB 4UTBH 1CL7L 3PL6A 3NIFE 5FKPA 1K4DB 4MAYD 1JV5A 2Q8BH 3FONB 2CPCA 4LDEB 2XY1A 1U8JB 3BSZL 3V6ZB 3QB7C 5EORL 2OZ4A 4BH8A 5FCUL 4DJMA 1S5HA 5IM7B 4GAJL 5DYOB 2VSDA 2VAAA 2W0PA 3GHBL 4P5TB 3IF1A 4MJIE 3QEQA 4PTUB 3HZVB 2BY3A 1OW0A 3OKEB 3BX7C 3GSWA 2PXYA 2VABA 2OM5A 5DEZA 1MHCA 3U36A 4JPVL 5JXAH 3UEZA 3H9HB 1MHHB 5I6XC 5GIRB 5HGHA 5HXMA 2HLAB 3KPTA 3DV4A 1J0HA 3BGMA 4X6FA 4AEIL 3Q5YA 2J6EA 4GUPB 3ZHLA 4W70A 3TF7C 1DEEA 4U6XB 2ENYA 1HZHH 1EGJL 2YN5A 4XWOC 2X70B 4L8SB 4IRSA 1RURH 3AS1A 4BQ9A 1A7OH 3QWOB 4NM8H 2W60B 4JRYB 2F8VA 1NC2B 2EH7H 4OZHF 4IRJD 4CL7A 5I73C 4R0LA 1QP1A 4KJPC 2YHGA 4YLQT 5E0QA 4ODXB 4OD3H 4M7JH 5GS1C 2DM3A 3QUXA 2HN7A 1U91A 3MJ9A 2R2HA 3ZTJH 1JWUB 2XQBL 3RY6A 1A1OA 1GZPA 1UG9A 4O02H 4OLXH 4NPYA 4QHLB 1XH3B 3ZTJG 2Q6WA 2G9HA 2XNAA 1INEL 1CXEA 2WSKA 4LCIL 5IFJB 3OR6A 3FTGB 1J0JA 1KPUA 3O2WL 2OL3A 4QRPD 3RL2B 2RGSA 3SGEH 4S10A 5ESQB 3W9EB 1BEYH 3L3HB 4QT5B 5F9DC 1KLGB 3VFPA 3HI5L 1PAMA 5CGTA 3VD3A 4HUVA 3MV8E 2XA8L 4BSVA 1ZEAH 2B1AL 3DXAA 3X14A 1N8ZB 1I9JL 3HNVH 4HLJA 4NZJA 1MEXH 3D1MC 3R8BB 2P5WE 3B6SA 1PFCA 3GMNA 2VDOH 3BYYA 4PJAB 2ATKB 2EEDA 5A16A 4RGNB 2ID5A 1VFAA 1UM6H 3TT1L 5F9WB 5F6HI 1VADA 3ZKXC 3SN6N 4LKCB 5EFIA 1OGAE 4LHUA 4A6YH 3UTZA 2EDLA 1YECH 3KWWA 3H0TB 1KCLA 5D8JH 1MF2H 3ZYJA 4LLUB 1OTTC 3LKOB 5EU6A 1J1XL 2NY6D 3BH8A 4P46A 3NCCB 1T5XA 2KBGA 5IM7A 2BSED 2XA3A 1F3DJ 1A9BA 4P5TA 3FL7A 3SO3B 2ZUUA 2V5MA 2FD6L 5SV4A 2A1WH 1SMAA 3MLTA 4F57H 1MRCH 3OKEA 3U9UB 3JV6B 1BOGA 3I6LE 1F02I 3BD5A 1JWSB 2WLYA 3B5TA 1IGIL 1CGVA 3VD7A 4X99B 1GGBL 1LO4L 1JRHL 4U6XA 5GSVA 1NCBH 1DLHB 2PO6D 3ZDXF 1CL7H 3NIGF 5DMIL 1SMOA 2OS7A 3HC0A 5D7IE 3QWOA 3W0WD 4G3YL 4XB7A 3EZJB 4TVPE 1NC2A 1CQYA 3DO7A 1O5DT 5E6ID 4KK5D 3O9WA 4E41D 4GAJH 1J86A 1EXUB 2NY3D 1OQXA 3N1FC 3GHBH 3IDJB 3WE6B 2ARJQ 4KKCD 5JHDB 5HI5C 1K4CB 5GGRY 4F58L 3WHE0 1T6WA 4MSWB 3P9MA 4QHLA 1XH3A 2RIKA 1LE9B 3RVVC 3QA3B 3TP4A 5IFJA 4AEIH 1YZZA 2W9DL 1S7UB 2PYEE 3WKNA 5ESQA 4KWUA 3W9EA 4QT5A 3MRBA 4XCEB 4LRIA 5I1DB 3IVKA 5JA9A 1N8ZA 3I9GL 4ODUB 1XAUA 5MENE 2ED8A 4MLSA 1U3HB 5A43C 3TNNB 1HN1A 1QA9B 2EDTA 1YJDC 4PJAA 2ATKA 1QZ1A 2VXUL 1C12A 5D7JA 1YEDB 5F1NA 2P5EB 1INEH 3E6FB 3QFJD 4ZXBD 3NTCH 3DMMB 2ZCLL 3CH8A 3C9NB 5IVXF 4NCC1 3NCFB 1ZA3A 1WFOA 2IGFL 1JWMB 4LLUA 2OYPA 3M17B 3LKOA 2GCYA 1U6AL 4PJ9A 2Z35B 2BHYA 3KPPA 3HI5H 3O4LE 3ZDYF 4NRYB 1OQOA 2XA8H 2ZPKL 4WW2A 5F7FA 3RZCB 1I8LC 2B1AH 2A38A 1G6RA 3KJ4C 3MMEA 4F7CB 4HXAL 1C16A 1CFQB 3LKRB 4U3HA 1LO5A 3VXMA 3WDJA 3WIFB 5KSAB 5DQDH 3LDBB 2A6KB 4X99A 3TT1H 3WFBL 5CZXD 4U6TA 1JGDB 4K94H 3LQAC 4P2QD 2C7UB 2YS4A 2J88L 3CD4A 2AJ3B 5JIHA 5E1AA 1AD0A 3QUZA 4R4NC 2VLJA 1J1XH 2F19L 2H26A 2D7TH 3L3JB 5ICYB 1OCWL 3QCTL 1EXUA 3U4AA 3EYQD 5C0CE 1AGDA 5LVEA 3P73B 2V5SA 3LKNB 3WE6A 2MOVA 2EXYD 2FJFB 4M7ZB 5BS0E 1BD2D 2FD6H 3SBWA 4ENED 4X7SL 2NXZD 2VKXA 4EVNA 4YHNB 2AK4E 4Z7VF 3MUGA 5TE4L 2BVQA 4LEXL 4JGJA 1RZGA 3PQYD 5ID0B 3GMLB 5I17A 4ELMB 4RDQF 1NMAL 4HH9A 3HR6A 1GGBH 3QDJD 2P24A 1JRHH 4L8CA 2P45B 3CIQA 1KIRB 1IM9D 2DF3A 2DIJA 4HBQA 5F1KC 5DRZA 1U8NB 2VNCA 4G6ML 3V5KB 4FABL 3P11H 1WF5A 5KOMC 4DOHB 1I9EA 4XPFL 1KG0A 2ZJSH 1YUHA 3FN0H 4ZSOA 2C4FT 3RUGB 1TJIH 4YGVA 3LEXB 4ODUA 3RX7A 4Y4KA 4MA7L 2O5ZL 1QRNB 1QA9A 1ZGLP 4F58H 3VFNB 3TA3C 3WNPA 1IQDB 3UTTA 2Y7QB 4O00A 5FO8B 2D2OA 4D0DA 4CBPA 2FL5B 1RIHH 5F8RC 1T1YA 3DMMA 3C9NA 2W9DH 3CFEB 4EI5C 1JF1B 5E5RB 1ZLUH 4LASH 2HKFH 3QH3A 4DAGH 3KHQA 1RZ7L 2YPKB 5DK2B 5EZJB 3GM0A 5C0GB 5D96B 3DX7A 3MFFB 5SWSB 3BGFC 3HMWH 5HHQA 1RZIB 4OV5B 4NFCA 3RZCA 4XBGB 1L9NA 3SDXA 3I9GH 3LKQB 2HVJB 4J12A 1S7QA 3LKRA 3RVTC 3AS0A 3SCMA 3SKNB 3D0VA 4RQQA 4M9PA 2ZOKA 1P7HL 3O4OB 5F3BA 2VXUH 4N90E 2FR4B 4HIIB 2AV7A 4HFWB 5HYEA 2ARJB 5HYJA 3MYJB 4MNGE 1NCNA 3DX6B 2C7UA 3G5VB 5TQ0L 5BV7H 2ZCLH 3GMOB 2JELL 4WRLA 2FECI 1R3IL 1H9VA 3ZSSA 3CX2A 2BNRA 3V95A 1U6AH 1KV3A 1CXLA 4QLRA 4Y4HB 3ULUD 3ARGC 3LKNA 5DEFB 3LH2L 3ZTNL 2PKDA 1QR1B 4WFFD 5HGBA 4PJIE 4HUXB 2ICWJ 4JGMA 1DVFD 1ONQB 4HXAH 4XPHL 3W11D 2UVEA 2CR3A 3QUMA 4YBHA 3R06B 1BJ8A 5ID0A 3C2SA 1FFNB 2AXFB 4PJCE 3WFBH 2L7UA 3QIUA 4QXUL 5I1KL 1CD1B 4OD2B 2OX5A 1I3GL 4QTHB 3WNNA 2GSIB 1YDPA 4N0UB 1LILA 1WZ1L 4NKOB 2J88H 1U8NA 4P99A 5EUOF 4H0IA 1CDGA 3IRZA 5LQBL 3WFZA 1HXYA 3L5XL 4JRXD 3QCTH 2HT3C 1CWVA 3NFPA 1QSEB 5DJZB 5HTSA 2VDNL 2CH8A 4L29B 3EIFA 4R4BB 5CZVL 5I75C 4FOMA 1P4BL 3VRIB 1Z3GL 3W5MA 1U8MB 2RQ8A 4W4OA 2EYSA 4X7SH 1IQDA 2J8OA 5EIQA 4YHIB 4WGWB 5FO8A 4GBXC 3U7AA 5TE4H 2FL5A 4ZYKA 5FV2A 4LEXH 5C0EA 3E3QC 2B7DT 2DMCA 2Z4QA 5BW7A 5B8CB 1F6AA 3FZUC 1CK0L 1L7IL 3LKSB 3CFEA 1NMAH 2BNQD 1IGJB 1OHQA 5DFTA 1VEPA 2N4IA 1X5LA 2X4NA 3O11B 5D2NE 3CLEL 3SDCC 4JHWL 4U1KB 2YPKA 5DK2A 3P30L 1V7ML 4FABH 1FBIL 3T0EC 2QJDA 3BRFA 3QAZC 3MFFA 1WUNT 3C6SB 3EFFA 4XPFH 