2FAZA

Ubiquitin-like domain of human nuclear zinc finger protein np95
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
SMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-like containing PHD and RING finger domains protei
total genus 22
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fazA00
5D94A 1Y8RC 2KX0A 3DQVA 2D10A 2LVOA 4PYZA 1RAXA 3ZO5B 1SIFA 4WJQA 4LJOB 1LFDA 2LXAA 2EMTA 4KIKA 3VAWA 3VUYA 2M4NA 3OLMD 3JVZX 3UF8A 1WE6A 3DBLI 3M63B 2LWPA 1TGZB 2WWZA 2DZIA 2DAJA 2L0FA 4G50A 2JZZA 4MGKE 1HE8A 2KO3A 3L0WB 4II2B 3TCAA 2MX2A 1SE9A 3HIZA 3R66C 4IUMB 1BT0A 1UBIA 3PLUA 2NCNA 4II3B 4LJPB 4BVUC 2FCMA 4E71A 3KW5B 3PVLA 2C60A 1WE7A 2FIFA 2FUHB 4GOCA 3A4RA 4DHJD 2A5UA 1EUVB 1GC6A 2DENB 1ISNA 2M0XA 3DVNU 3H6NA 3A9JA 2GOWA 3DDCB 1K8RB 5AZFA 5BO4B 3DBSA 3ZRCA 2KXJA 2ZZPB 5J2RA 4ANUA 3QAQA 1E8XA 1U4AA 5E6OA 3PV1A 2KNBA 3TIXA 4EEWA 5CHWA 3PSEB 2IO2B 4GDLB 1ZGUB 4A3OA 3WIMA 1WR6E 1WIAA 2J0MA 3ZIMA 5LXIB 5KHQA 5C1ZA 4ZDVA 4CO7A 3PGEA 2PPHA 4B6WA 3RCZA 1YX6B 1G6JA 4HJKA 3QQ8B 1WZ0A 1WM3A 2N1VA 4DHJB 2KC1A 3N30A 3EC8A 1JRUA 5G55A 1WXMA 2O6VD 2BYFA 2RGFA 2WX0A 4DK5A 3IBEA 5JHAA 1UGMA 5IA7A 2C9WB 2CHWA 5E6PA 2L7RA 3AULA 3L54A 2OJRA 3APCA 4K7UA 3PPAA 1V86A 2JF5A 2NBVB 4MDKE 4CYEA 3A1QA 4IG7B 3N3KB 1OQYA 3V61A 3S2AA 2NS5A 1XT9B 4JIOU 4YL8A 3ZRFA 3T8MA 3H7PB 1IPGA 3D32A 3V62A 1WJ4A 2XK5A 5DPTA 2FCNA 4IM0A 1UH6A 3WA0A 2KTFA 3N32A 3PLVA 3IFWB 3Q3FA 1X1MA 3PRMB 2A4ZA 1WJ6A 3KYCD 3L10B 4NY0A 2KK8A 1WGGA 2KFKB 3ZDTA 2UYZB 3SU8X 3EFUA 3KH0A 5C23A 1WX8A 4RM8A 2CU1A 1UBQA 2R2QA 4W9KA 4DDGD 2ZNVB 4NJ6A 1V81A 2AWTA 4G0NB 2UWQA 2WYQA 1P98A 2MCNB 4AJYB 1S1QB 3DVNV 1H4RA 4E74A 4M8NA 4EZLA 1D3ZA 1WGYA 3NS8A 4FN2A 4W9IA 3QCAA 4F1SA 4LCDE 3A33B 2D2QA 2BGFA 4WAAA 2L76A 2NBUA 4JL9A 2KWUB 4HCNB 4NJ7A 4AUQC 4I6NB 3R7RA 1R4MI 1UELA 2BKFA 2MP2B 2BWES 3ENEA 3EHVA 2IZVB 2RR9A 3M62B 4RM9A 1OTRB 2K8BA 2N9EB 2REXA 2MRPA 4MSQB 3VTUA 2MBOA 4IW0A 4NAWA 1OEYA 2V4LA 4DHZB 3JSVB 3VDZA 4K81A 4W9HA 2BF8B 3AXCA 4HPMB 2IBIB 3DVGY 3UINB 2MA9B 2GBRA 3L13A 3DOWA 1V2YA 1E5WA 3ZNGC 2MWSB 2DYBA 4I6LB 2ZVNA 4FBJB 4FJZA 3QX1A 2GBMA 4WJOA 1P3QU 1YJ1A 2DZMA 3B1LX 4CHKA 3AI5A 3K9PB 3K9OB 4W9LA 1TBEA 5EDSA 3ZNHB 3L16A 2KD0A 4HCPB 4BKTA 2KANA 2KMAA 2BWFA 1V9JA 1Q5WB 2R2OA 4PS8A 3RZWC 4BBNC 2IO3B 1Z2MA 2LD9A 3UIPB 2K6QA 1J19A 2K8HA 2N9PC 4GN1A 3U7DA 4DDID 3AU5A 4HDOA 2KQ7A 2BYVE 1WH3A 2QHOA 3EECA 2C7NB 4G3XB 3PREA 4KSKC 3TMPB 3HM3A 1E90A 3QIJA 1H8CA 3VTVA 2FAZA 2DYMA 5D7GA 4EUTA 3QJZA 3T9LA 3ZNID 2KZRA 2L8JA 3KUDB 2KWCA 4FJVB 4OVVA 2D3GA 1CMXB 3VFKA 4ICVA 2D11A 2M8SA 4DHZE 2XK5B 1P0RA 3R7QA 2LVQA 3WAOA 1LXDA 2MBEA 4J6IA 4A20A 4KDLB 2I1JA 5DPSA 4N9F4 2AYOB 2EKEC 1VCBA 3NZUA 3BY4B 3TL5A 2JRHA 2GBNA 3A9KB 4KDIC 2G45B 3M3JA 1TZ1A 4HDQA 2LJ5A 3KUZA 3QK0A 3ZLZA 4B9KA 4BKGA 4EOYA 2XBBC 4KZ0A 1RLFA 1WX9A 1QZEA 1WXAA 3V6EB 3RT3B 4WJNA 3WANA 2KDBA 1FXTB 3ZDMC 4BFRA 3PHWB 3IVFA 2DZJA 4IWQA 2IO1B 2ZJDA 3AU4A 4ZYNA 4ASWC 4TV3A 1KJTA 1YX5B 3CSFA 2GBJA 4DWFA 5JZEB 2KWVB 4TUUA 2Z0EB 5J17A 1V5OA 1WJUA 2DYOA 2WX1A 2ZNVC 1C1YB 3JSVA 4MH0E 4F8CB 1WX7A 2N4FA 3KYDD 4EZJA 4A3PA 2K1FA 3ML8A 2JXXA 1E8YA 4FJYA 4KZCA 1EF1A 1TTNA 4BOSC 1V80A 2V1YA 4BKSA 5D2MB 1KM7A 2N9XA 2KN5A 5G2NA 3WAPA 4PS3A 4BKSD 2N7EA 1UZXB 2KJ6A 4HLEA 3ZNZB 1WZ3A 2JWZA 3Q3JA 2ZVOA 3V6CB 3PTFC 4LDTB 4NQLB 1RFAA 1YD8U 3ECIA 2L00B 4AWJA 2JVCA 4AOFA 2V3SA 1M94A 2Z59B 4GIVA 4GB9A 3WALA 2C7MB 3LDZE 3B08A 2MBHA 3ML9A 1I35A 2W9NA 2O6VA 2EMSA 4GGQA 1A5RA 1F9JA 1GJZA 2LASA 3A1QB 2YLMA 4KVGB 4HK2A 4ANVA 3RYTA 3MHSD 4OVUA 2KLCA 3X0WA 3PS6A 1WXVA 3PT2B 4IM3A 2O2VB 4ANXA 1T0YA 2N7DA 3KVFB 3VHTC 5DPWA 4NAWB 2NPTB 3NZSA 1WMHB 2DAFA 2CHZA 2J0KA 2RD0A 1E8ZA 3QC8B 4GDKB 1J8CA 2JT4B 4W9JA 2MSED 1NBFC 1S3SG 1WGHA 5CX3A 3RZFA 2LI5A 3HM6X 2DX5B 2KFJA 4WWPA 3A4SC 2LGYA 4K7SA 1SGHA 1V49A 4FA6A 4EZKA 2WDTB 2D07B 2IY1B 4TKNA 2CR5A 3L17A 3H1UA 2BKRB 2JPHA 3ZVVA 2PE9A 3QARA 2KVRA 2NBWB 5AZGA 1VD2A 2LRWA 4MM3A 2DZKA 2K25A 2XEWA 3I3TB 4IWOA 4MJSA 1WR1A 3ONSA 3VUXA 4JLCA 2NVUI 1WRDB 3QWZB 1C3TA 4IWPA 5E6NA 3VXWA 4XZ4A 1AARA 1LQBA 3UIOB 1Q0WB 3UGBB 1Q1OA 4M0WB 1WGRA 4URKA 3W1SC 3CF6E 2HE7A 2L3ZA 2LVPA 3WAMA 3V60A 1RRBA 4HVBA 5DPRA 3O65B 1XD3B 3DVGX 5L83A 2K6DB 4KIKB 4WJPA 4K1RB 4LDTD 2PE6B 3OJ4B 3U8ZA 4AP4C 4PS7A 4X57B 4EFOA 5AEKB 1L7YA 1KLVA 3A9KA 2IYDB 2O6VB 1PQSA 2RSUA 5KHOA 5L95C 1WYWB 2MW5A 2KDFB 2KOXA 2PJHA 3CMMB 4P7IA 2JRIB 4DBGA 1MG8A 5JH5C 2ZPNA 4MGZE 3OAWA 4FHKA 4TQ0A 4HXDA 1EO6A 5GMVA 3SDLC 3ALBA 1GUAB 1IP9A 4HWIB 2O2VA 3QHTA 3SD5A 3SHQA 2JY6A 2LXCA 2Y5BB 1GNUA 4F7ZA 2NR2A 5DCNA 5J18A 2FCSA 2IO0B 3GOEA 1L2NA 2ZCBA 2CKHB 2KJHB 2KTRB 4MGIE 4MSMB 3UQBA 2L05A 4I6PA 2K39A 3LJ3A 4PYUA 4WQOB 4ICUA 2AL6A 3NY5A 2JUOA 2RPQA 3APDA 4G11A 4WWOA 1ZW7A 3M95A 3ZTCA 4FADA 5LXHA 2NPTA 4BOZB 2I1KA 2KHWB 1E7VA 3MJWA 4HPLB 2L0TA 3TJPA 4ANWA 4EKUA 2GMIC 2OOBB 4FLHA 2KLGA 4MELA 3VQIA 3NHEB 3DPDA 4NQKE 2HTHA 4ZRKA 2IY0B 2AL3A 2LGDA 1UD7A 3A9JB 2KDEB 2N1WA 4AJWA 2G4SA 4XX5A 5CTRC 4XC2A 3JYUA 3UQAA 2KKCA 3HHMA 1WY8A 4GDLA 2KMCA 1WJNA 2LUEA 4IC7B 2FNJB 4GXBA 2ZEQA 3VH4B 3U30A 1J0GA 2ASQA 3L08A 1WFYA 3NOBA 2LRUA 4M8MA 2C5LC 3MTNB 2BPSA 1YQBA 4KV2A 2AEHA 4GMVA 3VUWA 2CHXA 2LGXA 2KX3A 1WI0A 1EF5A 2LZ6A 4K7WA 3RD2A 5JHBA 1KOTA 2DHZA 1WM2A 3PRPB 3HK0A 2FIDA 4E3CA 3TBLD 3ZKJC 3VVWB 1XQQA 2MBBB 3H9DA 4W9GA 2ZCCA 3ZUNA 1WF9A 1I42A 2Z0DB 1E7UA 4JGHB 2KTRA 1IYFA 3IHPC 1P9DU 3H7SA 4KSLC 2K8CA 4ZRJA 4W9EA 3BINA 2J7QB 2YVCA 2CS4A 3W1YA 2C7HA 2KJRA 1Z5SB 1V6EA 5HKHA 3QA8A 4GDKA 4WWNA 2M1MA 3R3MA 4FULA 2HD5B 2MQJA 3APFA 5D6JB 4JQWC 1ZKHA 2G4DB 3GZNI 3X23A 5TR5A 2KDIA 3KUCB 3DBHI 3RUIB 4GU2A 1GG3A 2GBKA 3IG3A 3CSTA 2VRRB 4NPNA 5FR6A 1NI2A 1YIWA 3VTWA 2M17A 2MP2A 2ZPYA 3PZDA 3PHXB 3RULA 4B95A 4DXAB 2BYEA 2HJ8A 3H7PA 5CHVC 3C0RB 5IAAC 3VH3B 4FHJA 3ZTDA 1LM8B 2J0JA 4W9FA 3P2BA 3JW0X 4MGYE 1WMHA 2G3QB 2MLBA 3DBRI 5CHFA 4BBNF 2JZ3B 1NDDA 4W9DA 1P1AA 4MJSB 3W1SA 2KFKA 1WGDA 3B0AA 2MBQA 1OGWA 1V5TA 5AZHA 4GSWA 1WXSA 3ZW3A 1E8WA 3DCGA 3OJ3A 1OEYJ 4NNJB 4TQ1A 2FCQA 1R4NI 4ZRIA 2KC2A 3PRZA 4IM2A 5LLIA 1GC7A 2PEAA 4W9CA 4RMAA 2B3AA 4MEMA 2KQSA
chains in the Genus database with same CATH superfamily
