2FB0A

Crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
ANSMIRLNVFVRVNETNREKAIEAAKELTACSLKEEGCIAYDTFESSTRRDVFMICETWQNAEVLAAHEKTAHFAQYVGIIQELAEMKLEKFEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein from Bacteroides thetaiotaomicron VPI-5482 at 2.10 resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fb0A00
2ASYA 2XMUA 1Q53A 3KNGA 1KQKA 5A6PA 1KVIA 2OD6A 4YEAA 2ROGA 3LGMA 1AW0A 4A46A 1FE0A 2OAUA 2ROEA 1GXUA 5T7LA 2PD1A 5B0EA 1SI9A 2K1RA 4FNIA 1JK9B 3K7RA 2GA7A 1OQ3A 1Y3JA 5B08A 1N5QA 3E8OA 2VV5A 1GXTA 4A47A 2W4DA 1Q4RA 3LO3A 1X0PA 4Y2IA 3TRGA 1FE4A 1QUPA 2XMTA 2QLWA 2QLXA 1TL5A 3HF5A 4OJGA 1OQ6A 2K2PA 2AP6A 2GGPA 3FRYA 1TZ0A 3HX9A 1IUJA 4OJ3A 2OKQA 3HHLC 1RJJA 2OMOA 1OPZA 1Y3KA 2RU9A 1TUVA 2RSQA 5F0UA 4Y2MA 1MWZA 2HFNA 2BBEA 1N5TA 3WDOA 1WD6A 1FESA 2GV1A 4HH0A 2K7KA 2Q3PA 2IFXA 3FGVA 3BM7A 3HHLA 5B0AA 2KT2A 3BF4A 5IXUA 1ULRA 1TR0A 1SB6A 2LXFA 3HHLD 3TOQA 1K0VA 1LQ9A 1VQYA 4OIXA 4DL0C 2ROPA 4EFAC 1TL4A 2GFFA 2RILA 2ZDOA 2LDIA 2L3MA 4ZA1A 5B0DA 2HLUA 2IYGA 5KAKA 2KYZA 5B0GA 1CC7A 1YG0A 4A4JA 1AFJA 3TNVA 1Q8LA 2GO8A 2XMVA 2OP5A 3DCAA 5A6WA 4OJ1A 4U9RA 1JWWA 1CC8A 2OFHX 2HFOA 1KVJA 3DXSX 3KG0A 1S6OA 4Y2KA 5T7LB 1XBWA 2K1RB 1AFIA 1R6YA 2IYIA 4HI2A 2BJEA 2RMLA 3QMQA 1VQSA 2ZDPA 2OD4A 2VH7A 4FNHA 5K9FA 3MCSA 4A48A 1YJUA 2GCFA 3T9NA 3CJKA 1P8GA 1APSA 1YRXA 2XMKA 2PGCA 2FHMA 2XMJA 3BN7A 3BB5A 3IWXA 3MZIA 3BDEA 3IWLA 1Y0HA 2KKHA 4HL9A 4NL5A 1FEEA 4OJHA 1V3ZA 3CJKB 2G9OA 4Q2MA 2CRLA 3HDSA 2QYCA 2BYCA 2EW9A 4F67A 2N4DA 4NPOA 5B0FA 1Y9OA 2HLTA 2GGPB 1YJVA 1W2IA 1URRA 1MWYA 3BR8A 3VTIA 5B0BA 2OFGX 3GZ7A 4HH1A 1YJRA 1FD8A 2FIUA 1YJTA 1FVSA 1Q8BA 4HI1A 1X7VA 2AJ1A 2JDJA 2N7YA 5F0WA 2ACYA 2LQBA 2XMMA 1FVQA 1U7LA 4Q2LA 1CPZA 1N5SA 1X8DA 4YDXA 3HHLB 2LQ9A 2AJ0A 2FTRA 1SQEA 4ZOSA 3I9ZA 3KKFA 1OSDA 3QGPA 4QOTA 3KG1A 2AW0A 2HQIA 2W4CA 1N5VA 2BJDA 2QIFA 4DN9A 4DPOA 2BUNA 3HFKA 3UDCA 3BGUA 1P6TA 2HIQA 3FMBA 1S6UA 5B09A 3LGNA 2FB0A 2KT3A 3F44A 2N4CA 5B0CA 2XMWA 2K7JA 2W4PA