1JZ5A 1CF8H 3SGEI 4OCXH 5BZWB 3G9VA 2APWA 5ALCL 3O6KL 3QXTA 3LKQA 3TFKC 2EDFA 1T04B 1P6AB 2O5ZH 3PP3K 1W0YT 4FZEL 2FLBT 4QXTB 3FB7A 3FJTA 3VFMB 3QI9B 2DRUA 1K6QL 1WBYB 3UTSA 3QXAB 4U2YA 1TTGA 2B1HL 3MYJA 3MJ6A 4XI5D 1JGLL 2AJUL 1PEWA 4JKLA 5IB1A 1E4KA 3DX8B 2A2QT 4X6CE 1QSFD 5DJDA 2EKSA 4F33B 1G9ML 1Z2KA 5I71C 2Q76A 3IDGA 1WZLA 1RZ7H 2BVPB 4Y4HA 5FB8B 2FB4L 4MS8C 5DEFA 1QR1A 4OCYL 4DN4L 2DL9A 3I3EA 1ZV5A 4PJ7E 4FQXD 4JVUA 2NR6D 3A6CH 3ROLB 4K23L 4G6JL 3RWGA 2PW2A 5IHZA 2V7NB 1FZMB 2VLKE 4JREC 4G6KL 3TVMB 3ARQA 5DA4A 2VLMD 1FFNA 1U2HA 5C3TA 3AY4C 2AXFA 2BVOB 4OFKA 4OF6A 1JHTB 4UDTB 1CD1A 4QHKI 1EFXD 4QTHA 2GSIA 5TQ0H 1D6EB 1JL8A 2JELH 2B20A 1KELL 4JY6A 5AZEL 4C55A 1R3IH 1YA5A 2LU7A 4QKXB 1OWRM 3UO1L 1QO3B 4DTGL 4I77L 4U4BA 1CL7I 1QSEA 1YMMD 1FSKC 1UM5L 1QRKA 5TE7H 1MPAL 5AUMB 3BXNB 3NACL 3EDKA 5DJ6A 5FECB 3ULVC 1RSFA 2LU3A 2NY2C 2B5IB 4YHIA 4XPHH 3DUUA 3BPLB 1FJ1B 4XWOD 1RMFH 3IYLW 1MJJB 2XTJE 3AAZB 5DJCB 4LIQE 4NKIL 1PY9A 4EDWL 1UWXK 5FM8A 5BO1L 5EZIL 4KJPD 5D7LA 4QXUH 3BZ4B 1SHMA 2H9GA 2YPLB 3O11A 4QHMA 4DKDC 4ERSL 1WZ1H 4PFEA 1YC8A 2FEDC 3FFCE 5LQBH 3F7VB 5FM4A 1PZUB 3L5XH 5KBNC 1J0IA 3VXUD 2ARWA 4JDTL 2LTQC 4MLIA 2NY0B 2VDNH 2O93L 1LDSA 1I7UB 3ALWA 1MH5B 5E2WL 4JFEB 2NW2A 2VJXA 5IROC 1A8JH 5AYUL 1X4ZA 5KSBE 3FRPG 4G8EB 2BC4A 2LAGB 3VFMA 4I48B 2FEEL 1S7RB 3QXAA 2LVCA 3WNMA 3QDME 1S9XB 4LPUA 4ORGB 1U8PB 3DX8A 5GRWA 5IV2B 4LCCA 2ERJC 1CK0H 1L7IH 2YEZB 4F33A 1WZMA 5DK0B 5T1LA 1NCWL 1A4JB 4HUWB 4ZS7H 3JWOL 3ARBA 4OLUL 3UROR 3QP3A 4LNVA 3CLEH 1ES0B 1J5OL 4JHWH 1BQHB 5EOTA 1ZSDB 2BVPA 2DOCA 3P30H 1V7MH 5J12C 5FB8A 1FBIH 1W8OA 3M8OL 1X7QB 5C07A 5ALCH 3O6KH 3CSYA 1NJ9B 4M62L 4NQDE 1HYSC 1QBLL 4OCSL 4LRNL 1FZMA 1TMCB 1H0DB 1UA6L 3LKPB 2PN5A 2MNUA 1A64A 3Q6FB 2DM2A 1OTTD 35C8H 3MRCA 3KR3L 1ZT1B 2NW3B 1K6QH 3O3DA 2N7AA 4KK6C 5CILL 4UDTA 2B1HH 1D6VL 3A0OA 3BP4A 4UIKL 1JGLH 2CRZA 2JKXA 3NPSB 2AJUH 3VWJB 1T21A 3HMXA 1G7QB 5DWUL 3HI1A 5EU3B 5LGKA 1GJIA 4U1IB 1G9MH 5F7HA 2EDHA 4LLMB 2A83B 1Q9KB 3HUJF 1OOAA 4BA8A 2FB4H 4YX2H 4H20L 4OCYH 4DN4H 5AUMA 3HPJB 4OIAA 5CP3A 5DRWB 5FECA 4L3CB 5IJKC 1KYOK 3O8XA 4K23H 4G6JH 2YD9A 1FJ1A 2ITDA 4I2XE 3DBXB 4L4VB 5E2JA 3QEHB 4B7IA 4G6KH 2XN9D 5IMLB 5K59F 1RHFA 4GW1A 4OKVA 4EKXA 4X6EB 5DURD 2Z9TA 1NFDA 5JW5B 3JUZA 2PYFB 5GGTL 5FYJH 1KELH 5D5MF 4HV8B 5CJOL 1K3IA 3JZ7A 4BH7A 3ULUL 3UO1H 5TDOB 5KVMC 4I77H 2NTFB 3X11A 2FJGB 1RY7B 4XVUC 3RVVD 4HK0B 4U1HA 1IT9H 1FNFA 4N68A 1D7FA 1I7UA 3D85D 1MH5A 1FG2B 3NACH 2ICEB 4IDJL 1NMCC 3IKCB 3ZMRA 4I48A 1S7RA 2W65B 5ELIA 3QCUL 1I9RH 3ARFD 4GKSA 3VGAC 1G7HB 4N8VB 2WINA 5C6TL 3T0DA 2IWGA 5EZIH 2YD2A 3VXRB 1CN4A 1A4JA 1ZTXL 4JDZB 4NKDB 4ERSH 4L3ED 3MNZB 1P7QA 3RTQB 2GUOA 4GW5A 1MELA 4TPRL 1IM3B 3BWUC 3WIIH 5L2KE 5HHNA 4H8WC 4JDTH 5DZLA 2XWTA 3Q5TA 5ISZA 3S98A 4Z5RB 2X6MA 5E2WH 2PTTA 3V6OE 5H94A 4WI5A 1T22A 3AROA 2AEPL 4PJ5D 3Q3GA 1QD0A 4NN5C 5JXED 1K8IB 1FL6B 1HKFA 5A1AA 1RHHA 5D1ZC 4Z0XB 1NCWH 4BYHA 4KJQC 4UT7L 3JWOH 3GFUA 4OV6F 4XPGH 3CGTA 1AXSA 1N6QH 1T83C 1JCKA 4I0PC 1IL1A 3M8OH 5I8KL 3QEGL 1S78C 4OZFG 4PIRF 3HPJA 2LQRA 1ODAA 3GBML 3KPRA 5BJTB 5IBLC 4NRZB 4CVZB 3L7FB 5L0QB 1DLFL 1CIDA 2B4CH 4WO4B 4L4VA 4WHCA 5F7YC 4K7PX 4FQIL 1UA6H 2JJSA 3L3IB 5E9DA 2E9BA 1IAIL 4R4ND 4OUUB 1UH4A 4R96A 3DARA 1D6VH 1G7JB 3B8YA 4UIKH 3SGJC 3VXNB 2E5EA 3KLHC 2R69H 4XP4L 5HYQB 2DJSA 2Y07L 1RUQL 3TO4C 1RIVL 4FS0A 1UQSB 1XGRB 5J6HB 5J9PA 5DZNA 2NTFA 3V5HA 5C09D 2QR0B 4EEEA 4FG6C 4DUWA 1BF8A 3WJJC 2EH8H 2GITB 1XGPA 2BHUA 2ZG1A 3FQTA 2ICEA 3BDYL 5C2BL 1OAXL 1R6VA 5FGSA 3GMMB 3RGVB 5A40E 1S7VA 3EAKA 3AM8A 4QXGL 4XHJC 1J11A 2BCKA 2H3NA 3LMJL 4R7DA 3S35H 4EUPH 4U1MB 1CS6A 5T1KD 3QIWA 5F89A 3GJFK 3U30B 1NFDF 3HLAB 3B9KA 1NCTA 4IOIB 2FBJL 1NUDA 4E42A 3L7EB 1NEUA 2FO4B 4OD1L 2XWJB 5GGTH 2ZUQC 3MR9A 1VSCA 2YZ1A 4TUOA 2QHLA 5CJOH 3QULB 5DMYA 1IM3A 1OGTB 3LN4B 3TA3D 1XT5A 2V2WA 2ZZUT 4F2MA 4G9FE 2R0LH 5IBUG 3D3VA 4OFVA 1T2QL 4YR6A 4IDJH 2YSSA 4EI5D 3OXSA 2QSCL 4ZPVA 2IANA 3QRGL 4BQCA 3DHJA 2DLGA 4OCNC 1ZA6A 4E41E 2ICES 4WI4A 4Y8AA 3PWPB 1A3LH 2YRZA 4NQEE 2SEBB 1CICB 5IEHB 3PDGA 2AABL 4G8GE 4NO0A 3TIEB 5CIPA 2LU4A 3MRGB 1HIML 4APQB 4FQLH 4I9WD 4YDJA 5FM5M 4ISVB 5EIVA 3TWCL 4J1UA 1NC4B 5I2IA 1KYOJ 1J10A 2VISB 3CVHL 4NIKB 5FFLA 4J2XA 3LS4H 3S37X 3K8LA 2DICA 2VLRD 4MJ2A 3G5YB 4R26H 2NY1D 5I0ZA 3QJHB 5KANG 1DN0B 4PRAB 5E2TL 5K9QI 3WLBA 1WT5C 5LJYH 2CDGB 4XCCL 2NZ9D 3F12A 2IH1B 4Y1AB 3OG4B 4WCYH 2ZSVB 2Z8SA 1K8DA 2J8HA 5CS7A 5KG9B 3VXNA 3I6GA 4QHNA 4UT9H 4TVPH 32C2B 5DFWH 3VRJB 4XBEH 1UQSA 2EC8A 5ANME 5J13C 3VGBA 2GJ6B 4HKXB 4Q6IA 2HWZL 2WUCL 4GKNB 4LLWA 5I8KH 4GRWH 3QEGH 3IDYC 3C60C 4WV1B 2GITA 3JTTA 2CRIA 3QIBA 5I74C 3GBMH 4TN9A 3L5JA 3RNQA 3GMMA 5CEXA 4XMKL 1AFVL 1RJZA 4E5XA 1KPRA 3S4SB 