2FAZA

Ubiquitin-like domain of human nuclear zinc finger protein np95
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
b'SMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like containing PHD and RING finger domains protei
molecule tags Ligase
source organism Homo sapiens
publication title Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95
rcsb
total genus 22
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fazA00
4GB9A 2M8SA 4WQOB 2AEHA 3TIXA 1CMXB 1L7YA 5FR6A 1V49A 1WM3A 3JYUA 3BINA 4LJOB 3W1YA 1P0RA 2WYQA 4AWJA 2KJ6A 5JZEB 2M17A 3NS8A 3DVNU 2C5LC 4LJPB 4WAAA 4WWOA 3DVNV 3EHVA 4BKSD 2BWFA 1PQSA 2K8HA 2MBQA 2I1KA 2M4NA 2PEAA 3M63B 3PPAA 2J0JA 4GGQA 4LDTB 4BBNC 3IFWB 5AZGA 3ZTCA 4EZKA 1LM8B 1WR1A 2KTRA 1SGHA 2IO0B 3OAWA 1MG8A 2ZVOA 3BY4B 2L05A 4FBJB 1C1YB 2NPTA 3UIPB 3B1LX 3QWZB 4MEMA 1EF1A 1UBQA 3AXCA 4JQWC 2C60A 2D10A 2ZJDA 1RAXA 3ZDMC 4X57B 3VQIA 3UQAA 2YLMA 2GBJA 3ML8A 2ZNVB 2V1YA 3UGBB 1V6EA 3HIZA 2KO3A 5E6OA 5CX3A 1SE9A 2A5UA 3MTNB 4JIOU 3QCAA 3DBRI 1WM2A 3DPDA 3H7PA 4GOCA 2K39A 2C7NB 3VH3B 4XX5A 3KH0A 3H6NA 4GN1A 1IP9A 1V80A 2MCNB 5BO4B 4CO7A 5KHQA 3DCGA 5G2NA 1WX9A 4MGZE 2JRIB 4NY0A 5AZFA 3H7SA 4IC7B 1E8YA 3ZNID 3KUZA 3JSVB 1TTNA 5G55A 1L2NA 3DBHI 2JXXA 1YX6B 3K9OB 5E6PA 2FCNA 2ZCCA 4WJOA 2HJ8A 5DPTA 3R7RA 2VRRB 4E3CA 2JY6A 3PHWB 2KTRB 2DAFA 1WJ4A 3QAQA 3U8ZA 4M8MA 2MX2A 4M8NA 3DVGY 1WY8A 2FNJB 3DVGX 3IVFA 3OJ4B 4BVUC 1R4MI 2J0MA 2DX5B 2LJ5A 3RULA 2N9XA 3ZVVA 2DZJA 5D6JB 4OVUA 1SIFA 2K8BA 1T0YA 2O2VB 2XBBC 1WFYA 1P9DU 1UGMA 2FAZA 2MRPA 2EMTA 2JZ3B 2KANA 3QK0A 1Z2MA 2J0KA 2WWZA 3QQ8B 4MSMB 2LGXA 4GMVA 3RD2A 2KX0A 3ZLZA 4ICUA 2KVRA 2DYBA 4CYEA 2KJRA 3VHTC 2WDTB 3VUYA 2IYDB 4EZJA 3H7PB 1WXSA 2QHOA 3R3MA 3VVWB 1E5WA 3ZW3A 3KUCB 3QJZA 2LGYA 1BT0A 3N3KB 4MSQB 4A20A 2OOBB 3ECIA 3QA8A 4GIVA 4GXBA 2KC1A 4PYZA 1WXMA 2L3ZA 4PYUA 3AI5A 1Q0WB 3L08A 3VDZA 4XC2A 3DBLI 2DYOA 5DPSA 4GDKA 3VTWA 3AU5A 2FCQA 5CHFA 3ZNHB 2LD9A 2KDBA 4J6IA 4BFRA 1GNUA 4GDLB 3A4SC 4RMAA 2PJHA 3PHXB 2M0XA 2ASQA 1WGHA 3L10B 3MHSD 4MDKE 2KLCA 2KQ7A 4FADA 2KXJA 5J18A 4MJSA 2IBIB 3ZNGC 5JHBA 4NQKE 2KWUB 2KWVB 2CHZA 2IO2B 2KC2A 4FHJA 2AYOB 3QX1A 3RZWC 2O2VA 2K8CA 2KMCA 3PRMB 4NQLB 1E7VA 4OVVA 2IY1B 3HK0A 1V5OA 1G6JA 1LQBA 4TUUA 1LFDA 3L13A 3LJ3A 2JUOA 5D2MB 5AZHA 4ANUA 4KVGB 3SU8X 1E8ZA 3X0WA 1WR6E 1YIWA 4JLCA 1XD3B 3SDLC 2N4FA 3HM3A 1WX7A 3B08A 4DHJB 1HE8A 1M94A 2MQJA 3A9KB 2LXCA 5L95C 2BYVE 3PLUA 3UF8A 3VUWA 4ANVA 4PS8A 3T9LA 4WJPA 2O6VD 4DWFA 1KLVA 1ZGUB 2MBBB 2EMSA 4DDGD 2NBUA 5D7GA 4ZRKA 2GBNA 3DOWA 2DAJA 2C7MB 1Q5WB 2LVPA 4NNJB 1E8WA 4MM3A 3HM6X 3I3TB 4KSKC 3JSVA 1V9JA 2D11A 1U4AA 4K81A 1WGDA 1XT9B 2GMIC 2HTHA 3KUDB 4HLEA 4WJQA 3LDZE 2BYEA 1F9JA 4IWPA 2V4LA 4MGIE 4BKGA 4EZLA 2BF8B 2CKHB 3CF6E 4II3B 2D3GA 3ALBA 2IO3B 2A4ZA 4IM3A 3UIOB 1ISNA 2N7EA 3QIJA 4K7UA 4G0NB 3APFA 4KDLB 3DDCB 4K1RB 1I42A 2LXAA 2KDEB 4AJWA 3Q3JA 2FIDA 2HD5B 5DPWA 3M62B 1YX5B 1WRDB 3TMPB 2CHWA 1UH6A 2LGDA 3M95A 4G50A 5DCNA 1YJ1A 4FN2A 4NAWB 2KFJA 1IYFA 1H8CA 3TJPA 1OEYJ 2JF5A 1WGYA 3AU4A 5C23A 3PT2B 1WF9A 3D32A 1V5TA 3N32A 1OEYA 2LVQA 4K7WA 4LCDE 4KZCA 1NDDA 4FULA 2FCMA 5CTRC 4KIKA 3ZO5B 3GZNI 2CR5A 4I6LB 5HKHA 1RFAA 1Y8RC 3B0AA 3PZDA 1NBFC 4W9GA 4ZYNA 1WJNA 2JWZA 5E6NA 3UQBA 2IZVB 2K25A 2G4SA 2Z59B 2KJHB 1WX8A 3ZTDA 1XQQA 2N1WA 4DXAB 4F7ZA 2AWTA 4IUMB 4GDKB 1RRBA 4HXDA 4MJSB 3APCA 3A9JB 4DBGA 3UINB 3WAMA 4F8CB 2LRUA 3WAPA 2DYMA 3RUIB 4MGKE 3ENEA 4ASWC 4W9LA 4NJ6A 2L76A 2LZ6A 1V86A 2NR2A 1I35A 2IY0B 3A1QA 2DENB 2MWSB 2N7DA 4KDIC 3U7DA 2KX3A 4GU2A 1GJZA 3PRZA 5DPRA 3HHMA 5EDSA 4AP4C 3L0WB 5TR5A 4TQ1A 3PSEB 3V6CB 3ZIMA 3A33B 1E7UA 2WX0A 3RYTA 4BOZB 1WH3A 4ANXA 1WJ6A 3C0RB 2BWES 2K6QA 2N1VA 3PVLA 4IG7B 5LXHA 3ONSA 1RLFA 4FJYA 1J8CA 1P98A 4HCPB 4EKUA 4RM8A 3RZFA 4W9IA 2I1JA 1E90A 1WXVA 2CU1A 3OLMD 1KOTA 4IW0A 4FJVB 2C9WB 2W9NA 1VCBA 5IAAC 4A3PA 2UYZB 3PRPB 1WGGA 2L7RA 2RSUA 4WJNA 2OJRA 4HWIB 1S3SG 1WYWB 2HE7A 2L8JA 2MP2A 1NI2A 3M3JA 4W9EA 3SD5A 5C1ZA 2LVOA 4EFOA 3L17A 4CHKA 3IHPC 2GBMA 3ML9A 4IWOA 4RM9A 1E8XA 3JVZX 1R4NI 1WXAA 1TZ1A 2L0TA 3APDA 2AL6A 4P7IA 4HPMB 3ZKJC 4EUTA 3A9JA 2KKCA 2UWQA 2ZCBA 4GSWA 3PS6A 2BKRB 2RR9A 1WIAA 2JRHA 3PTFC 1YD8U 4PS7A 5J17A 4HCNB 4YL8A 5LLIA 2N9EB 2LRWA 3IBEA 1K8RB 3V61A 1UZXB 4ZDVA 4NPNA 1IPGA 3KW5B 1QZEA 2XK5B 4WWPA 5L83A 3VTVA 2ZNVC 4HK2A 4DHZB 2XK5A 4M0WB 1WZ0A 2FIFA 4PS3A 1H4RA 2PE9A 2BYFA 4II2B 2KFKA 4MH0E 4KV2A 2KLGA 3VAWA 4N9F4 3CSFA 1EF5A 3JW0X 3IG3A 3EECA 4W9HA 1A5RA 2L0FA 3NZSA 4I6PA 3TBLD 2LI5A 3NOBA 1FXTB 2NCNA 4BBNF 4DHJD 1WMHA 2LASA 4LDTD 3O65B 2CS4A 1D3ZA 4KSLC 4W9DA 3EFUA 2DZIA 2KN5A 3KYCD 4FLHA 3NY5A 1GG3A 2MP2B 3P2BA 4JGHB 4W9FA 3V6EB 4ZRJA 3TCAA 3VXWA 2BPSA 4HJKA 5D94A 2N9PC 4K7SA 4BOSC 4E71A 4F1SA 4MELA 5JH5C 4TQ0A 5KHOA 2O6VA 5GMVA 3QARA 3QHTA 3WANA 1GC7A 2J7QB 3DQVA 4NJ7A 3N30A 2R2QA 3CMMB 1TGZB 2MBHA 5J2RA 1WGRA 4ZRIA 1TBEA 4DHZE 3H9DA 3KYDD 2LWPA 4E74A 3PLVA 4IM2A 2PE6B 2KMAA 4B6WA 3V62A 3S2AA 3U30A 1WE6A 1WJUA 4ANWA 1Q1OA 2G4DB 4W9JA 3X23A 1EUVB 2DZKA 2Z0DB 2MA9B 4EEWA 4I6NB 3A1QB 4AUQC 2JT4B 4B95A 2MSED 1JRUA 2AL3A 3SHQA 3L54A 3ZDTA 1EO6A 2MW5A 3L16A 4HVBA 2IO1B 4JL9A 3ZUNA 3R7QA 2GBRA 1P1AA 2RGFA 1V81A 2ZZPB 2NPTB 2NS5A 1OQYA 4IM0A 3T8MA 3PGEA 2EKEC 4WWNA 3QC8B 2K6DB 4KIKB 2KFKB 3VFKA 2G45B 4HDOA 1V2YA 2Y5BB 3VTUA 3ZNZB 4AOFA 3VH4B 4BKSA 2FCSA 2KNBA 2KQSA 2ZVNA 3MJWA 1WMHB 2DZMA 3OJ3A 3PV1A 3NZUA 4NAWA 4MGYE 3R66C 1YQBA 2KTFA 2O6VB 2WX1A 5AEKB 1S1QB 1UD7A 2FUHB 1AARA 4HPLB 3GOEA 3RT3B 2BGFA 3W1SA 4W9CA 4BKTA 1C3TA 3CSTA 3A9KA 5JHAA 3TL5A 3WAOA 2M1MA 2NVUI 3PREA 5CHVC 2B3AA 1OTRB 1X1MA 2JZZA 2KWCA 2KK8A 5LXIB 4B9KA 1WE7A 2C7HA 2MBOA 4A3OA 2NBVB 4TV3A 4URKA 4HDQA 3KVFB 1VD2A 2KD0A 3EC8A 2R2OA 2ZEQA 2D2QA 3K9PB 3VUXA 2REXA 3ZRCA 1UELA 1J0GA 2MLBA 2K1FA 2JPHA 2ZPNA 3AULA 4G3XB 1ZW7A 2GBKA 2RPQA 3A4RA 3WALA 4AJYB 2BKFA 1J19A 1WZ3A 2D07B 4G11A 2KOXA 1LXDA 3RCZA 5IA7A 5CHWA 4FHKA 4TKNA 1UBIA 2KHWB 2LUEA 4KZ0A 3V60A 1WI0A 3H1UA 4FJZA 4XZ4A 1KM7A 3NHEB 2DHZA 2YVCA 2MBEA 3W1SC 1KJTA 1P3QU 4FA6A 4W9KA 4ICVA 2PPHA 2CHXA 3WA0A 3ZRFA 4GDLA 2GOWA 2KZRA 2G3QB 2L00B 3DBSA 4IWQA 2Z0EB 2NBWB 4DDID 4EOYA 1OGWA 2JVCA 3Q3FA 2ZPYA 2KDIA 2XEWA 4DK5A 3WIMA 1GUAB 2V3SA 2KDFB 2RD0A 1GC6A 1ZKHA 1Z5SB
chains in the Genus database with same CATH superfamily