chains in the Genus database with same CATH superfamily
3VAGA 2XY5A 2BXJA 4PPDA 2DNHA 2ZH6A 3D1QA 4ZPCA 4ECZA 2C3MA 1UWBA 2B9YA 2G2YA 1IBMF 2PD1A 2J0SD 2ZH3A 1UKUA 5IQQA 3QRPA 4FYXB 4RBTA 1S0OA 4RW8B 1WC0A 4ZKAA 3Q24A 4JI1J 1RBAA 1NUEA 2GIRA 2OPRB 4IUFA 1XNQJ 2MZSA 4DV5F 1MROA 1NHKL 3HLUA 3T1AA 3LUYA 3DFEA 3CPWR 2XI3A 3DLEB 5F8IA 3ETMA 3FRYA 1D0EA 2ALYB 3MM8B 2VA3A 3A8EA 4DR3J 3V81B 4BS2A 2CKWA 2HWTA 5C24B 4FYYB 5L1LA 1ZPVA 4AT1B 3WZ0A 1S9FA 1NSKL 1NKBA 3SEOA 4EYIB 4IRKA 2CAJA 3PW2A 3DOMB 3KFWX 2PMWA 1GAOA 1S4FA 1D9AA 3VQSA 5F9LA 4C8NA 4DR2F 3RB4A 3E2EA 4OLOA 5K8MA 1CS4A 1WHYA 1LQ9A 2FJBB 2ZFHA 4YB6A 3M30A 3OT9A 3VZHA 3ZTPA 2ZM6F 2R7UA 3QAEA 2CIMA 1X4AA 1MG7A 1O5JA 2W7PA 3SDEB 3K5MA 3RRHA 2UXDJ 2CNNB 1UW9A 3MOJB 1RT5B 1J5EF 1N0UA 2QA1A 1PYOB 4QQBA 4A8SA 5J2QA 4RW7A 3HZGA 1TK8A 2A0FB 2VFTA 4UOFA 3C6TB 5M2RA 3DRPA 3DYAA 3GSDA 2N3LA 2O66A 3W5ZA 2VKZG 2ZH4A 4ZHRA 2QFIA 3I55S 1UEKA 2HGNA 2YNHB 1IBKJ 3CCUS 1R0AA 3RAQA 1LFWA 1JJCB 4RNFA 3DOLA 3CGIA 4LSZB 2DCUB 3UN2A 1HARA 5K14B 2D9PA 4BC9A 4BCAA 3ZXWA 1GK8A 4DG1A 4HI2A 1ZM9A 3J81Y 3KMQA 4GO5X 4DV0J 2IDLA 1TAUA 5KFLA 3CCMS 1RBOB 5KFJA 1FKAF 4FZVA 1NHVA 2XZDB 5AXLA 2F63A 4LQ9A 2E5JA 5CYMA 5HSPA 3X1LB 1U2RA 2C42A 2AJQA 3N9UC 3LF0A 3WX4A 1RKJA 2WSCC 2H5EA 4OI6A 3H5XA 1AUDA 1QVFR 3US5A 3CIZA 5GMEA 2M3DA 2A6OA 4OYZA 4BBYA 3IP0A 3CCTA 4K59A 2B8QA 1RTHB 3ITHB 4W98A 5IZHA 5DLGA 1X9WA 2MPUA 3MTKA 3KLFB 1EHWA 2H48B 4DLGA 2Y0SD 2DYAA 3I96A 2XZTB 2BABA 2OPQA 4CM0A 4YB1P 4USHA 2HKEA 3C8YA 1N54B 4LFAF 1XERA 1S6QA 5CZXA 3QRQA 1WKJA 3SIPB 9ATCB 1T9TA 2YKAA 4DL4A 2MHEA 2XC9A 2UXCJ 3OQ2A 1S1UB 4NI2B 1PIEA 3FFIB 3VAIA 2MY7A 2FTRA 4DLEA 3IR5B 4WXWA 2UXBF 3BV8A 1BXNA 4XDDA 5HVGA 2V2KA 1PYTA 2CXEA 2RF2A 2VD3A 4FS2A 4DR5F 1NK6A 3RAXA 3HULA 1FFWB 3MEGB 3FMBA 4HEA9 4HYKA 3HZEA 4PYDA 1CJKA 4MFBA 4CTAA 3C6UB 3THTA 1NK8A 1WI8A 2RJZA 3N5FA 2XMWA 2K7JA 3D68A 3BSOA 3LTOA 2DNNA 1ELOA 2W4PA 1Q95G 3MHYA 4KYZA 3ULHA 1NJYA 4DV2F 1TL7B 1YHQS 3Q8RB 1D1UA 4B3SF 2DRAA 4WF9Q 