1RAXA 4YWGG 2WXJA 3FC4A 4KIKA 3VAWA 2M4NA 3OLMD 3JVZX 1WE6A 5HHDG 1TGZB 1TKGA 2DZIA 1LO5D 2WWZA 3R2TA 2L0FA 2JZZA 1HE8A 4HKQA 3HIZA 4OZCA 4IUMB 2FCMA 1ENFA 3PVLA 2C60A 4GOCA 1VJKA 1K50A 5BYQA 2M0AA 2MH7A 2AX5A 3DDCB 5BO4B 1I4PA 4ZRPA 4H2AA 2R61A 4EEWA 5CHWA 4L2YA 3WIMA 1XF5L 3ZIMA 1ZPSA 5KHQA 5C1ZA 4ZDVA 3GZNB 4CO7A 3Q3OC 1G6JA 3OWEB 3RCZA 3MFGA 3QQ8B 1I4GA 1UWXA 2LJIA 5AUKA 3N30A 1JRUA 1BMLC 1WXMA 2WX0A 4DK5A 3IBEA 2BS4B 1L6UA 2L7RA 1FCLA 1D5MC 3NRZA 4CYEA 3FILB 3V61A 1OQYA 3S2AA 2FE8A 3R2IA 4JIOU 3AE8B 3D32A 1OQRA 2FCNA 2KTFA 1X1MA 3PRMB 1RM6C 1WJ6A 2KK8A 2VZKB 3P63A 2CU1A 2R2QA 2WXIA 2AWTA 2RDGA 2HTME 1H4RA 5JXVA 1B9RA 4PT5A 2WXMA 3HVZA 1VRAB 4F1SA 4LCDE 4O1NA 2V3NA 2V0GA 2BGFA 1V1PA 5TSSA 2X38A 4TMAB 2WDRB 3ETRA 1F2RI 2KWUB 4HCNB 2JWUA 4ZRQA 3EHVA 2IZVB 2WXHA 2K8BA 2N9EB 2J52A 1JW9D 2KVZA 3BVMA 4IW0A 4NAWA 3UINB 3L13A 4FBJB 2MEKA 4FJZA 4AQ7A 2DZMA 4CHKA 1ET9A 1TBEA 1MJDA 2KANA 1P7FA 1V9JA 2R2OA 4PS8A 3P4RB 2LHEA 1TY0A 2K8HA 2N9PC 3FKYA 1WH3A 2C7NB 3HM3A 1SE4A 3QIJA 1H8CA 3T9LA 3E56A 1J7CA 1FFVA 2KWCA 4FJVB 3ZYYX 4YXDB 1HA5A 1XLQA 5EE0A 2I1JA 3Q2AC 1VCBA 3NZUA 1IGCA 2JRHA 2GBNA 4KDIC 2G45B 3M3JA 1TZ1A 3ZLZA 4B9KA 4BKGA 2WXGA 3ZQ4A 4KZ0A 2VH2A 4ACFA 1GAQB 3PO0A 4DHJD 3WANA 3ZDMC 1C9FA 3PHWB 3IVFA 2WNMA 2QCZA 1ZE3D 4ASWC 4TV3A 1KJTA 4DWFA 4L23A 2LUMA 2KWVB 2ZNVC 1V5OA 2E6XA 4F8CB 4EZJA 4A3PA 2K1FA 2N0SB 2JXXA 1XXGA 4FJYA 3WCQA 4BKSA 5G2NA 4BKSD 2N7EA 3MJ5A 3ZNZB 1QOAA 3Q3JA 4K3CA 4KKIA 4C7ZA 1MPEA 2DNFA 1SIJA 4AOFA 2Z59B 2Z8LA 3WALA 2C7MB 3RNBC 2MBHA 1K53A 1N62A 1GJZA 2LASA 3A1QB 4KVGB 2LFIA 2TSSA 1GB4A 3Q3NC 4OVUA 1PGXA 2KLCA 2EKIA 4RGOS 4IM3A 2O2VB 2N7DA 3KVFB 4KKJA 2J0KA 2WXOA 3TEYA 4OHJA 1NBFC 3A4SC 2LGYA 4FXCA 4LLGM 1V49A 4FA6A 5FKAC 4TKNA 1TKYA 4HROA 2KDMA 3DHGC 2BKRB 2KVRA 2NBWB 2WXRA 4XWTA 4A8XC 1XLOA 2QDFA 3I3TB 4MJSA 3VUXA 1MVKA 4IWPA 5E6NA 3UIOB 1CJEA 1WGRA 3W1SC 2Y5PA 2XNAC 2WLBA 3O65B 1YN4A 5L83A 4K1RB 4LDTD 4XGAB 4X57B 3SFEB 3NVWA 2PTLA 2KOXA 2KDFB 4P7IA 1FRDA 1MG8A 1L0YB 2ZPNA 5HG2A 3ZXRA 3V3XA 4HXDA 3GE3C 3ALBA 1GUAB 1IP9A 4HWIB 2O2VA 3QHTA 5MPOA 2LXCA 1IBXA 2Y5BB 1GNUA 5J18A 2FCSA 4J3OD 1JMLA 2K39A 4TSSA 4ICUA 3NY5A 1QILA 2RPQA 3APDA 4G11A 3NUHB 4FADA 2NMQA 2PW9A 2I1KA 1ZDVA 2KHWB 4BOZB 1KLGD 2L0TA 4ANWA 4YSYB 3VQIA 4B0EA 5HFYA 2KDEB 1EM7A 4AJWA 1E6EB 3JYUA 4GDLA 4RGNA 2LUEA 3AE9B 3U30A 1WFYA 3NVVA 2AQ2B 2LRUA 4M8MA 2Y5CA 2BPSA 2AEHA 4GMVA 1YN5A 2LGXA 2W54A 2LZ6A 4K7WA 4WQMA 4GLSC 3PRPB 4K3BA 2FIDA 1N61A 3TUOA 1QT9A 1QKZA 2MBBB 3H9DA 3LXFA 1I42A 1E7UA 3C8YA 3H7SA 4KSLC 4W9EA 2CS4A 2KJRA 3P4PB 4LNOA 4FULA 2I38A 5I4DA 4JQWC 2G4DB 3H8HA 5HI1A 3Q69A 3RUIB 4GU2A 5EE1A 1KTKA 2VRRB 2M17A 4B95A 2HJ8A 1YNTE 3VH3B 2IGDA 5CHFA 2G3QB 3IAM1 4HJGE 3BK1A 3B0AA 1C4CA 1OGWA 2EELA 1VDVA 4NJCA 1E8WA 3DCGA 1OEYJ 1V1PB 2FCQA 3PRZA 2WU5B 1GC7A 5D94A 1ZOYB 2D10A 4PYZA 3ZO5B 3LB8C 2L52A 3UF8A 1FD6A 3DBLI 3M63B 2LWPA 2QEJC 3ZJTA 3SEBA 1UBIA 2NCNA 2FUHB 2BB5A 1WSPA 1PDXA 1GOZA 3A9JA 2GOWA 3DBSA 4C56C 2KXJA 5J2RA 3QAQA 3PV1A 2DWQA 2KWDA 3TIXA 4WURA 3OG5A 3RMKC 2J0MA 1SXTA 5LXIB 2PPHA 2ZW0A 1WZ0A 5D3IB 2KC1A 2FBWB 1XCTL 5G55A 2O6VD 2BYFA 5IA7A 2CHWA 3L54A 4K7UA 2K0PA 2JF5A 4NZLB 1N5WA 4IG7B 2NS5A 1XT9B 4YL8A 4OZBA 3T8MA 3H7PB 3V62A 1WJ4A 3HVDA 3AV8A 3WA0A 3N32A 1TIFA 3KYCD 1T0SC 1FO4A 1MFWA 2KFKB 2UYZB 3EFUA 3KH0A 4RM8A 4W9KA 1UBQA 4DDGD 4G0NB 2BBCA 3BIID 4E74A 4EZLA 1WGYA 1KF6B 3NS8A 4FN2A 3QCAA 1QOFA 1OFFA 1QOBA 2D2QA 3A33B 2L76A 4JL9A 1I7HA 4NJ7A 4AUQC 4I6NB 1R4MI 1UELA 4RCOA 3ENEA 2RR9A 4S0RA 1QLBB 2REXA 3VTUA 2V4LA 2N9KA 3VDZA 4K81A 2RDHA 2BF8B 4YTMB 3W5UB 2MA9B 1V2YA 1E5WA 2ZVNA 1FRRA 2GBMA 4B0MA 4WJOA 1F1HA 3AI5A 1PGBA 5EDSA 3ZNHB 3SFDB 2W82A 3L16A 1HTOA 4BBNC 1GB1A 3C19A 4C7YA 2INNE 1KH0A 2K6QA 1J19A 2WHIA 1SBBB 4GN1A 4DDID 5G5HA 2KQ7A 2BYVE 2KYWA 4G3XB 3PREA 1HQRD 3IT4B 3CIRB 2DYMA 3QJZA 3RI7C 4HEA1 5EE9A 4YT0B 2KZRA 4OVVA 1FMAD 1IGDA 2SEBD 1CMXB 1C4PA 1L4ZB 1SB3C 3MP9A 4DHZE 2XK5B 4WWMA 3R7QA 1GPXA 4J6IA 4M02A 4KDLB 4A20A 4S17A 1K51A 2AYOB 2WDQB 3TL5A 1I4RA 3A9KB 1PGAA 2LJ5A 3KUZA 4EOYA 1L6VA 2XBBC 4USAA 3ZXVA 1DOIA 2WXFA 4RF1A 1WX9A 4WJNA 2DZJA 2IO1B 3AU4A 1E9MA 3P42A 2NTSA 3DBRB 1YX5B 4A6QA 5JZEB 4TUUA 3VR9B 4US8A 1WJUA 2WX1A 1C1YB 2JYEA 3RNCC 3KYDD 5BMHA 3ML8A 1E8YA 3P1MA 1EF1A 1TTNA 2BS3B 4BOSC 1V80A 2QC8A 1KM7A 3AN1A 4HPPA 4PS3A 2KJ6A 1WZ3A 4HRSA 4L1BA 2ZVOA 3VR8B 3PTFC 3ECIA 4AS1A 2V3SA 1M94A 3J9CA 3ML9A 1FNUA 1I35A 2W9NA 2O6VA 2EMSA 3DBLB 3O13A 3TEWA 1DYQA 4A55A 3RYTA 3BVZA 3MHSD 1TS5A 4RGMA 3PS6A 4ANXA 1WMHB 2DAFA 2CHZA 1J8CA 2MSED 1S3SG 3VRAB 5CX3A 2DX5B 2KFJA 4WWPA 1ZXIA 1MI0A 2JZPA 4EZKA 3W5VB 2D07B 4XWWA 1TY2A 3L17A 5BYRA 2JPHA 3ZVVA 2PE9A 3QARA 5AZGA 1F0ZA 2LRWA 1WR1A 4JLCA 2NVUI 2H88B 3NVYA 3VXWA 3N9YC 1LQBA 2E3TA 1D5ZC 4URKA 1WXQA 2HE7A 1JALA 2L3ZA 3WAMA 1WYGA 1FNVA 5E6JA 3V60A 5DPRA 4WJPA 4KIKB 1E0ZA 3AMZA 2PE6B 5H92C 3OJ4B 3U8ZA 4AP4C 1KLVA 2O6VB 3Q8CA 1FIQA 4YSZB 4M01A 3ABVB 5L95C 2MW5A 2PJHA 2JQRB 2JRIB 3N1XC 4MGZE 1AN8A 2I2YA 4TQ0A 1R4NB 5GMVA 3SDLC 1RYJA 3SD5A 5IO9A 3SHQA 1E10A 3T3OA 3ZGZA 5DCNA 1YQ3B 4LK0M 3GOEA 2KTRB 3UQBA 4I6PA 2AL6A 2JUOA 2ACZB 1ZW7A 4REZA 2NPTA 1E7VA 3MJWA 4HPLB 2GMIC 2OOBB 1JWBD 3DPDA 4ZRKA 2LGDA 2AL3A 3A9JB 2N1WA 4XX5A 5CTRC 3GE8C 3UQAA 3HHMA 1WY8A 1WJNA 1ZXHA 2KMCA 1IUEA 4GXBA 2ZEQA 2J42A 2ASQA 3L08A 1L0XB 1QQRA 2JX5A 3AE4B 1T0RC 2KX3A 1EF5A 3RD2A 4MM3B 1N5XA 3DWMA 1WM2A 4DXGA 4E3CA 3TBLD 1KRHA 3VVWB 1OQQA 4KX6B 4W9GA 2ZCCA 1L4DB 1Q10A 3Q6BA 2KTRA 1JQ4A 2INDC 3BINA 2YVCA 2WXNA 3T3NA 3AE6B 3QA8A 2QSDA 4GDKA 3R3MA 5H8YE 4JWSC 5TR5A 3KUCB 2YEPF 4RGTA 2PIAA 3IG3A 3CSTA 3VTWA 3Q8EA 1NI2A 2K9XA 3V05A 3RULA 4DXAB 4KGSA 2BYEA 2K22A 3H7PA 5IAAC 2G9HD 3ZTDA 2PMVA 1XO3A 3P2BA 3DBRI 4BBNF 3AE5B 1XLPA 3ZJVA 3W1SA 2KFKA 1WGDA 1FM0D 1AW7A 4OW0A 1V5TA 1WXSA 4NNJB 3E9SA 1R4NI 5LLIA 4W9CA 3I5JC 2B3AA 1Y8RC 3DQVA 4ZOHC 2LVOA 2WQYB 4WJQA 1LFDA 2LXAA 1NVID 2CJOA 4C4VB 4OVZA 5T8IA 2WU2B 2DAJA 3KWLA 4G50A 1FCCC 3TCAA 2MX2A 1SSNA 4II3B 4LJPB 3N20C 4E71A 3KW5B 2FIFA 4MH8A 3RNGC 1UWMA 1EUVB 1ISNA 2M0XA 3DVNU 1K8RB 3BK2A 4LTUA 5AZFA 4US9A 3W9CB 4WIPA 1E8XA 2LHDA 3MC8A 2KNBA 4NAMA 2IO2B 4A3OA 1ZGUB 1WR6E 2V3PA 3PGEA 4B6WA 4HJKA 1P7EA 2MJEA 2N1VA 3EC8A 2BVCA 4RH6A 2RGFA 1UGMA 5E6PA 5IKCM 3AULA 3IXSA 4QAYA 1TKEA 1FEHA 1V86A 2NBVB 1J7BA 1K52A 2XK5A 1BXTA 5DPTA 1UH6A 3PLVA 3IFWB 3AE3B 2A4ZA 2KQ4X 3RNAC 4PK1A 3L10B 4NY0A 2IGHA 1WGGA 4D2KA 3ZDTA 1ZUD2 4N6EB 1PUTA 1V81A 2UWQA 4AJYB 1P98A 2MCNB 4OZAA 2ON8A 3BVGA 4W9IA 1N63A 1CQVA 1L0VB 3UI3A 3P4QB 4WAAA 3SR6A 1VZ8A 1UGJA 3R7RA 2BKFA 2MP2B 2BWES 1PYWD 4ZHOA 2MJ3A 1VLBA 1SE2A 2PVOD 2WXKA 3M62B 2LGSA 2MRPA 3DHIC 2WP9B 4MSQB 2MBOA 4DHZB 3JSVB 4ZYSA 3RFZB 4HPMB 2IBIB 3DVGY 4JX1C 1FXAA 1STEA 1HZ5A 2GBRA 3ZNGC 2MWSB 2DYBA 4I6LB 5BMIA 2WS3B 1JROA 3QX1A 1SJHD 1YJ1A 3B1LX 2KD0A 2BWFA 2B76B 1Q5WB 3DWGC 2KAJA 2W3RA 1Z2MA 3AECB 2RPVA 3UIPB 2BQQA 1M4VA 3TMPB 5FR3A 4KSKC 3VTVA 5D7GA 4EUTA 3ZNID 2L8JA 1VZ7A 3KUDB 2D3GA 1FXIA 4ICVA 2M8SA 3KLSX 1C76A 2LGIA 1P0RA 2M19A 3WAOA 1LXDA 2MBEA 5C2TB 4YTNB 4N9F4 2EKEC 4YTPB 3BY4B 3GS2A 1T3QA 2L1AA 1RLFA 3U7ZA 3V6EB 3RT3B 3AB5A 2SAKA 4BFRA 4IWQA 3FILA 1EWYC 3AEEB 2W55A 3CSFA 2GBJA 3JSVA 2D3AA 1RWSA 2Q5WD 1WX7A 4MH0E 2J4XA 3RPFC 2JSVX 2LMCA 1TJEA 3BYYB 2N9XA 1UZXB 2JWZA 3TEZA 3V6CB 3U52E 4NQLB 1YD8U 2L00B 3AEDB 3HRDD 2JVCA 1F52A 4GB9A 1CZPA 3B08A 1WRIA 1F9JA 2YLMA 3EA6A 5IOIA 4HK2A 4ANVA 1KLUD 1TS2A 3IAS1 1WXVA 3PT2B 1C78A 1TT5B 4NAWB 2NPTB 3NZSA 3N1YC 1E8ZA 3PZ8A 3RZFA 2LI5A 3U2SC 4K7SA 1SGHA 2WDTB 2IY1B 2INPE 1EWCA 4C80A 4RFBA 3RNEC 4WAFA 4DXFA 2D3CA 4MM3A 2XEWA 2K25A 4C00A 2PLPA 1WRDB 1JWUD 3U4EG 4XZ4A 1AARA 3UGBB 2DBYA 2INCC 3CF6E 1RRBA 3EFCA 2K6DB 2IDYA 4Q2JA 4EFOA 5AEKB 1L7YA 3BYTB 2IYDB 3MHZA 4A9AA 1RFKA 1Y56A 4A90A 1WYWB 1XEEA 3IT6B 4DBGA 2LEKA 4IOIE 4UDUC 5JH5C 3OAWA 1JWSD 4FHKA 1NYQA 3MC9A 1JWMD 4RNAA 2JY6A 2JXTA 1MHHE 2KMMA 2IO0B 1L2NA 2ZCBA 4MGIE 2KJHB 2RMMA 4C4VA 2L05A 4WQOB 4PYUA 3NZ3A 1HZ6A 4WWOA 5LXHA 3ZTCA 2MJDA 4FLHA 4XDCA 4N59A 2CJNA 3NHEB 2QIEB 1YQ4B 1BUIC 1V1OA 2KKCA 3B2FA 4ARIA 4IC7B 2FNJB 4P1BC 4KGRA 4WH4A 3NOBA 1FNWA 3RN9C 1JCKB 2WDVB 1ESFA 4N58A 3R8BA 1EU3A 4LNNA 5G5GA 2CHXA 1WI0A 