1R4NB 1R4MB 1CMXB 1JROA 2K0PA 3JYUA 4YWGG 1GB1A 5T8IA 2PW9A 5JZEB 2M17A 4LJPB 3BYYB 3EHVA 3LXFA 1PQSA 2MBQA 4LDTB 4GGQA 5AZGA 1LM8B 1WR1A 2KTRA 1IGCA 1SGHA 2JWUA 3BY4B 3FKYA 3QWZB 4MEMA 4UDUC 2C60A 1N61A 1RAXA 3ZDMC 3ZJTA 2PMVA 1ZXHA 2GBJA 3ML8A 3BVZA 5CX3A 2QCZA 3QCAA 3R8BA 3ZJVA 3DPDA 2V3NA 1WRIA 4K3BA 3AEDB 2WU5B 2LHDA 3VH3B 1IP9A 2N9LA 3DCGA 3BK2A 5G2NA 4AQ7A 4ZHPA 4MGZE 4IC7B 4WIPA 3KUZA 4KX6B 2JXXA 3K9OB 1JWSD 1SIJA 2FCNA 2HJ8A 2VRRB 2PKOA 1LO5D 4M8NA 3DVGY 4BVUC 1T6BX 3RULA 1SIFA 2K8BA 1L0VB 2OHFA 1P9DU 3QK0A 1JW9D 4LTUA 2KVRA 2DYBA 1L6UA 3P4SB 2QEJC 4C4VB 1NENB 4US9A 4EZJA 2QHOA 2INCC 2LGYA 3N3KB 3ECIA 3QA8A 3RNAC 4GXBA 2KC1A 1F1HA 2DYOA 5CHFA 3AB5A 3ZNHB 4J6IA 2WXGA 3FAHA 5AUKA 2KWDA 3PHXB 3L10B 2KLCA 3ZGZA 2KXJA 2AX5A 2IGDA 3ZNGC 2KWUB 2KWVB 2KC2A 4FHJA 1MJDA 2KMCA 4M01A 1LFDA 3L13A 3P4PB 3R2IA 2INDC 4US8A 2DLBA 4KVGB 1SEBD 1MFWA 2V0GA 4JLCA 4YSYB 2N4FA 3NVZA 3A9KB 4RGMA 2GB1A 1XLQA 1AWDA 4PS8A 1RWSA 1T3QA 4WJPA 2KYWA 2K3UA 2MBBB 2JYTA 5C3JB 4DDGD 2NBUA 3DOWA 2DAJA 3Q2AC 2IJ0A 1STEA 2LVPA 4RF0A 3RNFC 2JU6X 3HM6X 3I3TB 3JSVA 1U4AA 2HTHA 3KUDB 4HLEA 2V4LA 4EZLA 2BF8B 4II3B 1UWXA 3ALBA 4MM3B 4IM3A 4KKJA 1ISNA 4KDLB 3DDCB 1TS4A 1JMLA 3EA6A 2FIDA 1SE3A 1YX5B 2Z8LA 2CHWA 1UH6A 3P42A 2LGDA 3M95A 3DBRB 4G50A 5EE1A 4USAA 1H8CA 1B9RA 1OEYJ 2JF5A 1WGYA 3AU4A 2W54A 5C23A 3D32A 3SFEB 1NDDA 4FULA 1TT5B 5CTRC 3PZDA 4C4VA 4ZYNA 2K25A 2G4SA 3ZTDA 5D3DA 1WX8A 1ZE3D 1XQQA 4DXAB 3AEAB 4F7ZA 4IUMB 4GDKB 2KDMA 3A9JB 3UINB 3WAMA 4DXGA 2LRUA 2J52A 2DYMA 2RDGA 3N1ZC 4W9LA 2WXIA 2VZKB 3CWIA 4RNAA 1V86A 1I35A 3A1QA 2DENB 4KDIC 3ZQ4A 4AP4C 3AM9A 1WJ6A 2SEBD 2BWES 2N1VA 1HZ5A 4XDDA 4FJYA 3MC0B 1L0YB 2I1JA 3BVGA 1KOTA 4IW0A 2W9NA 1K53A 3R2TA 2L7RA 2RSUA 3W5UB 1WYGA 1S3SG 4W9EA 3SD5A 4EFOA 5BYSA 1JWUD 4A55A 2GBMA 1TJEA 3ML9A 3JVZX 1R4NI 3KQ4A 4P7IA 4HPMB 2KKCA 3IAS1 2WNMA 1N62A 2W3SA 3PTFC 5J17A 4YL8A 1K8RB 1UZXB 4NPNA 2WGSA 1QZEA 3VTVA 4NJCA 4MH8A 1YJIA 2WXJA 4N9F4 1YNTE 2V4IB 1K50A 3EECA 3NZSA 2INNE 3IT4B 3TSSA 2MJ3A 4DHJD 1HTQA 1WXQA 1NVID 2KN5A 4BZAA 2FE8A 2WXOA 2MJDA 3TCAA 3VXWA 5D94A 2N9PC 4K7SA 5JH5C 1OQQA 4MACA 2MEKA 3RNGC 5KHOA 2WXNA 2WDVB 1MHHE 3AE7B 4A8XC 2MBHA 3B9JA 4RGNA 5J2RA 4P6VF 4DHZE 3H9DA 4IM2A 4Q2JA 4B6WA 3S2AA 3BYTB 3U30A 1WE6A 4HKQA 2DZKA 3W5VB 4AUQC 2JT4B 2MSED 1JRUA 1L4DB 4MT5A 3ZDTA 1EO6A 2KACA 4M02A 1KLGD 4WQMA 1F0ZA 4LLGM 2ZZPB 2NS5A 4IM0A 4WWNA 2WXMA 3RNEC 3DHHC 2G1EA 4C7YA 3VTUA 3ZNZB 3VH4B 1ROEA 2FCSA 2KQSA 1L6VA 3MJWA 3NZUA 1IGDA 1XEEA 4MGYE 4J3OD 1VDVA 2O6VB 2FUHB 2BGFA 4W9CA 4BKTA 4DQOC 3Q8CA 1J7AA 3TEWA 4OVZA 2M1MA 3PREA 2B3AA 1ET9A 3Q8EA 1OTRB 1X1MA 2MHJA 3BK1A 4ACFA 1JALA 3NVWA 2C7HA 3RNCC 4CQNA 2WS3B 4URKA 4HDQA 1Q10A 2KD0A 3EC8A 2HTME 2D2QA 2REXA 2JQRB 2MLBA 4TMAB 1VZ7A 4HROA 1L4ZB 1ZW7A 2GBKA 2OJWA 2RPQA 5IA7A 3MJ5A 4KGRA 5CHWA 4OZAA 2LUEA 3GS2A 2L32A 4FJZA 5G5GA 4XZ4A 3SFDB 3W1SC 1KJTA 4FA6A 2X8XX 3ZRFA 1FRDA 2XNAC 2KZRA 3DBSA 2NBWB 4C80A 4ZRPA 3B2GA 1ZKHA 2M8SA 4S17A 1WM3A 4LJOB 3BINA 1NI3A 1SJED 2KJ6A 3DVNU 2C5LC 2WDRB 2BWFA 2K8HA 2I1KA 2PEAA 3AE4B 1K51A 3CIRB 1VRAB 1ZDXA 3DHIC 3IFWB 2BB6A 2ZVOA 3RI7C 2NPTA 3UIPB 1XLNA 4X57B 3UQAA 2PIAA 2V1YA 1EWCA 3UGBB 1V6EA 3U52E 2NTSA 3SEBA 2WU2B 4GOCA 4XX5A 2UU7A 2MCNB 1KRHA 2BYTA 1L2NA 1TTNA 2M0AA 3DBHI 2LHEA 3UI3A 3FC4A 4E3CA 2ONQA 3PHWB 1ESFA 1V1PB 3QAQA 1TS5A 3DVGX 4YT0B 3ZXVA 1WFYA 2BS2B 1N5WA 3NZ3A 1HTOA 1JWBD 1FEHA 2JZ3B 2KANA 4GMVA 2KX0A 4RGOS 3ZLZA 2IYDB 3H7PB 3R3MA 1E5WA 1BT0A 4A20A 1I4GA 2VH1A 2L3ZA 4PYUA 3EFCA 3VDZA 3DBLI 4GDKA 4D2KA 4RMAA 1N6ZA 2ASQA 4YTPB 4MJSA 1SE4A 4OW0A 2IO2B 4JE3B 3DBLB 2AYOB 3QX1A 3RZWC 2K8CA 5HG2A 1E7VA 2IY1B 3HK0A 1V5OA 1LQBA 3LJ3A 1SXTA 5D2MB 4RCOA 1XCQL 4N59A 1WR6E 1YIWA 3HM3A 5BYRA 1WX7A 4WURA 2MH7A 2MQJA 1XXGA 1FO4A 3VUWA 2Q5WD 4ZRKA 3C19A 4ITKA 1GPXA 4IOIE 4K81A 1WGDA 1PDXA 4JX1C 4WJQA 1HQRD 1F9JA 2LJIA 1T0QC 1N63A 4REZA 1VLBA 3UIOB 3DBHB 4K7UA 3APFA 1HZ6A 1E0ZA 3ZXRA 1V1OA 2HD5B 1UGJA 5I4DA 5DPWA 3M62B 2INPE 1C4CA 1WRDB 1ZPSA 2KFJA 5EE0A 3U4EG 1A70A 4LNOA 2FCMA 4KIKA 3Q8FA 4L23A 1Y8RC 1SE2A 3B0AA 1R7SA 3HVZA 1TY0A 4MJSB 4DBGA 2AQ1B 3WAPA 3W9CB 3RUIB 5FR3A 1KFYB 2WLBA 3DWGC 2IY0B 2MWSB 2N7DA 2KX3A 3PRZA 5DPRA 3HHMA 5TR5A 4TQ1A 3ZIMA 4BOZB 3URYA 4IG7B 3PO0A 2G9HD 3PVLA 4AS1A 1P98A 4EKUA 3MFGA 1T0RC 2Y5PA 2VH2A 4FJVB 2C9WB 2N0SB 5IAAC 3ZJUA 1SJHD 2OJRA 1WYWB 1FNWA 2L8JA 1WGKA 3OG5A 2BT6A 3IHPC 1WXAA 1TZ1A 4YSZB 3FILA 4JWSC 4ZOHC 1Y56A 3MHZA 2ZCBA 2BKRB 3NVVA 2IGHA 1WIAA 2JRHA 4PS7A 5BYQA 5G5HA 2N9EB 5LLIA 5MPOA 5TSSA 1IPGA 3KW5B 1ACCA 2RDBC 2ZNVC 4HK2A 2JZPA 2JSVX 3HRDD 1H4RA 2KFKA 4MH0E 3Q3OC 4KV2A 2KLGA 3VAWA 1DGJA 1I4RA 5IO9A 2KT7A 1I4QA 1HA5A 1A5RA 2L0FA 3TBLD 2QDFA 1YMHE 2AQ2B 3V05A 4W9DA 3EFUA 3KYCD 1C9FA 4JGHB 3P2BA 3V6EB 4ZRJA 2BPSA 4HJKA 2E3TA 4TQ0A 3WANA 1GC7A 4LNNA 4KGTA 1PGXA 5D3IB 4E74A 1OFFA 2LWPA 3PLVA 2PE6B 2WXFA 1T5XD 1LGRA 4KGSA 4LNFA 2MA9B 1D5MC 1YN4A 2MW5A 3T8MA 1IUEA 1KH0A 4KIKB 2G45B 4HDOA 4XYCA 1N60A 3AE3B 3AECB 4BKSA 4ZYSA 2ZVNA 1WMHB 2PVOD 5EE3A 3R66C 1XLPA 1C3TA 4A6QA 5CHVC 4C00A 1CJEA 2KAJA 4ZHOA 4A3OA 3RMKC 2NBVB 4TV3A 1F77A 3K9PB 1VD2A 2VZKD 2R2OA 2ZEQA 3ZRCA 1DOXA 2W3RA 2B76B 2X38A 4B0MA 1QOBA 3HVDA 1XO3A 4B0EA 4JPSA 2ZPNA 1NYRA 2D5GA 4G3XB 1ZUD2 3A4RA 4AJYB 1JQ4A 1FXAA 2D07B 4FHKA 4OZBA 1UF0A 2L83A 5H8YE 5FKAC 3I9V1 3KLSX 2RPVA 4YTMB 3V60A 1WI0A 5HI1A 1KM7A 2MBEA 5IP4D 4ICVA 3AE8B 1E9MA 1B1ZA 4GDLA 1TS3A 2G3QB 2ICIA 2L00B 2Z0EB 1OGWA 3Q3FA 2XEWA 1GUAB 2KDFB 2RD0A 1YOVB 2W55A 1Z5SB 4GB9A 3TIXA 3NS1A 1L7YA 2EKIA 1V49A 4RH6A 1P0RA 1FNUA 2WXPA 2JXTA 3DVNV 4BBNC 2J0JA 3ZTCA 1FPYA 4HJGE 2WXQA 2L05A 4FBJB 3B1LX 4IKGA 1M4VA 1EF1A 1UBQA 3AXCA 1KF6B 2D10A 2ZJDA 1F2RI 4RFBA 3VQIA 2M56B 3I5JC 3HIZA 1AN8A 2KO3A 2A5UA 1FIQA 1YN5A 2J4XA 4NAMA 3DBRI 1WM2A 3KH0A 3H6NA 4GN1A 4KKIA 4CO7A 5BO4B 1NYQA 5AZFA 3H7SA 1QF6A 1E8YA 3ZNID 3JSVB 5G55A 3Q8BA 2ZCCA 4WJOA 3ZYYX 2KTRB 4WWMA 4P1CC 2FUG1 2HDEA 4M8MA 4H2AA 3AN1A 1WY8A 3AE6B 2J0MA 2DX5B 3GP7A 2DZJA 2NTTA 4OVUA 1DOYA 3ABVB 2FAZA 2MRPA 2M19A 3QQ8B 4MSMB 4ICUA 2LFIA 4N6EB 2KJRA 3VHTC 2WDTB 3VUYA 3AMZA 1D4BA 4ARIA 3ZW3A 1BUIC 3QJZA 3KWLA 2OOBB 3VR8B 4GIVA 3N20C 1WXMA 5C2TB 1D5ZC 2ON8A 1E10A 1PGBA 4XC2A 3AU5A 1PGAA 2FCQA 4YXDB 1GNUA 4GDLB 1EU4A 2PJHA 2M0XA 1BXTA 4FADA 4MDKE 2KQ7A 5JHBA 4NQKE 1ET6A 3AE1B 1V97A 2BQQA 2Y5CA 4NZLB 2O2VA 1CQVA 4NQLB 4OVVA 1HXYD 1G6JA 4TUUA 2JUOA 4OHJA 3Q3MC 1E8ZA 2RMMA 3X0WA 1XD3B 4HKZE 1M94A 1FRRA 3IXSA 5L95C 2XN9C 2BYVE 3PLUA 2ACZB 3UF8A 3T9LA 1BMLC 1E6EB 2K5PA 5D7GA 1Q5WB 5LNK1 1E8WA 4MM3A 3IT6B 2D11A 1XT9B 2WXLA 2GMIC 3TEZA 3RPFC 4N58A 2CKHB 2IO3B 2A4ZA 2CJOA 3QIJA 4K1RB 2KDEB 3EGRA 3Q3JA 1EM7A 1PYWD 1P7FA 1DOIA 1L0XB 1C79A 1YJJA 4K3CA 4NAWB 4P16A 2WXRA 1ZP0B 2WDQB 3TJPA 4L2YA 3PT2B 3P1MA 1MG4A 1OEYA 2LVQA 4K7WA 4LCDE 4A9AA 3ZO5B 4I6LB 2CR5A 1CK1A 5HKHA 1RFAA 1QT9A 4W9GA 1WJNA 2QSDA 2WQYB 3KWVA 1JWAD 3GB1A 1RRBA 4HXDA 1I7HA 2LGIA 4ASWC 1ENFA 4NJ6A 1RFKA 1QOFA 1FFUA 2LZ6A 4XWWA 2J53A 3U7DA 1C76A 1GJZA 2GLSA 5EDSA 3L0WB 3PSEB 1FFVA 3A33B 1CZPA 1WH3A 2K6QA 5LXHA 3ONSA 1F2RC 1RLFA 3AEBB 1J8CA 1EU3A 2TSSA 1WXVA 1V8CA 3OLMD 1C78A 2QILA 4LNIA 1VCBA 2CU3A 4WJNA 1TY2A 2K22A 4HWIB 1FNVA 4CHKA 1ZXIA 1D5XC 1E8XA 1QOGA 2AL6A 3ZKJC 5GXGB 5EE9A 3NJTA 3RNBC 4HCNB 2LRWA 3IBEA 2H88B 1XCTL 3V61A 1D6EC 4HRSA 5L83A 2YEPB 1IBXA 3N9YC 4M0WB 1WZ0A 4PS3A 2V9HA 4II2B 3AE2B 1EF5A 3JW0X 5HFYA 3EUB2 1FXTB 2NCNA 4BBNF 1TKYA 2LASA 2WXKA 2FBWB 1D3ZA 3Q3NC 2BBCA 4W9FA 4FLHA 3NY5A 1GG3A 4F1SA 4BOSC 4E71A 2O6VA 3MP9A 3QARA 3QHTA 3DQVA 4NJ7A 2R2QA 3CMMB 1TGZB 1WGRA 4ZRIA 3KYDD 2QJLA 3E56A 2KMAA 3V62A 1WJUA 2WXHA 4W9JA 5HHDG 2Z0DB 1I4PA 3SHQA 3L54A 1RYJA 1DYQA 3J9CA 3PZ7A 2K9XA 5BMGA 4JL9A 3ZUNA 3R7QA 2RGFA 2NPTB 1OQYA 4S0RA 1TYGB 1PFDA 1SSNA 2KFKB 1V2YA 2Y5BB 4GLSC 1UWMA 4AOFA 3OJ3A 2ZW1A 4NAWA 3SR6A 1YQBA 2KTFA 3AEFB 1UD7A 1AARA 3RT3B 5JHAA 5JXVA 2KWCA 2KK8A 2LMCA 4B9KA 2ZW0A 2D3CA 1WE7A 2MBOA 4WAFA 1AW7A 3KVFB 3VUXA 4C7ZA 1J0GA 3E9SA 3C8YA 1K52A 3AULA 1L5PA 2QIEB 3WALA 2LEKA 1J19A 3RCZA 2KOXA 3BZDB 4TKNA 2KHWB 1TKEA 3H1UA 2YVCA 1FMAD 4LK0M 