2E66A 3TZWA 3FZBA 2M4MA 4L3NA 3TX8A 2Z30B 4A46A 3TUJC 3HVTB 4FP9A 4C0BA 1SC4B 5CCMA 5T7LA 5KT4A 4N76A 3A8KA 3GFHA 1N0VC 1WEXA 3IR7B 2HNZA 4KKOB 2KHCA 5LSOA 4J9OA 4ECQA 2CQPA 4YS2A 4ED0A 2HHTA 3RR7A 4A47A 3GIKA 3HM9A 4RNOA 4P10A 2YWHA 5IOLA 2J0XA 2FYXA 2QLWA 3HF5A 4NLSA 1T05B 5CYJA 5MAOA 4JI8F 3CE8A 3D3BJ 3HX9A 5DM7Q 2H4WB 4PWWA 1S79A 1RKIA 1LW2A 3JQKA 4PG6A 3GQCA 1Y3KA 1XNQF 2AT1B 4QU7A 5F0UA 4MTPA 1PJ5A 2JVOA 3C15B 2DPJA 2BKNA 4P2MA 5IT4A 1TKXB 2IIHA 3KJNB 3FSYA 2H5IB 2DXDA 5E0OA 3RB0A 2MQNA 3H40A 4J9NA 1T8EA 1WUUA 1WC4A 2O67A 1PAEX 4TKTA 1OYEA 4C7QA 3D67A 1CJVA 1WEYA 2LA6A 3PFEA 4CLLA 2R2TA 1S77D 5FD1A 2CYYA 1H72C 2OPQB 3CD5A 4G1QB 1BY9A 4OHVA 4FBUA 1UETA 2HFVA 1KEKA 3GIIA 1S1WB 1UVMA 3L7UA 3Q8UA 4KGKA 1RUSA 2ZHAA 1C1CA 2HLUA 1C1BB 2HNYA 2YH0A 4LSLA 5J1PA 1U1PA 1S10A 2IC3B 1F1BB 2H4YB 1U48A 4URQU 1HNWJ 3TNVA 3HVRA 5AE2A 3VGTA 1FJGF 3OJUA 1SL2A 1HWUA 1GH8A 4ZVTB 5CYQB 3N6LA 3PR5B 4ZVSB 1RI7A 2LCWA 2IPOB 2R7VA 1B70B 1YDLA 2DEJA 2ZD1B 3FCHA 2ZH7A 4NLDA 3R2CJ 2CQHA 3DRXA 1S0NA 4UUXA 4F0HA 3JSMA 3OXFA 2ZBCA 3GP9A 1TP7A 3M2UB 4DR3F 4NXMJ 1YJUA 3B8HA 1PCAA 3T9NA 4MMOA 5KT2A 3U1NA 2GX8A 1U2CA 5KFRA 4LREA 1NCLA 4I0WA 5DGBA 3THPA 1XMOF 1LW0A 1WF0A 2I38A 3KLEA 3O44A 4NLTA 4OYMA 2X1FA 1N6QA 1FKPA 3D1HA 3P45B 2EFVA 4FN5A 4TU8A 2HZVA 1B0PA 1PSDA 3O3LA 5D15A 3TAMB 3PY8A 2MZ1A 4JI3J 3MAQA 1VRQC 1T05A 4ZPWR 3FMWA 2OH2A 4C0OC 2PN6A 4H4KA 3VGUA 4K4YA 5HQLA 2GVZA 1BQNB 1KQFB 1M1GA 2G4BA 2R2RA 1E6VA 3Q89A 3X3UA 3KK3A 4B3RF 4BC7A 2DNKA 3SV4A 3HVAA 1TKXA 4RU2A 2KN4A 1WHVA 3SV3A 4ED8A 1X8DA 1G2EA 2VFVA 3VAJA 1R27B 2R2UA 2V50A 3I9ZA 4C9DA 3OL6A 3V4MA 3TUIC 4ZLPA 2JSXA 2GC8A 2HRTA 1U4BA 1EQMA 3CJRA 2GQQA 2H65B 4DL2A 1UL3A 2VG5B 4ZPTR 5G4DA 3MEDB 4CP5A 5HBMB 5I3UB 4NXNF 2CPIA 4KHMA 4M5HA 3D0HE 4PKDB 3UE2A 1TL7A 3M7VA 4RJVA 2YH1A 2N4CA 4R5PB 2XGQA 2WVCA 1RT1A 2WVEA 2D3UA 5I3PA 4PQAA 2PC6A 2J6SA 2V2ZA 2VICA 1RYRA 1UZDA 2B9EA 4Z37A 3DRSA 4JV2A 2V9KA 1BWEA 1WC6A 2GHWA 3DU5A 3HHEA 1HBMA 4RX6A 3RBZA 3TAQA 