3SGDH 4OGAC 4PS4L 3LEVL 4QY8B 3GRWL 4WFHE 1AD9A 1IAIH 3HLAA 1B2WL 4IOIA 3L3DB 2HT3D 4F9PA 2E7BA 3DUSB 5L88H 2Q7NA 3QNYB 4WI6A 2OTWB 4XC1H 4XP4H 2JIXA 1ZLWH 4Z7WF 4PGZA 3T3PF 2Y07H 1RUQH 4HWEL 1OGTA 1RIVH 1KIQA 2XQYK 1G6VK 5E1HB 4GBXD 1I4FA 2H6PB 1KTLB 3RWJB 3ARED 1H5BC 1B3JA 4XRCA 4C56D 4E9LA 3OSKA 3FZUD 5IVXB 3C5JB 5C2BH 5K9KA 4LPXA 1LP9E 1YEGH 3MGOB 3GSXA 4GXVL 2Y72A 4IOSD 5SX5K 1C5BH 3SDCD 4OFYA 4S1QL 5KN5B 4DK6A 3T0ED 3GSNB 3K4DA 5C0JA 2FBJH 4LVNB 4OD1H 5JZ7D 4YHYB 1FFPB 1ZHBB 4YIQB 4APQA 5IOPB 1IC5H 4MNHA 2CJUL 4OGXL 4WWKC 4X6DF 3BJ91 1XF4B 4LCWE 1KC5H 2R23B 1NGXB 1P1ZA 1S9VB 3ROOA 4OQTA 5BRZA 4D9RD 2L7JA 4KQ4L 1J9CT 3LV3B 4PPTA 3QDJE 1QHOA 3VXSB 3OKLB 4U7MA 5JNYB 3D2UB 2DM4A 3O3AA 4NGHL 2Y1VA 4FFZL 3BZDA 1T2QH 3MGAA 2DYPA 3QBTB 3QISA 5JDSB 3HE7C 3O2DL 3QJHA 4PJFE 1P5VA 2H32A 1DN0A 4PRAA 4AG4L 5C08D 2EICA 3QRGH 1S7XA 5DFVC 3QDGA 2F53B 3EO9L 5GRUH 4ZNEA 1VGKA 1NQBA 4MS8D 4U33A 3TN0C 43C9B 5HHME 2AABH 3JV5A 3SQOH 1LEIB 1NKOA 3ARYA 3ZSTA 2GJ6A 4PJBA 4Z7VB 1WAAE 4M43H 3I84A 4C59B 4ZUTA 4PLKD 1VACB 5INCB 2FBOJ 3K8KA 1OSZB 4QF1B 3FRPA 5TDPA 2YUWA 4Y5XB 4AZ8A 2YWZA 4LNRA 4DEPC 5EBGA 5B39G 3CLFH 4JFDB 4YHML 1CXHA 3DURA 4JKMA 5DQ9A 5E2TH 4LDLB 2X4TB 3HG1A 4PRDA 4XCCH 3CXHJ 3DUSA 3U7WL 4ZUSA 1RD6A 3EYFB 3L3KB 2OTWA 5D9SB 1NBZB 1HHJA 3V8CA 1VFBB 4PJGB 4QWWC 3D6GA 4X7FC 4HC1L 5DHYB 3BFOA 4JO2L 4RGMB 3GEWB 2DI8A 1MWAH 3AU1B 5AZ2L 2PF6A 2H6PA 5J56B 1KTLA 4AK1A 4FTVA 1UC6A 1AKJB 3EYVB 4P4KA 3LQAL 1P2CB 3C5JA 1A4KB 4GAFB 4P2RB 2Z31A 4JN2A 3QUKB 5HYFA 1FZKA 4XMKH 5K9JL 5HGDA 4WGVB 4JZOB 3KAAA 4PS4H 2FATL 1JUFB 4U6HA 1QPPA 2AERT 3GRWH 2FEDD 1GAFL 4CW1A 3ULUE 3MLVL 4XVSL 5FM5O 1B2WH 3ISWA 4J7RA 4P5MB 4OBSA 3C2AL 5IUSA 2J7LA 1FFPA 1ZHBA 1QG3A 4K3JL 1V3JA 5D7SH 5IOPA 2PTVA 4WUUA 4JB9L 4HWEH 5E4IA 2R23A 5DJAB 2WLZA 1KXVC 2M8XA 1IGYA 3LV3A 3X3GH 3ZE2F 3D2UA 4M6NL 2GQHA 2YA2A 5I1LA 1EJOL 5FKAA 4Z8FL 4JM2A 2AEQL 4ZUVA 3PL6C 1W0WB 2CLVB 4O2FA 2IAMB 4CU8A 3MRFB 3AGVA 1B88A 4GXVH 3PP4H 4PB9H 4JANB 4IMLA 4YEEA 5FA4A 4S1QH 3MOAL 4J3TA 5LAXA 4JVPA 2EDKA 1AC0A 3PWLA 3CZFB 3TCLB 4CU7A 2FEEI 2XTLA 4IOFC 4Z6AT 4WTZG 1CLYL 2BP3A 4NWUL 3DROB 1HYRC 4MCYA 1OW0C 4ZFFB 4G9DA 2PXYC 1JNNL 4LFHD 2CJUH 4OGXH 5E7BA 4DZBB 1FV1B 1GGIH 2UV3A 2QQLL 3X17A 1VACA 5IBTL 4KK6D 2JCCF 4KQ4H 4LARL 2BNQE 3HZKB 4OCRL 1E0OB 5I8EB 5EWIL 3UAJC 4NGHH 1JTTA 4FFZH 3MNWB 5F7LB 5EUOB 4XCYB 5IW1A 4IRSC 2DKUA 4AG4H 5CWSB 2QADD 4RMVA 2X4TA 3UCRA 2G75A 5F7KC 1MCOL 3PHQA 5C0RL 3EO9H 1SVCP 2UWEE 1HSBB 4R0LC 2HKHH 5HHPB 4AIXA 3KPMA 3QUXC 3LD8B 5KOVC 5F7EL 3NA9L 4PJGA 4YJZL 3SKOB 1I8KB 1A3RL 1YJDH 3AU1A 3RY6C 4HQQL 2YUVA 4X9GA 4Z78B 1J8HD 1P2CA 1A4KA 5CBEB 5IBUB 3VE0A 4NQSA 4G80B 3VH8G 5IFHL 1HEZB 1JUFA 4AIZB 4YHMH 1JNJA 4KK9C 4P5MA 2YD7A 1XR9B 5FGCE 4XVUD 3U7WH 2Z93A 2VXQL 1TLKA 3O6LL 3LQMA 1OP5K 2E7HA 4ODHL 2V5YA 4KK8C 3WIHA 3N06B 3SDDB 2AP2A 5DJAA 2GT9B 2P8PA 3CUPB 3EW3B 4HC1H 4JO2H 4OZFA 3OKOB 4GRLA 4LLQA 5AZ2H 1FAIL 5HVHC 2ZSWB 5M94B 3UPRA 3MBXL 3WS3A 1NGWA 5EH1A 4MJIA 3LQAH 3L1OH 2MCPH 4PRNA 4DGYH 3VXPB 5AAWA 3MRFA 1QBAA 3CCHA 4Y4FB 3FB5A 4PG2A 2CR6A 2FATH 4P2OD 4AMKL 4JN1H 4P46C 3GKZA 1GAFH 1XIWD 4RISL 1BVLA 4XVSH 4P5TC 4BUGA 1LK3L 4K7PY 3C2AH 4Z77B 4Q0XL 3QO1A 2GTWA 4JFFB 4KDVA 4ZFFA 5GQBA 4YUEL 4NDMA 1MSPA 4JB9H 1Y0LA 1TTUA 4NZRL 3R4DA 3EUUA 1CLOL 3P4OB 5FO9A 2VL4A 1BFTA 4HZLB 3RWIA 3TNMB 3PWJA 4W4NA 1EJOH 1H3VA 1WCBA 1G1YA 4WTXA 4BELD 5CD5D 3BO8B 4KJQD 2ESVA 1YEKL 4F15B 5GRYA 5JOEA 2YD4A 4HKZB 2XPGA 3O9WC 4JQIL 1FZJB 4X5WB 4I0PD 4ZFOL 5HHPA 5C70A 1QLFB 2UZIH 1VENA 2FYYB 2R2BA 1S78D 3P77B 4U3XA 4JRWA 3VG9B 3MLWL 3U0WL 4FXKB 1MCNA 1FPTL 3GSOA 4PJEE 5IBLD 3SKOA 1CLYH 4G6AC 4Y19B 1T1WA 1N3NA 2RFXA 4U1SB 3OXRA 4ZO9A 3QQ9D 1FORH 4ZO8A 4Z78A 5TGBA 2YN3A 3CU1A 2QQLH 3MV8A 2YA1A 4UDUB 5IBTH 3C5ZD 5C0AD 4Y2OA 4LARH 1G7PA 3CDGA 4R7NB 4G80A 2P5WA 4OCRH 1Y6MR 3KLHD 1EVTC 1RU9L 2IQ9L 5E2VL 3TO4D 4LRIC 3WYRA 4PRIB 3GMPA 4KAQL 2C9AA 4U1LA 4UB0L 1OGAA 4FG6D 4KKAC 2OI9B 3SGDI 4XNMB 3HZYA 4J3OC 4KI5F 8FABB 5GGSB 1VEMA 4GMSL 1IAII 1X9QA 5F6HJ 4CUCA 4FQ1L 1EJ6A 4HHAA 3NA9H 1A3RH 2IBGA 2DTML 3VFSA 4DKEH 3CUPA 4TRPL 4XHJD 1G1CA 3OKOA 1UFUA 4HQQH 1A7BA 2ZSWA 5D7JC 3O3EA 5F9WC 4NNYA 1U58B 1RUMH 4OZGE 3VXPA 4NQUA 4LOUC 4OZIB 3IDMA 4Y7MA 4L4TE 3QR2A 1CR9L 4PJDE 3C6LB 4YBQD 3THML 5I1IH 3OJDB 5JIKA 3VD5A 1A7NL 3KLAB 4PJ9C 1KNOB 2VN7A 5IQ7H 2AJZB 4YHOL 3V0AC 3SO3C 5CINL 2R4RH 2A6DB 5GRJH 2V9RA 5CSZA 3BEWB 1J1OL 4WW2C 1I7TB 1I3RB 1IEBB 3W39B 3ULVL 2VXQH 3O6LH 4L1DA 5D7IA 3MCLL 5IMMA 5J0BA 4DZ8B 4LVHC 3OF6D 4X4XA 3BQUD 3TM6A 3NZ8A 1FAIH 4HZLA 3H7LA 1U3JA 3MBXH 3QXVA 3Q0HA 5IHUL 2WIMA 2OP4H 1OSPL 4Q7DA 3QQ3A 3CH1B 2QSQA 2C1OA 3F5WB 1F11B 1I7RA 4PBVC 4HUUA 4M48H 3QUZC 4NZUL 4GO6B 3PJSA 4EI6B 1UZ6E 3PUCA 