2CHXA 2GOWA 4IWQA 2MJEA 4EOYA 4DDID 3AV8A 2IGGA 5IKCM 1QQRA 2V3SA 4C56C 4A3PA 4WQOB 2AEHA 2PVGC 5FR6A 3W1YA 1FM0D 2WYQA 4AWJA 4R3DA 3NS8A 4WAAA 4WWOA 4BKSD 2DBYA 2M4NA 3PPAA 3M63B 3I57A 4PT5A 4EZKA 1OQRA 3AE5B 3TUOA 2IO0B 3OAWA 1MG8A 1C1YB 4O1NA 5FK9C 4JQWC 3O13A 3AEEB 3GZNB 2L52A 2YLMA 2ZNVB 1VZ6A 2DNFA 4L1BA 5E6OA 2LGSA 1SE9A 4DXFA 3MTNB 4JIOU 4RF1A 2QMTA 3H7PA 1WWTA 2I2YA 2GI9A 2BW2A 2C7NB 2K39A 3OWEB 4XWTA 3T3OA 1V80A 5KHQA 1WX9A 2JRIB 4NY0A 2OEDA 1YX6B 5E6PA 1F52A 4TSSA 5DPTA 3R7RA 1AYFA 2JY6A 1T0SC 2DAFA 1WJ4A 3U8ZA 4OZCA 2MX2A 2FNJB 3IVFA 3OJ4B 1R4MI 2JX5A 2LJ5A 2N9XA 3P4QB 3ZVVA 1SF0A 5D6JB 1MVKA 2E6XA 1T0YA 2O2VB 2D3AA 2XBBC 1UGMA 3HUIA 2EMTA 1Z2MA 1SB3C 2BB5A 2J0KA 2WWZA 2LGXA 1QOAA 4XGAB 3RD2A 4CYEA 1WXSA 3VVWB 3KUCB 3NUHB 4MSQB 2D3BA 4PYZA 3AI5A 1Q0WB 3L08A 2I38A 5DPSA 4BFRA 2LD9A 2KDBA 2LUMA 2KQ4X 3A4SC 1IBXB 1GAQB 1WGHA 3MHSD 5J18A 4HPPA 4PK1A 2IBIB 2CHZA 2BS3B 2J42A 2YEPF 3PRMB 2H89B 5AZHA 4FXCA 4ANUA 2JYEA 3SU8X 2CJNA 3BVMA 1VJKA 2WHIA 3SDLC 3B08A 4DHJB 1HE8A 1GOZA 1UUPA 2LXCA 2L1AA 4ANVA 1MI0A 3PZ8A 5E6JA 2O6VD 4DWFA 1KLVA 1ZGUB 2EMSA 1KLUD 2GBNA 1PUTA 3Q69A 3VR9B 2C7MB 4NNJB 1TS2A 4KSKC 1V9JA 4M00A 3LDZE 2BYEA 4IWPA 1VZ8A 4MGIE 4BKGA 4QAYA 1QILA 3CF6E 2D3GA 2R61A 2BTEA 2N7EA 2PTLA 4G0NB 2V3PA 1YQ4B 1I42A 2LXAA 4AJWA 1FCLA 1QKZA 2HJ1A 4RGTA 1NEKB 2QC8A 3TMPB 1HEZE 3MC9A 5DCNA 1YJ1A 4FN2A 4BAXA 3IAM1 1IYFA 1WF9A 3N32A 1V5TA 4KZCA 2WP9B 3GZNI 4HEA1 1NBFC 1TIFA 2JWZA 5E6NA 3UQBA 2NMQA 1UNSA 2IZVB 5H92C 2Z59B 2KJHB 2N1WA 2DWQA 1I4HA 2AWTA 3APCA 4F8CB 5BMHA 3NVYA 4MGKE 3ENEA 4A90A 3VRBB 2L76A 3GE8C 2NR2A 3T3NA 1V1PA 4GU2A 3DHGC 3LYYA 3L4PA 3RFZB 1FXIA 3V6CB 1JWMD 3RYTA 1E7UA 2KN4A 2WX0A 4ANXA 2IDYA 3C0RB 3MC8A 4HCPB 4RM8A 3U2SC 3B2FA 3RZFA 4W9IA 2KMMA 1E90A 2CU1A 1JCKB 2EELA 3I63C 3AH7A 1ZOYB 3V3XA 4JWUC 2UYZB 3PRPB 1WGGA 3P4RB 1FCCC 2HE7A 2MP2A 5C1ZA 3M3JA 2N9KA 1NI2A 2LVOA 3L17A 5AUIA 4XE0A 4IWOA 4RM9A 2L0TA 3APDA 4EUTA 3A9JA 3LB8C 4YSXB 2UWQA 4GSWA 3PS6A 3GE3C 1YQ3B 3AEGB 2RR9A 1EWYC 4M0WA 1KTKA 1YD8U 4ZDVA 3WCQA 2XK5B 4WWPA 4DHZB 2XK5A 1I4XA 3DWMA 2FIFA 2PE9A 2BYFA 5IN7A 4ZRQA 3TEYA 3CSFA 4P1BC 3IG3A 3U7ZA 4W9HA 5BMIA 4I6PA 2LI5A 3NOBA 5IOIA 3BWUD 1C77A 2AQ3B 1WMHA 4LDTD 3O65B 2CS4A 1MPEA 4LNKA 4KSLC 2DZIA 3VTWA 2MP2B 1ZDVA 4MELA 3P63A 2Y3AA 4EE2A 5GMVA 1XF5L 2J7QB 3N30A 1MHXA 1TBEA 2KVZA 4ANWA 1Q1OA 2G4DB 4WH4A 3X23A 1EUVB 4EEWA 4I6NB 3A1QB 3VRAB 1QLBB 4B95A 2BS4B 2AL3A 1YN3A 3L16A 2BVCA 4HVBA 2IO1B 4YTNB 2GBRA 1P1AA 1V81A 1XLOA 3PGEA 2EKEC 2IPKD 3QC8B 2K6DB 3VFKA 3TEXA 1J7CA 2KNBA 3PV1A 2DZMA 1N5XA 1TKGA 2WX1A 5AEKB 1S1QB 4HPLB 3BIID 3GOEA 3W1SA 1JRPA 3FILB 1J7BA 3NRZA 3CSTA 1FD6A 3A9KA 3TL5A 1WSPA 3WAOA 2NVUI 2JZZA 1VR9A 2RDHA 5LXIB 1C4PA 2PLPA 2GRIA 1UELA 3Q14C 4IDIA 2K1FA 2JPHA 3Q6BA 2SAKA 3Q8AA 3NG0A 2BKFA 1WZ3A 3AE9B 4G11A 1LXDA 1P7EA 1SBBB 1RM6C 3RN9C 1UBIA 1E7PB 4KZ0A 3H8HA 3NHEB 4ARCA 2DHZA 3ETRA 3N1YC 1P3QU 2W82A 4W9KA 2PPHA 1TZOA 2N7JA 3WA0A 1GB4A 2JVCA 2ZPYA 2KDIA 1C4AA 4DK5A 3WIMA 3W2DA 1GC6A 3N1XC 4XDCA
chains in the Genus database with same CATH topology
4GB9A 2M8SA 4WQOB 2AEHA 3TIXA 1CMXB 1L7YA 5FR6A 1V49A 1WM3A 3JYUA 3BINA 4LJOB 3W1YA 1P0RA 2WYQA 4AWJA 2KJ6A 5JZEB 2M17A 3NS8A 3DVNU 2C5LC 4LJPB 4WAAA 4WWOA 3DVNV 3EHVA 4BKSD 2BWFA 1PQSA 2K8HA 2MBQA 2I1KA 2M4NA 2PEAA 3M63B 3PPAA 2J0JA 4GGQA 4LDTB 4BBNC 3IFWB 5AZGA 3ZTCA 4EZKA 1LM8B 1WR1A 2KTRA 1SGHA 2IO0B 3OAWA 1MG8A 2ZVOA 3BY4B 2L05A 4FBJB 1C1YB 2NPTA 3UIPB 3B1LX 3QWZB 4MEMA 1EF1A 1UBQA 3AXCA 4JQWC 2C60A 2D10A 2ZJDA 1RAXA 3ZDMC 4X57B 3VQIA 3UQAA 2YLMA 2GBJA 3ML8A 2ZNVB 2V1YA 3UGBB 1V6EA 3HIZA 2KO3A 5E6OA 5CX3A 1SE9A 2A5UA 3MTNB 4JIOU 3QCAA 3DBRI 1WM2A 3DPDA 3H7PA 4GOCA 2K39A 2C7NB 3VH3B 4XX5A 3KH0A 3H6NA 4GN1A 1IP9A 1V80A 2MCNB 5BO4B 4CO7A 5KHQA 3DCGA 5G2NA 1WX9A 4MGZE 2JRIB 4NY0A 5AZFA 3H7SA 4IC7B 1E8YA 3ZNID 3KUZA 3JSVB 1TTNA 5G55A 1L2NA 3DBHI 2JXXA 1YX6B 3K9OB 5E6PA 2FCNA 2ZCCA 4WJOA 2HJ8A 5DPTA 3R7RA 2VRRB 4E3CA 2JY6A 3PHWB 2KTRB 2DAFA 1WJ4A 3QAQA 3U8ZA 4M8MA 2MX2A 4M8NA 3DVGY 1WY8A 2FNJB 3DVGX 3IVFA 3OJ4B 4BVUC 1R4MI 2J0MA 2DX5B 2LJ5A 3RULA 2N9XA 3ZVVA 2DZJA 5D6JB 4OVUA 1SIFA 2K8BA 1T0YA 2O2VB 2XBBC 1WFYA 1P9DU 1UGMA 2FAZA 2MRPA 2EMTA 2JZ3B 2KANA 3QK0A 1Z2MA 2J0KA 2WWZA 3QQ8B 4MSMB 2LGXA 4GMVA 3RD2A 2KX0A 3ZLZA 4ICUA 2KVRA 2DYBA 4CYEA 2KJRA 3VHTC 2WDTB 3VUYA 2IYDB 4EZJA 3H7PB 1WXSA 2QHOA 3R3MA 3VVWB 1E5WA 3ZW3A 3KUCB 3QJZA 2LGYA 1BT0A 3N3KB 4MSQB 4A20A 2OOBB 3ECIA 3QA8A 4GIVA 4GXBA 2KC1A 4PYZA 1WXMA 2L3ZA 4PYUA 3AI5A 1Q0WB 3L08A 3VDZA 4XC2A 3DBLI 2DYOA 5DPSA 4GDKA 3VTWA 3AU5A 2FCQA 5CHFA 3ZNHB 2LD9A 2KDBA 4J6IA 4BFRA 1GNUA 4GDLB 3A4SC 4RMAA 2PJHA 3PHXB 2M0XA 2ASQA 1WGHA 3L10B 3MHSD 4MDKE 2KLCA 2KQ7A 4FADA 2KXJA 5J18A 4MJSA 2IBIB 3ZNGC 5JHBA 4NQKE 2KWUB 2KWVB 2CHZA 2IO2B 2KC2A 4FHJA 2AYOB 3QX1A 3RZWC 2O2VA 2K8CA 2KMCA 3PRMB 4NQLB 1E7VA 4OVVA 2IY1B 3HK0A 1V5OA 1G6JA 1LQBA 4TUUA 1LFDA 3L13A 3LJ3A 2JUOA 5D2MB 5AZHA 4ANUA 4KVGB 3SU8X 1E8ZA 3X0WA 1WR6E 1YIWA 4JLCA 1XD3B 3SDLC 2N4FA 3HM3A 1WX7A 3B08A 4DHJB 1HE8A 1M94A 2MQJA 3A9KB 2LXCA 5L95C 2BYVE 3PLUA 3UF8A 3VUWA 4ANVA 4PS8A 3T9LA 4WJPA 2O6VD 4DWFA 1KLVA 1ZGUB 2MBBB 2EMSA 4DDGD 2NBUA 5D7GA 4ZRKA 2GBNA 3DOWA 2DAJA 2C7MB 1Q5WB 2LVPA 4NNJB 1E8WA 4MM3A 3HM6X 3I3TB 4KSKC 3JSVA 1V9JA 2D11A 1U4AA 4K81A 1WGDA 1XT9B 2GMIC 2HTHA 3KUDB 4HLEA 4WJQA 3LDZE 2BYEA 1F9JA 4IWPA 2V4LA 4MGIE 4BKGA 4EZLA 2BF8B 2CKHB 3CF6E 4II3B 2D3GA 3ALBA 2IO3B 2A4ZA 4IM3A 3UIOB 1ISNA 2N7EA 3QIJA 4K7UA 4G0NB 3APFA 4KDLB 3DDCB 4K1RB 1I42A 2LXAA 2KDEB 4AJWA 3Q3JA 2FIDA 2HD5B 5DPWA 3M62B 1YX5B 1WRDB 3TMPB 2CHWA 1UH6A 2LGDA 3M95A 4G50A 5DCNA 1YJ1A 4FN2A 4NAWB 2KFJA 1IYFA 1H8CA 3TJPA 1OEYJ 2JF5A 1WGYA 3AU4A 5C23A 3PT2B 1WF9A 3D32A 1V5TA 3N32A 1OEYA 2LVQA 4K7WA 4LCDE 4KZCA 1NDDA 4FULA 2FCMA 5CTRC 4KIKA 3ZO5B 3GZNI 2CR5A 4I6LB 5HKHA 1RFAA 1Y8RC 3B0AA 3PZDA 1NBFC 4W9GA 4ZYNA 1WJNA 2JWZA 5E6NA 3UQBA 2IZVB 2K25A 2G4SA 2Z59B 2KJHB 1WX8A 3ZTDA 1XQQA 2N1WA 4DXAB 4F7ZA 2AWTA 4IUMB 4GDKB 1RRBA 4HXDA 4MJSB 3APCA 3A9JB 4DBGA 3UINB 3WAMA 4F8CB 2LRUA 3WAPA 2DYMA 3RUIB 4MGKE 3ENEA 4ASWC 4W9LA 4NJ6A 2L76A 2LZ6A 1V86A 2NR2A 1I35A 2IY0B 3A1QA 2DENB 2MWSB 2N7DA 4KDIC 3U7DA 2KX3A 4GU2A 1GJZA 3PRZA 5DPRA 3HHMA 5EDSA 4AP4C 3L0WB 5TR5A 4TQ1A 3PSEB 3V6CB 3ZIMA 3A33B 1E7UA 2WX0A 3RYTA 4BOZB 1WH3A 4ANXA 1WJ6A 3C0RB 2BWES 2K6QA 2N1VA 3PVLA 4IG7B 5LXHA 3ONSA 1RLFA 4FJYA 1J8CA 1P98A 4HCPB 4EKUA 4RM8A 3RZFA 4W9IA 2I1JA 1E90A 1WXVA 2CU1A 3OLMD 1KOTA 4IW0A 4FJVB 2C9WB 2W9NA 1VCBA 5IAAC 4A3PA 2UYZB 3PRPB 1WGGA 2L7RA 2RSUA 4WJNA 2OJRA 4HWIB 1S3SG 1WYWB 2HE7A 2L8JA 2MP2A 1NI2A 3M3JA 4W9EA 3SD5A 5C1ZA 2LVOA 4EFOA 3L17A 4CHKA 3IHPC 2GBMA 3ML9A 4IWOA 4RM9A 1E8XA 3JVZX 1R4NI 1WXAA 1TZ1A 2L0TA 3APDA 2AL6A 4P7IA 4HPMB 3ZKJC 4EUTA 3A9JA 2KKCA 2UWQA 2ZCBA 4GSWA 3PS6A 2BKRB 2RR9A 1WIAA 2JRHA 3PTFC 1YD8U 4PS7A 5J17A 4HCNB 4YL8A 5LLIA 2N9EB 2LRWA 3IBEA 1K8RB 3V61A 1UZXB 4ZDVA 4NPNA 1IPGA 3KW5B 1QZEA 2XK5B 4WWPA 5L83A 3VTVA 2ZNVC 4HK2A 4DHZB 2XK5A 4M0WB 1WZ0A 2FIFA 4PS3A 1H4RA 2PE9A 2BYFA 4II2B 2KFKA 4MH0E 4KV2A 2KLGA 3VAWA 4N9F4 3CSFA 1EF5A 3JW0X 3IG3A 3EECA 4W9HA 1A5RA 2L0FA 3NZSA 4I6PA 3TBLD 2LI5A 3NOBA 1FXTB 2NCNA 4BBNF 