4FF4A 1KDNA 5LT5A 1KS2A 3KXDA 4YB5A 4DF8A 3OTEA 2N7CA 2IMOA 1DY3A 1EJ7L 4IH5A 1CQMA 4YN3B 1F9HA 5HN0A 3V6DB 2NXCA 1WTBA 2BM1A 3E8OA 4OYIA 3F56A 2X1BA 1TFYA 2XMTA 2J9DE 5HK4A 3AJ2A 4ICLA 3GG1A 2VBXA 5I3QA 1U02A 1JJ2R 1S97A 5IV4A 1B3TA 5GAHI 1Q86T 1HQUB 3O8WA 3ZZUA 4DBQA 3UN5A 2FC8A 5KFBA 4K4XA 2HHWA 5D4OA 1RT2A 1B0TA 2VBYA 1FESA 4TY8A 2AYBA 2K7KA 4MKYA 3RW6A 1TK5A 1IKYB 1GTEA 1RCXB 1H74A 5E3CA 2KT2A 4PG7A 3TP2A 2EWHA 4Y2AA 5IXUA 2NCKL 3O5TB 5CD4A 2FLPA 2XS5A 1JKHB 3TAPA 1D3WA 3I0RA 3IC1A 1C1BA 4LFBF 2VOOA 2UUWA 4ZPAA 1VK3A 4OX6A 3RBXA 2CA9A 2OJ3A 2ZH1A 4B3SJ 4LIRA 4DV6J 4KPYA 3EJMA 4LF9J 3M8ZA 1JQGA 4KFBB 3R97A 5C2CA 2KYZA 3KHHA 4O3NA 7FDRA 3VV2B 4JI2F 2ZC3A 3PEHA 3BO3A 2XI2A 3EUNA 3CMQA 1UW4A 2RU3A 2A10A 4EBDA 5ETSA 2NXJA 4Y2KA 1VHIA 3MR5A 1LXNA 1SUQA 2LMIA 3G82A 4X4OA 1RT3A 4X2BA 1FD2A 2WOMB 4U67Q 4ZPVR 1OWXA 4J9QA 4AL6A 4M95A 2OPRA 4DS5A 2WRMA 4IFVB 4M5DB 2HNDA 1T9YA 3RRKA 3MFHA 3GFZA 1RT6B 1Q8KA 3QLHA 3S6EA 4DX7A 2AHOB 2RDDA 3FQKA 3MPDA 1HQEA 2UUAJ 4IR1A 5A2QY 3EVOA 4WZMA 4UUWA 3EWGA 4PAAA 3MR3A 3P6YC 4DSIA 3SFGA 2E5HA 4JOUA 3BH7B 4WKRA 1MWYA 1W2IA 3DDIA 2EEYA 3MEKA 3O1LA 3DRRB 3DHWC 3HSZA 4TU9A 4QWEA 1RHKB 1YJRA 2E7WA 3R5AA 4PXBA 4F36A 3J7ZT 4HKQA 2D69A 5LMNF 3PW5A 2MGZB 3NS7B 1RHQB 5D0EA 2AJ1A 2F40A 3FC9A 3FK4A 3TO8A 1N56A 2CJYB 3W2WA 4OX9J 1FVQA 1U7LA 4DV7F 2KRBA 3LP0A 3OTOJ 2R7SA 4Q44A 3SSSA 1U1LA 2BOAA 5H9FJ 2IAJB 2WHOA 3UVJA 3DLGB 2KT5A 3GILA 3OUYA 2AW0A 4OV6A 2FY8A 3PX6A 3EDQB 3Q8PB 3TUZC 3QPIA 2XO7A 3QRRA 2K3KA 1OY9A 1QVGR 4F4XA 4ZJQA 3PCOB 3P5TL 4B9UA 2Q43A 4KO0B 4S0MA 2FB0A 3UR3C 4CT8A 2WB4A 4B02A 2ZZNA 4ZS6A 3UDVA 4WBFA 1FFGB 2IBOA 4QR1A 2KVIA 4O0NA 4C4WA 1KQKA 2LQ5A 4IRCA 1TVRB 3TARA 2LU2A 4ECYA 2D1CA 4JV5F 5C42B 4WZQA 2HK3A 3G96A 1MNEA 2XEXA 2GZOA 3GFYA 2GA7A 2DHSA 3OSNA 1MMLA 3PVXA 1WSRA 2AKWB 4AYBD 5A8KB 5EGYA 3MAAA 4ZVPB 3JAMU 2HBQB 4ECRA 2C2MB 2Z2YB 3QATA 4LF5F 1BGXT 2HFUA 3P3DA 4DUZJ 3HI9A 4ES1A 1QUPA 3ITHA 1B99A 3NAIA 3H4BA 5LOQA 2RRNA 3DLJA 1VC6A 