4W68A 4AMKH 1A6AA 1X6LA 3HUJB 1DQDL 4RISH 1NAMB 3P77A 2EE6A 5JO5B 3O3UN 5INDB 2PYEA 1LK3H 1Q0YL 3SBWC 4Q0XH 3OAUL 1FVCB 4OTXL 1JZ4A 1KPVA 2NX5E 2CGRH 4OLZL 3VU2A 4Z7UE 1KJ2H 3SO5A 4PJHF 3CC5A 3EJJX 3M07A 2MQ3A 4UDUA 5J6GB 5I30H 1CLOH 5C2UB 3C8DA 1UJTA 5JR1L 1BFOA 2V9QA 5MENA 1Q9LA 1R24A 5D72L 2E6JA 2WBKA 1KXTB 5E99L 3BI9X 3PABA 1KCSL 3CFBB 4M6OL 2OBGA 3BYTA 1YEKH 2O5YL 3VG0L 3OHXA 4XNMA 1WIOA 5B38G 3VJ6A 3C60D 8FABA 5GGSA 3MLWH 3HE6B 4Y4KC 3SJVE 3U0WH 4CN6A 1FPTH 1IILE 4F8QA 2CLZB 1AY1L 1R3HB 3C09C 4OGAD 4O5LL 2WBWB 1CFNB 1U58A 3O4LA 3GIZL 3DMMC 4C4KO 5EOCH 4JO1L 1S7WB 3KPSA 5DD1L 4LQFL 4A6YB 3IXTA 3C6LA 3FT2B 5EO9B 3S36L 1MI5D 4MXWL 1C5DB 5LXGL 5AG8A 1M7IA 1RU9H 2YR3A 5TFSH 5IMKB 4M1GH 1KNOA 3TYGL 2IQ9H 4FMFA 3IJYB 1NCDL 1BHGA 1TQBC 4KAQH 4UB0H 3P0YH 3HAEB 1I8IA 1I7TA 1I3RA 3RZCC 3W39A 4YAQB 2VITB 5EBWB 4FQQA 3ARZA 4GMSH 1RUKL 5GS1A 1HDMA 4FQ1H 4YWGL 1UWEL 3SCMC 5ACLA 4NC2B 4V1DB 3KPOA 4TRPH 3F65A 3LDBC 2APTA 1Z9SA 5C0CA 2A74A 4JRYE 5FYLD 2X89A 2FH8A 1AO7E 5BS0A 4KRNA 4PJIB 2BVTA 5L6YL 5IW6B 5B39A 5F72S 3JWDC 3MJGX 1W72B 1GH7A 3THMH 2AK4A 2F8XC 1I75A 3AMKA 4PG9B 4OLVL 1A7NH 4QRUB 1NAMA 4YHOH 5GGQL 5GS3A 1IC1A 2VDQH 4JQXA 5INDA 2V2TB 5CINH 1E28B 2VIRB 5HYSB 3DX9B 1J1OH 2AKRA 5DUML 5JQHC 1GPOH 3VFGL 3ULVH 2IADB 2O5XL 1D9KA 3PIQB 3MCLH 3BP6B 4RWHA 3HE7D 1CFTA 3SE9L 3VFTB 5FIEA 5CSGA 5J6GA 5DFVD 1MWAA 4GRWF 4GAYA 2WBJB 1IKNC 4YDKL 4ODWB 1OSPH 1IGTA 7FABL 3KXFB 5E8PB 1ZHKA 3EJYD 3IFPB 3PV7A 3GJEA 3ES6A 2IPUG 4NZUH 4PJ8B 1RJYB 3KS0J 4MJ5B 2E7CA 2WIIA 3F8UB 4H8WL 5DGQA 4RGNE 1DQDH 4K2UL 5ACMA 5FHAL 2R15A 1F4WL 1NCUA 1XCTB 5ADPL 3KVQA 4WEBH 1ZT4B 1Q0YH 2DM7A 5EO0B 3DRTA 2OXGA 3GB7A 3OAUH 4AL8H 4W4OC 4RRPG 4OTXH 1CFSB 1CDUA 1YYML 1TZHB 4OLZH 3RDTA 3QEUB 2KH2B 5BW7C 4MYWB 1O7SA 4EJ1C 4OQ1A 4XGZA 1IMHC 3WUWB 1WWBX 1C5DA 5D72H 5DTFB 3OKKA 1GZQB 1CE6B 2UYLB 2G2RA 4ZDHB 4AYFA 4QWWD 4M6OH 1R3KB 1E27A 2X7LB 4MNGA 4UTAL 5HBBA 2A0LC 2F54D 4JZJB 4X6CB 3WL9A 4NQCB 1A6WL 4U0QB 3S96B 2ZCHH 4AJ0A 2VLRE 2F8OA 3PV6B 2BFVL 1CYGA 4X80L 1BZ9A 2PW1A 5C0BB 1KT2A 1AY1H 3HHRB 3MA9L 4Y2DB 5EC1A 4XC3H 1A22B 4O5LH 2FWOA 5HDQL 5BZDB 1HSAA 3NCJH 4OM1L 1UJ3B 4WTWA 3STLA 2IPTH 3RP1A 1E4KC 3GIZH 3PE9A 1AQDB 1G7MA 4LSVL 4PJIA 4QRQA 5DI8B 5TF1H 4JO1H 3UC0L 1S9WA 5DD1H 4LQFH 2KZ1B 4RZCB 1W72A 1MCLA 3S36H 3QHZL 3T0BA 3MV7D 4ONGL 4X7EC 3E8UL 4YFDB 2MKWA 4XP9L 4MXWH 5JHDE 5TPWL 3SKMB 4NUJB 2VLKB 4QRUA 4RNRB 4WI9A 1CGSL 1CGYA 4Y4HC 5IJVB 1I7ZB 1DE4B 4PJCA 3JV4A 3F7PC 5CEZD 1PQZB 4PTTA 1JI1A 2ICCA 2DQFA 1FRGL 2CLRA 4RFEA 2J8UB 3PL6D 1RUKH 4YWGH 2VXVL 5AEAA 2ADJB 4ZTPL 2KQNA 5TH2A 1QFHA 4ALAL 3NCBB 2VH5L 3TGXA 4KI1A 1AGFB 3SGKA 3CVIL 3GSUB 3VH8A 2CDEB 5L6YH 3BE1L 2BNUB 4IOFD 5CCKL 3QEQD 3C8KB 4JJ5B 5C6PB 1UXWA 4PJ8A 4OLVH 4CAGA 2XTJB 3MRJB 1W2KT 2PXYD 3PNWA 2ZKHL 5GGQH 4MWFB 4NT6B 4C56E 1XCTA 3BIKB 2P5EE 1LNUB 1KN4L 5DUMH 1FGVL 3MREA 3GDBA 1X5GA 3R0MA 3EOAA 3RBSA 5D2NA 5C9JB 1MIEL 1MQ8A 3SPVA 3UAJD 1AI1L 2OTUA 1OD7A 2PUQT 4XZUB 3DOSA 3TZVB 3G6JB 5B8CC 5ID1B 3HRZB 1F42A 1TQCB 5DEGB 4IS6B 2HJFA 3DUHA 5HY9B 1JZ2A 1A1MB 3VXOA 3WHXB 2ZG2A 5HHOB 1PW3A 2GY5A 1PY4A 3IAQA 1GZQA 3RZWA 4Z7WB 1ZWIB 3L3OA 2IF7A 3QUXD 4ZDHA 2CQVA 3NBNA 1XZ0B 2C4FU 3MOBL 3T77A 1MQKL 5IG7A 1GRWA 1J05B 2OR8A 4G8IB 3QDMB 5ICXB 4H8WH 3S97C 4X6CA 4K2UH 1VA9A 1JPFA 5EN2B 5FHAH 4Z7QE 2MTPA 5AD0B 4U0RB 1F4WH 3CMGA 1HQRB 1MFDH 4CJ0A 5C71A 5ADPH 3QO0B 2FIRT 4YHLL 3LQZA 3QWRD 1INQA 2Y6SC 4Y2DA 2M26A 4M8QA 4LMQI 1U0QA 4EDXB 4KK9D 1UWXH 1PKOA 3BAEL 4XWGL 4KZEL 4PYGA 3VRLF 2R8SL 1AQDA 4PJ7A 4LCCC 3BMVA 1S9YB 5FYKD 1OAYL 2D7QA 3G08A 1XR8B 3DXAD 2XZAL 5DJXB 4YHKL 3FQUA 2GJZB 5A2LH 4IIQA 2QSTA 4Y16A 3ARBC 1DQQA 4NUJA 2CMRH 3WCYA 2VLKA 4KK8D 3MACL 4X6DB 1ZOXA 4RBPK 4YHPB 3RIFF 5CP7B 3MV9A 2Q8AL 1ZLUK 2PNDA 5GHWL 1PQZA 4BKLB 5FUOL 4QTIL 1NKRA 2W9LA 4UTAH 2DBLH 5DJYA 3HZMB 1A6WH 4ELME 4LHUD 3IJSA 3FN3A 1II4E 4R97B 4M1DH 2BFVH 4QHKJ 2D03L 3BEVB 4L5FL 4X80H 3B3IB 5L7XH 5GGVL 3MA9H 5EU6D 1ITCA 5HDQH 4P46D 3O3BB 1RULL 4FQHB 4JFZL 4KUCD 4OM1H 4DOHE 2VDPH 3PHOB 4I18A 3QZWG 5E03A 4LSVH 2CDEA 1JN6B 3RUGE 3L5WA 2BNUA 5HI4D 3C8KA 1T6VN 3QHZH 1AGBA 4JJ5A 3E8UH 5TPWH 1QRNE 3M45A 3WN5A 5C92A 1CGSH 4CGTA 4JG1L 4BFBD 4X5XA 2LVEA 5C9JA 1CU4L 1EMTH 1FRGH 4PY7B 3FB6A 2YA0A 3P9LA 5JLZA 2HJKB 4NJAL 3O8XC 4PV8B 3FFCA 4X4YA 5FDWB 1QBML 2VXVH 3ARTA 4R3SB 5FYLL 3CFKB 4M61B 4ZTPH 1NC2D 3GKWL 3AC0A 3HRZA 1WFTA 4ALAH 5DEGA 3ZDZF 2VH5H 1A1MA 3O9WD 5SWSE 2Q20A 3QRFM 4L9DA 1L7TH 3GGWA 3CVIH 3NABH 5KSBA 1D5XB 4MAYB 3BE1H 1SJXA 1XZ0A 5CCKH 5DUBA 1F4XL 2DQTL 4GW4B 1M6OA 3V6FB 4KMTL 3ZKMC 4G8IA 3QDMA 5ICXA 4LSSL 1FNSH 5EN2A 2ZKHH 3MNVB 1LD9B 2EO9A 2Z8RA 3VI4F 3UTQA 2OSLB 3PDDA 1AI1H 1MAKA 1CFVL 1JNHA 4EDXA 5C6WH 2CKBL 4L8BA 3U82B 4P3DA 1GGCL 4TULL 3HCVA 1WK0A 4KKAD 1XR8A 4NQDA 4KKNA 5DJXA 3B43A 2ADIA 2GJZA 4WJ5A 3HC3L 3IDNB 2EDRA 4JHAL 4J3XA 3FAWA 3MOBH 1G9NH 4HKBA 4IRJB 5D7JD 1JI2A 5DQJA 3FRUA 3IDIB 4KJYA 3F7YA 5E8DL 1YMHA 5FO7B 1MCJA 1WTLA 3EDJA 4IBLT 4LOUD 3X3FL 1R5IB 3FQRA 4N0UE 5GS0H 2CXGA 3MRLA 5J4MA 4G7YH 4WFEE 2VL5B 1QHPA 4MJ4A 4PJ9D 4MZ3A 3OR7A 2EIBA 2CO7B 2NLJB 3U6RA 1MAJA 5MI0B 4KZEH 4HSQA 3MRNB 5CGMA 4D0CB 4RMTA 1OAYH 4QRPB 2XZAH 1INDL 1AGCA 2EC9T 4YHKH 1QSZA 3ECBA 4I2XA 3SEPA 5ACZA 5M95B 1JMZA 2PETA 2RCSL 3MACH 4HIHA 1KIUA 3VDBA 1R5WA 1BFVL 1PJ9A 2Q8AH 3WXWH 1N6VA 4UOJA 1QKZL 3VXMD 5JPMB 5GHWH 3TPKA 4QTIH 3WDHA 2JCCB 1PZ5A 4PY7A 4XHQA 3T04D 2PCPB 4CJ1A 3NCYS 5D4QA 3EOBB 5F1OB 2WMPA 4KDWA 2V7HA 5IMOA 3C87A 2JJSC 2D03H 4L5FH 4D0BB 3QUZD 1OF2B 2VLJD 4OZ4A 4MXVF 3K3QA 1RULH 4JFZH 1MRDH 3MBEA 1WBXB 1TZIB 3O45B 4MAYA 1CDJA 4ORZC 1UZ8B 5I76A 3ORJA 4GW4A 3TBSB 3V6FA 2NY6B 3H7BB 4H88L 5ITFB 4F7TB 5CEZL 1AE6L 2HG5A 4YO0A 4WU5B 5CJBA 2YD3A 4OT1L 1QNZL 4JFOB 4JG1H 5MEOA 2I9LB 3RNKB 2EYTA 4U1GB 4PRBB 5GZOC 1SBBA 1JJUA 3ETBF 3AM8C 4NJAH 3OB0H 1ND0B 4YXKH 3QJFB 1QVOB 4Y5VB 1KB9J 2CUHA 5L2KA 2OZ4L 1QBMH 3QIWC 1YPZF 5FYLH 2ZUTA 4P48A 3GKWH 3B9KC 5I1HL 3FKUS 4G9FB 4P59L 2PO6B 1QBBA 3V6OA 5KSBF 3T1WA 1KULA 5BV7C 1P9MA 3BH9A 3IDNA 4KZDL 4Y4KD 2APFA 3W0WB 2FIKB 3WEXB 4P5KB 3MRHB 1EEZB 3ALPA 4W6XB 5E6IB 4YHZL 4IRJA 4F7PA 4KMTH 4HGMA 4U2ZA 5E8EB 3UTTD 3L95A 4E41B 4M6ML 4LSSH 2NY3B 3VMNA 1DDHB 2J6EL 5CEYB 1ORQA 4EN3A 3DMMD 4YDVB 4U7SA 5KVFL 1A7RL 2AVGA 3RBGA 1CFVH 4NO3A 3GJFH 4LSRL 5I1AA 5KJRL 5D7KE 2CKBH 2NLJA 3WD5L 4YE4L 3P9WB 1GGCH 2MPAL 4TULH 1G7LB 3RZCD 1ORSA 3FQNB 4LPCA 3MJ9L 3HC3H 2WP3T 5HD8C 3D9AL 1TVHA 1FYHB 2AV1A 3D0LB 3SCMD 3HPLA 4JHAH 4KRMB 2PR4H 1EA9C 4UU9A 1CXKA 4XNQA 4P57B 4HWBH 4XNXH 5HYJD 4AH2A 3HA0A 1HQ4B 5L0QC 2OL3L 5D2LF 2XKUA 2Q3AA 4RRPA 4OIBA 2YPLE 1DN2A 4C83A 4JPIB 2M1KA 4JDVA 3O41B 2FX9L 2HFEB 3U46A 2BNRD 4ZPTB 4XAKD 3RPIB 5FYKL 3MLRL 3BKMH 3QFJB 4ZXBB 4HDIA 5FUCE 5I16B 3MO1B 2X4OB 4X7DC 2VUYA 4UOW1 1INDH 4JFEE 3H7BA 5ITFA 4HX1A 1C08A 4F7TA 4Z76A 4Q6IC 5J11B 3IU3A 2FHBA 3KHOA 3BDBA 1QKZH 4JFOA 1EBPA 5BQ7A 3QDAA 3QIBC 3RNKA 3L9RB 1KBGL 3QIUD 4OI7A 3MXWL 1MHEA 4MD0B 4Y5VA 3LRSB 1BGXL 1YN7B 5ENWA 4PRPE 1UYWL 3TBTB 3T4AB 3U30C 5DHVB 3RWEB 4G9FA 3UPCA 3FT3B 3ME0A 4F9PC 4KVCL 3H3KA 3PWNA 1CT8B 1D3CA 1LP9B 3OAZH 3A6BL 1IZKA 3TBWB 2B8OT 4ZQKB 3S5LB 2JB6B 4NOFA 5E8EA 1EAJA 2K7PA 4E41A 4UQ2B 4KV5E 1IJ9A 1AE6H 2CRYA 3CJJA 5CEZH 3BIBX 4NQEA 5C1MB 4HPYL 5ERWB 3KYKL 5E24E 1HH6B 4G8GA 4YDVA 4ZFZB 4M4PA 1IGCH 3F58L 1BD2B 1HWGB 2NXZB 3EO0B 4H1LH 4X98B 2NY7L 5K33A 1Y18B 3SDAD 2OZ4H 4H1LG 4BFGA 2UUDK 3PQYB 1GXEA 3MA7B 5I1HH 5EZLA 3EGSB 3ESVF 3QDJB 5L9DL 2A0LD 4KKLC 1SEBB 4APQC 1IM9B 4MDJB 4KZDH 3OV6A 3G5XA 4YZFF 5C8JB 4Q2ZA 4ODVL 3U48A 4LBEA 3UTSD 5E4EB 1AHWA 2J6EH 5D1QA 3BPCA 5KVFH 1NDMB 4WY7L 1J8KA 1A7RH 3ULVF 3V4UH 4JPIA 3QG7L 4PUBH 5ANMA 2P8MB 5SX5H 4YDIL 2HFEA 4LSRH 1HILB 4NHCL 2W0FB 4WU7B 5I8OL 5KJRH 2DDQL 3HNTL 4HJGB 4Y4HD 3QUYA 4ZXBA 2A6IB 3WD5H 5I16A 2ORBH 2JJWA 4YE4H 5KVEL 3PWVA 1BVKA 2MPAH 2G5RA 4OFPA 3MV11 4OJFL 4MNQD 5KZCD 3MJ9H 1LDPH 1GC1C 1HXMB 1XCQB 4JFHE 1LO3L 1T4KB 3D9AH 3S88L 4JHBA 3RJQB 4XP5L 3T2OA 4PJHB 5DVOA 2XZCH 5CD3A 1FL3B 3RWCA 5EIIA 3UBXG 4HIEB 4WFGD 2OL3H 4G43B 1HHIA 1FVEB 4EOWL 1DQMH 3MODH 3T4AA 2ZP0T 4EUPB 2XKNB 4BSWA 3MRMB 2FX9H 1C5CL 4AM0A 3MLRH 3FO0H 3K0WA 1LP9A 4RGOL 4NO5A 1G6RL 1DFBL 5D1ZA 4ZQKA 1AQKH 3S5LA 1H8NA 4DVRL 4TNWF 12E8L 3G9AB 4ODTL 4PGJA 2X2YA 3REVB 3I02B 1F2QA 2QSVA 1T83A 3ZE1F 4P4KC 3O6FA 1OT2A 1K2DA 3OG6B 2Z31C 4GG8A 5D7LD 2MJWA 5BVJB 3X13B 1FN4B 5GGUA 1DVFB 2OJEA 3MXWH 3N1MC 3MRRB 5D71L 4PGBB 4LCWA 5IIEB 3FOMB 1O0VA 1UYWH 4NSKA 4BZ1L 2GEEA 2Q87A 2ZNXA 4X7TA 1KXQE 2AGJL 3QDJA 4G7VL 4ZUUB 1SBSL 1WEJL 2A73A 1IRAY 4WI8A 43CAA 1FNGB 1CGUA 4MHHG 2HH0L 3VCLB 4PJFA 2XZZA 4U05A 4QRRD 4UINH 5C8JA 2CRMA 2QQKL 1EFQA 3FT4B 2Y6SD 4IHOA 1TVBB 3NAAL 5I1CL 2DI7A 1TZGL 1R5VB 4HPYH 4OZHE 3KYKH 1MLCB 4G8FB 2FDBP 4JM2C 3F58H 2P8MA 4FHBD 5T1LD 4TUJB 5EU5B 1U36A 1WAAA 3ARBD 4H25A 1ZHLB 1N6UA 3RHWF 4R90H 2BOCA 2A6IA 3FCTB 1S8DA 3GO1H 3OKMB 2BNQB 3Q5OA 5L9DH 5C07D 3Q48A 1XMWA 4N9GB 4QRSA 1HXMA 2R56L 1T03L 1N7ML 1TTFA 2R1YA 5TJWK 3EOTL 4ODVH 4OKDA 2AQ2A 4MX7A 4XVTL 1KENL 2GK0A 4Z7OF 4PLJC 5EU7E 4N0YL 1T20B 2XFXB 3A67L 3D18A 3DV6A 4L1HA 4WY7H 1OB1B 3TV3L 5C0FB 3QG7H 4HG4K 5FHBH 1DEDA 4J6RL 2XKNA 4YDIH 3KYMB 3OL2A 5I8OH 3PGDA 5KSVB 3HNTH 2F54E 4CADB 2F5BL 1QSFB 4JM4L 4TOYL 3ABZA 2HVKB 1AGEA 1L0QA 2DQDH 4OJFH 3IGAB 1F3JB 1Y6NR 3IFOB 5ALBL 3O8XD 1LO3H 1A14L 1ZHNB 1NDGB 2OMBA 4XP5H 3T0AA 3MJ8B 1FNAA 3MGTA 3PWUA 4ZOAA 4ODSL 4FQXB 4DCQB 3PWPE 4JQVA 1FFQA 4U1JB 3VFRB 1QFWL 3BJLA 1AP2A 1HH9A 4EOWH 4ETQA 3ARSA 4H0GA 5ETUA 3RWHB 5F6IC 4PYHA 