4DHJD 1WMHA 2LASA 4LDTD 3O65B 2CS4A 1D3ZA 4KSLC 4W9DA 3EFUA 2DZIA 2KN5A 3KYCD 4FLHA 3NY5A 1GG3A 2MP2B 3P2BA 4JGHB 4W9FA 3V6EB 4ZRJA 3TCAA 3VXWA 2BPSA 4HJKA 5D94A 2N9PC 4K7SA 4BOSC 4E71A 4F1SA 4MELA 5JH5C 4TQ0A 5KHOA 2O6VA 5GMVA 3QARA 3QHTA 3WANA 1GC7A 2J7QB 3DQVA 4NJ7A 3N30A 2R2QA 3CMMB 1TGZB 2MBHA 5J2RA 1WGRA 4ZRIA 1TBEA 4DHZE 3H9DA 3KYDD 2LWPA 4E74A 3PLVA 4IM2A 2PE6B 2KMAA 4B6WA 3V62A 3S2AA 3U30A 1WE6A 1WJUA 4ANWA 1Q1OA 2G4DB 4W9JA 3X23A 1EUVB 2DZKA 2Z0DB 2MA9B 4EEWA 4I6NB 3A1QB 4AUQC 2JT4B 4B95A 2MSED 1JRUA 2AL3A 3SHQA 3L54A 3ZDTA 1EO6A 2MW5A 3L16A 4HVBA 2IO1B 4JL9A 3ZUNA 3R7QA 2GBRA 1P1AA 2RGFA 1V81A 2ZZPB 2NPTB 2NS5A 1OQYA 4IM0A 3T8MA 3PGEA 2EKEC 4WWNA 3QC8B 2K6DB 4KIKB 2KFKB 3VFKA 2G45B 4HDOA 1V2YA 2Y5BB 3VTUA 3ZNZB 4AOFA 3VH4B 4BKSA 2FCSA 2KNBA 2KQSA 2ZVNA 3MJWA 1WMHB 2DZMA 3OJ3A 3PV1A 3NZUA 4NAWA 4MGYE 3R66C 1YQBA 2KTFA 2O6VB 2WX1A 5AEKB 1S1QB 1UD7A 2FUHB 1AARA 4HPLB 3GOEA 3RT3B 2BGFA 3W1SA 4W9CA 4BKTA 1C3TA 3CSTA 3A9KA 5JHAA 3TL5A 3WAOA 2M1MA 2NVUI 3PREA 5CHVC 2B3AA 1OTRB 1X1MA 2JZZA 2KWCA 2KK8A 5LXIB 4B9KA 1WE7A 2C7HA 2MBOA 4A3OA 2NBVB 4TV3A 4URKA 4HDQA 3KVFB 1VD2A 2KD0A 3EC8A 2R2OA 2ZEQA 2D2QA 3K9PB 3VUXA 2REXA 3ZRCA 1UELA 1J0GA 2MLBA 2K1FA 2JPHA 2ZPNA 3AULA 4G3XB 1ZW7A 2GBKA 2RPQA 3A4RA 3WALA 4AJYB 2BKFA 1J19A 1WZ3A 2D07B 4G11A 2KOXA 1LXDA 3RCZA 5IA7A 5CHWA 4FHKA 4TKNA 1UBIA 2KHWB 2LUEA 4KZ0A 3V60A 1WI0A 3H1UA 4FJZA 4XZ4A 1KM7A 3NHEB 2DHZA 2YVCA 2MBEA 3W1SC 1KJTA 1P3QU 4FA6A 4W9KA 4ICVA 2PPHA 2CHXA 3WA0A 3ZRFA 4GDLA 2GOWA 2KZRA 2G3QB 2L00B 3DBSA 4IWQA 2Z0EB 2NBWB 4DDID 4EOYA 1OGWA 2JVCA 3Q3FA 2ZPYA 2KDIA 2XEWA 4DK5A 3WIMA 1GUAB 2V3SA 2KDFB 2RD0A 1GC6A 1ZKHA 1Z5SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GB9 A;  2M8S A;  4WQO B;  2AEH A;  3TIX A;  1CMX B;  1L7Y A;  5FR6 A;  1V49 A;  1WM3 A;  3JYU A;  3BIN A;  4LJO B;  3W1Y A;  1P0R A;  2WYQ A;  4AWJ A;  2KJ6 A;  5JZE B;  2M17 A;  3NS8 A;  3DVN U;  2C5L C;  4LJP B;  4WAA A;  4WWO A;  3DVN V;  3EHV A;  4BKS D;  2BWF A;  1PQS A;  2K8H A;  2MBQ A;  2I1K A;  2M4N A;  2PEA A;  3M63 B;  3PPA A;  2J0J A;  4GGQ A;  4LDT B;  4BBN C;  3IFW B;  5AZG A;  3ZTC A;  4EZK A;  1LM8 B;  1WR1 A;  2KTR A;  1SGH A;  2IO0 B;  3OAW A;  1MG8 A;  2ZVO A;  3BY4 B;  2L05 A;  4FBJ B;  1C1Y B;  2NPT A;  3UIP B;  3B1L X;  3QWZ B;  4MEM A;  1EF1 A;  1UBQ A;  3AXC A;  4JQW C;  2C60 A;  2D10 A;  2ZJD A;  1RAX A;  3ZDM C;  4X57 B;  3VQI A;  3UQA A;  2YLM A;  2GBJ A;  3ML8 A;  2ZNV B;  2V1Y A;  3UGB B;  1V6E A;  3HIZ A;  2KO3 A;  5E6O A;  5CX3 A;  1SE9 A;  2A5U A;  3MTN B;  4JIO U;  3QCA A;  3DBR I;  1WM2 A;  3DPD A;  3H7P A;  4GOC A;  2K39 A;  2C7N B;  3VH3 B;  4XX5 A;  3KH0 A;  3H6N A;  4GN1 A;  1IP9 A;  1V80 A;  2MCN B;  5BO4 B;  4CO7 A;  5KHQ A;  3DCG A;  5G2N A;  1WX9 A;  4MGZ E;  2JRI B;  4NY0 A;  5AZF A;  3H7S A;  4IC7 B;  1E8Y A;  3ZNI D;  3KUZ A;  3JSV B;  1TTN A;  5G55 A;  1L2N A;  3DBH I;  2JXX A;  1YX6 B;  3K9O B;  5E6P A;  2FCN A;  2ZCC A;  4WJO A;  2HJ8 A;  5DPT A;  3R7R A;  2VRR B;  4E3C A;  2JY6 A;  3PHW B;  2KTR B;  2DAF A;  1WJ4 A;  3QAQ A;  3U8Z A;  4M8M A;  2MX2 A;  4M8N A;  3DVG Y;  1WY8 A;  2FNJ B;  3DVG X;  3IVF A;  3OJ4 B;  4BVU C;  1R4M I;  2J0M A;  2DX5 B;  2LJ5 A;  3RUL A;  2N9X A;  3ZVV A;  2DZJ A;  5D6J B;  4OVU A;  1SIF A;  2K8B A;  1T0Y A;  2O2V B;  2XBB C;  1WFY A;  1P9D U;  1UGM A;  2FAZ A;  2MRP A;  2EMT A;  2JZ3 B;  2KAN A;  3QK0 A;  1Z2M A;  2J0K A;  2WWZ A;  3QQ8 B;  4MSM B;  2LGX A;  4GMV A;  3RD2 A;  2KX0 A;  3ZLZ A;  4ICU A;  2KVR A;  2DYB A;  4CYE A;  2KJR A;  3VHT C;  2WDT B;  3VUY A;  2IYD B;  4EZJ A;  3H7P B;  1WXS A;  2QHO A;  3R3M A;  3VVW B;  1E5W A;  3ZW3 A;  3KUC B;  3QJZ A;  2LGY A;  1BT0 A;  3N3K B;  4MSQ B;  4A20 A;  2OOB B;  3ECI A;  3QA8 A;  4GIV A;  4GXB A;  2KC1 A;  4PYZ A;  1WXM A;  2L3Z A;  4PYU A;  3AI5 A;  1Q0W B;  3L08 A;  3VDZ A;  4XC2 A;  3DBL I;  2DYO A;  5DPS A;  4GDK A;  3VTW A;  3AU5 A;  2FCQ A;  5CHF A;  3ZNH B;  2LD9 A;  2KDB A;  4J6I A;  4BFR A;  1GNU A;  4GDL B;  3A4S C;  4RMA A;  2PJH A;  3PHX B;  2M0X A;  2ASQ A;  1WGH A;  3L10 B;  3MHS D;  4MDK E;  2KLC A;  2KQ7 A;  4FAD A;  2KXJ A;  5J18 A;  4MJS A;  2IBI B;  3ZNG C;  5JHB A;  4NQK E;  2KWU B;  2KWV B;  2CHZ A;  2IO2 B;  2KC2 A;  4FHJ A;  2AYO B;  3QX1 A;  3RZW C;  2O2V A;  2K8C A;  2KMC A;  3PRM B;  4NQL B;  1E7V A;  4OVV A;  2IY1 B;  3HK0 A;  1V5O A;  1G6J A;  1LQB A;  4TUU A;  1LFD A;  3L13 A;  3LJ3 A;  2JUO A;  5D2M B;  5AZH A;  4ANU A;  4KVG B;  3SU8 X;  1E8Z A;  3X0W A;  1WR6 E;  1YIW A;  4JLC A;  1XD3 B;  3SDL C;  2N4F A;  3HM3 A;  1WX7 A;  3B08 A;  4DHJ B;  1HE8 A;  1M94 A;  2MQJ A;  3A9K B;  2LXC A;  5L95 C;  2BYV E;  3PLU A;  3UF8 A;  3VUW A;  4ANV A;  4PS8 A;  3T9L A;  4WJP A;  2O6V D;  4DWF A;  1KLV A;  1ZGU B;  2MBB B;  2EMS A;  4DDG D;  2NBU A;  5D7G A;  4ZRK A;  2GBN A;  3DOW A;  2DAJ A;  2C7M B;  1Q5W B;  2LVP A;  4NNJ B;  1E8W A;  4MM3 A;  3HM6 X;  3I3T B;  4KSK C;  3JSV A;  1V9J A;  2D11 A;  1U4A A;  4K81 A;  1WGD A;  1XT9 B;  2GMI C;  2HTH A;  3KUD B;  4HLE A;  4WJQ A;  3LDZ E;  2BYE A;  1F9J A;  4IWP A;  2V4L A;  4MGI E;  4BKG A;  4EZL A;  2BF8 B;  2CKH B;  3CF6 E;  4II3 B;  2D3G A;  3ALB A;  2IO3 B;  2A4Z A;  4IM3 A;  3UIO B;  1ISN A;  2N7E A;  3QIJ A;  4K7U A;  4G0N B;  3APF A;  4KDL B;  3DDC B;  4K1R B;  1I42 A;  2LXA A;  2KDE B;  4AJW A;  3Q3J A;  2FID A;  2HD5 B;  5DPW A;  3M62 B;  1YX5 B;  1WRD B;  3TMP B;  2CHW A;  1UH6 A;  2LGD A;  3M95 A;  4G50 A;  5DCN A;  1YJ1 A;  4FN2 A;  4NAW B;  2KFJ A;  1IYF A;  1H8C A;  3TJP A;  1OEY J;  2JF5 A;  1WGY A;  3AU4 A;  5C23 A;  3PT2 B;  1WF9 A;  3D32 A;  1V5T A;  3N32 A;  1OEY A;  2LVQ A;  4K7W A;  4LCD E;  4KZC A;  1NDD A;  4FUL A;  2FCM A;  5CTR C;  4KIK A;  3ZO5 B;  3GZN I;  2CR5 A;  4I6L B;  5HKH A;  1RFA A;  1Y8R C;  3B0A A;  3PZD A;  1NBF C;  4W9G A;  4ZYN A;  1WJN A;  2JWZ A;  5E6N A;  3UQB A;  2IZV B;  2K25 A;  2G4S A;  2Z59 B;  2KJH B;  1WX8 A;  3ZTD A;  1XQQ A;  2N1W A;  4DXA B;  4F7Z A;  2AWT A;  4IUM B;  4GDK B;  1RRB A;  4HXD A;  4MJS B;  3APC A;  3A9J B;  4DBG A;  3UIN B;  3WAM A;  4F8C B;  2LRU A;  3WAP A;  2DYM A;  3RUI B;  4MGK E;  3ENE A;  4ASW C;  4W9L A;  4NJ6 A;  2L76 A;  2LZ6 A;  1V86 A;  2NR2 A;  1I35 A;  2IY0 B;  3A1Q A;  2DEN B;  2MWS B;  2N7D A;  4KDI C;  3U7D A;  2KX3 A;  4GU2 A;  1GJZ A;  3PRZ A;  5DPR A;  3HHM A;  5EDS A;  4AP4 C;  3L0W B;  5TR5 A;  4TQ1 A;  3PSE B;  3V6C B;  3ZIM A;  3A33 B;  1E7U A;  2WX0 A;  3RYT A;  4BOZ B;  1WH3 A;  4ANX A;  1WJ6 A;  3C0R B;  2BWE S;  2K6Q A;  2N1V A;  3PVL A;  4IG7 B;  5LXH A;  3ONS A;  1RLF A;  4FJY A;  1J8C A;  1P98 A;  4HCP B;  4EKU A;  4RM8 A;  3RZF A;  4W9I A;  2I1J A;  1E90 A;  1WXV A;  2CU1 A;  3OLM D;  1KOT A;  4IW0 A;  4FJV B;  2C9W B;  2W9N A;  1VCB A;  5IAA C;  4A3P A;  2UYZ B;  3PRP B;  1WGG A;  2L7R A;  2RSU A;  4WJN A;  2OJR A;  4HWI B;  1S3S G;  1WYW B;  2HE7 A;  2L8J A;  2MP2 A;  1NI2 A;  3M3J A;  4W9E A;  3SD5 A;  5C1Z A;  2LVO A;  4EFO A;  3L17 A;  4CHK A;  3IHP C;  2GBM A;  3ML9 A;  4IWO A;  4RM9 A;  1E8X A;  3JVZ X;  1R4N I;  1WXA A;  1TZ1 A;  2L0T A;  3APD