4BWMA 4B3RJ 1LFPA 1R89A 1NJWA 3FSIA 3WBZA 1XMQJ 1JX4A 1KBRA 3CDBA 1RT2B 1ZM3A 4TY8B 2OKQA 2HQCA 1VYAA 1BQMB 1PILA 1YSJA 1RJJA 2C3UA 3SCKE 3OR1A 2LP4A 5J2NB 3HP6A 2DGXA 2KM8C 3KMSA 3MUVP 1WF2A 4LRDA 4NA1A 4OYBA 1J5OB 2GIFA 3B82A 2GV1A 3I87A 4QYZJ 5FJ4A 1NXIA 2DNLA 4DV1J 2A2DA 3OFGA 2LKZA 5B0AA 4A8XA 4FVCA 2KFNA 2XYGB 4DEZA 1HNVA 1V5IB 3HHLD 4KRWA 3TOQA 5HMYA 1SJ3P 3BO4A 4K5SA 3CWJA 1B0VA 3MM5A 1UJ5A 3CT9A 3EZOA 1RAOA 4EGLA 1N33F 3BGFA 1NKEA 4NWBA 5AE3A 1KHVA 2LDIA 1WHXA 3LP0B 4HDGA 4I1TA 4J90A 3MMAA 2D3O1 1NJZA 4YHHF 4IG3A 2ASJA 4OYOA 2F4VJ 1H3DA 2HEKA 2IMWP 1HD0A 4C98A 2VQFJ 4ZP7A 2A2CA 3OUYB 2V8PA 3PFOA 3DCAA 1RTDB 1HBUA 3E01B 1CC8A 5CA5A 3DNCA 4KTQA 4WE1A 1YVFA 2DHAA 2YKNA 5ETLA 4C48A 3J7A1 4UZBA 2I5JB 5T7LB 3F73A 1AFIA 2CQ4A 1W26A 4OLPA 1EB0A 4R0JA 1RA6A 1YITS 3PHEA 4CWBA 1LWFB 4FVMA 4O4GA 3E51A 3CCJS 4OZ1A 5KOWA 4JB8B 3NGDA 3KHLA 2BM0A 3BREA 1JLCA 4LF8J 2OEMA 1APSA 2A18A 2MLXA 1MLAA 3BQ2A 4DV4F 1KLMB 2YNFB 1HQEB 3SFUA 1VQ4S 1KNZA 2JWNA 3MZIA 4NZ6A 3IWLA 1FKOB 1V3ZA 3W65A 1U6BA 4I64A 2Q79A 4HTIA 1LEOA 2MQ8A 2I0XA 4K4SA 1FTCA 3ET6A 3HSJA 4M5IA 4ED6A 2EK1A 1C0UB 1HBNB 1NRKA 1CJUB 1PAUB 3CW2C 4X65F 2GGPB 4CYUB 1WOOA 4O0IA 1AZSB 2K8GA 1VRUB 3M8QA 4PCQA 4DV3F 2CQDA 1H6KX 1YX2A 4X64F 4DV6F 3SI8A 4OHZA 4B3TJ 3TA1A 4G1QA 4DV0F 3HO1A 3FRZA 3JTPA 4P2SA 3Q83A 4IFYA 1TAQA 2W01A 3AD8C 4K2XA 4DQPA 3G2XA 3CULA 5KFNA 2VHGA 3MEEA 5KG4A 2E5IA 3M6XA 4L3KA 1C1CB 1RAIB 4NCAA 5BYSA 2QV6A 3M05A 4LVOP 1QAIA 1RABB 3GSIA 3PNIA 1RAGB 3DDKA 3ILIA 2ZE2B 4F26A 3ZC4A 2UXDF 1CBKA 2KB2A 2IJRA 2BUNA 1X5PA 2U1AA 3CJTA 1P6TA 5KG5A 2E1PA 4HACA 5KG7A 1NK7A 3CCES 3LGNA 4OZJA 4YFUA 2JEIA 2E9TA 2W25A 5KG2A 5J1EA 1TUWA 4K0KF 4OHWA 1U0SA 2JL9A 1FRKA 1HBUB 3I5AA 1U47A 3QWUA 1OIAA 3M2UA 2IY5B 2ROGA 3WQPA 4F0MA 1WI6A 4X4VA 4C8MA 1PO6A 1RBLA 2W7OA 2JLGA 3MURP 2P8IA 3ZTRA 2BJ8A 3V6HA 1WDTA 4I56A 3KK1A 5KFZA 5IFMA 5A0YB 5ITHA 1U2FA 4JV5J 2MEWA 2Z0GA 2WVDA 3HHNB 1HL6A 2V8DA 1CSJA 2VL1A 4WU3A 1WOSA 5ETNA 3C14A 3TEHB 4RW8A 