1C5CH 5MEPB 3ZKMD 1EEYB 1Q9WB 4ZUUA 1UT9A 1OAUL 2EDEA 1BWWA 5GGSY 1EFXB 1FNGA 5I19L 1A21A 1I1CA 1KLUA 3VCLA 1DFBH 5DJ0A 3TIDA 1FZOB 3ZDXE 3EYUH 3FT4A 3NIGE 1CG9A 12E8H 4O58L 3QUML 4ODTH 1YNTB 5BVPH 3LB6C 1IQWL 1ZLWK 4NN6C 2YOCA 3TO2B 4GRLC 3WFHA 3LRHA 1YMMB 5I6XB 1MLCA 1RZFL 3RVUD 1UB5A 4Y1AE 2WAHA 3VFWA 1MVUB 3T4YA 4MQXC 1LEGA 4ETYA 5E95B 3EJZC 4PG2C 3SY0B 2B4CC 5D71H 4MA3A 1P7QD 1JZ6A 4BZ1H 1H3PH 1XF2B 5B4MC 4JPKL 4M9OA 5CKGA 4AEHL 2AGJH 4XB8A 5I73B 4G7VH 1SBSH 4YK4C 3RA7L 3MLXL 1LWRA 4N9GA 1DANT 5EULV 4EBQL 5ISZD 4LAJH 3JVGA 4URTB 1NGPL 2QQKH 4NJ9L 4BK4A 2AJVL 5B22A 3BN9C 1KJVA 3NAAH 2UWEA 3MZGB 3N50A 4LDOB 3VXUB 5I1CH 2FECL 3G6AA 4Y88A 1T20A 1TZGH 2XFXA 2VTFA 2D7PA 1CZ8L 3VFVB 3CVHB 5C0FA 1HK6A 3P4NA 3ZKSD 4RMUA 4D9QE 3BPNC 4RIRB 5I18H 1MFNA 1OARL 1A6UL 3S37L 1JHKL 5KS9F 2C3VB 2W9EL 1TENA 3KPRD 3LD8C 1B0RB 1D5MB 3TLRA 1IAKB 5IVXE 1M1SA 2JF1A 2R56H 4YC2C 1GGYA 1BZQK 5IR1A 1A2YA 4X0KA 4WWKA 1XF5A 1ERNA 3EOTH 5E9DD 4XVTH 5JXAL 1KENH 1RJLB 1R3JB 3JSSA 4HJJL 4DCQA 4K3GA 5HPMB 3VFRA 3ZKXB 4N0YH 3ZDYE 3A67H 4I4WB 1FFOB 3MLSH 3TV3H 2ZUYA 5DVNA 4PJXF 2IFGA 4J6RH 4ZAKA 4TSAH 3NH7L 2AW2A 1PKQB 1JMXA 3OKNB 5IEKB 2MCG1 4PP2A 3SE4A 4Q9RH 2F5BH 4CNIB 4JM4H 4TOYH 2BXZA 4PJDB 3VXSE 4M7JL 1FZOA 5GZOD 2XY2A 5ALBH 5F7DB 4F9LA 2IALA 3VFUA 4NQVB 5JW4R 3L3GB 4J3WA 1A14H 4O02L 4QRTA 3QIWD 4DQOH 4N5UA 3M1BA 2F53E 2D9QB 4GMTL 5T1MB 5B3JF 3B9KD 4HWBA 4XH2B 4ODSH 1A1NA 1MVUA 3U2SA 1X5ZA 2BRRH 3T1FB 1B0GB 1QFWH 3JWDH 1NUNB 5ILTL 3L6FA 3MTRA 2YUXA 1KCVL 2XN9B 1EAPB 2ADFH 4OAWA 5FF6A 4Z7VE 5DURB 3H2WA 1MFEL 4O51B 4TVSa 1OAUH 4X6BB 5EO1B 1DR9A 3D39D 3D3VD 3BP5B 1F45A 3GSVA 5LGJA 2X9WA 1OTSC 2JK5A 3QUMH 4JFDE 4JFPA 2IAND 3RX8A 3KPQA 2YK1H 4F3FB 4AENB 1BJ1H 2R1XA 3D85B 1RZFH 4HG4J 4PJEA 2D0HA 3CVHA 3WLWC 3TBVB 4NO0D 1YECL 1G84A 4HIJB 2BJML 3OWEA 1MF2L 3ARXA 4S11A 4F15C 2V9TA 4P2YA 1SJHA 5HD8D 2NY4C 4Z7UB 5IVZB 5IP4A 3ARFB 4PRHD 2C3VA 4IEFB 4JPKH 5IB3A 3BRDA 3VG9C 1T0NB 4AEHH 4NNPH 4ELKA 3CFJB 3QFDA 2P49B 1D5MA 3RA7H 3MLXH 1IAKA 5E8NA 4ZS6C 3STZB 4P2RE 2DL2A 4L3EB 4EBQH 2FSEB 5GSRA 1NPUA 1MRCL 1RZKC 3ZL4L 1FNLA 4X83A 4LCUB 1RK1A 4NJ9H 5DUPL 1HHKB 1I1YA 1KGCD 4HGWB 3MROA 5HPMA 5E00B 3LPWA 1O7VA 1CZ8H 1FFOA 1KOAA 5F7NC 5IW3A 1NCBL 4GG6B 2AI0L 4H1LA 4PJ5B 4P9ML 1I1AA 1T66C 3GSRA 1OARH 1YY9C 1UWGL 1XGYH 3PGCB 5EC2B 1A6UH 5JOPD 3K4ZA 3S37H 4OZGA 5DMKB 1JHKH 1HOCA 2W9EH 3IJHB 2IBZX 3QIBD 4L4TA 1KN2L 4PJDA 4U1NB 4L4JA 1KTDB 2P1YA 3CFDB 3IB4A 2HLFC 3KJ4B 4GKOA 3Q2CA 3QNZB 3L3GA 2VZ1A 5JPNA 3LIZH 5F88B 5T3ZD 1P5UA 3DVFA 2GI7A 4NN7B 2FCBA 4F7EB 4HJJH 4RAUA 3T1FA 4LF3B 4MDIA 3C6LC 3KPLA 1U8KB 1F4AA 4N8CH 1M71B 1UACL 1NGYB 2JIXD 1IC7L 4O9HL 1MNUL 2X4QA 2X4RA 4HT1H 2VB5A 3NH7H 4FMKA 3K81A 4GLRH 1V8HA 1T1ZA 1XGQA 5EO1A 4X4ME 1AO7B 3FN9A 2X4UB 2I60H 3H9SE 3BP5A 1U92B 1J18A 1BX2A 4HZAA 4LLAA 4MHHI 2YBRA 3RL1B 1BP3B 1N0XL 5EUOE 5C09B 1A6ZB 1YNKL 4LLDA 2VLJE 2QEJA 4M3KB 1RZJC 3GSQA 2AXGA 3UBXA 3V7MA 4GMTH 3TBVA 3DI2B 3K46A 3NTCL 2NQCA 2IPKA 4HIJA 3MX0A 2NX5A 1Q94B 5BOPA 4KKLD 4APQD 2ATPA 4Z7UA 5T1KB 4LLYA 4BM7A 5ILTH 3ARFA 1KCVH 3NCMA 4BJLA 1JBJA 1OWWA 4JQXC 1MFEH 2XT1B 2DLHA 2GSGB 1F3RB 3CFJA 5BRZD 4JFQB 1ADQA 4M3JA 1ZVSA 1QYGL 5L8KB 5MHSD 2FSEA 2IQAB 1D9KC 2VWEE 2DYPD 1NGZA 3U9PL 3TA3B 4CU6A 5F9JB 4Z7NE 4Y5YA 5DQDL 3QDGD 1G0XA 3BHBB 2DWEA 5DS8B 5FCSH 3T8XA 4K94L 3SJVA 3WS6A 1G0YR 1OY3B 4NHUA 5CFHA 4KFZC 2APBA 5TE6L 4KRPC 4EI5B 4PREB 4UAOC 3GI8L 4EZMA 1K4DA 2UVFA 2BJMH 3FONA 1MJUL 3HFML 1U8JA 3V6ZA 5JXEA 4B53A 2D7TL 1YEEL 3BGFB 5DYOA 3IJHA 1H3WM 1A0QL 3B4NA 4FZ8H 1IAIM 2MSPA 5GRVK 4PTUA 3HZVA 1Q9OB 4H26B 3QNZA 4HEME 2V2XB 4N5EC 3ZL4H 2ICWB 5DUPH 3RDTC 5EBLB 4DFIA 1JZ8A 3H9HA 1VGEH 1BOYA 3HG1D 1MHHA 2KQMA 5GIRA 4F7EA 2HLAA 3DGGB 4XNUL 2DB8A 3GNML 1E4XL 2W0KA 4GUPA 4KGLA 2VLRB 1CD8A 1NGYA 1MCCA 1P6FA 4YDLC 1Q8MA 2NY1B 3V6BR 4HUMB 2IFFH 2X70A 4L8SA 1WSST 5GISL 4JFFE 2XRAL 2AI0H 2W60A 4JRYA 4P9MH 3P11L 1F58L 4PGDB 1UKSA 4PGEB 1UWGH 1AO7A 2ZJSL 5F3HB 1UENA 3FN0L 5GPRA 4FTVD 4K3DH 4P4KD 3MJ7B 4ODXA 3CSBA 1TJIL 1KN2H 1RJCA 4RMQA 2Z31D 3RL1A 1IAOB 5GGRB 3IXAB 1JWUA 1X4YA 4LVEA 4HMEA 1Z6JT 1FYTE 4CMMB 3H9ZA 1RIHL 5I8CB 3HMXH 3NCYP 4LLVB 2C1PB 3FTGA 4FNLH 3FO2B 2X9XA 5KSUB 5J57B 1UACH 3RL2A 1MRFL 4Y19E 1IC7H 4O9HH 3L3HA 1MNUH 4LASL 3V79C 4WUUD 2HKFL 1KLGA 3VXTB 1X5KA 4DAGL 1U95B 3HMWL 3B2VL 4QGTA 5CP3H 2Y36L 4UMGA 3KDMB 2IQAA 4JM2D 5I75B 1EEQA 1JYVA 5EOQL 4X8XA 2Z0BA 1UZ6F 1IZJA 4QHUB 5EZOH 1N0XH 4GBXB 1YNKH 5IF0B 1QSVA 4PRIE 4XP1L 5DS8A 3AREB 4C56B 1UXSB 4LKCA 4L8DB 4OLYL 3SGKC 2DWDB 5BV7L 2W07A 3FQWB 3H0TA 2YD5A 2BOBB 2DIBA 1JHLH 5DT1L 3O0RL 3SDCB 5FYJD 4J4PD 4PBWD 4PJ8C 3T0EB 1T0MB 1CDCA 3HC4L 4XCFL 3QSKB 4ZFOB 4RMRA 2CIIB 1YY8B 2AJYH 4HH8A 4UQ3B 4PLJD 2H2PC 4PV9B 