A;  2AL6 A;  4P7I A;  4HPM B;  3ZKJ C;  4EUT A;  3A9J A;  2KKC A;  2UWQ A;  2ZCB A;  4GSW A;  3PS6 A;  2BKR B;  2RR9 A;  1WIA A;  2JRH A;  3PTF C;  1YD8 U;  4PS7 A;  5J17 A;  4HCN B;  4YL8 A;  5LLI A;  2N9E B;  2LRW A;  3IBE A;  1K8R B;  3V61 A;  1UZX B;  4ZDV A;  4NPN A;  1IPG A;  3KW5 B;  1QZE A;  2XK5 B;  4WWP A;  5L83 A;  3VTV A;  2ZNV C;  4HK2 A;  4DHZ B;  2XK5 A;  4M0W B;  1WZ0 A;  2FIF A;  4PS3 A;  1H4R A;  2PE9 A;  2BYF A;  4II2 B;  2KFK A;  4MH0 E;  4KV2 A;  2KLG A;  3VAW A;  4N9F 4;  3CSF A;  1EF5 A;  3JW0 X;  3IG3 A;  3EEC A;  4W9H A;  1A5R A;  2L0F A;  3NZS A;  4I6P A;  3TBL D;  2LI5 A;  3NOB A;  1FXT B;  2NCN A;  4BBN F;  4DHJ D;  1WMH A;  2LAS A;  4LDT D;  3O65 B;  2CS4 A;  1D3Z A;  4KSL C;  4W9D A;  3EFU A;  2DZI A;  2KN5 A;  3KYC D;  4FLH A;  3NY5 A;  1GG3 A;  2MP2 B;  3P2B A;  4JGH B;  4W9F A;  3V6E B;  4ZRJ A;  3TCA A;  3VXW A;  2BPS A;  4HJK A;  5D94 A;  2N9P C;  4K7S A;  4BOS C;  4E71 A;  4F1S A;  4MEL A;  5JH5 C;  4TQ0 A;  5KHO A;  2O6V A;  5GMV A;  3QAR A;  3QHT A;  3WAN A;  1GC7 A;  2J7Q B;  3DQV A;  4NJ7 A;  3N30 A;  2R2Q A;  3CMM B;  1TGZ B;  2MBH A;  5J2R A;  1WGR A;  4ZRI A;  1TBE A;  4DHZ E;  3H9D A;  3KYD D;  2LWP A;  4E74 A;  3PLV A;  4IM2 A;  2PE6 B;  2KMA A;  4B6W A;  3V62 A;  3S2A A;  3U30 A;  1WE6 A;  1WJU A;  4ANW A;  1Q1O A;  2G4D B;  4W9J A;  3X23 A;  1EUV B;  2DZK A;  2Z0D B;  2MA9 B;  4EEW A;  4I6N B;  3A1Q B;  4AUQ C;  2JT4 B;  4B95 A;  2MSE D;  1JRU A;  2AL3 A;  3SHQ A;  3L54 A;  3ZDT A;  1EO6 A;  2MW5 A;  3L16 A;  4HVB A;  2IO1 B;  4JL9 A;  3ZUN A;  3R7Q A;  2GBR A;  1P1A A;  2RGF A;  1V81 A;  2ZZP B;  2NPT B;  2NS5 A;  1OQY A;  4IM0 A;  3T8M A;  3PGE A;  2EKE C;  4WWN A;  3QC8 B;  2K6D B;  4KIK B;  2KFK B;  3VFK A;  2G45 B;  4HDO A;  1V2Y A;  2Y5B B;  3VTU A;  3ZNZ B;  4AOF A;  3VH4 B;  4BKS A;  2FCS A;  2KNB A;  2KQS A;  2ZVN A;  3MJW A;  1WMH B;  2DZM A;  3OJ3 A;  3PV1 A;  3NZU A;  4NAW A;  4MGY E;  3R66 C;  1YQB A;  2KTF A;  2O6V B;  2WX1 A;  5AEK B;  1S1Q B;  1UD7 A;  2FUH B;  1AAR A;  4HPL B;  3GOE A;  3RT3 B;  2BGF A;  3W1S A;  4W9C A;  4BKT A;  1C3T A;  3CST A;  3A9K A;  5JHA A;  3TL5 A;  3WAO A;  2M1M A;  2NVU I;  3PRE A;  5CHV C;  2B3A A;  1OTR B;  1X1M A;  2JZZ A;  2KWC A;  2KK8 A;  5LXI B;  4B9K A;  1WE7 A;  2C7H A;  2MBO A;  4A3O A;  2NBV B;  4TV3 A;  4URK A;  4HDQ A;  3KVF B;  1VD2 A;  2KD0 A;  3EC8 A;  2R2O A;  2ZEQ A;  2D2Q A;  3K9P B;  3VUX A;  2REX A;  3ZRC A;  1UEL A;  1J0G A;  2MLB A;  2K1F A;  2JPH A;  2ZPN A;  3AUL A;  4G3X B;  1ZW7 A;  2GBK A;  2RPQ A;  3A4R A;  3WAL A;  4AJY B;  2BKF A;  1J19 A;  1WZ3 A;  2D07 B;  4G11 A;  2KOX A;  1LXD A;  3RCZ A;  5IA7 A;  5CHW A;  4FHK A;  4TKN A;  1UBI A;  2KHW B;  2LUE A;  4KZ0 A;  3V60 A;  1WI0 A;  3H1U A;  4FJZ A;  4XZ4 A;  1KM7 A;  3NHE B;  2DHZ A;  2YVC A;  2MBE A;  3W1S C;  1KJT A;  1P3Q U;  4FA6 A;  4W9K A;  4ICV A;  2PPH A;  2CHX A;  3WA0 A;  3ZRF A;  4GDL A;  2GOW A;  2KZR A;  2G3Q B;  2L00 B;  3DBS A;  4IWQ A;  2Z0E B;  2NBW B;  4DDI D;  4EOY A;  1OGW A;  2JVC A;  3Q3F A;  2ZPY A;  2KDI A;  2XEW A;  4DK5 A;  3WIM A;  1GUA B;  2V3S A;  2KDF B;  2RD0 A;  1GC6 A;  1ZKH A;  1Z5S B; 
#chains in the Genus database with same CATH topology
 1R4N B;  1R4M B;  1CMX B;  1JRO A;  2K0P A;  3JYU A;  4YWG G;  1GB1 A;  5T8I A;  2PW9 A;  5JZE B;  2M17 A;  4LJP B;  3BYY B;  3EHV A;  3LXF A;  1PQS A;  2MBQ A;  4LDT B;  4GGQ A;  5AZG A;  1LM8 B;  1WR1 A;  2KTR A;  1IGC A;  1SGH A;  2JWU A;  3BY4 B;  3FKY A;  3QWZ B;  4MEM A;  4UDU C;  2C60 A;  1N61 A;  1RAX A;  3ZDM C;  3ZJT A;  2PMV A;  1ZXH A;  2GBJ A;  3ML8 A;  3BVZ A;  5CX3 A;  2QCZ A;  3QCA A;  3R8B A;  3ZJV A;  3DPD A;  2V3N A;  1WRI A;  4K3B A;  3AED B;  2WU5 B;  2LHD A;  3VH3 B;  1IP9 A;  2N9L A;  3DCG A;  3BK2 A;  5G2N A;  4AQ7 A;  4ZHP A;  4MGZ E;  4IC7 B;  4WIP A;  3KUZ A;  4KX6 B;  2JXX A;  3K9O B;  1JWS D;  1SIJ A;  2FCN A;  2HJ8 A;  2VRR B;  2PKO A;  1LO5 D;  4M8N A;  3DVG Y;  4BVU C;  1T6B X;  3RUL A;  1SIF A;  2K8B A;  1L0V B;  2OHF A;  1P9D U;  3QK0 A;  1JW9 D;  4LTU A;  2KVR A;  2DYB A;  1L6U A;  3P4S B;  2QEJ C;  4C4V B;  1NEN B;  4US9 A;  4EZJ A;  2QHO A;  2INC C;  2LGY A;  3N3K B;  3ECI A;  3QA8 A;  3RNA C;  4GXB A;  2KC1 A;  1F1H A;  2DYO A;  5CHF A;  3AB5 A;  3ZNH B;  4J6I A;  2WXG A;  3FAH A;  5AUK A;  2KWD A;  3PHX B;  3L10 B;  2KLC A;  3ZGZ A;  2KXJ A;  2AX5 A;  2IGD A;  3ZNG C;  2KWU B;  2KWV B;  2KC2 A;  4FHJ A;  1MJD A;  2KMC A;  4M01 A;  1LFD A;  3L13 A;  3P4P B;  3R2I A;  2IND C;  4US8 A;  2DLB A;  4KVG B;  1SEB D;  1MFW A;  2V0G A;  4JLC A;  4YSY B;  2N4F A;  3NVZ A;  3A9K B;  4RGM A;  2GB1 A;  1XLQ A;  1AWD A;  4PS8 A;  1RWS A;  1T3Q A;  4WJP A;  2KYW A;  2K3U A;  2MBB B;  2JYT A;  5C3J B;  4DDG D;  2NBU A;  3DOW A;  2DAJ A;  3Q2A C;  2IJ0 A;  1STE A;  2LVP A;  4RF0 A;  3RNF C;  2JU6 X;  3HM6 X;  3I3T B;  3JSV A;  1U4A A;  2HTH A;  3KUD B;  4HLE A;  2V4L A;  4EZL A;  2BF8 B;  4II3 B;  1UWX A;  3ALB A;  4MM3 B;  4IM3 A;  4KKJ A;  1ISN A;  4KDL B;  3DDC B;  1TS4 A;  1JML A;  3EA6 A;  2FID A;  1SE3 A;  1YX5 B;  2Z8L A;  2CHW A;  1UH6 A;  3P42 A;  2LGD A;  3M95 A;  3DBR B;  4G50 A;  5EE1 A;  4USA A;  1H8C A;  1B9R A;  1OEY J;  2JF5 A;  1WGY A;  3AU4 A;  2W54 A;  5C23 A;  3D32 A;  3SFE B;  1NDD A;  4FUL A;  1TT5 B;  5CTR C;  3PZD A;  4C4V A;  4ZYN A;  2K25 A;  2G4S A;  3ZTD A;  5D3D A;  1WX8 A;  1ZE3 D;  1XQQ A;  4DXA B;  3AEA B;  4F7Z A;  4IUM B;  4GDK B;  2KDM A;  3A9J B;  3UIN B;  3WAM A;  4DXG A;  2LRU A;  2J52 A;  2DYM A;  2RDG A;  3N1Z C;  4W9L A;  2WXI A;  2VZK B;  3CWI A;  4RNA A;  1V86 A;  1I35 A;  3A1Q A;  2DEN B;  4KDI C;  3ZQ4 A;  4AP4 C;  3AM9 A;  1WJ6 A;  2SEB D;  2BWE S;  2N1V A;  1HZ5 A;  4XDD A;  4FJY A;  3MC0 B;  1L0Y B;  2I1J A;  3BVG A;  1KOT A;  4IW0 A;  2W9N A;  1K53 A;  3R2T A;  2L7R A;  2RSU A;  3W5U B;  1WYG A;  1S3S G;  4W9E A;  3SD5 A;  4EFO A;  5BYS A;  1JWU D;  4A55 A;  2GBM A;  1TJE A;  3ML9 A;  3JVZ X;  1R4N I;  3KQ4 A;  4P7I A;  4HPM B;  2KKC A;  3IAS 1;  2WNM A;  1N62 A;  2W3S A;  3PTF C;  5J17 A;  4YL8 A;  1K8R B;  1UZX B;  4NPN A;  2WGS A;  1QZE A;  3VTV A;  4NJC A;  4MH8 A;  1YJI A;  2WXJ A;  4N9F 4;  1YNT E;  2V4I B;  1K50 A;  3EEC A;  3NZS A;  2INN E;  3IT4 B;  3TSS A;  2MJ3 A;  4DHJ D;  1HTQ A;  1WXQ A;  1NVI D;  2KN5 A;  4BZA A;  2FE8 A;  2WXO A;  2MJD A;  3TCA A;  3VXW A;  5D94 A;  2N9P C;  4K7S A;  5JH5 C;  1OQQ A;  4MAC A;  2MEK A;  3RNG C;  5KHO A;  2WXN A;  2WDV B;  1MHH E;  3AE7 B;  4A8X C;  2MBH A;  3B9J A;  4RGN A;  5J2R A;  4P6V F;  4DHZ E;  3H9D A;  4IM2 A;  4Q2J A;  4B6W A;  3S2A A;  3BYT B;  3U30 A;  1WE6 A;  4HKQ A;  2DZK A;  3W5V B;  4AUQ C;  2JT4 B;  2MSE D;  1JRU A;  1L4D B;  4MT5 A;  3ZDT A;  1EO6 A;  2KAC A;  4M02 A;  1KLG D;  4WQM A;  1F0Z A;  4LLG M;  2ZZP B;  2NS5 A;  4IM0 A;  4WWN A;  2WXM A;  3RNE C;  3DHH C;  2G1E A;  4C7Y A;  3VTU A;  3ZNZ B;  3VH4 B;  1ROE A;  2FCS A;  2KQS A;  1L6V A;  3MJW A;  3NZU A;  1IGD A;  1XEE A;  4MGY E;  4J3O D;  1VDV A;  2O6V B;  2FUH B;  2BGF A;  4W9C A;  4BKT A;  4DQO C;  3Q8C A;  1J7A A;  3TEW A;  4OVZ A;  2M1M A;  3PRE A;  2B3A A;  1ET9 A;  3Q8E A;  1OTR B;  1X1M A;  2MHJ A;  3BK1 A;  4ACF A;  1JAL A;  3NVW A;  2C7H A;  3RNC C;  4CQN A;  2WS3 B;  4URK A;  4HDQ A;  1Q10 A;  2KD0 A;  3EC8 A;  2HTM E;  2D2Q A;  2REX A;  2JQR B;  2MLB A;  4TMA B;  1VZ7 A;  4HRO A;  1L4Z B;  1ZW7 A;  2GBK A;  2OJW A;  2RPQ A;  5IA7 A;  3MJ5 A;  4KGR A;  5CHW A;  4OZA A;  2LUE A;  3GS2 A;  2L32 A;  4FJZ A;  5G5G A;  4XZ4 A;  3SFD B;  3W1S C;  1KJT A;  4FA6 A;  2X8X X;  3ZRF A;  1FRD A;  2XNA C;  2KZR A;  3DBS A;  2NBW B;  4C80 A;  4ZRP A;  3B2G A;  1ZKH A;  2M8S A;  4S17 A;  1WM3 A;  4LJO B;  3BIN A;  1NI3 A;  1SJE D;  2KJ6 A;  3DVN U;  2C5L C;  2WDR B;  2BWF A;  2K8H A;  2I1K A;  2PEA A;  3AE4 B;  1K51 A;  3CIR B;  1VRA B;  1ZDX A;  3DHI C;  3IFW B;  2BB6 A;  2ZVO A;  3RI7 C;  2NPT A;  3UIP B;  1XLN A;  4X57 B;  3UQA A;  2PIA A;  2V1Y A;  1EWC A;  3UGB B;  1V6E A;  3U52 E;  2NTS A;  3SEB A;  2WU2 B;  4GOC A;  4XX5 A;  2UU7 A;  2MCN B;  1KRH A;  2BYT A;  1L2N A;  1TTN A;  2M0A A;  3DBH I;  2LHE A;  3UI3 A;  3FC4 A;  4E3C A;  2ONQ A;  3PHW B;  1ESF A;  1V1P B;  3QAQ A;  1TS5 A;  3DVG X;  4YT0 B;  3ZXV A;  1WFY A;  2BS2 B;  1N5W A;  3NZ3 A;  1HTO A;  1JWB D;  1FEH A;  2JZ3 B;  2KAN A;  4GMV A;  2KX0 A;  4RGO S;  3ZLZ A;  2IYD B;  3H7P B;  3R3M A;  1E5W A;  1BT0 A;  4A20 A;  1I4G A;  2VH1 A;  2L3Z A;  4PYU A;  3EFC A;  3VDZ A;  3DBL I;  4GDK A;  4D2K A;  4RMA A;  1N6Z A;  2ASQ A;  4YTP B;  4MJS A;  1SE4 A;  4OW0 A;  2IO2 B;  4JE3 B;  3DBL B;  2AYO B;  3QX1 A;  3RZW C;  2K8C A;  5HG2 A;  1E7V A;  2IY1 B;  3HK0 A;  1V5O A;  1LQB A;  3LJ3 A;  1SXT A;  5D2M B;  4RCO A;  1XCQ L;  4N59 A;  1WR6 E;  1YIW A;  3HM3 A;  5BYR A;  1WX7 A;  4WUR A;  2MH7 A;  2MQJ A;  1XXG A;  1FO4 A;  3VUW A;  2Q5W D;  4ZRK A;  3C19 A;  4ITK A;  1GPX A;  4IOI E;  4K81 A;  1WGD A;  1PDX A;  4JX1 C;  4WJQ A;  1HQR D;  1F9J A;  2LJI A;  1T0Q C;  1N63 A;  4REZ A;  1VLB A;  3UIO B;  3DBH B;  4K7U A;  3APF A;  1HZ6 A;  1E0Z A;  3ZXR A;  1V1O A;  2HD5 B;  1UGJ A;  5I4D A;  5DPW A;  3M62 B;  2INP E;  1C4C A;  1WRD B;  1ZPS A;  2KFJ A;  5EE0 A;  3U4E G;  1A70 A;  4LNO A;  2FCM A;  4KIK A;  3Q8F A;  4L23 A;  1Y8R C;  1SE2 A;  3B0A A;  1R7S A;  3HVZ A;  1TY0 A;  4MJS B;  4DBG A;  2AQ1 B;  3WAP A;  3W9C B;  3RUI B;  5FR3 A;  1KFY B;  2WLB A;  3DWG C;  2IY0 B;  2MWS B;  2N7D A;  2KX3 A;  3PRZ A;  5DPR A;  3HHM A;  5TR5 A;  4TQ1 A;  3ZIM A;  4BOZ B;  3URY A;  4IG7 B;  3PO0 A;  2G9H D;  3PVL A;  4AS1 A;  1P98 A;  4EKU A;  3MFG A;  1T0R C;  2Y5P A;  2VH2 A;  4FJV B;  2C9W B;  2N0S B;  5IAA C;  3ZJU A;  1SJH D;  2OJR A;  1WYW B;  1FNW A;  2L8J A;  1WGK A;  3OG5 A;  2BT6 A;  3IHP C;  1WXA A;  1TZ1 A;  4YSZ B;  3FIL A;  4JWS C;  4ZOH C;  1Y56 A;  3MHZ A;  2ZCB A;  2BKR B;  3NVV A;  2IGH A;  1WIA A;  2JRH A;  4PS7 A;  5BYQ A;  5G5H A;  2N9E B;  5LLI A;  5MPO A;  5TSS A;  1IPG A;  3KW5 B;  1ACC A;  2RDB C;  2ZNV C;  4HK2 A;  2JZP A;  2JSV X;  3HRD D;  1H4R A;  2KFK A;  4MH0 E;  3Q3O C;  4KV2 A;  2KLG A;  3VAW A;  1DGJ A;  1I4R A;  5IO9 A;  2KT7 A;  1I4Q A;  1HA5 A;  1A5R A;  2L0F A;  3TBL D;  2QDF A;  1YMH E;  2AQ2 B;  3V05 A;  4W9D A;  3EFU A;  3KYC D;  1C9F A;  4JGH B;  3P2B A;  3V6E B;  4ZRJ A;  2BPS A;  4HJK A;  2E3T A;  4TQ0 A;  3WAN A;  1GC7 A;  4LNN A;  4KGT A;  1PGX A;  5D3I B;  4E74 A;  1OFF A;  2LWP A;  3PLV A;  2PE6 B;  2WXF A;  1T5X D;  1LGR A;  4KGS A;  4LNF A;  2MA9 B;  1D5M C;  1YN4 A;  2MW5 A;  3T8M A;  1IUE A;  1KH0 A;  4KIK B;  2G45 B;  4HDO A;  4XYC A;  1N60 A;  3AE3 B;  3AEC B;  4BKS A;  4ZYS A;  2ZVN A;  1WMH B;  2PVO D;  5EE3 A;  3R66 C;  1XLP A;  1C3T A;  4A6Q A;  5CHV C;  4C00 A;  1CJE A;  2KAJ A;  4ZHO A;  4A3O A;  3RMK C;  2NBV B;  4TV3 A;  1F77 A;  3K9P B;  1VD2 A;  2VZK D;  2R2O A;  2ZEQ A;  3ZRC A;  1DOX A;  2W3R A;  2B76 B;  2X38 A;  4B0M A;  1QOB A;  3HVD A;  1XO3 A;  4B0E A;  4JPS A;  2ZPN A;  1NYR A;  2D5G A;  4G3X B;  1ZUD 2;  3A4R A;  4AJY B;  1JQ4 A;  1FXA A;  2D07 B;  4FHK A;  4OZB A;  1UF0 A;  2L83 A;  5H8Y E;  5FKA C;  3I9V 1;  3KLS X;  2RPV A;  4YTM B;  3V60 A;  1WI0 A;  5HI1 A;  1KM7 A;  2MBE A;  5IP4 D;  4ICV A;  3AE8 B;  1E9M A;  1B1Z A;  4GDL A;  1TS3 A;  2G3Q B;  2ICI A;  2L00 B;  2Z0E B;  1OGW A;  3Q3F A;  2XEW A;  1GUA B;  2KDF B;  2RD0 A;  1YOV B;  2W55 A;  1Z5S B;  4GB9 A;  3TIX A;  3NS1 A;  1L7Y A;  2EKI A;  1V49 A;  4RH6 A;  1P0R A;  1FNU A;  2WXP A;  2JXT A;  3DVN V;  4BBN C;  2J0J A;  3ZTC A;  1FPY A;  4HJG E;  2WXQ A;  2L05 A;  4FBJ B;  3B1L X;  4IKG A;  1M4V A;  1EF1 A;  1UBQ A;  3AXC A;  1KF6 B;  2D10 A;  2ZJD A;  1F2R I;  4RFB A;  3VQI A;  2M56 B;  3I5J C;  3HIZ A;  1AN8 A;  2KO3 A;  2A5U A;  1FIQ A;  1YN5 A;  2J4X A;  4NAM A;  3DBR I;  1WM2 A;  3KH0 A;  3H6N A;  4GN1 A;  4KKI A;  4CO7 A;  5BO4 B;  1NYQ A;  5AZF A;  3H7S A;  1QF6 A;  1E8Y A;  3ZNI D;  3JSV B;  5G55 A;  3Q8B A;  2ZCC A;  4WJO A;  3ZYY X;  2KTR B;  4WWM A;  4P1C C;  2FUG 1;  2HDE A;  4M8M A;  4H2A A;  3AN1 A;  1WY8 A;  3AE6 B;  2J0M A;  2DX5 B;  3GP7 A;  2DZJ A;  2NTT A;  4OVU A;  1DOY A;  3ABV B;  2FAZ A;  2MRP A;  2M19 A;  3QQ8 B;  4MSM B;  4ICU A;  2LFI A;  4N6E B;  2KJR A;  3VHT C;  2WDT B;  3VUY A;  3AMZ A;  1D4B A;  4ARI A;  3ZW3 A;  1BUI C;  3QJZ A;  3KWL A;  2OOB B;  3VR8 B;  4GIV A;  3N20 C;  1WXM A;  5C2T B;  1D5Z C;  2ON8 A;  1E10 A;  1PGB A;  4XC2 A;  3AU5 A;  1PGA A;  2FCQ A;  4YXD B;  1GNU A;  4GDL B;  1EU4 A;  2PJH A;  2M0X A;  1BXT A;  4FAD A;  4MDK E;  2KQ7 A;  5JHB A;  4NQK E;  1ET6 A;  3AE1 B;  1V97 A;  2BQQ A;  2Y5C A;  4NZL B;  2O2V A;  1CQV A;  4NQL B;  4OVV A;  1HXY D;  1G6J A;  4TUU A;  2JUO A;  4OHJ A;  3Q3M C;  1E8Z A;  2RMM A;  3X0W A;  1XD3 B;  4HKZ E;  1M94 A;  1FRR A;  3IXS A;  5L95 C;  2XN9 C;  2BYV E;  3PLU A;  2ACZ B;  3UF8 A;  3T9L A;  1BML C;  1E6E B;  2K5P A;  5D7G A;  1Q5W B;  5LNK 1;  1E8W A;  4MM3 A;  3IT6 B;  2D11 A;  1XT9 B;  2WXL A;  2GMI C;  3TEZ A;  3RPF C;  4N58 A;  2CKH B;  2IO3 B;  2A4Z A;  2CJO A;  3QIJ A;  4K1R B;  2KDE B;  3EGR A;  3Q3J A;  1EM7 A;  1PYW D;  1P7F A;  1DOI A;  1L0X B;  1C79 A;  1YJJ A;  4K3C A;  4NAW B;  4P16 A;  2WXR A;  1ZP0 B;  2WDQ B;  3TJP A;  4L2Y A;  3PT2 B;  3P1M A;  1MG4 A;  1OEY A;  2LVQ A;  4K7W A;  4LCD E;  4A9A A;  3ZO5 B;  4I6L B;  2CR5 A;  1CK1 A;  5HKH A;  1RFA A;  1QT9 A;  4W9G A;  1WJN A;  2QSD A;  2WQY B;  3KWV A;  1JWA D;  3GB1 A;  1RRB A;  4HXD A;  1I7H A;  2LGI A;  4ASW C;  1ENF A;  4NJ6 A;  1RFK A;  1QOF A;  1FFU A;  2LZ6 A;  4XWW A;  2J53 A;  3U7D A;  1C76 A;  1GJZ A;  2GLS A;  5EDS A;  3L0W B;  3PSE B;  1FFV A;  3A33 B;  1CZP A;  1WH3 A;  2K6Q A;  5LXH A;  3ONS A;  1F2R C;  1RLF A;  3AEB B;  1J8C A;  1EU3 A;  2TSS A;  1WXV A;  1V8C A;  3OLM D;  1C78 A;  2QIL A;  4LNI A;  1VCB A;  2CU3 A;  4WJN A;  1TY2 A;  2K22 A;  4HWI B;  1FNV A;  4CHK A;  1ZXI A;  1D5X C;  1E8X A;  1QOG A;  2AL6 A;  3ZKJ C;  5GXG B;  5EE9 A;  3NJT A;  3RNB C;  4HCN B;  2LRW A;  3IBE A;  2H88 B;  1XCT L;  3V61 A;  1D6E C;  4HRS A;  5L83 A;  2YEP B;  1IBX A;  3N9Y C;  4M0W B;  1WZ0 A;  4PS3 A;  2V9H A;  4II2 B;  3AE2 B;  1EF5 A;  3JW0 X;  5HFY A;  3EUB 2;  1FXT