4AXIA 4CNYA 3V81A 4KC5A 3WIVA 1KLMA 1RGVA 2MQQA 1ZTTA 3NMRA 5DDRC 1TZ0A 4O4RA 4RWWA 2GAHC 4QR0A 5KFAA 4A8OA 3OLAA 1UVNA 3QIDA 3UNYA 2J8AA 2ZJQQ 4Y2MA 4ZDNA 3OVBA 3AOAA 3MM8A 2WONB 1O8BA 2DNPA 4NCGB 3BSNA 1VLYA 2QL9B 3CJ0A 3IBWA 1C0UA 3R5JB 4G1IA 4HH0A 2QMXA 2CPYA 2DNYA 3J80U 3UPFA 2HHUA 3GJSB 1QSLA 1RCOB 2YPYA 3PIOQ 4FKXA 3RTVA 2CQBA 2M7SA 2QA4S 4XO0A 3IM9A 1NKCA 4C8YA 3VVTA 5HQ8A 4Z7YA 2FVSA 2V8HA 4K4TA 6FD1A 2AEJA 2DEIA 4YR3A 3Q23A 2VG6A 4JI8J 3NBPB 4JV0A 1EKSA 4QBUA 3HD1A 1SJQA 4X4NA 1Q8LA 3BQ1A 3RGIA 4UY85 4LJMA 3EPIA 3OVSA 3T1HJ 4EO8A 2LQ8A 2E1CA 1VGYA 4E2FB 1HBMB 4DG1B 3KG0A 4WYWA 1REGX 2W8LA 4DWIA 1S6OA 5IM0A 3M1VB 4QWAA 2K1RB 4OQJA 4L73A 3EVWA 2YNHA 5L39A 3ILLA 5KT7A 5CYMB 4X62J 4X4QA 4CI0B 1LOUA 2AJFE 1DJ0A 2EFPA 2FLOA 3FNNA 2NYIA 3NEKA 3MPWA 4JV1A 2UUCJ 4N8NA 5T41A 2OTJS 4HHJA 1UMJA 3KLIB 1RTDA 1U1MA 1Y5LB 1GEHA 3BGRA 2NZ4A 2HPUA 3O6QA 3RUBL 2A3JA 1FEEA 2RIJA 2V34A 1YJ9S 1VQ6S 1C0TB 2CPXA 4H4KC 4WK1A 1S1VB 1D8YA 2DGQA 3BYRA 2QRRA 1BMQB 1PC5A 3MCMA 1Y9OA 1JJHA 4K7QA 4P6QA 4RU9A 4N5SA 3BR8A 5KFFA 4UQTA 3PW4A 4L72B 1JLEB 2FIUA 4ES2A 2HRUA 5FIIA 1NZ8A 3ONQA 2F4VF 2YWGA 3M2VB 2C3OA 3QGIA 3C19A 5U47A 2VA2A 2XMMA 2V63A 3CD7A 4IQMA 1RA7A 1Q8IA 4C3KA 5GVQA 4ED1A 2RUSA 4CLWA 4CLUA 5H9EJ 2NXNA 5EN1A 4F7VA 1OSDA 1Z4UA 3VGSA 1B7FA 4LF7J 1IBCB 3MM7A 3B4DA 2MLYA 2XSJA 4J37A 2HIQA 2IJNA 3SSQA 2O5DA 5HMWA 4TQRA 5HMXA 2PA8D 3AAWB 4DL3A 1FDAA 4G3IA 1GT8A 2X1GA 3KLFA 1X4EA 3LAMA 4Q8EA 1FJ7A 1CJKB 2W24A 1F9EB 4MFBB 2XMAA 2QMUB 4Y00A 4ZIWA 4N56A 2HYIB 5KFWA 1AW0A 3C16A 5A0YA 1N36F 1S7HA 1KOHA 1DBDA 2AF6A 4MIBA 4CLPA 1KTQA 3B54A 5B0EA 2K1RA 2R7RA 2RS2A 1JK9B 1SKSA 2HHQA 2K06A 4R25A 1F2GA 4HLBA 1VIOA 3IRXB 3QAUA 2CADA 5HROA 4NLXA 4RWXA 1GXTA 3MXHP 2D74B 2M8HA 3IRWP 4F3MA 1ROFA 4CZCA 2WBRA 3KLIA 2K2PA 2E1RA 2VPZB 3KG4A 4Y2CA 3LPEA 1LK5A 3H90A 5D4LA 5JMNA 4I2QA 4RNNA 3QO9A 1ITPA 2NLWA 1R8BA 1VQPS 2FGCA 3WHIA 1FTRA 4K2JA 1HR0F 1TUVA 3AXMA 1YJNS 1RQ0A 3ENWA 1WD6A 5BXIA 2CQ0A 2JC1A 4LSNA 2DJWA 