1MG4A 5JHBA 4XE0A 1TS3A 3ZUNA 1D6EC 2KACA 2Z0DB 3I57A 4JGHB 4ZRJA 1XCQL 5HKHA 1NYRA 4WWNA 2MQJA 3APFA 3GZNI 3X23A 1NENB 1GG3A 4NPNA 1YIWA 1SE3A 3PHXB 3AM9A 1AYFA 3C0RB 2WXPA 3DHHC 4FHJA 1LM8B 3JW0X 4MGYE 5AUIA 1WMHA 2MLBA 5IN7A 1PFDA 1NDDA 4W9DA 1P1AA 1JRPA 3B9JA 4MJSB 2MBQA 2WXLA 3ZW3A 4BZAA 4ZRIA 4IM2A 2H89B 2QMTA 5C3JB 3VH4B 3EGRA 2GI9A 2KX0A 1YOVB 2OHFA 1SIFA 4LJOB 2K3UA 2EMTA 3VUYA 2QILA 1UNSA 4KGTA 2PVGC 4CQNA 2VH1A 3CWIA 4MGKE 4JPSA 3L0WB 2KO3A 4II2B 1SE9A 3R66C 3RNFC 3NJTA 1BT0A 2BB6A 3PLUA 4BVUC 3HUIA 1WE7A 2JU6X 2XN9C 4XYCA 3A4RA 4IDIA 2A5UA 2W3SA 2IJ0A 2UU7A 1GC6A 2DENB 1E7PB 3H6NA 2N9LA 2HJ1A 3AE7B 3ZRCA 2ICIA 2ZZPB 5GXGB 4ANUA 4DQOC 1U4AA 3PZ7A 5E6OA 1D4BA 3PSEB 4GDLB 1WIAA 1YX6B 3AEBB 2GLSA 4DHJB 1WM3A 2BS2B 1V97A 3NS1A 3L4PA 4IKGA 1TYGB 5LNK1 5JHAA 2QJLA 2C9WB 1FFUA 3MC0B 4LNKA 2OJRA 1NI3A 4BAXA 3APCA 3PPAA 4MDKE 1I4HA 2V9HA 3A1QA 3N3KB 2IGGA 3ZRFA 4LNFA 1IPGA 3AE2B 4IM0A 3Q3FA 1MHXA 3SU8X 1R4MB 5C23A 1WX8A 2ZNVB 3GB1A 4NJ6A 1DGJA 2WYQA 1S1QB 3DVNV 4M8NA 2GRIA 1D3ZA 1A70A 2OJWA 4YSXB 3AEAB 2NBUA 1HXYD 4JE3B 1SEBD 5BYSA 4RM9A 1OTRB 2GB1A 4HKZE 1KFYB 3GP7A 4LNIA 2FUG1 1OEYA 1WGKA 3Q8AA 4W9HA 1N6ZA 1C79A 3AXCA 3DOWA 2DLBA 4ARCA 2K5PA 1P3QU 2MHJA 3K9PB 3K9OB 4W9LA 3AEFB 5FK9C 4HCPB 4BKTA 1VR9A 2KMAA 3RZWC 2IO3B 2LD9A 1YJIA 2WGSA 1AWDA 3U7DA 3FAHA 3AU5A 4HDOA 1ACCA 2IPKD 2QHOA 3EECA 1QOGA 1E90A 2FAZA 1ET6A 1T0QC 2Y3AA 2PKOA 1SJED 4M00A 3VFKA 2D11A 1HEZE 5IP4D 2LVQA 2OEDA 2ONQA 5D3DA 1YMHE 5DPSA 1ROEA 3Q8FA 2RDBC 4HDQA 3QK0A 1YN3A 4P16A 1J7AA 2JYTA 1NEKB 1WXAA 1QZEA 3B2GA 4XDDA 2KDBA 1FXTB 2ZJDA 4ZYNA 2D5GA 2Z0EB 5J17A 1YJJA 2DYOA 5EE3A 2V4IB 2N4FA 4KZCA 1T5XD 2V1YA 5D2MB 2KN5A 3WAPA 2KN4A 4HLEA 4LDTB 1I4XA 1RFAA 3BZDB 4AWJA 3AE1B 4GIVA 3LDZE 1N60A 2D3BA 2BTEA 4GGQA 1A5RA 4M0WA 4R3DA 3Q14C 2CU3A 3Q8BA 1FPYA 1ZDXA 3X0WA 3ZJUA 2ZW1A 4MACA 5BMGA 1T0YA 4RF0A 3VHTC 5DPWA 1C4AA 1I4QA 1VZ6A 2RD0A 3QC8B 4GDKB 2JT4B 2YEPB 4W9JA 1WWTA 1WGHA 3EUB2 3HM6X 2KT7A 4P1CC 3VRBB 4JWUC 2CR5A 3TEXA 3H1UA 2VZKD 4EE2A 1VD2A 1QF6A 2DZKA 4IWOA 2AQ3B 2L32A 3ONSA 3QWZB 1C3TA 1UF0A 1Q0WB 1Q1OA 4M0WB 1F2RC 2M56B 2J53A 3DBHB 2L83A 3P4SB 2LVPA 2HDEA 2AQ1B 3I63C 4HVBA 1XD3B 3DVGX 1F77A 3Q3MC 4PS7A 4ITKA 3A9KA 1B1ZA 1PQSA 2RSUA 5KHOA 3CMMB 4P6VF 1T6BX 4ZHPA 1TZOA 1L5PA 1EO6A 1DOYA 1D5XC 4MT5A 4F7ZA 2NR2A 2CKHB 4MSMB 3LJ3A 3TSSA 3M95A 3N1ZC 3LYYA 4EKUA 3TJPA 1V8CA 2KLGA 4MELA 4NQKE 2HTHA 2IY0B 2BT6A 1UD7A 2G4SA 4XC2A 3KQ4A 3KWVA 1LGRA 3W2DA 1J0GA 2C5LC 3MTNB 2BW2A 1YQBA 4KV2A 3VUWA 1KOTA 2DHZA 3HK0A 1CK1A 3BWUD 3ZKJC 3URYA 1R7SA 1XQQA 1WF9A 2BYTA 1IYFA 3IHPC 3NVZA 1SF0A 1P9DU 2K8CA 2J7QB 3W1YA 2C7HA 1Z5SB 1V6EA 3I9V1 2M1MA 1JWAD 2HD5B 5D6JB 2X8XX 1ZKHA 2KDIA 3DBHI 3AH7A 2GBKA 1UUPA 1EU4A 5FR6A 3NG0A 2ZPYA 2MP2A 3PZDA 1XLNA 5CHVC 2N7JA 2WXQA 2J0JA 4W9FA 2JZ3B 2G1EA 1ZP0B 1IBXB 2NTTA 1HTQA 1DOXA 5AZHA 4GSWA 3OJ3A 4TQ1A 2KC2A 1C77A 2PEAA 3AEGB 4RMAA 1TS4A 4MEMA 2KQSA
chains in the Genus database with same CATH topology
5D94A 1Y8RC 2KX0A 3DQVA 2D10A 2LVOA 4PYZA 1RAXA 3ZO5B 1SIFA 4WJQA 4LJOB 1LFDA 2LXAA 2EMTA 4KIKA 3VAWA 3VUYA 2M4NA 3OLMD 3JVZX 3UF8A 1WE6A 3DBLI 3M63B 2LWPA 1TGZB 2WWZA 2DZIA 2DAJA 2L0FA 4G50A 2JZZA 4MGKE 1HE8A 2KO3A 3L0WB 4II2B 3TCAA 2MX2A 1SE9A 3HIZA 3R66C 4IUMB 1BT0A 1UBIA 3PLUA 2NCNA 4II3B 4LJPB 4BVUC 2FCMA 4E71A 3KW5B 3PVLA 2C60A 1WE7A 2FIFA 2FUHB 4GOCA 3A4RA 4DHJD 2A5UA 1EUVB 1GC6A 2DENB 1ISNA 2M0XA 3DVNU 3H6NA 3A9JA 2GOWA 3DDCB 1K8RB 5AZFA 5BO4B 3DBSA 3ZRCA 2KXJA 2ZZPB 5J2RA 4ANUA 3QAQA 1E8XA 1U4AA 5E6OA 3PV1A 2KNBA 3TIXA 4EEWA 5CHWA 3PSEB 2IO2B 4GDLB 1ZGUB 4A3OA 3WIMA 1WR6E 1WIAA 2J0MA 3ZIMA 5LXIB 5KHQA 5C1ZA 4ZDVA 4CO7A 3PGEA 2PPHA 4B6WA 3RCZA 1YX6B 1G6JA 4HJKA 3QQ8B 1WZ0A 1WM3A 2N1VA 4DHJB 2KC1A 3N30A 3EC8A 1JRUA 5G55A 1WXMA 2O6VD 2BYFA 2RGFA 2WX0A 4DK5A 3IBEA 5JHAA 1UGMA 5IA7A 2C9WB 2CHWA 5E6PA 2L7RA 3AULA 3L54A 2OJRA 3APCA 4K7UA 3PPAA 1V86A 2JF5A 2NBVB 4MDKE 4CYEA 3A1QA 4IG7B 3N3KB 1OQYA 3V61A 3S2AA 2NS5A 1XT9B 4JIOU 4YL8A 3ZRFA 3T8MA 3H7PB 1IPGA 3D32A 3V62A 1WJ4A 2XK5A 5DPTA 2FCNA 4IM0A 1UH6A 3WA0A 2KTFA 3N32A 3PLVA 3IFWB 3Q3FA 1X1MA 3PRMB 2A4ZA 1WJ6A 3KYCD 3L10B 4NY0A 2KK8A 1WGGA 2KFKB 3ZDTA 2UYZB 3SU8X 3EFUA 3KH0A 5C23A 1WX8A 4RM8A 2CU1A 1UBQA 2R2QA 4W9KA 4DDGD 2ZNVB 4NJ6A 1V81A 2AWTA 4G0NB 2UWQA 2WYQA 1P98A 2MCNB 4AJYB 1S1QB 3DVNV 1H4RA 4E74A 4M8NA 4EZLA 1D3ZA 1WGYA 3NS8A 4FN2A 4W9IA 3QCAA 4F1SA 4LCDE 3A33B 2D2QA 2BGFA 4WAAA 2L76A 2NBUA 4JL9A 2KWUB 4HCNB 4NJ7A 4AUQC 4I6NB 3R7RA 1R4MI 1UELA 2BKFA 2MP2B 2BWES 3ENEA 3EHVA 2IZVB 2RR9A 3M62B 4RM9A 1OTRB 2K8BA 2N9EB 2REXA 2MRPA 4MSQB 3VTUA 2MBOA 4IW0A 4NAWA 1OEYA 2V4LA 4DHZB 3JSVB 3VDZA 4K81A 4W9HA 2BF8B 3AXCA 4HPMB 2IBIB 3DVGY 3UINB 2MA9B 2GBRA 3L13A 3DOWA 1V2YA 1E5WA 3ZNGC 2MWSB 2DYBA 4I6LB 2ZVNA 4FBJB 4FJZA 3QX1A 2GBMA 4WJOA 1P3QU 1YJ1A 2DZMA 3B1LX 4CHKA 3AI5A 3K9PB 3K9OB 4W9LA 1TBEA 5EDSA 3ZNHB 3L16A 2KD0A 4HCPB 4BKTA 2KANA 2KMAA 2BWFA 1V9JA 1Q5WB 2R2OA 4PS8A 3RZWC 4BBNC 2IO3B 1Z2MA 2LD9A 3UIPB 2K6QA 1J19A 2K8HA 2N9PC 4GN1A 3U7DA 4DDID 3AU5A 4HDOA 2KQ7A 2BYVE 1WH3A 2QHOA 3EECA 2C7NB 4G3XB 3PREA 4KSKC 3TMPB 3HM3A 1E90A 3QIJA 1H8CA 3VTVA 2FAZA 2DYMA 5D7GA 4EUTA 3QJZA 3T9LA 3ZNID 2KZRA 2L8JA 3KUDB 2KWCA 4FJVB 4OVVA 2D3GA 1CMXB 3VFKA 4ICVA 2D11A 2M8SA 4DHZE 2XK5B 1P0RA 3R7QA 2LVQA 3WAOA 1LXDA 2MBEA 4J6IA 4A20A 4KDLB 2I1JA 5DPSA 4N9F4 2AYOB 2EKEC 1VCBA 3NZUA 3BY4B 3TL5A 2JRHA 2GBNA 3A9KB 4KDIC 2G45B 3M3JA 1TZ1A 4HDQA 2LJ5A 3KUZA 3QK0A 3ZLZA 4B9KA 4BKGA 4EOYA 2XBBC 4KZ0A 1RLFA 1WX9A 1QZEA 1WXAA 3V6EB 3RT3B 4WJNA 3WANA 2KDBA 1FXTB 3ZDMC 4BFRA 3PHWB 3IVFA 2DZJA 4IWQA 2IO1B 2ZJDA 3AU4A 4ZYNA 4ASWC 4TV3A 1KJTA 1YX5B 3CSFA 2GBJA 4DWFA 5JZEB 2KWVB 4TUUA 2Z0EB 5J17A 1V5OA 1WJUA 2DYOA 2WX1A 2ZNVC 1C1YB 3JSVA 4MH0E 4F8CB 1WX7A 2N4FA 3KYDD 4EZJA 4A3PA 2K1FA 3ML8A 2JXXA 1E8YA 4FJYA 4KZCA 1EF1A 1TTNA 4BOSC 1V80A 2V1YA 4BKSA 5D2MB 1KM7A 2N9XA 2KN5A 5G2NA 3WAPA 4PS3A 4BKSD 2N7EA 1UZXB 2KJ6A 4HLEA 3ZNZB 1WZ3A 2JWZA 3Q3JA 2ZVOA 3V6CB 3PTFC 4LDTB 4NQLB 1RFAA 1YD8U 3ECIA 2L00B 4AWJA 2JVCA 4AOFA 2V3SA 1M94A 2Z59B 4GIVA 4GB9A 3WALA 2C7MB 3LDZE 3B08A 2MBHA 3ML9A 1I35A 2W9NA 2O6VA 2EMSA 4GGQA 1A5RA 1F9JA 1GJZA 2LASA 3A1QB 2YLMA 4KVGB 4HK2A 4ANVA 3RYTA 3MHSD 4OVUA 2KLCA 3X0WA 3PS6A 1WXVA 3PT2B 4IM3A 2O2VB 4ANXA 1T0YA 2N7DA 3KVFB 3VHTC 5DPWA 4NAWB 2NPTB 3NZSA 1WMHB 2DAFA 2CHZA 2J0KA 2RD0A 1E8ZA 3QC8B 4GDKB 1J8CA 2JT4B 4W9JA 2MSED 1NBFC 1S3SG 1WGHA 5CX3A 3RZFA 2LI5A 3HM6X 2DX5B 2KFJA 4WWPA 3A4SC 2LGYA 4K7SA 1SGHA 1V49A 4FA6A 4EZKA 2WDTB 2D07B 2IY1B 4TKNA 2CR5A 3L17A 3H1UA 2BKRB 2JPHA 3ZVVA 2PE9A 3QARA 2KVRA 2NBWB 5AZGA 1VD2A 2LRWA 4MM3A 2DZKA 2K25A 2XEWA 3I3TB 4IWOA 4MJSA 1WR1A 3ONSA 3VUXA 4JLCA 2NVUI 1WRDB 3QWZB 1C3TA 4IWPA 5E6NA 3VXWA 4XZ4A 1AARA 1LQBA 3UIOB 1Q0WB 3UGBB 1Q1OA 4M0WB 1WGRA 4URKA 3W1SC 3CF6E 2HE7A 2L3ZA 2LVPA 3WAMA 3V60A 1RRBA 4HVBA 5DPRA 3O65B 1XD3B 3DVGX 5L83A 2K6DB 4KIKB 4WJPA 4K1RB 4LDTD 2PE6B 3OJ4B 3U8ZA 4AP4C 4PS7A 4X57B 4EFOA 5AEKB 1L7YA 1KLVA 3A9KA 2IYDB 2O6VB 1PQSA 2RSUA 5KHOA 5L95C 1WYWB 2MW5A 2KDFB 2KOXA 2PJHA 3CMMB 4P7IA 2JRIB 4DBGA 1MG8A 5JH5C 2ZPNA 4MGZE 3OAWA 4FHKA 4TQ0A 4HXDA 1EO6A 5GMVA 3SDLC 3ALBA 