B;  2NCN A;  4BBN F;  1TKY A;  2LAS A;  2WXK A;  2FBW B;  1D3Z A;  3Q3N C;  2BBC A;  4W9F A;  4FLH A;  3NY5 A;  1GG3 A;  4F1S A;  4BOS C;  4E71 A;  2O6V A;  3MP9 A;  3QAR A;  3QHT A;  3DQV A;  4NJ7 A;  2R2Q A;  3CMM B;  1TGZ B;  1WGR A;  4ZRI A;  3KYD D;  2QJL A;  3E56 A;  2KMA A;  3V62 A;  1WJU A;  2WXH A;  4W9J A;  5HHD G;  2Z0D B;  1I4P A;  3SHQ A;  3L54 A;  1RYJ A;  1DYQ A;  3J9C A;  3PZ7 A;  2K9X A;  5BMG A;  4JL9 A;  3ZUN A;  3R7Q A;  2RGF A;  2NPT B;  1OQY A;  4S0R A;  1TYG B;  1PFD A;  1SSN A;  2KFK B;  1V2Y A;  2Y5B B;  4GLS C;  1UWM A;  4AOF A;  3OJ3 A;  2ZW1 A;  4NAW A;  3SR6 A;  1YQB A;  2KTF A;  3AEF B;  1UD7 A;  1AAR A;  3RT3 B;  5JHA A;  5JXV A;  2KWC A;  2KK8 A;  2LMC A;  4B9K A;  2ZW0 A;  2D3C A;  1WE7 A;  2MBO A;  4WAF A;  1AW7 A;  3KVF B;  3VUX A;  4C7Z A;  1J0G A;  3E9S A;  3C8Y A;  1K52 A;  3AUL A;  1L5P A;  2QIE B;  3WAL A;  2LEK A;  1J19 A;  3RCZ A;  2KOX A;  3BZD B;  4TKN A;  2KHW B;  1TKE A;  3H1U A;  2YVC A;  1FMA D;  4LK0 M;  2CHX A;  2GOW A;  4IWQ A;  2MJE A;  4EOY A;  4DDI D;  3AV8 A;  2IGG A;  5IKC M;  1QQR A;  2V3S A;  4C56 C;  4A3P A;  4WQO B;  2AEH A;  2PVG C;  5FR6 A;  3W1Y A;  1FM0 D;  2WYQ A;  4AWJ A;  4R3D A;  3NS8 A;  4WAA A;  4WWO A;  4BKS D;  2DBY A;  2M4N A;  3PPA A;  3M63 B;  3I57 A;  4PT5 A;  4EZK A;  1OQR A;  3AE5 B;  3TUO A;  2IO0 B;  3OAW A;  1MG8 A;  1C1Y B;  4O1N A;  5FK9 C;  4JQW C;  3O13 A;  3AEE B;  3GZN B;  2L52 A;  2YLM A;  2ZNV B;  1VZ6 A;  2DNF A;  4L1B A;  5E6O A;  2LGS A;  1SE9 A;  4DXF A;  3MTN B;  4JIO U;  4RF1 A;  2QMT A;  3H7P A;  1WWT A;  2I2Y A;  2GI9 A;  2BW2 A;  2C7N B;  2K39 A;  3OWE B;  4XWT A;  3T3O A;  1V80 A;  5KHQ A;  1WX9 A;  2JRI B;  4NY0 A;  2OED A;  1YX6 B;  5E6P A;  1F52 A;  4TSS A;  5DPT A;  3R7R A;  1AYF A;  2JY6 A;  1T0S C;  2DAF A;  1WJ4 A;  3U8Z A;  4OZC A;  2MX2 A;  2FNJ B;  3IVF A;  3OJ4 B;  1R4M I;  2JX5 A;  2LJ5 A;  2N9X A;  3P4Q B;  3ZVV A;  1SF0 A;  5D6J B;  1MVK A;  2E6X A;  1T0Y A;  2O2V B;  2D3A A;  2XBB C;  1UGM A;  3HUI A;  2EMT A;  1Z2M A;  1SB3 C;  2BB5 A;  2J0K A;  2WWZ A;  2LGX A;  1QOA A;  4XGA B;  3RD2 A;  4CYE A;  1WXS A;  3VVW B;  3KUC B;  3NUH B;  4MSQ B;  2D3B A;  4PYZ A;  3AI5 A;  1Q0W B;  3L08 A;  2I38 A;  5DPS A;  4BFR A;  2LD9 A;  2KDB A;  2LUM A;  2KQ4 X;  3A4S C;  1IBX B;  1GAQ B;  1WGH A;  3MHS D;  5J18 A;  4HPP A;  4PK1 A;  2IBI B;  2CHZ A;  2BS3 B;  2J42 A;  2YEP F;  3PRM B;  2H89 B;  5AZH A;  4FXC A;  4ANU A;  2JYE A;  3SU8 X;  2CJN A;  3BVM A;  1VJK A;  2WHI A;  3SDL C;  3B08 A;  4DHJ B;  1HE8 A;  1GOZ A;  1UUP A;  2LXC A;  2L1A A;  4ANV A;  1MI0 A;  3PZ8 A;  5E6J A;  2O6V D;  4DWF A;  1KLV A;  1ZGU B;  2EMS A;  1KLU D;  2GBN A;  1PUT A;  3Q69 A;  3VR9 B;  2C7M B;  4NNJ B;  1TS2 A;  4KSK C;  1V9J A;  4M00 A;  3LDZ E;  2BYE A;  4IWP A;  1VZ8 A;  4MGI E;  4BKG A;  4QAY A;  1QIL A;  3CF6 E;  2D3G A;  2R61 A;  2BTE A;  2N7E A;  2PTL A;  4G0N B;  2V3P A;  1YQ4 B;  1I42 A;  2LXA A;  4AJW A;  1FCL A;  1QKZ A;  2HJ1 A;  4RGT A;  1NEK B;  2QC8 A;  3TMP B;  1HEZ E;  3MC9 A;  5DCN A;  1YJ1 A;  4FN2 A;  4BAX A;  3IAM 1;  1IYF A;  1WF9 A;  3N32 A;  1V5T A;  4KZC A;  2WP9 B;  3GZN I;  4HEA 1;  1NBF C;  1TIF A;  2JWZ A;  5E6N A;  3UQB A;  2NMQ A;  1UNS A;  2IZV B;  5H92 C;  2Z59 B;  2KJH B;  2N1W A;  2DWQ A;  1I4H A;  2AWT A;  3APC A;  4F8C B;  5BMH A;  3NVY A;  4MGK E;  3ENE A;  4A90 A;  3VRB B;  2L76 A;  3GE8 C;  2NR2 A;  3T3N A;  1V1P A;  4GU2 A;  3DHG C;  3LYY A;  3L4P A;  3RFZ B;  1FXI A;  3V6C B;  1JWM D;  3RYT A;  1E7U A;  2KN4 A;  2WX0 A;  4ANX A;  2IDY A;  3C0R B;  3MC8 A;  4HCP B;  4RM8 A;  3U2S C;  3B2F A;  3RZF A;  4W9I A;  2KMM A;  1E90 A;  2CU1 A;  1JCK B;  2EEL A;  3I63 C;  3AH7 A;  1ZOY B;  3V3X A;  4JWU C;  2UYZ B;  3PRP B;  1WGG A;  3P4R B;  1FCC C;  2HE7 A;  2MP2 A;  5C1Z A;  3M3J A;  2N9K A;  1NI2 A;  2LVO A;  3L17 A;  5AUI A;  4XE0 A;  4IWO A;  4RM9 A;  2L0T A;  3APD A;  4EUT A;  3A9J A;  3LB8 C;  4YSX B;  2UWQ A;  4GSW A;  3PS6 A;  3GE3 C;  1YQ3 B;  3AEG B;  2RR9 A;  1EWY C;  4M0W A;  1KTK A;  1YD8 U;  4ZDV A;  3WCQ A;  2XK5 B;  4WWP A;  4DHZ B;  2XK5 A;  1I4X A;  3DWM A;  2FIF A;  2PE9 A;  2BYF A;  5IN7 A;  4ZRQ A;  3TEY A;  3CSF A;  4P1B C;  3IG3 A;  3U7Z A;  4W9H A;  5BMI A;  4I6P A;  2LI5 A;  3NOB A;  5IOI A;  3BWU D;  1C77 A;  2AQ3 B;  1WMH A;  4LDT D;  3O65 B;  2CS4 A;  1MPE A;  4LNK A;  4KSL C;  2DZI A;  3VTW A;  2MP2 B;  1ZDV A;  4MEL A;  3P63 A;  2Y3A A;  4EE2 A;  5GMV A;  1XF5 L;  2J7Q B;  3N30 A;  1MHX A;  1TBE A;  2KVZ A;  4ANW A;  1Q1O A;  2G4D B;  4WH4 A;  3X23 A;  1EUV B;  4EEW A;  4I6N B;  3A1Q B;  3VRA B;  1QLB B;  4B95 A;  2BS4 B;  2AL3 A;  1YN3 A;  3L16 A;  2BVC A;  4HVB A;  2IO1 B;  4YTN B;  2GBR A;  1P1A A;  1V81 A;  1XLO A;  3PGE A;  2EKE C;  2IPK D;  3QC8 B;  2K6D B;  3VFK A;  3TEX A;  1J7C A;  2KNB A;  3PV1 A;  2DZM A;  1N5X A;  1TKG A;  2WX1 A;  5AEK B;  1S1Q B;  4HPL B;  3BII D;  3GOE A;  3W1S A;  1JRP A;  3FIL B;  1J7B A;  3NRZ A;  3CST A;  1FD6 A;  3A9K A;  3TL5 A;  1WSP A;  3WAO A;  2NVU I;  2JZZ A;  1VR9 A;  2RDH A;  5LXI B;  1C4P A;  2PLP A;  2GRI A;  1UEL A;  3Q14 C;  4IDI A;  2K1F A;  2JPH A;  3Q6B A;  2SAK A;  3Q8A A;  3NG0 A;  2BKF A;  1WZ3 A;  3AE9 B;  4G11 A;  1LXD A;  1P7E A;  1SBB B;  1RM6 C;  3RN9 C;  1UBI A;  1E7P B;  4KZ0 A;  3H8H A;  3NHE B;  4ARC A;  2DHZ A;  3ETR A;  3N1Y C;  1P3Q U;  2W82 A;  4W9K A;  2PPH A;  1TZO A;  2N7J A;  3WA0 A;  1GB4 A;  2JVC A;  2ZPY A;  2KDI A;  1C4A A;  4DK5 A;  3WIM A;  3W2D A;  1GC6 A;  3N1X C;  4XDC A; 
#chains in the Genus database with same CATH homology
 4GB9 A;  2M8S A;  4WQO B;  2AEH A;  3TIX A;  1CMX B;  1L7Y A;  5FR6 A;  1V49 A;  1WM3 A;  3JYU A;  3BIN A;  4LJO B;  3W1Y A;  1P0R A;  2WYQ A;  4AWJ A;  2KJ6 A;  5JZE B;  2M17 A;  3NS8 A;  3DVN U;  2C5L C;  4LJP B;  4WAA A;  4WWO A;  3DVN V;  3EHV A;  4BKS D;  2BWF A;  1PQS A;  2K8H A;  2MBQ A;  2I1K A;  2M4N A;  2PEA A;  3M63 B;  3PPA A;  2J0J A;  4GGQ A;  4LDT B;  4BBN C;  3IFW B;  5AZG A;  3ZTC A;  4EZK A;  1LM8 B;  1WR1 A;  2KTR A;  1SGH A;  2IO0 B;  3OAW A;  1MG8 A;  2ZVO A;  3BY4 B;  2L05 A;  4FBJ B;  1C1Y B;  2NPT A;  3UIP B;  3B1L X;  3QWZ B;  4MEM A;  1EF1 A;  1UBQ A;  3AXC A;  4JQW C;  2C60 A;  2D10 A;  2ZJD A;  1RAX A;  3ZDM C;  4X57 B;  3VQI A;  3UQA A;  2YLM A;  2GBJ A;  3ML8 A;  2ZNV B;  2V1Y A;  3UGB B;  1V6E A;  3HIZ A;  2KO3 A;  5E6O A;  5CX3 A;  1SE9 A;  2A5U A;  3MTN B;  4JIO U;  3QCA A;  3DBR I;  1WM2 A;  3DPD A;  3H7P A;  4GOC A;  2K39 A;  2C7N B;  3VH3 B;  4XX5 A;  3KH0 A;  3H6N A;  4GN1 A;  1IP9 A;  1V80 A;  2MCN B;  5BO4 B;  4CO7 A;  5KHQ A;  3DCG A;  5G2N A;  1WX9 A;  4MGZ E;  2JRI B;  4NY0 A;  5AZF A;  3H7S A;  4IC7 B;  1E8Y A;  3ZNI D;  3KUZ A;  3JSV B;  1TTN A;  5G55 A;  1L2N A;  3DBH I;  2JXX A;  1YX6 B;  3K9O B;  5E6P A;  2FCN A;  2ZCC A;  4WJO A;  2HJ8 A;  5DPT A;  3R7R A;  2VRR B;  4E3C A;  2JY6 A;  3PHW B;  2KTR B;  2DAF A;  1WJ4 A;  3QAQ A;  3U8Z A;  4M8M A;  2MX2 A;  4M8N A;  3DVG Y;  1WY8 A;  2FNJ B;  3DVG X;  3IVF A;  3OJ4 B;  4BVU C;  1R4M I;  2J0M A;  2DX5 B;  2LJ5 A;  3RUL A;  2N9X