3M8PA 4PPZA 4ANEA 2UUBF 4QU6A 1A9NB 2X1AA 2QTWA 5A76A 1LWCB 4MKAA 4DR4F 1VIXA 3LP2B 1X4DA 3QFHA 2MY8A 5K5MA 1KTVA 2BR0A 4IR9A 2CZVC 3EM1A 2VF3A 9RUBA 1UTAA 4V1Ak 3QIPA 5I4MA 4EFAC 3CF5Q 2ERRA 2LDYA 2QMWA 4LFCF 1X4GA 2G1HA 5EX0A 1FXDA 3OXGA 4PG5A 2ZWPA 5DZ6A 1U6ZA 2JVRA 5AXMA 1YTYA 1RWUA 4F4AA 1FXRA 4YDDB 4RW6A 5KAKA 1YLXA 2DR8A 1KWMA 2NYHA 3LH2S 3PRDA 4EO6A 3UR0A 2KFYA 1VBXA 1TK0A 2MKYA 3CDEA 4HVZA 2AQ4A 3ENQA 2ACMA 4G6VB 4DR1J 3T5HA 2PI5A 4CCHA 4NXNJ 2HNYB 5C5JA 4O3RA 1VQNS 4U7UK 1BD6A 4DHVA 5GADI 2EPIA 5F8GA 4DQQA 2GVDB 1P9YA 1LXJA 2EKNA 2YQ3A 3IA0A 4FYVB 1TU0B 2DH7A 2V8VA 5CYQA 3B6BA 4QIWD 3LPYA 3EZUA 4DX6A 3J81j 4ETXA 3R5CA 3QMQA 4EZ6A 4MIAA 1OO0B 3CJSA 1VQSA 2HFZA 2RHQB 3EXYA 2CNLB 2YBVA 3N01A 2W2PP 3HSDA 5K9FA 5DDQC 4DSJA 3EE3A 3KOAA 2YKOA 1IBLF 1FKPB 2CPZA 1RLDA 3NGSA 1YRUA 4LVNP 3TA2A 1Q7YT 4LF9F 4ALZA 3IRXA 3R3TA 2J0WA 3CJKB 4KHPJ 3OR1B 5J2NA 4OI0A 4YOEA 2CJ9A 3BPSP 4M5GA 1VBYA 3IWNC 2YKPA 5IWAF 2XNQA 4KAIA 2N4DA 3EMTA 2UVUA 3B78A 1IN0A 1M1HA 3LP1B 4N77A 3FQLA 2B6AB 4DR2J 1N6QB 2XZWA 2C2NA 2FHOB 1ZAVA 5BYRA 3Q2SC 3UDEA 3VTIA 1LWXA 1Q5VA 2RH3A 2WB1D 1XR7A 2GHPA 3M2VA 4HHHA 2C2RA 5C25A 1OMSA 2UP1A 1UFLA 2GQCA 1LWEB 2HWIA 1ZZFA 2EFNA 2MZRA 4M5MA 3PXGa 2C22A 1KSPA 1X7VA 2A1BA 3VAMA 3R7SB 1BQNA 1FWKA 1ZAWA 4MYUA 3G8TA 4X4PA 5DQIA 1F5CA 1SV5A 2ZVIA 1SQEA 2R8GA 2XS2A 1JLQB 2A6MA 2P9EA 3KKFA 5BJRA 4ED2A 3PW0A 4M63A 5LJ5Y 3R1HA 1VDHA 2XBPA 2UUAF 2PMHA 2LECA 4FS1A 2KRRA 1YWXA 3R6LB 4Q5VA 3JSMB 1FNMA 2XTJP 1S1XB 3W61A 4W4MA 2NPFA 3PHTA 3QJJA 4K4UA 1HI8A 5J2QB 3HPOA 4NLQA 1FDNA 2ATLA 3HMJG 2VOPA 4QIVA 3VALA 2HVHA 1RTJA 1F9FA 1G4CA 4UW2A 3IMQJ 1IBMJ 3H2UB 1HNZF 2JRSA 3D6HB 3OD2A 3VZIA 4YY3F 1DTQB 3DRSB 2IHR1 4DL5A 1Y3JA 1IM4A 2NSBA 2VDIA 4GMKA 2CNOB 3DOKB 4GKJF 5D78A 3W1YC 4CM2A 4ICLB 2J5AA 5KT3A 2LEPA 2PMZD 4H54A 1NDPA 4I2QB 3C46A 1MU2B 3BR9A 3SXLA 3ET6B 1J27A 3CCVS 4RW9A 2UVRA 2HVIA 3D3CJ 1HHTP 1FFSB 2MKCA 3OVAA 1FNXH 1IBKF 1VQ7S 1FCAA 1A7GE 1BHNA 2AYGA 2VB6A 2IM0A 5ETRA 