1GUAB 1IP9A 4HWIB 2O2VA 3QHTA 3SD5A 3SHQA 2JY6A 2LXCA 2Y5BB 1GNUA 4F7ZA 2NR2A 5DCNA 5J18A 2FCSA 2IO0B 3GOEA 1L2NA 2ZCBA 2CKHB 2KJHB 2KTRB 4MGIE 4MSMB 3UQBA 2L05A 4I6PA 2K39A 3LJ3A 4PYUA 4WQOB 4ICUA 2AL6A 3NY5A 2JUOA 2RPQA 3APDA 4G11A 4WWOA 1ZW7A 3M95A 3ZTCA 4FADA 5LXHA 2NPTA 4BOZB 2I1KA 2KHWB 1E7VA 3MJWA 4HPLB 2L0TA 3TJPA 4ANWA 4EKUA 2GMIC 2OOBB 4FLHA 2KLGA 4MELA 3VQIA 3NHEB 3DPDA 4NQKE 2HTHA 4ZRKA 2IY0B 2AL3A 2LGDA 1UD7A 3A9JB 2KDEB 2N1WA 4AJWA 2G4SA 4XX5A 5CTRC 4XC2A 3JYUA 3UQAA 2KKCA 3HHMA 1WY8A 4GDLA 2KMCA 1WJNA 2LUEA 4IC7B 2FNJB 4GXBA 2ZEQA 3VH4B 3U30A 1J0GA 2ASQA 3L08A 1WFYA 3NOBA 2LRUA 4M8MA 2C5LC 3MTNB 2BPSA 1YQBA 4KV2A 2AEHA 4GMVA 3VUWA 2CHXA 2LGXA 2KX3A 1WI0A 1EF5A 2LZ6A 4K7WA 3RD2A 5JHBA 1KOTA 2DHZA 1WM2A 3PRPB 3HK0A 2FIDA 4E3CA 3TBLD 3ZKJC 3VVWB 1XQQA 2MBBB 3H9DA 4W9GA 2ZCCA 3ZUNA 1WF9A 1I42A 2Z0DB 1E7UA 4JGHB 2KTRA 1IYFA 3IHPC 1P9DU 3H7SA 4KSLC 2K8CA 4ZRJA 4W9EA 3BINA 2J7QB 2YVCA 2CS4A 3W1YA 2C7HA 2KJRA 1Z5SB 1V6EA 5HKHA 3QA8A 4GDKA 4WWNA 2M1MA 3R3MA 4FULA 2HD5B 2MQJA 3APFA 5D6JB 4JQWC 1ZKHA 2G4DB 3GZNI 3X23A 5TR5A 2KDIA 3KUCB 3DBHI 3RUIB 4GU2A 1GG3A 2GBKA 3IG3A 3CSTA 2VRRB 4NPNA 5FR6A 1NI2A 1YIWA 3VTWA 2M17A 2MP2A 2ZPYA 3PZDA 3PHXB 3RULA 4B95A 4DXAB 2BYEA 2HJ8A 3H7PA 5CHVC 3C0RB 5IAAC 3VH3B 4FHJA 3ZTDA 1LM8B 2J0JA 4W9FA 3P2BA 3JW0X 4MGYE 1WMHA 2G3QB 2MLBA 3DBRI 5CHFA 4BBNF 2JZ3B 1NDDA 4W9DA 1P1AA 4MJSB 3W1SA 2KFKA 1WGDA 3B0AA 2MBQA 1OGWA 1V5TA 5AZHA 4GSWA 1WXSA 3ZW3A 1E8WA 3DCGA 3OJ3A 1OEYJ 4NNJB 4TQ1A 2FCQA 1R4NI 4ZRIA 2KC2A 3PRZA 4IM2A 5LLIA 1GC7A 2PEAA 4W9CA 4RMAA 2B3AA 4MEMA 2KQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D94 A;  1Y8R C;  2KX0 A;  3DQV A;  2D10 A;  2LVO A;  4PYZ A;  1RAX A;  3ZO5 B;  1SIF A;  4WJQ A;  4LJO B;  1LFD A;  2LXA A;  2EMT A;  4KIK A;  3VAW A;  3VUY A;  2M4N A;  3OLM D;  3JVZ X;  3UF8 A;  1WE6 A;  3DBL I;  3M63 B;  2LWP A;  1TGZ B;  2WWZ A;  2DZI A;  2DAJ A;  2L0F A;  4G50 A;  2JZZ A;  4MGK E;  1HE8 A;  2KO3 A;  3L0W B;  4II2 B;  3TCA A;  2MX2 A;  1SE9 A;  3HIZ A;  3R66 C;  4IUM B;  1BT0 A;  1UBI A;  3PLU A;  2NCN A;  4II3 B;  4LJP B;  4BVU C;  2FCM A;  4E71 A;  3KW5 B;  3PVL A;  2C60 A;  1WE7 A;  2FIF A;  2FUH B;  4GOC A;  3A4R A;  4DHJ D;  2A5U A;  1EUV B;  1GC6 A;  2DEN B;  1ISN A;  2M0X A;  3DVN U;  3H6N A;  3A9J A;  2GOW A;  3DDC B;  1K8R B;  5AZF A;  5BO4 B;  3DBS A;  3ZRC A;  2KXJ A;  2ZZP B;  5J2R A;  4ANU A;  3QAQ A;  1E8X A;  1U4A A;  5E6O A;  3PV1 A;  2KNB A;  3TIX A;  4EEW A;  5CHW A;  3PSE B;  2IO2 B;  4GDL B;  1ZGU B;  4A3O A;  3WIM A;  1WR6 E;  1WIA A;  2J0M A;  3ZIM A;  5LXI B;  5KHQ A;  5C1Z A;  4ZDV A;  4CO7 A;  3PGE A;  2PPH A;  4B6W A;  3RCZ A;  1YX6 B;  1G6J A;  4HJK A;  3QQ8 B;  1WZ0 A;  1WM3 A;  2N1V A;  4DHJ B;  2KC1 A;  3N30 A;  3EC8 A;  1JRU A;  5G55 A;  1WXM A;  2O6V D;  2BYF A;  2RGF A;  2WX0 A;  4DK5 A;  3IBE A;  5JHA A;  1UGM A;  5IA7 A;  2C9W B;  2CHW A;  5E6P A;  2L7R A;  3AUL A;  3L54 A;  2OJR A;  3APC A;  4K7U A;  3PPA A;  1V86 A;  2JF5 A;  2NBV B;  4MDK E;  4CYE A;  3A1Q A;  4IG7 B;  3N3K B;  1OQY A;  3V61 A;  3S2A A;  2NS5 A;  1XT9 B;  4JIO U;  4YL8 A;  3ZRF A;  3T8M A;  3H7P B;  1IPG A;  3D32 A;  3V62 A;  1WJ4 A;  2XK5 A;  5DPT A;  2FCN A;  4IM0 A;  1UH6 A;  3WA0 A;  2KTF A;  3N32 A;  3PLV A;  3IFW B;  3Q3F A;  1X1M A;  3PRM B;  2A4Z A;  1WJ6 A;  3KYC D;  3L10 B;  4NY0 A;  2KK8 A;  1WGG A;  2KFK B;  3ZDT A;  2UYZ B;  3SU8 X;  3EFU A;  3KH0 A;  5C23 A;  1WX8 A;  4RM8 A;  2CU1 A;  1UBQ A;  2R2Q A;  4W9K A;  4DDG D;  2ZNV B;  4NJ6 A;  1V81 A;  2AWT A;  4G0N B;  2UWQ A;  2WYQ A;  1P98 A;  2MCN B;  4AJY B;  1S1Q B;  3DVN V;  1H4R A;  4E74 A;  4M8N A;  4EZL A;  1D3Z A;  1WGY A;  3NS8 A;  4FN2 A;  4W9I A;  3QCA A;  4F1S A;  4LCD E;  3A33 B;  2D2Q A;  2BGF A;  4WAA A;  2L76 A;  2NBU A;  4JL9 A;  2KWU B;  4HCN B;  4NJ7 A;  4AUQ C;  4I6N B;  3R7R A;  1R4M I;  1UEL A;  2BKF A;  2MP2 B;  2BWE S;  3ENE A;  3EHV A;  2IZV B;  2RR9 A;  3M62 B;  4RM9 A;  1OTR B;  2K8B A;  2N9E B;  2REX A;  2MRP A;  4MSQ B;  3VTU A;  2MBO A;  4IW0 A;  4NAW A;  1OEY A;  2V4L A;  4DHZ B;  3JSV B;  3VDZ A;  4K81 A;  4W9H A;  2BF8 B;  3AXC A;  4HPM B;  2IBI B;  3DVG Y;  3UIN B;  2MA9 B;  2GBR A;  3L13 A;  3DOW A;  1V2Y A;  1E5W A;  3ZNG C;  2MWS B;  2DYB A;  4I6L B;  2ZVN A;  4FBJ B;  4FJZ A;  3QX1 A;  2GBM A;  4WJO A;  1P3Q U;  1YJ1 A;  2DZM A;  3B1L X;  4CHK A;  3AI5 A;  3K9P B;  3K9O B;  4W9L A;  1TBE A;  5EDS A;  3ZNH B;  3L16 A;  2KD0 A;  4HCP B;  4BKT A;  2KAN A;  2KMA A;  2BWF A;  1V9J A;  1Q5W B;  2R2O A;  4PS8 A;  3RZW C;  4BBN C;  2IO3 B;  1Z2M A;  2LD9 A;  3UIP B;  2K6Q A;  1J19 A;  2K8H A;  2N9P C;  4GN1 A;  3U7D A;  4DDI D;  3AU5 A;  4HDO A;  2KQ7 A;  2BYV E;  1WH3 A;  2QHO A;  3EEC A;  2C7N B;  4G3X B;  3PRE A;  4KSK C;  3TMP B;  3HM3 A;  1E90 A;  3QIJ A;  1H8C A;  3VTV A;  2FAZ A;  2DYM A;  5D7G A;  4EUT A;  3QJZ A;  3T9L A;  3ZNI D;  2KZR A;  2L8J A;  3KUD B;  2KWC A;  4FJV B;  4OVV A;  2D3G A;  1CMX B;  3VFK A;  4ICV A;  2D11 A;  2M8S A;  4DHZ E;  2XK5 B;  1P0R A;  3R7Q A;  2LVQ A;  3WAO A;  1LXD A;  2MBE A;  4J6I A;  4A20 A;  4KDL B;  2I1J A;  5DPS A;  4N9F 4;  2AYO B;  2EKE C;  1VCB A;  3NZU A;  3BY4 B;  3TL5 A;  2JRH A;  2GBN A;  3A9K B;  4KDI C;  2G45 B;  3M3J A;  1TZ1 A;  4HDQ A;  2LJ5 A;  3KUZ A;  3QK0 A;  3ZLZ A;  4B9K A;  4BKG A;  4EOY A;  2XBB C;  4KZ0 A;  1RLF A;  1WX9 A;  1QZE A;  1WXA A;  3V6E B;  3RT3 B;  4WJN A;  3WAN A;  2KDB A;  1FXT B;  3ZDM C;  4BFR A;  3PHW B;  3IVF A;  2DZJ A;  4IWQ A;  2IO1 B;  2ZJD A;  3AU4 A;  4ZYN A;  4ASW C;  4TV3 A;  1KJT A;  1YX5 B;  3CSF A;  2GBJ A;  4DWF A;  5JZE B;  2KWV B;  4TUU A;  2Z0E B;  5J17 A;  1V5O A;  1WJU A;  2DYO A;  2WX1 A;  2ZNV C;  1C1Y B;  3JSV A;  4MH0 E;  4F8C B;  1WX7 A;  2N4F A;  3KYD D;  4EZJ A;  4A3P A;  2K1F A;  3ML8 A;  2JXX A;  1E8Y A;  4FJY A;  4KZC A;  1EF1 A;  1TTN A;  4BOS C;  1V80 A;  2V1Y A;  4BKS A;  5D2M B;  1KM7 A;  2N9X A;  2KN5 A;  5G2N A;  3WAP A;  4PS3 A;  4BKS D;  2N7E A;  1UZX B;  2KJ6 A;  4HLE A;  3ZNZ B;  1WZ3 A;  2JWZ A;  3Q3J A;  2ZVO A;  3V6C B;  3PTF C;  4LDT B;  4NQL B;  1RFA A;  1YD8 U;  3ECI A;  2L00 B;  4AWJ A;  2JVC A;  4AOF A;  2V3S A;  1M94 A;  2Z59 B;  4GIV A;  4GB9 A;  3WAL A;  2C7M B;  3LDZ E;  3B08 A;  2MBH A;  3ML9 A;  1I35 A;  2W9N A;  2O6V A;  2EMS A;  4GGQ A;  1A5R A;  1F9J A;  1GJZ A;  2LAS A;  3A1Q B;  2YLM A;  4KVG B;  4HK2 A;  4ANV A;  3RYT A;  3MHS D;  4OVU A;  2KLC A;  3X0W A;  3PS6 A;  1WXV A;  3PT2 B;  4IM3 A;  2O2V B;  4ANX A;  1T0Y A;  2N7D A;  3KVF B;  3VHT C;  5DPW A;  4NAW B;  2NPT B;  3NZS A;  1WMH B;  2DAF A;  2CHZ A;  2J0K A;  2RD0 A;  1E8Z A;  3QC8 B;  4GDK B;  1J8C A;  2JT4 B;  4W9J A;  2MSE D;  1NBF C;  1S3S G;  1WGH A;  5CX3 A;  3RZF A;  2LI5 A;  3HM6 X;  2DX5 B;  2KFJ A;  4WWP A;  3A4S C;  2LGY A;  4K7S A;  1SGH A;  1V49 A;  4FA6 A;  4EZK A;  2WDT B;  2D07 B;  2IY1 B;  4TKN A;  2CR5 A;  3L17 A;  3H1U A;  2BKR B;  2JPH A;  3ZVV A;  2PE9 A;  3QAR A;  2KVR A;  2NBW B;  5AZG A;  1VD2 A;  2LRW A;  4MM3 A;  2DZK A;  2K25 A;  2XEW A;  3I3T B;  4IWO A;  4MJS A;  1WR1 