A;  3ZVV A;  2DZJ A;  5D6J B;  4OVU A;  1SIF A;  2K8B A;  1T0Y A;  2O2V B;  2XBB C;  1WFY A;  1P9D U;  1UGM A;  2FAZ A;  2MRP A;  2EMT A;  2JZ3 B;  2KAN A;  3QK0 A;  1Z2M A;  2J0K A;  2WWZ A;  3QQ8 B;  4MSM B;  2LGX A;  4GMV A;  3RD2 A;  2KX0 A;  3ZLZ A;  4ICU A;  2KVR A;  2DYB A;  4CYE A;  2KJR A;  3VHT C;  2WDT B;  3VUY A;  2IYD B;  4EZJ A;  3H7P B;  1WXS A;  2QHO A;  3R3M A;  3VVW B;  1E5W A;  3ZW3 A;  3KUC B;  3QJZ A;  2LGY A;  1BT0 A;  3N3K B;  4MSQ B;  4A20 A;  2OOB B;  3ECI A;  3QA8 A;  4GIV A;  4GXB A;  2KC1 A;  4PYZ A;  1WXM A;  2L3Z A;  4PYU A;  3AI5 A;  1Q0W B;  3L08 A;  3VDZ A;  4XC2 A;  3DBL I;  2DYO A;  5DPS A;  4GDK A;  3VTW A;  3AU5 A;  2FCQ A;  5CHF A;  3ZNH B;  2LD9 A;  2KDB A;  4J6I A;  4BFR A;  1GNU A;  4GDL B;  3A4S C;  4RMA A;  2PJH A;  3PHX B;  2M0X A;  2ASQ A;  1WGH A;  3L10 B;  3MHS D;  4MDK E;  2KLC A;  2KQ7 A;  4FAD A;  2KXJ A;  5J18 A;  4MJS A;  2IBI B;  3ZNG C;  5JHB A;  4NQK E;  2KWU B;  2KWV B;  2CHZ A;  2IO2 B;  2KC2 A;  4FHJ A;  2AYO B;  3QX1 A;  3RZW C;  2O2V A;  2K8C A;  2KMC A;  3PRM B;  4NQL B;  1E7V A;  4OVV A;  2IY1 B;  3HK0 A;  1V5O A;  1G6J A;  1LQB A;  4TUU A;  1LFD A;  3L13 A;  3LJ3 A;  2JUO A;  5D2M B;  5AZH A;  4ANU A;  4KVG B;  3SU8 X;  1E8Z A;  3X0W A;  1WR6 E;  1YIW A;  4JLC A;  1XD3 B;  3SDL C;  2N4F A;  3HM3 A;  1WX7 A;  3B08 A;  4DHJ B;  1HE8 A;  1M94 A;  2MQJ A;  3A9K B;  2LXC A;  5L95 C;  2BYV E;  3PLU A;  3UF8 A;  3VUW A;  4ANV A;  4PS8 A;  3T9L A;  4WJP A;  2O6V D;  4DWF A;  1KLV A;  1ZGU B;  2MBB B;  2EMS A;  4DDG D;  2NBU A;  5D7G A;  4ZRK A;  2GBN A;  3DOW A;  2DAJ A;  2C7M B;  1Q5W B;  2LVP A;  4NNJ B;  1E8W A;  4MM3 A;  3HM6 X;  3I3T B;  4KSK C;  3JSV A;  1V9J A;  2D11 A;  1U4A A;  4K81 A;  1WGD A;  1XT9 B;  2GMI C;  2HTH A;  3KUD B;  4HLE A;  4WJQ A;  3LDZ E;  2BYE A;  1F9J A;  4IWP A;  2V4L A;  4MGI E;  4BKG A;  4EZL A;  2BF8 B;  2CKH B;  3CF6 E;  4II3 B;  2D3G A;  3ALB A;  2IO3 B;  2A4Z A;  4IM3 A;  3UIO B;  1ISN A;  2N7E A;  3QIJ A;  4K7U A;  4G0N B;  3APF A;  4KDL B;  3DDC B;  4K1R B;  1I42 A;  2LXA A;  2KDE B;  4AJW A;  3Q3J A;  2FID A;  2HD5 B;  5DPW A;  3M62 B;  1YX5 B;  1WRD B;  3TMP B;  2CHW A;  1UH6 A;  2LGD A;  3M95 A;  4G50 A;  5DCN A;  1YJ1 A;  4FN2 A;  4NAW B;  2KFJ A;  1IYF A;  1H8C A;  3TJP A;  1OEY J;  2JF5 A;  1WGY A;  3AU4 A;  5C23 A;  3PT2 B;  1WF9 A;  3D32 A;  1V5T A;  3N32 A;  1OEY A;  2LVQ A;  4K7W A;  4LCD E;  4KZC A;  1NDD A;  4FUL A;  2FCM A;  5CTR C;  4KIK A;  3ZO5 B;  3GZN I;  2CR5 A;  4I6L B;  5HKH A;  1RFA A;  1Y8R C;  3B0A A;  3PZD A;  1NBF C;  4W9G A;  4ZYN A;  1WJN A;  2JWZ A;  5E6N A;  3UQB A;  2IZV B;  2K25 A;  2G4S A;  2Z59 B;  2KJH B;  1WX8 A;  3ZTD A;  1XQQ A;  2N1W A;  4DXA B;  4F7Z A;  2AWT A;  4IUM B;  4GDK B;  1RRB A;  4HXD A;  4MJS B;  3APC A;  3A9J B;  4DBG A;  3UIN B;  3WAM A;  4F8C B;  2LRU A;  3WAP A;  2DYM A;  3RUI B;  4MGK E;  3ENE A;  4ASW C;  4W9L A;  4NJ6 A;  2L76 A;  2LZ6 A;  1V86 A;  2NR2 A;  1I35 A;  2IY0 B;  3A1Q A;  2DEN B;  2MWS B;  2N7D A;  4KDI C;  3U7D A;  2KX3 A;  4GU2 A;  1GJZ A;  3PRZ A;  5DPR A;  3HHM A;  5EDS A;  4AP4 C;  3L0W B;  5TR5 A;  4TQ1 A;  3PSE B;  3V6C B;  3ZIM A;  3A33 B;  1E7U A;  2WX0 A;  3RYT A;  4BOZ B;  1WH3 A;  4ANX A;  1WJ6 A;  3C0R B;  2BWE S;  2K6Q A;  2N1V A;  3PVL A;  4IG7 B;  5LXH A;  3ONS A;  1RLF A;  4FJY A;  1J8C A;  1P98 A;  4HCP B;  4EKU A;  4RM8 A;  3RZF A;  4W9I A;  2I1J A;  1E90 A;  1WXV A;  2CU1 A;  3OLM D;  1KOT A;  4IW0 A;  4FJV B;  2C9W B;  2W9N A;  1VCB A;  5IAA C;  4A3P A;  2UYZ B;  3PRP B;  1WGG A;  2L7R A;  2RSU A;  4WJN A;  2OJR A;  4HWI B;  1S3S G;  1WYW B;  2HE7 A;  2L8J A;  2MP2 A;  1NI2 A;  3M3J A;  4W9E A;  3SD5 A;  5C1Z A;  2LVO A;  4EFO A;  3L17 A;  4CHK A;  3IHP C;  2GBM A;  3ML9 A;  4IWO A;  4RM9 A;  1E8X A;  3JVZ X;  1R4N I;  1WXA A;  1TZ1 A;  2L0T A;  3APD A;  2AL6 A;  4P7I A;  4HPM B;  3ZKJ C;  4EUT A;  3A9J A;  2KKC A;  2UWQ A;  2ZCB A;  4GSW A;  3PS6 A;  2BKR B;  2RR9 A;  1WIA A;  2JRH A;  3PTF C;  1YD8 U;  4PS7 A;  5J17 A;  4HCN B;  4YL8 A;  5LLI A;  2N9E B;  2LRW A;  3IBE A;  1K8R B;  3V61 A;  1UZX B;  4ZDV A;  4NPN A;  1IPG A;  3KW5 B;  1QZE A;  2XK5 B;  4WWP A;  5L83 A;  3VTV A;  2ZNV C;  4HK2 A;  4DHZ B;  2XK5 A;  4M0W B;  1WZ0 A;  2FIF A;  4PS3 A;  1H4R A;  2PE9 A;  2BYF A;  4II2 B;  2KFK A;  4MH0 E;  4KV2 A;  2KLG A;  3VAW A;  4N9F 4;  3CSF A;  1EF5 A;  3JW0 X;  3IG3 A;  3EEC A;  4W9H A;  1A5R A;  2L0F A;  3NZS A;  4I6P A;  3TBL D;  2LI5 A;  3NOB A;  1FXT B;  2NCN A;  4BBN F;  4DHJ D;  1WMH A;  2LAS A;  4LDT D;  3O65 B;  2CS4 A;  1D3Z A;  4KSL C;  4W9D A;  3EFU A;  2DZI A;  2KN5 A;  3KYC D;  4FLH A;  3NY5 A;  1GG3 A;  2MP2 B;  3P2B A;  4JGH B;  4W9F A;  3V6E B;  4ZRJ A;  3TCA A;  3VXW A;  2BPS A;  4HJK A;  5D94 A;  2N9P C;  4K7S A;  4BOS C;  4E71 A;  4F1S A;  4MEL A;  5JH5 C;  4TQ0 A;  5KHO A;  2O6V A;  5GMV A;  3QAR A;  3QHT A;  3WAN A;  1GC7 A;  2J7Q B;  3DQV A;  4NJ7 A;  3N30 A;  2R2Q A;  3CMM B;  1TGZ B;  2MBH A;  5J2R A;  1WGR A;  4ZRI A;  1TBE A;  4DHZ E;  3H9D A;  3KYD D;  2LWP A;  4E74 A;  3PLV A;  4IM2 A;  2PE6 B;  2KMA A;  4B6W A;  3V62 A;  3S2A A;  3U30 A;  1WE6 A;  1WJU A;  4ANW A;  1Q1O A;  2G4D B;  4W9J A;  3X23 A;  1EUV B;  2DZK A;  2Z0D B;  2MA9 B;  4EEW A;  4I6N B;  3A1Q B;  4AUQ C;  2JT4 B;  4B95 A;  2MSE D;  1JRU A;  2AL3 A;  3SHQ A;  3L54 A;  3ZDT A;  1EO6 A;  2MW5 A;  3L16 A;  4HVB A;  2IO1 B;  4JL9 A;  3ZUN A;  3R7Q A;  2GBR A;  1P1A A;  2RGF A;  1V81 A;  2ZZP B;  2NPT B;  2NS5 A;  1OQY A;  4IM0 A;  3T8M A;  3PGE A;  2EKE C;  4WWN A;  3QC8 B;  2K6D B;  4KIK B;  2KFK B;  3VFK A;  2G45 B;  4HDO A;  1V2Y A;  2Y5B B;  3VTU A;  3ZNZ B;  4AOF A;  3VH4 B;  4BKS A;  2FCS A;  2KNB A;  2KQS A;  2ZVN A;  3MJW A;  1WMH B;  2DZM A;  3OJ3 A;  3PV1 A;  3NZU A;  4NAW A;  4MGY E;  3R66 C;  1YQB A;  2KTF A;  2O6V B;  2WX1 A;  5AEK B;  1S1Q B;  1UD7 A;  2FUH B;  1AAR A;  4HPL B;  3GOE A;  3RT3 B;  2BGF A;  3W1S A;  4W9C A;  4BKT A;  1C3T A;  3CST A;  3A9K A;  5JHA A;  3TL5 A;  3WAO A;  2M1M A;  2NVU I;  3PRE A;  5CHV C;  2B3A A;  1OTR B;  1X1M A;  2JZZ A;  2KWC A;  2KK8 A;  5LXI B;  4B9K A;  1WE7 A;  2C7H A;  2MBO A;  4A3O A;  2NBV B;  4TV3 A;  4URK A;  4HDQ A;  3KVF B;  1VD2 A;  2KD0 A;  3EC8 A;  2R2O A;  2ZEQ A;  2D2Q A;  3K9P B;  3VUX A;  2REX A;  3ZRC A;  1UEL A;  1J0G A;  2MLB A;  2K1F A;  2JPH A;  2ZPN A;  3AUL A;  4G3X B;  1ZW7 A;  2GBK A;  2RPQ A;  3A4R A;  3WAL A;  4AJY B;  2BKF A;  1J19 A;  1WZ3 A;  2D07 B;  4G11 A;  2KOX A;  1LXD A;  3RCZ A;  5IA7 A;  5CHW A;  4FHK A;  4TKN A;  1UBI A;  2KHW B;  2LUE A;  4KZ0 A;  3V60 A;  1WI0 A;  3H1U A;  4FJZ A;  4XZ4 A;  1KM7 A;  3NHE B;  2DHZ A;  2YVC A;  2MBE A;  3W1S C;  1KJT A;  1P3Q U;  4FA6 A;  4W9K A;  4ICV A;  2PPH A;  2CHX A;  3WA0 A;  3ZRF A;  4GDL A;  2GOW A;  2KZR A;  2G3Q B;  2L00 B;  3DBS A;  4IWQ A;  2Z0E B;  2NBW B;  4DDI D;  4EOY A;  1OGW A;  2JVC A;  3Q3F A;  2ZPY A;  2KDI A;  2XEW A;  4DK5 A;  3WIM A;  1GUA B;  2V3S A;  2KDF B;  2RD0 A;  1GC6 A;  1ZKH A;  1Z5S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...