1QYGH 4XPBH 5D2NC 1ETZB 4OZIE 3CDFA 3PDOB 3U9UA 5H37H 4XCNB 3JV6A 4HKJB 1I8MB 3U9PH 4OGZA 5JDJA 4NNXB 5H37G 1JWSA 3HS0B 5C86A 3DGGA 3ULSB 4P2CG 1WVZA 3W2DH 2VLRA 1DLHA 1ZAGA 4MB5A 4ZUWB 5TE6H 2DQHL 4KI5D 3GI8H 3QPQC 5DZOA 3LPFA 5C08B 5I71B 1MJUH 3HFMH 3ZE0F 4NWTH 3VD9A 1BQHG 1JNLL 1UB6B 3UP1A 4KUCF 2GAZB 1YEEH 2ITCB 1A0QH 2J3SA 3IDJA 3QQ4B 2Q7YB 1KJMB 5JHDA 1K4CA 1IAOA 5KAQG 4Y2DC 3UTPD 2JB5L 4MSWA 1H8SA 4JREB 5EUKB 1LMKA 4CMMA 1LE9A 1F5WA 3QA3A 3HUJE 5I8CA 4KGJA 3QCVL 4XNUH 3GNMH 1E4XH 1S7UA 4MNQE 1MLBB 5DR5H 4IIQC 2IEPA 1MCEA 4Y16C 6CGTA 3BGAA 5GISH 3WDIA 1FLRL 2XRAH 3V52L 4XCEA 3MRPB 4EQ3A 1F58H 3LB6D 2C5DC 1QFWI 3BKYL 2H8PB 5CHNB 5DVLA 5I1DA 5K59E 4GRLD 4OGYH 1CF8L 1FSKB 4OCXL 3MUJA 4LU5L 4NKMB 4MJID 5EPMB 5ESVB 5JW4N 5T3XE 4RAHA 4MQXD 1U3HA 3TNNA 4QHUA 3I6KB 5D5ME 5T3ZL 3QHTC 3ZKNC 5J1AB 1MCIA 1MAML 5FGRA 3AREA 1YEDA 4C56A 1WWCA 2P5EA 4L8DA 4HS8H 5B4MD 2YD1A 4F37K 3E6FA 1DTUA 4I18C 5F71A 3IFNL 1JWMA 3M17A 4RBPH 4TUKL 2MWCA 1MRFH 2XTJC 1FH5L 2VLLB 3WN5C 1KCUH 5IK3B 4YXLL 2Z35A 3CAFA 4MD4B 2NY5C 3SE3A 3RVXD 1YY8A 3L5HA 4NRYA 3B2VH 4D2NA 3FFDB 2Y36H 3A6CL 1BF2A 5EOQH 4F7CA 2BDNH 4HKJA 1XGUB 1CFQA 1MCPH 4PJAF 1T7ZA 3TZVC 3BWAB 4NNXA 2I07B 2P47B 2P44B 4CMHB 2ESVD 3WIFA 5KSAA 2R2EB 1DBAH 1VCAA 2A6KA 4NC1E 1EX0A 4G42B 4XP1H 1JGDA 1LVEA 2ERJB 4OLYH 4N8VG 3IS0X 1TXKA 2ZUVA 1HI6B 4LCYB 3VMOA 4Y8DC 2I9TB 1UGNA 4YH6A 3F6LA 5EU4B 1F2XK 4QRRE 5IB5B 4O4YH 2AJ3A 1WJ3A 5DT1H 3AFLA 3O0RH 2BZDA 2IPUK 4Y0GA 5J12B 3L3JA 4V1DE 5ICYA 4OQTL 3HC4H 4B50A 4XCFH 3P73A 3MV8D 4QGYA 5DLML 3T08A 3QQ4A 5TE7L 4I5BB 4WW2F 1QTYT 1A9EB 2FJFA 4BFIB 3D48R 3MCKB 2P5WD 1NBYB 4YHNA 4YPGB 5EUKA 1E4WL 1KEMH 3GI9H 1RMFL 5GZNC 3FHAA 3GMLA 1UCBL 4N0RA 4ELMA 1OGAD 1U93B 3DIFB 1IKNA 5CIPH 1GC1L 1VEOA 2DQHH 1KIRA 3V5KA 2QADB 4M7LT 1FCGA 1SY6A 3MRPA 2VO5A 5CHNA 4TNWK 2I26N 4CN4A 1HWHB 2CIKB 1JNLH 4QXWA 5JHLH 5E5UB 4NKMA 5LCVH 3RUGA 4P3CL 8CGTA 3LEXA 3QXDB 3KXFE 4GLRI 2AXJA 1QRNA 2E27L 4GAGL 3I6KA 3VFNA 5D93C 3VI3F 2JB5H 3I6LD 2Y7QA 1HNGA 3BISA 2GTZB 3QNXB 4YBLB 5DRNB 1MUJB 3QCVH 3FQXB 4XNZB 1JF1A 3TC9A 2JJUA 4ZS7L 4TVPD 1FLRH 3V52H 1OTSD 4WI7A 3FO9B 5EZJA 5C0GA 3BKYH 5SWSA 4I13B 2X05A 1RZIA 3K2UL 4OV5A 3QHFL 4LU5H 4XBGA 3MLPA 1X5FA 1X5IA 1N4XH 4PP1D 2HVJA 1GOGA 1NMCB 1WBZB 1CTOA 3BRGC 3SKNA 3S8WA 3S9DB 3T65B 5T3ZH 1YEIH 3OGOE 2IBZY 35C8L 2FR4A 3R0NA 4HIIA 1MAMH 3FAXA 2NY4D 3CNKA 4HFWA 4G42A 2K7QA 5CUSH 2ARJA 3RHWK 2G5BB 2GYSA 3MBEC 3DX6A 3G5VA 2DMKA 2I9TA 4KDTA 2BMKB 2PYED 3GMOA 4MAYC 4NQCE 3TBYB 3IFNH 1WTGT 3RPKA 4B7LA 4ZS6D 4Z9KB 5AWNH 2D31B 4NFBA 4TUKH 2BSRB 2R39A 4P2OB 1FH5H 3EO1B 5C0BE 1XIWB 2JTDA 3BT2L 4YXLH 2J12B 4YX2L 4MCZB 4LK4A 5E7FA 2VZSA 1BZ7B 2C3GA 2Q86B 3QXUA 4HUXA 3SDXF 4XXDB 4P9HH 5MEND 5ESAB 4C58B 1NBYA 1PX3A 1ONQA 4K07A 1WICA 3R06A 1F90H 5IKCB 1T66D 2FZ3B 5DSCB 4NN5B 1YY9D 5EOCJ 4J3UA 3FOLB 3J7HA 4OD2A 3V6OC 1P9MC 3C5SB 4N0UA 5FYJL 4NKOA 2I25N 2J8UE 4RMWA 2HLFD 3EDDA 4IRJC 1HKLL 5KTEL 4I0PB 3GMQB 1J1PL 4OQTH 3O4LD 4EN3C 1U8HB 1IT9L 3ARRA 5DJZA 1VHPA 5DLMH 4L29A 2OQJB 3QXDA 2X4SB 1MCWW 1KEGL 4R4BA 3KPSD 1IEAB 3VRIA 1U8MA 2H32H 1P7KB 1E4WH 4JZNB 5DRNA 4WUKL 1I9RL 3PXHA 5FK9B 1MUJA 3C5ZB 5B8CA 1UCBH 1PLGH 1KIPB 3LKSA 1XEDA 5I66B 1IGJA 2VQTA 5I15L 1FNEB 1GC1H 1QLRB 3TO4B 2XQYG 1KB5B 4U1KA 1D5ZB 4HS6B 3C6SA 3WIIL 5C0CD 4GJTB 5BZWA 3G6JE 2X89D 5BS0D 4P3CH 1T04A 3W81A 3RY4A 3ZYZA 5HHOE 4GAGH 2E27H 3T65A 4TTDC 4Z7WE 2WWKT 4QXTA 3T3PE 2AK4D 3REWB 3S4SG 3QI9A 3NIDE 4MQ7B 2XG5A 2MHAB 1WBYA 3ZLQC 2G5BA 5KS9B 5ITBL 1PG7W 3LN5B 3TBYA 3U0PB 5TDNB 4L9LB 5A2FA 3WIHL 2WM0A 3WHE1 2ZUQB 2D31A 3BVNB 2BSRA 4P2OA 4XPAH 1D9KD 4AY0A 4PRPB 4XPGL 3GMRB 1XIWA 4QYOB 1N2RB 1N6QL 3DSFH 1P4LB 4S2SB 4U1GC 3K2UH 3QHFH 3ZT5A 4CN1A 2Y5TB 3ROLA 4I3SH 2NZIA 4Y5VC 2B4CL 4KRPD 1IGML 1X5YA 2HJLB 2NNAB 2V7NA 4PJXB 3ZT6A 1MHPH 4MGXA 4JLRB 3BQUB 3TVMA 5MEQB 5IKCA 3FO1B 3NFNB 4X6DE 3GSNH 2FZ3A 5DSCA 5HHVL 4WI3A 4R4FH 2BVOA 1JHTA 4HJ0C 3D39E 2DQUL 4NZTL 1D6EA 3I75B 1OPGL 1XGTB 5CGYC 2R69L 3AB0C 2YC1B 1RK0B 1ZS8B 2ZCKL 4R9HA 1WC7B 1QO3A 1BLNB 4KVNL 4N5ED 4FFWC 5E94B 1OVZA 3VGEA 1CVSC 3RDTD 3BT2H 15C8L 3ILQC 3GIVB 2OQJA 2EH8L 1IEAA 3BXNA 2XV6B 1EBAA 5IQ9B 3S35L 4N90D 1MJJA 3AAZA 4PRHE 4NQTA 3U4BL 2H45A 5DJCA 5GJSL 3C5ZA 4BFEA 4HWNA 1NFIB 1P53A 1DUZB 3BZ4A 1TCRB 2CUIA 2YPLA 1QLRA 4ZD3L 1KB5A 1EV2E 2WUBL 5J13B 1J0KA 5HI5D 2EXWC 1E4XI 1R3LB 3DECA 4PR5B 3OX8B 3F7VA 1HKLH 4JO4L 1T7WA 5KTEH 3BIAX 4WHDA 1AHWC 1WQVT 1J1PH 3N9GL 5SWZE 4JKWA 3IDYB 3C60B 5DD3L 5D1QC 4IM8A 5I74B 2ED7A 4RDQG 2R0LL 3WXVL 1KEGH 4JFEA 4FQCL 2P8LB 1B4JL 5DD6B 4G8EA 3REWA 2HT4C 2JJVA 2HFFB 2UUDH 4MQ7A 4NO2B 5DVMA 2X41A 1XF3B 3DVIA 2EC9U 3QUYC 4WUKH 4ZXBC 1S9XA 4ORGA 5IV2A 1U8PA 3LN5A 1PVHA 3UJIH 1A3LL 3NOIA 2YEZA 4L9LA 