A;  3ONS A;  3VUX A;  4JLC A;  2NVU I;  1WRD B;  3QWZ B;  1C3T A;  4IWP A;  5E6N A;  3VXW A;  4XZ4 A;  1AAR A;  1LQB A;  3UIO B;  1Q0W B;  3UGB B;  1Q1O A;  4M0W B;  1WGR A;  4URK A;  3W1S C;  3CF6 E;  2HE7 A;  2L3Z A;  2LVP A;  3WAM A;  3V60 A;  1RRB A;  4HVB A;  5DPR A;  3O65 B;  1XD3 B;  3DVG X;  5L83 A;  2K6D B;  4KIK B;  4WJP A;  4K1R B;  4LDT D;  2PE6 B;  3OJ4 B;  3U8Z A;  4AP4 C;  4PS7 A;  4X57 B;  4EFO A;  5AEK B;  1L7Y A;  1KLV A;  3A9K A;  2IYD B;  2O6V B;  1PQS A;  2RSU A;  5KHO A;  5L95 C;  1WYW B;  2MW5 A;  2KDF B;  2KOX A;  2PJH A;  3CMM B;  4P7I A;  2JRI B;  4DBG A;  1MG8 A;  5JH5 C;  2ZPN A;  4MGZ E;  3OAW A;  4FHK A;  4TQ0 A;  4HXD A;  1EO6 A;  5GMV A;  3SDL C;  3ALB A;  1GUA B;  1IP9 A;  4HWI B;  2O2V A;  3QHT A;  3SD5 A;  3SHQ A;  2JY6 A;  2LXC A;  2Y5B B;  1GNU A;  4F7Z A;  2NR2 A;  5DCN A;  5J18 A;  2FCS A;  2IO0 B;  3GOE A;  1L2N A;  2ZCB A;  2CKH B;  2KJH B;  2KTR B;  4MGI E;  4MSM B;  3UQB A;  2L05 A;  4I6P A;  2K39 A;  3LJ3 A;  4PYU A;  4WQO B;  4ICU A;  2AL6 A;  3NY5 A;  2JUO A;  2RPQ A;  3APD A;  4G11 A;  4WWO A;  1ZW7 A;  3M95 A;  3ZTC A;  4FAD A;  5LXH A;  2NPT A;  4BOZ B;  2I1K A;  2KHW B;  1E7V A;  3MJW A;  4HPL B;  2L0T A;  3TJP A;  4ANW A;  4EKU A;  2GMI C;  2OOB B;  4FLH A;  2KLG A;  4MEL A;  3VQI A;  3NHE B;  3DPD A;  4NQK E;  2HTH A;  4ZRK A;  2IY0 B;  2AL3 A;  2LGD A;  1UD7 A;  3A9J B;  2KDE B;  2N1W A;  4AJW A;  2G4S A;  4XX5 A;  5CTR C;  4XC2 A;  3JYU A;  3UQA A;  2KKC A;  3HHM A;  1WY8 A;  4GDL A;  2KMC A;  1WJN A;  2LUE A;  4IC7 B;  2FNJ B;  4GXB A;  2ZEQ A;  3VH4 B;  3U30 A;  1J0G A;  2ASQ A;  3L08 A;  1WFY A;  3NOB A;  2LRU A;  4M8M A;  2C5L C;  3MTN B;  2BPS A;  1YQB A;  4KV2 A;  2AEH A;  4GMV A;  3VUW A;  2CHX A;  2LGX A;  2KX3 A;  1WI0 A;  1EF5 A;  2LZ6 A;  4K7W A;  3RD2 A;  5JHB A;  1KOT A;  2DHZ A;  1WM2 A;  3PRP B;  3HK0 A;  2FID A;  4E3C A;  3TBL D;  3ZKJ C;  3VVW B;  1XQQ A;  2MBB B;  3H9D A;  4W9G A;  2ZCC A;  3ZUN A;  1WF9 A;  1I42 A;  2Z0D B;  1E7U A;  4JGH B;  2KTR A;  1IYF A;  3IHP C;  1P9D U;  3H7S A;  4KSL C;  2K8C A;  4ZRJ A;  4W9E A;  3BIN A;  2J7Q B;  2YVC A;  2CS4 A;  3W1Y A;  2C7H A;  2KJR A;  1Z5S B;  1V6E A;  5HKH A;  3QA8 A;  4GDK A;  4WWN A;  2M1M A;  3R3M A;  4FUL A;  2HD5 B;  2MQJ A;  3APF A;  5D6J B;  4JQW C;  1ZKH A;  2G4D B;  3GZN I;  3X23 A;  5TR5 A;  2KDI A;  3KUC B;  3DBH I;  3RUI B;  4GU2 A;  1GG3 A;  2GBK A;  3IG3 A;  3CST A;  2VRR B;  4NPN A;  5FR6 A;  1NI2 A;  1YIW A;  3VTW A;  2M17 A;  2MP2 A;  2ZPY A;  3PZD A;  3PHX B;  3RUL A;  4B95 A;  4DXA B;  2BYE A;  2HJ8 A;  3H7P A;  5CHV C;  3C0R B;  5IAA C;  3VH3 B;  4FHJ A;  3ZTD A;  1LM8 B;  2J0J A;  4W9F A;  3P2B A;  3JW0 X;  4MGY E;  1WMH A;  2G3Q B;  2MLB A;  3DBR I;  5CHF A;  4BBN F;  2JZ3 B;  1NDD A;  4W9D A;  1P1A A;  4MJS B;  3W1S A;  2KFK A;  1WGD A;  3B0A A;  2MBQ A;  1OGW A;  1V5T A;  5AZH A;  4GSW A;  1WXS A;  3ZW3 A;  1E8W A;  3DCG A;  3OJ3 A;  1OEY J;  4NNJ B;  4TQ1 A;  2FCQ A;  1R4N I;  4ZRI A;  2KC2 A;  3PRZ A;  4IM2 A;  5LLI A;  1GC7 A;  2PEA A;  4W9C A;  4RMA A;  2B3A A;  4MEM A;  2KQS A; 
#chains in the Genus database with same CATH topology
 1RAX A;  4YWG G;  2WXJ A;  3FC4 A;  4KIK A;  3VAW A;  2M4N A;  3OLM D;  3JVZ X;  1WE6 A;  5HHD G;  1TGZ B;  1TKG A;  2DZI A;  1LO5 D;  2WWZ A;  3R2T A;  2L0F A;  2JZZ A;  1HE8 A;  4HKQ A;  3HIZ A;  4OZC A;  4IUM B;  2FCM A;  1ENF A;  3PVL A;  2C60 A;  4GOC A;  1VJK A;  1K50 A;  5BYQ A;  2M0A A;  2MH7 A;  2AX5 A;  3DDC B;  5BO4 B;  1I4P A;  4ZRP A;  4H2A A;  2R61 A;  4EEW A;  5CHW A;  4L2Y A;  3WIM A;  1XF5 L;  3ZIM A;  1ZPS A;  5KHQ A;  5C1Z A;  4ZDV A;  3GZN B;  4CO7 A;  3Q3O C;  1G6J A;  3OWE B;  3RCZ A;  3MFG A;  3QQ8 B;  1I4G A;  1UWX A;  2LJI A;  5AUK A;  3N30 A;  1JRU A;  1BML C;  1WXM A;  2WX0 A;  4DK5 A;  3IBE A;  2BS4 B;  1L6U A;  2L7R A;  1FCL A;  1D5M C;  3NRZ A;  4CYE A;  3FIL B;  3V61 A;  1OQY A;  3S2A A;  2FE8 A;  3R2I A;  4JIO U;  3AE8 B;  3D32 A;  1OQR A;  2FCN A;  2KTF A;  1X1M A;  3PRM B;  1RM6 C;  1WJ6 A;  2KK8 A;  2VZK B;  3P63 A;  2CU1 A;  2R2Q A;  2WXI A;  2AWT A;  2RDG A;  2HTM E;  1H4R A;  5JXV A;  1B9R A;  4PT5 A;  2WXM A;  3HVZ A;  1VRA B;  4F1S A;  4LCD E;  4O1N A;  2V3N A;  2V0G A;  2BGF A;  1V1P A;  5TSS A;  2X38 A;  4TMA B;  2WDR B;  3ETR A;  1F2R I;  2KWU B;  4HCN B;  2JWU A;  4ZRQ A;  3EHV A;  2IZV B;  2WXH A;  2K8B A;  2N9E B;  2J52 A;  1JW9 D;  2KVZ A;  3BVM A;  4IW0 A;  4NAW A;  3UIN B;  3L13 A;  4FBJ B;  2MEK A;  4FJZ A;  4AQ7 A;  2DZM A;  4CHK A;  1ET9 A;  1TBE A;  1MJD A;  2KAN A;  1P7F A;  1V9J A;  2R2O A;  4PS8 A;  3P4R B;  2LHE A;  1TY0 A;  2K8H A;  2N9P C;  3FKY A;  1WH3 A;  2C7N B;  3HM3 A;  1SE4 A;  3QIJ A;  1H8C A;  3T9L A;  3E56 A;  1J7C A;  1FFV A;  2KWC A;  4FJV B;  3ZYY X;  4YXD B;  1HA5 A;  1XLQ A;  5EE0 A;  2I1J A;  3Q2A C;  1VCB A;  3NZU A;  1IGC A;  2JRH A;  2GBN A;  4KDI C;  2G45 B;  3M3J A;  1TZ1 A;  3ZLZ A;  4B9K A;  4BKG A;  2WXG A;  3ZQ4 A;  4KZ0 A;  2VH2 A;  4ACF A;  1GAQ B;  3PO0 A;  4DHJ D;  3WAN A;  3ZDM C;  1C9F A;  3PHW B;  3IVF A;  2WNM A;  2QCZ A;  1ZE3 D;  4ASW C;  4TV3 A;  1KJT A;  4DWF A;  4L23 A;  2LUM A;  2KWV B;  2ZNV C;  1V5O A;  2E6X A;  4F8C B;  4EZJ A;  4A3P A;  2K1F A;  2N0S B;  2JXX A;  1XXG A;  4FJY A;  3WCQ A;  4BKS A;  5G2N A;  4BKS D;  2N7E A;  3MJ5 A;  3ZNZ B;  1QOA A;  3Q3J A;  4K3C A;  4KKI A;  4C7Z A;  1MPE A;  2DNF A;  1SIJ A;  4AOF A;  2Z59 B;  2Z8L A;  3WAL A;  2C7M B;  3RNB C;  2MBH A;  1K53 A;  1N62 A;  1GJZ A;  2LAS A;  3A1Q B;  4KVG B;  2LFI A;  2TSS A;  1GB4 A;  3Q3N C;  4OVU A;  1PGX A;  2KLC A;  2EKI A;  4RGO S;  4IM3 A;  2O2V B;  2N7D A;  3KVF B;  4KKJ A;  2J0K A;  2WXO A;  3TEY A;  4OHJ A;  1NBF C;  3A4S C;  2LGY A;  4FXC A;  4LLG M;  1V49 A;  4FA6 A;  5FKA C;  4TKN A;  1TKY A;  4HRO A;  2KDM A;  3DHG C;  2BKR B;  2KVR A;  2NBW B;  2WXR A;  4XWT A;  4A8X C;  1XLO A;  2QDF A;  3I3T B;  4MJS A;  3VUX A;  1MVK A;  4IWP A;  5E6N A;  3UIO B;  1CJE A;  1WGR A;  3W1S C;  2Y5P A;  2XNA C;  2WLB A;  3O65 B;  1YN4 A;  5L83 A;  4K1R B;  4LDT D;  4XGA B;  4X57 B;  3SFE B;  3NVW A;  2PTL A;  2KOX A;  2KDF B;  4P7I A;  1FRD A;  1MG8 A;  1L0Y B;  2ZPN A;  5HG2 A;  3ZXR A;  3V3X A;  4HXD A;  3GE3 C;  3ALB A;  1GUA B;  1IP9 A;  4HWI B;  2O2V A;  3QHT A;  5MPO A;  2LXC A;  1IBX A;  2Y5B B;  1GNU A;  5J18 A;  2FCS A;  4J3O D;  1JML A;  2K39 A;  4TSS A;  4ICU A;  3NY5 A;  1QIL A;  2RPQ A;  3APD A;  4G11 A;  3NUH B;  4FAD A;  2NMQ A;  2PW9 A;  2I1K A;  1ZDV A;  2KHW B;  4BOZ B;  1KLG D;  2L0T A;  4ANW A;  4YSY B;  3VQI A;  4B0E A;  5HFY A;  2KDE B;  1EM7 A;  4AJW A;  1E6E B;  3JYU A;  4GDL A;  4RGN A;  2LUE A;  3AE9 B;  3U30 A;  1WFY A;  3NVV A;  2AQ2 B;  2LRU A;  4M8M A;  2Y5C A;  2BPS A;  2AEH A;  4GMV A;  1YN5 A;  2LGX A;  2W54 A;  2LZ6 A;  4K7W A;  4WQM A;  4GLS C;  3PRP B;  4K3B A;  2FID A;  1N61 A;  3TUO A;  1QT9 A;  1QKZ A;  2MBB B;  3H9D A;  3LXF A;  1I42 A;  1E7U A;  3C8Y A;  3H7S A;  4KSL C;  4W9E A;  2CS4 A;  2KJR A;  3P4P B;  4LNO A;  4FUL A;  2I38 A;  5I4D A;  4JQW C;  2G4D B;  3H8H A;  