5CMAB 5HDBF 1ZGLM 5D6DA 1MI5B 4RA0C 1ACYL 5DK0A 3EYSL 5I15H 4HUWA 4PRPA 1ES0A 4FQLL 1BQHA 3O2VH 4FQPA 1ZSDA 5T5FL 4S2SA 3KG5A 1I9IL 1GYAA 3V2AR 3FMGL 1X7QA 5F9AC 2B2XH 2O61B 5HJ3B 2Y5TA 1H5BB 3QG6B 1NJ9A 3E2HC 4JG0L 3T2PA 3LS4L 2NNAA 2XZQL 2R1WB 1H0DA 3LKPA 4R26L 4WW1B 3Q6FA 1ZT1A 2NW3A 4EQ2A 5DD0L 3ZO0A 1F6LL 1TPXC 3VWJA 4KMQA 4CVWA 4WCYL 5ITBH 3ZE2E 1N59B 1G7QA 2IC2A 2VOTA 1XGTA 1UCTA 3BPOC 1GHFH 4UT9L 4RMSA 5EU3A 3WIHH 4TVPL 2NMSA 1M7DB 4U1IA 4XBEL 1YYLL 2VUOA 1UM4L 3EYQC 4LLMA 2A83A 4OZFH 1Q9KA 1WCQA 3GIVA 3O6FC 4GKZB 4QCIB 2QKIB 4RFOL 1Q72H 5DRWA 4L3CA 4QRPE 4D9LL 3WFDH 3T3MF 3HE7B 1IGMH 3DBXA 3QEHA 3QPQD 3GJFB 4M6AA 1F00I 4N0FB 5IMLA 1AR2A 2FH6A 3OB0K 1N5AB 1AXTL 5HHVH 2Y4SA 4X6EA 4Q9CA 4OZHB 5JW5A 2JCCE 2DQUH 2PYFA 4HCRH 1T5WB 3PG2A 4FFVC 5L88L 4NZTH 1OPGH 4XC1L 1RZKL 4HV8A 4G5ZH 2WZPD 2ZCKH 1JVKA 3G04B 2RBLA 5TDOA 4KVNH 5LWYH 1UH3A 3S3PA 4NQXB 2FJGA 5DMGC 3SKUD 5FXCH 15C8H 1Z0NA 3SOBH 4HK0A 4LVOB 4D94A 2J4WH 1HE7A 4O2EB 1FG2A 1BIIB 1YEGL 3IKCA 4DEPB 2KUTA 4Y16D 2GHWB 4XMLH 4NO2A 2DS4A 2W65A 3OQ3B 1C5BL 4QNPE 1CXIA 4DVBB 4U6YB 3MV9D 4M5ZL 3U4BH 3WV0A 4WNQB 5GJSH 4IRZL 1G7HA 4N8VA 2VZOA 2AEIT 5JW3H 1N5YL 4YNYB 3VXRA 3LRGA 4JDZA 3U0TB 5IB4B 4NKDA 1LK2B 5SWQB 4ZD3H 3MNZA 1IC5L 2WUBH 3RTQA 3ZKND 1KC5L 3U83A 4JO4H 4X9HA 2F54B 3N9GH 4OFIA 1J0ZA 5DD3H 1KACB 3ILPB 4Z5RA 4K9EC 3ARDB 1U41A 4CDHA 3WXVH 4OM0L 4FQCH 5K9OB 1B4JH 1IVLA 3BP7B 3W0WE 1F8TH 5GRUL 3E6HB 1JK8B 1K8IA 1FL6A 1PYWB 1GIGL 4EIZC 1N59A 3AMLA 1XFPA 4JY4B 5IB2B 1NEZB 3SQOL 3MV7B 4Z0XA 1ACYH 1M7DA 2XICA 3EYSH 4ONFL 1MCFA 3RWDB 3FFCD 3RRQA 3RVTD 3ULUC 1RZJL 4M43L 2HA1A 5T5FH 1G9NC 3UZEA 1I9IH 5T5NG 3FMGH 4BK5A 5BJTA 4JQVC 3L5IA 4NRZA 2X1WL 4DUXA 4CVZA 3L7FA 4JG0H 4U31A 1CD0A 4ZFGL 3PL6B 5KAQF 3RKPA 2RHEA 5FKPB 4WO4A 1JV5B 4LPVA 2XZQH 4KV5F 4OIIL 3CLFL 2IG2L 4N0FA 5GS0C 3L3IA 1NAML 4OUUA 3QDMD 4OZHA 4BH8B 5DD0H 2VYRE 1G7JA 2VAAB 3RFZC 1OAKL 3IF1B 3ARGD 2WWMC 5HYQA 3QEQB 3V4VH 1N0LA 4IJ3B 1VFUA 4S1SH 4Q97A 1U9KA 3OAZK 4UV7L 5JTWA 1YYLH 1XGRA 2PXYB 3GSWB 3U36B 5J6HA 1MHCB 1UM4H 1MWAL 2QR0A 1I3UA 1DP0A 5GZND 1S9KC 4MA1C 5HGHB 5JQ6L 3DV4B 4XAWH 3QFJE 1BIIA 1REIA 4RFOH 4NQDD 1DEEB 4V2BA 3RGVA 1PX4A 1YEFL 4D9LH 5FYJE 4NKQB 1JTOA 2R0ZL 4U1MA 4JAMB 1P69B 1JGUL 4U6YA 3B2UC 1AXTH 3JTSB 4R0LB 1C7TA 3L7EA 3ESUF 2FO4A 3F7QA 3K7UA 3U0TA 5IB4A 1T3FB 2XWJA 3N85L 4YFEA 5SWQA 3QUXB 3JVGC 5DC0A 2HN7B 3BN3B 4H5SB 3S3SA 4I3GA 1U91B 5D7SL 1RZKH 2R2HB 1WISA 3QULA 3LN4A 4OI8A 4KUZL 1BQLH 1GZPB 2Q3ZA 4NPYB 1IBGH 2NXYC 2G9HB 2XNAB 2Q6WB 3X3GL 3ARDA 4P2QE 4XTRC 4D8PB 2WK2A 1MREL 3MYZA 1KPUB 1U8IB 1VESA 2OL3B 4KI5E 3F62A 4YGAB 1FO0B 5IHBA 2AK1L 5DJ2B 3PP4L 9CGTA 4PB9L 3VFPB 2VQUA 3E6HA 4M5ZH 1DUYB 5JMOC 3PWPA 4IRZH 4HUVB 2SEBA 3DGCR 1CICA 4JY4A 1TETL 3SDYL 4BSVB 5IEHA 3TIEA 3X14B 4ZOCA 3BKCL 4HPOL 2R29L 1N5YH 4R8WH 1BD2E 3MRGA 1IFHL 4CRPA 4U49A 3RWDA 3GMNB 3TFKD 1C7SA 4ODBD 2EEAA 3P4MB 1CDIA 5A16B 4ISVA 2W1NA 2R0WH 1GGIL 1VFAB 3PQYE 1NC4A 1VADB 2HYMA 5CJ5A 4LHUB 1FIGL 2VISA 3A6OA 3ALXA 1W72L 3MBED 3UTZB 3KWWB 3UMTA 2C3HA 4OM0H 3D5OF 3G5YA 1WLHA 4ZAKC 5EU6B 4MZ2A 4NBYB 3BH8B 1PSKL 3HI6H 1MVFA 4P46B 1R0AL 2CDGA 1T5XB 1DZBA 1AC6A 1A9BB 2IH1A 4Y1AA 3SE4C 2JLLA 2HKHL 2XG4A 1GIGH 2ZSVA 3TYFB 4K8RC 5KG9A 5BMFH 5HDOA 3MLTB 32C2A 3VRJA 2UZXB 4ONFH 4F9LC 1YJDL 4GT7A 4HKXA 1BOGB 3ZKQD 3MLUH 5L2KD 4GKNA 1RZJH 2J5LC 2V5TA 4WV1A 2K9UA 1OAQL 5IESH 5GSVB 4ZFGH 4MAUL 3S4SA 3HC0B 4JAMA 4OIIH 4QY8A 4HS3B 2IG2H 3DO7B 1NAMH 1Z9MA 3JTSA 3NGBB 3AS3A 4PJHE 1J0YA 3O9WB 4JVWA 3S3JA 3L3DA 1T3FA 4EN3D 4FFYH 1OAKH 5CJQL 4H5SA 2DTSA 3QNYA 4X4ZA 3H3PH 4NUGH 3P40A 4IDLA 1A7QL 2WNGA 2DD8L 3LEYL 3ULVD 4UV7H 1U2CA 2ESVE 2MMXA 1BJMA 2NY2D 1LO0H 3P9MB 4KROC 4AT6B 5T3XH 5JQ6H 4ONOA 3RWJA 1NCAH 4D8PA 5KW9H 2XYCA 1U8IA 3L1OL 2MCPL 3QWRA 4DGYL 3ARVA 5IVXA 3MGOA 1FO0A 1YEFH 4ZO6A 1CXFA 3IU4L 5DJ2A 2R0ZH 4NBXB 2AXHA 3MRBB 1JGUH 5KN5A 4JN1L 5C0NC 1DUYA 4FQ2L 4RX4A 5F7MC 3GSNA 3IVKB 2GW5A 4WFFE 4PY8I 2DIAA 3N85H 4GQ9L 4YIQA 3P4MA 4GXUN 3K74B 1CDYA 4TTDD 1XF4A 4KUZH 1C12B 5D7JB 1NGXA 2EYRB 1S9VA 2ZUSA 5F1NB 1BAFL 1TIUA 3VXSA 3OKLA 5JNYA 1ZANL 1EH9A 3WNOA 1ZA3B 1MREH 2D4DA 1YNLL 1NBVL 4TQEL 5A2JH 1I1FB 5JDSA 3NN8B 2AK1H 2BK8A 3LHPH 4M4RA 2GCYB 1I1AC 1X5HA 4PJ9B 3MOQA 2VRAA 3GBNL 4MVBC 2F53A 3HAEH 4LPYA 3RU8H 3KPPB 4JRXE 3TYFA 5GRVL 2UZIL 1V05A 1TETH 3HAEG 4WW2B 3SDYH 43C9A 2N7BA 3BKCH 4HPOH 2R29H 1LEIA 1G6RB 1IFHH 1ZXQA 3MMEB 3VW3L 1C16B 2W59A 3IT8D 1LO5B 1HYSD 4LVHB 4DW2L 4Z7VA 3VXMB 1DBML 1FORL 1JFQL 2C3WA 2AJSH 2IMNA 4DKFL 1OLZA 5INCA 4G9FD 2ENSA 5AAMA 4HJ0D 3H9SB 1FIGH 1OSZA 1W72H 4QF1A 5BXFB 4CDGC 4Y5XA 1FVDB 5CGYD 4HS3A 4JFDA 5E1AB 3BSZH 1AD0B 2IH3B 3QUZB 4LIQL 5EORH 2VLJB 1PSKH 2H26B 4N0CC 5FCUH 1R0AH 2NY5L 2EZ0C 4FFWD