5HI1 A;  3Q69 A;  3RUI B;  4GU2 A;  5EE1 A;  1KTK A;  2VRR B;  2M17 A;  4B95 A;  2HJ8 A;  1YNT E;  3VH3 B;  2IGD A;  5CHF A;  2G3Q B;  3IAM 1;  4HJG E;  3BK1 A;  3B0A A;  1C4C A;  1OGW A;  2EEL A;  1VDV A;  4NJC A;  1E8W A;  3DCG A;  1OEY J;  1V1P B;  2FCQ A;  3PRZ A;  2WU5 B;  1GC7 A;  5D94 A;  1ZOY B;  2D10 A;  4PYZ A;  3ZO5 B;  3LB8 C;  2L52 A;  3UF8 A;  1FD6 A;  3DBL I;  3M63 B;  2LWP A;  2QEJ C;  3ZJT A;  3SEB A;  1UBI A;  2NCN A;  2FUH B;  2BB5 A;  1WSP A;  1PDX A;  1GOZ A;  3A9J A;  2GOW A;  3DBS A;  4C56 C;  2KXJ A;  5J2R A;  3QAQ A;  3PV1 A;  2DWQ A;  2KWD A;  3TIX A;  4WUR A;  3OG5 A;  3RMK C;  2J0M A;  1SXT A;  5LXI B;  2PPH A;  2ZW0 A;  1WZ0 A;  5D3I B;  2KC1 A;  2FBW B;  1XCT L;  5G55 A;  2O6V D;  2BYF A;  5IA7 A;  2CHW A;  3L54 A;  4K7U A;  2K0P A;  2JF5 A;  4NZL B;  1N5W A;  4IG7 B;  2NS5 A;  1XT9 B;  4YL8 A;  4OZB A;  3T8M A;  3H7P B;  3V62 A;  1WJ4 A;  3HVD A;  3AV8 A;  3WA0 A;  3N32 A;  1TIF A;  3KYC D;  1T0S C;  1FO4 A;  1MFW A;  2KFK B;  2UYZ B;  3EFU A;  3KH0 A;  4RM8 A;  4W9K A;  1UBQ A;  4DDG D;  4G0N B;  2BBC A;  3BII D;  4E74 A;  4EZL A;  1WGY A;  1KF6 B;  3NS8 A;  4FN2 A;  3QCA A;  1QOF A;  1OFF A;  1QOB A;  2D2Q A;  3A33 B;  2L76 A;  4JL9 A;  1I7H A;  4NJ7 A;  4AUQ C;  4I6N B;  1R4M I;  1UEL A;  4RCO A;  3ENE A;  2RR9 A;  4S0R A;  1QLB B;  2REX A;  3VTU A;  2V4L A;  2N9K A;  3VDZ A;  4K81 A;  2RDH A;  2BF8 B;  4YTM B;  3W5U B;  2MA9 B;  1V2Y A;  1E5W A;  2ZVN A;  1FRR A;  2GBM A;  4B0M A;  4WJO A;  1F1H A;  3AI5 A;  1PGB A;  5EDS A;  3ZNH B;  3SFD B;  2W82 A;  3L16 A;  1HTO A;  4BBN C;  1GB1 A;  3C19 A;  4C7Y A;  2INN E;  1KH0 A;  2K6Q A;  1J19 A;  2WHI A;  1SBB B;  4GN1 A;  4DDI D;  5G5H A;  2KQ7 A;  2BYV E;  2KYW A;  4G3X B;  3PRE A;  1HQR D;  3IT4 B;  3CIR B;  2DYM A;  3QJZ A;  3RI7 C;  4HEA 1;  5EE9 A;  4YT0 B;  2KZR A;  4OVV A;  1FMA D;  1IGD A;  2SEB D;  1CMX B;  1C4P A;  1L4Z B;  1SB3 C;  3MP9 A;  4DHZ E;  2XK5 B;  4WWM A;  3R7Q A;  1GPX A;  4J6I A;  4M02 A;  4KDL B;  4A20 A;  4S17 A;  1K51 A;  2AYO B;  2WDQ B;  3TL5 A;  1I4R A;  3A9K B;  1PGA A;  2LJ5 A;  3KUZ A;  4EOY A;  1L6V A;  2XBB C;  4USA A;  3ZXV A;  1DOI A;  2WXF A;  4RF1 A;  1WX9 A;  4WJN A;  2DZJ A;  2IO1 B;  3AU4 A;  1E9M A;  3P42 A;  2NTS A;  3DBR B;  1YX5 B;  4A6Q A;  5JZE B;  4TUU A;  3VR9 B;  4US8 A;  1WJU A;  2WX1 A;  1C1Y B;  2JYE A;  3RNC C;  3KYD D;  5BMH A;  3ML8 A;  1E8Y A;  3P1M A;  1EF1 A;  1TTN A;  2BS3 B;  4BOS C;  1V80 A;  2QC8 A;  1KM7 A;  3AN1 A;  4HPP A;  4PS3 A;  2KJ6 A;  1WZ3 A;  4HRS A;  4L1B A;  2ZVO A;  3VR8 B;  3PTF C;  3ECI A;  4AS1 A;  2V3S A;  1M94 A;  3J9C A;  3ML9 A;  1FNU A;  1I35 A;  2W9N A;  2O6V A;  2EMS A;  3DBL B;  3O13 A;  3TEW A;  1DYQ A;  4A55 A;  3RYT A;  3BVZ A;  3MHS D;  1TS5 A;  4RGM A;  3PS6 A;  4ANX A;  1WMH B;  2DAF A;  2CHZ A;  1J8C A;  2MSE D;  1S3S G;  3VRA B;  5CX3 A;  2DX5 B;  2KFJ A;  4WWP A;  1ZXI A;  1MI0 A;  2JZP A;  4EZK A;  3W5V B;  2D07 B;  4XWW A;  1TY2 A;  3L17 A;  5BYR A;  2JPH A;  3ZVV A;  2PE9 A;  3QAR A;  5AZG A;  1F0Z A;  2LRW A;  1WR1 A;  4JLC A;  2NVU I;  2H88 B;  3NVY A;  3VXW A;  3N9Y C;  1LQB A;  2E3T A;  1D5Z C;  4URK A;  1WXQ A;  2HE7 A;  1JAL A;  2L3Z A;  3WAM A;  1WYG A;  1FNV A;  5E6J A;  3V60 A;  5DPR A;  4WJP A;  4KIK B;  1E0Z A;  3AMZ A;  2PE6 B;  5H92 C;  3OJ4 B;  3U8Z A;  4AP4 C;  1KLV A;  2O6V B;  3Q8C A;  1FIQ A;  4YSZ B;  4M01 A;  3ABV B;  5L95 C;  2MW5 A;  2PJH A;  2JQR B;  2JRI B;  3N1X C;  4MGZ E;  1AN8 A;  2I2Y A;  4TQ0 A;  1R4N B;  5GMV A;  3SDL C;  1RYJ A;  3SD5 A;  5IO9 A;  3SHQ A;  1E10 A;  3T3O A;  3ZGZ A;  5DCN A;  1YQ3 B;  4LK0 M;  3GOE A;  2KTR B;  3UQB A;  4I6P A;  2AL6 A;  2JUO A;  2ACZ B;  1ZW7 A;  4REZ A;  2NPT A;  1E7V A;  3MJW A;  4HPL B;  2GMI C;  2OOB B;  1JWB D;  3DPD A;  4ZRK A;  2LGD A;  2AL3 A;  3A9J B;  2N1W A;  4XX5 A;  5CTR C;  3GE8 C;  3UQA A;  3HHM A;  1WY8 A;  1WJN A;  1ZXH A;  2KMC A;  1IUE A;  4GXB A;  2ZEQ A;  2J42 A;  2ASQ A;  3L08 A;  1L0X B;  1QQR A;  2JX5 A;  3AE4 B;  1T0R C;  2KX3 A;  1EF5 A;  3RD2 A;  4MM3 B;  1N5X A;  3DWM A;  1WM2 A;  4DXG A;  4E3C A;  3TBL D;  1KRH A;  3VVW B;  1OQQ A;  4KX6 B;  4W9G A;  2ZCC A;  1L4D B;  1Q10 A;  3Q6B A;  2KTR A;  1JQ4 A;  2IND C;  3BIN A;  2YVC A;  2WXN A;  3T3N A;  3AE6 B;  3QA8 A;  2QSD A;  4GDK A;  3R3M A;  5H8Y E;  4JWS C;  5TR5 A;  3KUC B;  2YEP F;  4RGT A;  2PIA A;  3IG3 A;  3CST A;  3VTW A;  3Q8E A;  1NI2 A;  2K9X A;  3V05 A;  3RUL A;  4DXA B;  4KGS A;  2BYE A;  2K22 A;  3H7P A;  5IAA C;  2G9H D;  3ZTD A;  2PMV A;  1XO3 A;  3P2B A;  3DBR I;  4BBN F;  3AE5 B;  1XLP A;  3ZJV A;  3W1S A;  2KFK A;  1WGD A;  1FM0 D;  1AW7 A;  4OW0 A;  1V5T A;  1WXS A;  4NNJ B;  3E9S A;  1R4N I;  5LLI A;  4W9C A;  3I5J C;  2B3A A;  1Y8R C;  3DQV A;  4ZOH C;  2LVO A;  2WQY B;  4WJQ A;  1LFD A;  2LXA A;  1NVI D;  2CJO A;  4C4V B;  4OVZ A;  5T8I A;  2WU2 B;  2DAJ A;  3KWL A;  4G50 A;  1FCC C;  3TCA A;  2MX2 A;  1SSN A;  4II3 B;  4LJP B;  3N20 C;  4E71 A;  3KW5 B;  2FIF A;  4MH8 A;  3RNG C;  1UWM A;  1EUV B;  1ISN A;  2M0X A;  3DVN U;  1K8R B;  3BK2 A;  4LTU A;  5AZF A;  4US9 A;  3W9C B;  4WIP A;  1E8X A;  2LHD A;  3MC8 A;  2KNB A;  4NAM A;  2IO2 B;  4A3O A;  1ZGU B;  1WR6 E;  2V3P A;  3PGE A;  4B6W A;  4HJK A;  1P7E A;  2MJE A;  2N1V A;  3EC8 A;  2BVC A;  4RH6 A;  2RGF A;  1UGM A;  5E6P A;  5IKC M;  3AUL A;  3IXS A;  4QAY A;  1TKE A;  1FEH A;  1V86 A;  2NBV B;  1J7B A;  1K52 A;  2XK5 A;  1BXT A;  5DPT A;  1UH6 A;  3PLV A;  3IFW B;  3AE3 B;  2A4Z A;  2KQ4 X;  3RNA C;  4PK1 A;  3L10 B;  4NY0 A;  2IGH A;  1WGG A;  4D2K A;  3ZDT A;  1ZUD 2;  4N6E B;  1PUT A;  1V81 A;  2UWQ A;  4AJY B;  1P98 A;  2MCN B;  4OZA A;  2ON8 A;  3BVG A;  4W9I A;  1N63 A;  1CQV A;  1L0V B;  3UI3 A;  3P4Q B;  4WAA A;  3SR6 A;  1VZ8 A;  1UGJ A;  3R7R A;  2BKF A;  2MP2 B;  2BWE S;  1PYW D;  4ZHO A;  2MJ3 A;  1VLB A;  1SE2 A;  2PVO D;  2WXK A;  3M62 B;  2LGS A;  2MRP A;  3DHI C;  2WP9 B;  4MSQ B;  2MBO A;  4DHZ B;  3JSV B;  4ZYS A;  3RFZ B;  4HPM B;  2IBI B;  3DVG Y;  4JX1 C;  1FXA A;  1STE A;  1HZ5 A;  2GBR A;  3ZNG C;  2MWS B;  2DYB A;  4I6L B;  5BMI A;  2WS3 B;  1JRO A;  3QX1 A;  1SJH D;  1YJ1 A;  3B1L X;  2KD0 A;  2BWF A;  2B76 B;  1Q5W B;  3DWG C;  2KAJ A;  2W3R A;  1Z2M A;  3AEC B;  2RPV A;  3UIP B;  2BQQ A;  1M4V A;  3TMP B;  5FR3 A;  4KSK C;  3VTV A;  5D7G A;  4EUT A;  3ZNI D;  2L8J A;  1VZ7 A;  3KUD B;  2D3G A;  1FXI A;  4ICV A;  2M8S A;  3KLS X;  1C76 A;  2LGI A;  1P0R A;  2M19 A;  3WAO A;  1LXD A;  2MBE A;  5C2T B;  4YTN B;  4N9F 4;  2EKE C;  4YTP B;  3BY4 B;  3GS2 A;  1T3Q A;  2L1A A;  1RLF A;  3U7Z A;  3V6E B;  3RT3 B;  3AB5 A;  2SAK A;  4BFR A;  4IWQ A;  3FIL A;  1EWY C;  3AEE B;  2W55 A;  3CSF A;  2GBJ A;  3JSV A;  2D3A A;  1RWS A;  2Q5W D;  1WX7 A;  4MH0 E;  2J4X A;  3RPF C;  2JSV X;  2LMC A;  1TJE A;  3BYY B;  2N9X A;  1UZX B;  2JWZ A;  3TEZ A;  3V6C B;  3U52 E;  4NQL B;  1YD8 U;  2L00 B;  3AED B;  3HRD D;  2JVC A;  1F52 A;  4GB9 A;  1CZP A;  3B08 A;  1WRI A;  1F9J A;  2YLM A;  3EA6 A;  5IOI A;  4HK2 A;  4ANV A;  1KLU D;  1TS2 A;  3IAS 1;  1WXV A;  3PT2 B;  1C78 A;  1TT5 B;  4NAW B;  2NPT B;  3NZS A;  3N1Y C;  1E8Z A;  3PZ8 A;  3RZF A;  2LI5 A;  3U2S C;  4K7S A;  1SGH A;  2WDT B;  2IY1 B;  2INP E;  1EWC A;  4C80 A;  4RFB A;  3RNE C;  4WAF A;  4DXF A;  2D3C A;  4MM3 A;  2XEW A;  2K25 A;  4C00 A;  2PLP A;  1WRD B;  1JWU D;  3U4E G;  4XZ4 A;  1AAR A;  3UGB B;  2DBY A;  2INC C;  3CF6 E;  1RRB A;  3EFC A;  2K6D B;  2IDY A;  4Q2J A;  4EFO A;  5AEK B;  1L7Y A;  3BYT B;  2IYD B;  3MHZ A;  4A9A A;  1RFK A;  1Y56 A;  4A90 A;  1WYW B;  1XEE A;  3IT6 B;  4DBG A;  2LEK A;  4IOI E;  4UDU C;  5JH5 C;  3OAW A;  1JWS D;  4FHK A;  1NYQ A;  3MC9 A;  1JWM D;  4RNA A;  2JY6 A;  2JXT A;  1MHH E;  2KMM A;  2IO0 B;  1L2N A;  2ZCB A;  4MGI E;  2KJH B;  2RMM A;  4C4V A;  2L05 A;  4WQO B;  4PYU A;  3NZ3 A;  1HZ6 A;  4WWO A;  5LXH A;  3ZTC A;  2MJD A;  4FLH A;  4XDC A;  4N59 A;  2CJN A;  3NHE B;  2QIE B;  1YQ4 B;  1BUI C;  1V1O A;  2KKC A;  3B2F A;  4ARI A;  4IC7 B;  2FNJ B;  4P1B C;  4KGR A;  4WH4 A;  3NOB A;  1FNW A;  3RN9 C;  1JCK B;  2WDV B;  1ESF A;  4N58 A;  3R8B A;  1EU3 A;  4LNN A;  5G5G A;  2CHX A;  1WI0 A;  1MG4 A;  5JHB A;  4XE0 A;  1TS3 A;  3ZUN A;  1D6E C;  2KAC A;  2Z0D B;  3I57 A;  4JGH B;  4ZRJ A;  1XCQ L;  5HKH A;  1NYR A;  4WWN A;  2MQJ A;  3APF A;  3GZN I;  3X23 A;  1NEN B;  1GG3 A;  4NPN A;  1YIW A;  1SE3 A;  3PHX B;  3AM9 A;  1AYF A;  3C0R B;  2WXP A;  3DHH C;  4FHJ A;  1LM8 B;  3JW0 X;  4MGY E;  5AUI A;  1WMH A;  2MLB A;  5IN7 A;  1PFD A;  1NDD A;  4W9D A;  1P1A A;  1JRP A;  3B9J A;  4MJS B;  2MBQ A;  2WXL A;  3ZW3 A;  4BZA A;  4ZRI A;  4IM2 A;  2H89 B;  2QMT A;  5C3J B;  3VH4 B;  3EGR A;  2GI9 A;  2KX0 A;  1YOV B;  2OHF A;  1SIF A;  4LJO B;  2K3U A;  2EMT A;  3VUY A;  2QIL A;  1UNS A;  4KGT A;  2PVG C;  4CQN A;  2VH1 A;  3CWI A;  4MGK E;  4JPS A;  3L0W B;  2KO3 A;  4II2 B;  1SE9 A;  3R66 C;  3RNF C;  3NJT A;  1BT0 A;  2BB6 A;  3PLU A;  4BVU C;  3HUI A;  1WE7 A;  2JU6 X;  2XN9 C;  4XYC A;  3A4R A;  4IDI A;  2A5U A;  2W3S A;  2IJ0 A;  2UU7 A;  1GC6 A;  2DEN B;  1E7P B;  3H6N A;  2N9L A;  2HJ1 A;  3AE7 B;  3ZRC A;  2ICI A;  2ZZP B;  5GXG B;  4ANU A;  4DQO C;  1U4A A;  3PZ7 A;  5E6O A;  1D4B A;  3PSE B;  4GDL B;  1WIA A;  1YX6 B;  3AEB B;  2GLS A;  4DHJ B;  1WM3 A;  2BS2 B;  1V97 A;  3NS1 A;  3L4P A;  4IKG A;  1TYG B;  5LNK 1;  5JHA A;  2QJL A;  2C9W B;  1FFU A;  3MC0 B;  4LNK A;  2OJR A;  1NI3 A;  4BAX A;  3APC A;  3PPA A;  4MDK E;  1I4H A;  2V9H A;  3A1Q A;  3N3K B;  2IGG A;  3ZRF A;  4LNF A;  1IPG A;  3AE2 B;  4IM0 A;  3Q3F A;  1MHX A;  3SU8 X;  1R4M B;  5C23 A;  1WX8 A;  2ZNV B;  3GB1 A;  4NJ6 A;  1DGJ A;  2WYQ A;  1S1Q B;  3DVN V;  4M8N A;  2GRI A;  1D3Z A;  1A70 A;  2OJW A;  4YSX B;  3AEA B;  2NBU A;  1HXY D;  4JE3 B;  1SEB D;  5BYS A;  4RM9 A;  1OTR B;  2GB1 A;  4HKZ E;  1KFY B;  3GP7 A;  4LNI A;  2FUG 1;  1OEY A;  1WGK A;  3Q8A A;  4W9H A;  1N6Z A;  1C79 A;  3AXC A;  3DOW A;  2DLB A;  4ARC A;  2K5P A;  1P3Q U;  2MHJ A;  3K9P B;  3K9O B;  4W9L A;  3AEF B;  5FK9 C;  4HCP B;  4BKT A;  1VR9 A;  2KMA A;  3RZW C;  2IO3 B;  2LD9 A;  1YJI A;  2WGS A;  1AWD A;  3U7D A;  3FAH A;  3AU5 A;  4HDO A;  1ACC A;  2IPK D;  2QHO A;  3EEC A;  1QOG A;  1E90 A;  2FAZ A;  1ET6 A;  1T0Q C;  2Y3A A;  2PKO A;  1SJE D;  4M00 A;  3VFK A;  2D11 A;  1HEZ E;  5IP4 D;  2LVQ A;  2OED A;  2ONQ A;  5D3D A;  1YMH E;  5DPS A;  1ROE A;  3Q8F A;  2RDB C;  4HDQ A;  3QK0 A;  1YN3 A;  4P16 A;  1J7A A;  2JYT A;  1NEK B;  1WXA A;  1QZE A;  3B2G A;  4XDD A;  2KDB A;  1FXT B;  2ZJD A;  4ZYN A;  2D5G A;  2Z0E B;  5J17 A;  1YJJ A;  2DYO A;  5EE3 A;  2V4I B;  2N4F A;  4KZC A;  1T5X D;  2V1Y A;  5D2M B;  2KN5 A;  3WAP A;  2KN4 A;  4HLE A;  4LDT B;  1I4X A;  1RFA A;  3BZD B;  4AWJ A;  3AE1 B;  4GIV A;  3LDZ E;  1N60 A;  2D3B A;  2BTE A;  4GGQ A;  1A5R A;  4M0W A;  4R3D A;  3Q14 C;  2CU3 A;  3Q8B A;  1FPY A;  1ZDX A;  3X0W A;  3ZJU A;  2ZW1 A;  4MAC A;  5BMG A;  1T0Y A;  4RF0 A;  3VHT C;  5DPW A;  1C4A A;  1I4Q A;  1VZ6 A;  2RD0 A;  3QC8 B;  4GDK B;  2JT4 B;  2YEP B;  4W9J A;  1WWT A;  1WGH A;  3EUB 2;  3HM6 X;  2KT7 A;  4P1C C;  3VRB B;  4JWU C;  2CR5 A;  3TEX A;  3H1U A;  2VZK D;  4EE2 A;  1VD2 A;  1QF6 A;  2DZK A;  4IWO A;  2AQ3 B;  2L32 A;  3ONS A;  3QWZ B;  1C3T A;  1UF0 A;  1Q0W B;  1Q1O A;  4M0W B;  1F2R C;  2M56 B;  2J53 A;  3DBH B;  2L83 A;  3P4S B;  2LVP A;  2HDE A;  2AQ1 B;  3I63 C;  4HVB A;  1XD3 B;  3DVG X;  1F77 A;  3Q3M C;  4PS7 A;  4ITK A;  3A9K A;  1B1Z A;  1PQS A;  2RSU A;  5KHO A;  3CMM B;  4P6V F;  1T6B X;  4ZHP A;  1TZO A;  1L5P A;  1EO6 A;  1DOY A;  1D5X C;  4MT5 A;  4F7Z A;  2NR2 A;  2CKH B;  4MSM B;  3LJ3 A;  3TSS A;  3M95 A;  3N1Z C;  3LYY A;  4EKU A;  3TJP A;  1V8C A;  2KLG A;  4MEL A;  4NQK E;  2HTH A;  2IY0 B;  2BT6 A;  1UD7 A;  2G4S A;  4XC2 A;  3KQ4 A;  3KWV A;  1LGR A;  3W2D A;  1J0G A;  2C5L C;  3MTN B;  2BW2 A;  1YQB A;  4KV2 A;  3VUW A;  1KOT A;  2DHZ A;  3HK0 A;  1CK1 A;  3BWU D;  3ZKJ C;  3URY A;  1R7S A;  1XQQ A;  1WF9 A;  2BYT A;  1IYF A;  3IHP C;  3NVZ A;  1SF0 A;  1P9D U;  2K8C A;  2J7Q B;  3W1Y A;  2C7H A;  1Z5S B;  1V6E A;  3I9V 1;  2M1M A;  1JWA D;  2HD5 B;  5D6J B;  2X8X X;  1ZKH A;  2KDI A;  3DBH I;  3AH7 A;  2GBK A;  1UUP A;  1EU4 A;  5FR6 A;  3NG0 A;  2ZPY A;  2MP2 A;  3PZD A;  1XLN A;  5CHV C;  2N7J A;  2WXQ A;  2J0J A;  4W9F A;  2JZ3 B;  2G1E A;  1ZP0 B;  1IBX B;  2NTT A;  1HTQ A;  1DOX A;  5AZH A;  4GSW A;  3OJ3 A;  4TQ1 A;  2KC2 A;  1C77 A;  2PEA A;  3AEG B;  4RMA A;  1TS4 A;  4MEM A;  2KQS A; 
#chains in the Genus database with same CATH homology
 5D94 A;  1Y8R C;  2KX0 A;  3DQV A;  2D10 A;  2LVO A;  4PYZ A;  1RAX A;  3ZO5 B;  1SIF A;  4WJQ A;  4LJO B;  1LFD A;  2LXA A;  2EMT A;  4KIK A;  3VAW A;  3VUY A;  2M4N A;  3OLM D;  3JVZ X;  3UF8 A;  1WE6 A;  3DBL I;  3M63 B;  2LWP A;  1TGZ B;  2WWZ A;  2DZI A;  2DAJ A;  2L0F A;  4G50 A;  2JZZ A;  4MGK E;  1HE8 A;  2KO3 A;  3L0W B;  4II2 B;  3TCA A;  2MX2 A;  1SE9 A;  3HIZ A;  3R66 C;  4IUM B;  1BT0 A;  1UBI A;  3PLU A;  2NCN A;  4II3 B;  4LJP B;  4BVU C;  2FCM A;  4E71 A;  3KW5 B;  3PVL A;  2C60 A;  1WE7 A;  2FIF A;  2FUH B;  4GOC A;  3A4R A;  4DHJ D;  2A5U A;  1EUV B;  1GC6 A;  2DEN B;  1ISN A;  2M0X A;  3DVN U;  3H6N A;  3A9J A;  2GOW A;  3DDC B;  1K8R B;  5AZF A;  5BO4 B;  3DBS A;  3ZRC A;  2KXJ A;  2ZZP B;  5J2R A;  4ANU A;  3QAQ A;  1E8X A;  1U4A A;  5E6O A;  3PV1 A;  2KNB A;  3TIX A;  4EEW A;  5CHW A;  3PSE B;  2IO2 B;  4GDL B;  1ZGU B;  4A3O A;  3WIM A;  1WR6 E;  1WIA A;  2J0M A;  3ZIM A;  5LXI B;  5KHQ A;  5C1Z A;  4ZDV A;  4CO7 A;  3PGE A;  2PPH A;  4B6W A;  3RCZ A;  1YX6 B;  1G6J A;  4HJK A;  3QQ8 B;  1WZ0 A;  1WM3 A;  2N1V A;  4DHJ B;  2KC1 A;  3N30 A;  3EC8 A;  1JRU A;  5G55 A;  1WXM A;  2O6V D;  2BYF A;  2RGF A;  2WX0 A;  4DK5 A;  3IBE A;  5JHA A;  1UGM A;  5IA7 A;  2C9W B;  2CHW A;  5E6P A;  2L7R A;  3AUL A;  3L54 A;  2OJR A;  3APC A;  4K7U A;  3PPA A;  1V86 A;  2JF5 A;  2NBV B;  4MDK E;  4CYE A;  3A1Q A;  4IG7 B;  3N3K B;  1OQY A;  3V61 A;  3S2A A;  2NS5 A;  1XT9 B;  4JIO U;  4YL8 A;  3ZRF A;  3T8M A;  3H7P B;  1IPG A;  3D32 A;  3V62 A;  1WJ4 A;  2XK5 A;  5DPT A;  2FCN A;  4IM0 A;  1UH6 A;  3WA0 A;  2KTF A;  3N32 A;  3PLV A;  3IFW B;  3Q3F A;  1X1M A;  3PRM B;  2A4Z A;  1WJ6 A;  3KYC D;  3L10 B;  4NY0 A;  2KK8 A;  1WGG A;  2KFK B;  3ZDT A;  2UYZ B;  3SU8 X;  3EFU A;  3KH0 A;  5C23 A;  1WX8 A;  4RM8 A;  2CU1 A;  1UBQ A;  2R2Q A;  4W9K A;  4DDG D;  2ZNV B;  4NJ6 A;  1V81 A;  2AWT A;  4G0N B;  2UWQ A;  2WYQ A;  1P98 A;  2MCN B;  4AJY B;  1S1Q B;  3DVN V;  1H4R A;  4E74 A;  4M8N A;  4EZL A;  1D3Z A;  1WGY A;  3NS8 A;  4FN2 A;  4W9I A;  3QCA A;  4F1S A;  4LCD E;  3A33 B;  2D2Q A;  2BGF A;  4WAA A;  2L76 A;  2NBU A;  4JL9 A;  2KWU B;  4HCN B;  4NJ7 A;  4AUQ C;  4I6N B;  3R7R A;  1R4M I;  1UEL A;  2BKF A;  2MP2 B;  2BWE S;  3ENE A;  3EHV A;  2IZV B;  2RR9 A;  3M62 B;  4RM9 A;  1OTR B;  2K8B A;  2N9E B;  2REX A;  2MRP A;  4MSQ B;  3VTU A;  2MBO A;  4IW0 A;  4NAW A;  1OEY A;  2V4L A;  4DHZ B;  3JSV B;  3VDZ A;  4K81 A;  4W9H A;  2BF8 B;  3AXC A;  4HPM B;  2IBI B;  3DVG Y;  3UIN B;  2MA9 B;  2GBR A;  3L13 A;  3DOW A;  1V2Y A;  1E5W A;  3ZNG C;  2MWS B;  2DYB A;  4I6L B;  2ZVN A;  4FBJ B;  4FJZ A;  3QX1 A;  2GBM A;  4WJO A;  1P3Q U;  1YJ1 A;  2DZM A;  3B1L X;  4CHK A;  3AI5 A;  3K9P B;  3K9O B;  4W9L A;  1TBE A;  5EDS A;  3ZNH B;  3L16 A;  2KD0 A;  4HCP B;  4BKT A;  2KAN A;  2KMA A;  2BWF A;  1V9J A;  1Q5W B;  2R2O A;  4PS8 A;  3RZW C;  4BBN C;  2IO3 B;  1Z2M A;  2LD9 A;  3UIP B;  2K6Q A;  1J19 A;  2K8H A;  2N9P C;  4GN1 A;  3U7D A;  4DDI D;  3AU5 A;  4HDO A;  2KQ7 A;  2BYV E;  1WH3 A;  2QHO A;  3EEC A;  2C7N B;  4G3X B;  3PRE A;  4KSK C;  3TMP B;  3HM3 A;  1E90 A;  3QIJ A;  1H8C A;  3VTV A;  2FAZ A;  2DYM A;  5D7G A;  4EUT A;  3QJZ A;  3T9L A;  3ZNI D;  2KZR A;  2L8J A;  3KUD B;  2KWC A;  4FJV B;  4OVV A;  2D3G A;  1CMX B;  3VFK A;  4ICV A;  2D11 A;  2M8S A;  4DHZ E;  2XK5 B;  1P0R A;  3R7Q A;  2LVQ A;  3WAO A;  1LXD A;  2MBE A;  4J6I A;  4A20 A;  4KDL B;  2I1J A;  5DPS A;  4N9F 4;  2AYO B;  2EKE C;  1VCB A;  3NZU A;  3BY4 B;  3TL5 A;  2JRH A;  2GBN A;  3A9K B;  4KDI C;  2G45 B;  3M3J A;  1TZ1 A;  4HDQ A;  2LJ5 A;  3KUZ A;  3QK0 A;  3ZLZ A;  4B9K A;  4BKG A;  4EOY A;  2XBB C;  4KZ0 A;  1RLF A;  1WX9 A;  1QZE A;  1WXA A;  3V6E B;  3RT3 B;  4WJN A;  3WAN A;  2KDB A;  1FXT B;  3ZDM C;  4BFR A;  3PHW B;  3IVF A;  2DZJ A;  4IWQ A;  2IO1 B;  2ZJD A;  3AU4 A;  4ZYN A;  4ASW C;  4TV3 A;  1KJT A;  1YX5 B;  3CSF A;  2GBJ A;  4DWF A;  5JZE B;  2KWV B;  4TUU A;  2Z0E B;  5J17 A;  1V5O A;  1WJU A;  2DYO A;  2WX1 A;  2ZNV C;  1C1Y B;  3JSV A;  4MH0 E;  4F8C B;  1WX7 A;  2N4F A;  3KYD D;  4EZJ A;  4A3P A;  2K1F A;  3ML8 A;  2JXX A;  1E8Y A;  4FJY A;  4KZC A;  1EF1 A;  1TTN A;  4BOS C;  1V80 A;  2V1Y A;  4BKS A;  5D2M B;  1KM7 A;  2N9X A;  2KN5 A;  5G2N A;  3WAP A;  4PS3 A;  4BKS D;  2N7E A;  1UZX B;  2KJ6 A;  4HLE A;  3ZNZ B;  1WZ3 A;  2JWZ A;  3Q3J A;  2ZVO A;  3V6C B;  3PTF C;  4LDT B;  4NQL B;  1RFA A;  1YD8 U;  3ECI A;  2L00 B;  4AWJ A;  2JVC A;  4AOF A;  2V3S A;  1M94 A;  2Z59 B;  4GIV A;  4GB9 A;  3WAL A;  2C7M B;  3LDZ E;  3B08 A;  2MBH A;  3ML9 A;  1I35 A;  2W9N A;  2O6V A;  2EMS A;  4GGQ A;  1A5R A;  1F9J A;  1GJZ A;  2LAS A;  3A1Q B;  2YLM A;  4KVG B;  4HK2 A;  4ANV A;  3RYT A;  3MHS D;  4OVU A;  2KLC A;  3X0W A;  3PS6 A;  1WXV A;  3PT2 B;  4IM3 A;  2O2V B;  4ANX A;  1T0Y A;  2N7D A;  3KVF B;  3VHT C;  5DPW A;  4NAW B;  2NPT B;  3NZS A;  1WMH B;  2DAF A;  2CHZ A;  2J0K A;  2RD0 A;  1E8Z A;  3QC8 B;  4GDK B;  1J8C A;  2JT4 B;  4W9J A;  2MSE D;  1NBF C;  1S3S G;  1WGH A;  5CX3 A;  3RZF A;  2LI5 A;  3HM6 X;  2DX5 B;  2KFJ A;  4WWP A;  3A4S C;  2LGY A;  4K7S A;  1SGH A;  1V49 A;  4FA6 A;  4EZK A;  2WDT B;  2D07 B;  2IY1 B;  4TKN A;  2CR5 A;  3L17 A;  3H1U A;  2BKR B;  2JPH A;  3ZVV A;  2PE9 A;  3QAR A;  2KVR A;  2NBW B;  5AZG A;  1VD2 A;  2LRW A;  4MM3 A;  2DZK A;  2K25 A;  2XEW A;  3I3T B;  4IWO A;  4MJS A;  1WR1 A;  3ONS A;  3VUX A;  4JLC A;  2NVU I;  1WRD B;  3QWZ B;  1C3T A;  4IWP A;  5E6N A;  3VXW A;  4XZ4 A;  1AAR A;  1LQB A;  3UIO B;  1Q0W B;  3UGB B;  1Q1O A;  4M0W B;  1WGR A;  4URK A;  3W1S C;  3CF6 E;  2HE7 A;  2L3Z A;  2LVP A;  3WAM A;  3V60 A;  1RRB A;  4HVB A;  5DPR A;  3O65 B;  1XD3 B;  3DVG X;  5L83 A;  2K6D B;  4KIK B;  4WJP A;  4K1R B;  4LDT D;  2PE6 B;  3OJ4 B;  3U8Z A;  4AP4 C;  4PS7 A;  4X57 B;  4EFO A;  5AEK B;  1L7Y A;  1KLV A;  3A9K A;  2IYD B;  2O6V B;  1PQS A;  2RSU A;  5KHO A;  5L95 C;  1WYW B;  2MW5 A;  2KDF B;  2KOX A;  2PJH A;  3CMM B;  4P7I A;  2JRI B;  4DBG A;  1MG8 A;  5JH5 C;  2ZPN A;  4MGZ E;  3OAW A;  4FHK A;  4TQ0 A;  4HXD A;  1EO6 A;  5GMV A;  3SDL C;  3ALB A;  1GUA B;  1IP9 A;  4HWI B;  2O2V A;  3QHT A;  3SD5 A;  3SHQ A;  2JY6 A;  2LXC A;  2Y5B B;  1GNU A;  4F7Z A;  2NR2 A;  5DCN A;  5J18 A;  2FCS A;  2IO0 B;  3GOE A;  1L2N A;  2ZCB A;  2CKH B;  2KJH B;  2KTR B;  4MGI E;  4MSM B;  3UQB A;  2L05 A;  4I6P A;  2K39 A;  3LJ3 A;  4PYU A;  4WQO B;  4ICU A;  2AL6 A;  3NY5 A;  2JUO A;  2RPQ A;  3APD A;  4G11 A;  4WWO A;  1ZW7 A;  3M95 A;  3ZTC A;  4FAD A;  5LXH A;  2NPT A;  4BOZ B;  2I1K A;  2KHW B;  1E7V A;  3MJW A;  4HPL B;  2L0T A;  3TJP A;  4ANW A;  4EKU A;  2GMI C;  2OOB B;  4FLH A;  2KLG A;  4MEL A;  3VQI A;  3NHE B;  3DPD A;  4NQK E;  2HTH A;  4ZRK A;  2IY0 B;  2AL3 A;  2LGD A;  1UD7 A;  3A9J B;  2KDE B;  2N1W A;  4AJW A;  2G4S A;  4XX5 A;  5CTR C;  4XC2 A;  3JYU A;  3UQA A;  2KKC A;  3HHM A;  1WY8 A;  4GDL A;  2KMC A;  1WJN A;  2LUE A;  4IC7 B;  2FNJ B;  4GXB A;  2ZEQ A;  3VH4 B;  3U30 A;  1J0G A;  2ASQ A;  3L08 A;  1WFY A;  3NOB A;  2LRU A;  4M8M A;  2C5L C;  3MTN B;  2BPS A;  1YQB A;  4KV2 A;  2AEH A;  4GMV A;  3VUW A;  2CHX A;  2LGX A;  2KX3 A;  1WI0 A;  1EF5 A;  2LZ6 A;  4K7W A;  3RD2 A;  5JHB A;  1KOT A;  2DHZ A;  1WM2 A;  3PRP B;  3HK0 A;  2FID A;  4E3C A;  3TBL D;  3ZKJ C;  3VVW B;  1XQQ A;  2MBB B;  3H9D A;  4W9G A;  2ZCC A;  3ZUN A;  1WF9 A;  1I42 A;  2Z0D B;  1E7U A;  4JGH B;  2KTR A;  1IYF A;  3IHP C;  1P9D U;  3H7S A;  4KSL C;  2K8C A;  4ZRJ A;  4W9E A;  3BIN A;  2J7Q B;  2YVC A;  2CS4 A;  3W1Y A;  2C7H A;  2KJR A;  1Z5S B;  1V6E A;  5HKH A;  3QA8 A;  4GDK A;  4WWN A;  2M1M A;  3R3M A;  4FUL A;  2HD5 B;  2MQJ A;  3APF A;  5D6J B;  4JQW C;  1ZKH A;  2G4D B;  3GZN I;  3X23 A;  5TR5 A;  2KDI A;  3KUC B;  3DBH I;  3RUI B;  4GU2 A;  1GG3 A;  2GBK A;  3IG3 A;  3CST A;  2VRR B;  4NPN A;  5FR6 A;  1NI2 A;  1YIW A;  3VTW A;  2M17 A;  2MP2 A;  2ZPY A;  3PZD A;  3PHX B;  3RUL A;  4B95 A;  4DXA B;  2BYE A;  2HJ8 A;  3H7P A;  5CHV C;  3C0R B;  5IAA C;  3VH3 B;  4FHJ A;  3ZTD A;  1LM8 B;  2J0J A;  4W9F A;  3P2B A;  3JW0 X;  4MGY E;  1WMH A;  2G3Q B;  2MLB A;  3DBR I;  5CHF A;  4BBN F;  2JZ3 B;  1NDD A;  4W9D A;  1P1A A;  4MJS B;  3W1S A;  2KFK A;  1WGD A;  3B0A A;  2MBQ A;  1OGW A;  1V5T A;  5AZH A;  4GSW A;  1WXS A;  3ZW3 A;  1E8W A;  3DCG A;  3OJ3 A;  1OEY J;  4NNJ B;  4TQ1 A;  2FCQ A;  1R4N I;  4ZRI A;  2KC2 A;  3PRZ A;  4IM2 A;  5LLI A;  1GC7 A;  2PEA A;  4W9C A;  4RMA A;  2B3A A;  4MEM A;  2KQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...