3MGJA 2W7AA 5HP1A 3ENAA 4PZVA 1Q78A 2LQJA 1RACB 3SYZA 3UCZP 3L09A 4C2MA 5DS7A 1T9VA 2JLEA 2PDAA 1TKTB 1N48A 3CMAS 4B9NA 3FGVA 2IFXA 3GIJA 1HQUA 4OMFG 2WZ1A 2Y0BB 3TQ1A 2XLKA 2FJEB 1HR0J 2CJQA 1SKUB 2BQRA 1N5YB 1FJEB 1EIYB 2E9RX 2VONA 3I4PA 3MR7A 1BC6A 3LGHA 4QPTA 1X60A 3JS9A 4OX9F 4RW4A 5H9EK 5BR8J 3M6WA 1YQHA 1U1NA 4PUOB 2HGMA 2MMYA 2YTCA 3POTB 1FF2A 3CD0A 1EP4A 3GJQB 4WFNQ 1IQTA 2JX2A 3H5YA 1EETB 1R3NA 1SH2A 2W2QP 4ENOA 1N36J 4Q0BB 3K5NA 2CWKA 2ALZA 1P1LA 5DZ7A 1HMVB 1CULA 4R8UA 1FXLA 4J9SA 4R0EA 2DO0A 2XCPA 2QLJB 3BZQA 1S6PA 4WIIA 1SJRA 2U2FA 2W9CB 3Q0AA 2FPHX 4WFXA 4DV1F 3D9BA 1U1OA 1TKZA 3KK1B 2IJFA 3TQEA 3ZNUA 3ZZTA 2HFSA 1TELA 2RMLA 1VQ8S 4LF6J 3V4IA 4XK8C 3UO0A 3K8WA 4NXMF 1IVZA 2OMLA 2E5GA 2DGWA 4IYQA 2BRKA 4KQZA 4ECTA 2AX0A 2DNOA 3M6UA 5FDLB 5KG6A 1JLBA 3J7YU 1P8GA 3CDUA 2H54B 1HPZA 1Q16B 4C8ZA 1WF1A 3GV7B 3P96A 2HNZB 4KKOA 4XIUA 3OSPA 1RWOB 1IJFB 2OPSA 4NL5A 2DR6A 2B6AA 2XGPA 3AODA 2DXFA 2W2NP 3FEYB 4ELVA 4QWBA 1W2BR 2EW9A 4OI3A 1S99A 1SQGA 3QLHB 4F67A 4NPOA 4ZCKA 3PO5A 4ECVA 4ZN3A 1LWEA 3IS9A 3W8GA 1XMQF 4WK3A 2QE5A 1W25A 5HVFA 5A8WB 2OO4A 2OFGX 1FA0A 3JYTA 2DR9A 2V69A 1FD8A 3W2WB 1PYSB 1LW2B 3H42A 3QYYA 1M5VC 3BBFA 4OYPA 2MZQA 4DMZA 5H1SV 4YP3A 5A8RA 2IRUA 2QGFB 3EPGA 4HI1A 4ZJOA 3QT5A 3H8YA 3I6PA 5B7WA 1G1XA 4J5OA 4OYWA 1HQ2A 2SXLA 2XWXA 2UXBJ 1JLFB 1N5YA 3ZZZA 4DQIA 4ZMMA 1RE1B 4LRAA 1BE4A 4PWUA 3UVJB 2Z2LA 2AX1A 5I42B 1S1WA 3NCPA 3CJ5A 2ZOFA 1YRTA 4ID8A 4M5KA 2EG2A 3IBCB 3MTJA 2Y8WA 4Q0BA 2G2OA 1VISA 2UU9J 1S9GA 1ACMB 2ZOGA 1Y7PA 4J9MA 2YNGA 2WBMA 3CNQP 4IDKA 5ETVA 1T03A 1DFDA 1CQNA 4WTOB 1FE0A 1L3SA 4UOCA 4RKUC 2R8JA 4JUZA 4PRFA 3A12A 2BV3A 2ABYA 2CJAA 3DC2A 4P52A 3R5DA 5KFGA 2B56A 3W5YA 1N5QA 5E3AA 3GE9A 2BOPA 5KTQA 2O1PA 2FUG9 1UAWA 4UOGA 4LF8F 1R8CA 2O01C 3MM6A 4ZVHA 1FE4A 1RISA 1BQMA 4OJGA 5A8KA 4H4OB 3M2RA 4CO4A 4QYRA 1R31A 3UD5A 2DK2A 2H9ZA 4DXLA 2IDEA 1IUJA 2B7BB 2CDQA 3DLKB 3NNAA 1FJCA 2OMOA 2RQKA 3N5BA 3L4BC 1B64A 2CUYA 3HKWA 2BBEA 4YMEA 3GR1A 1TV6A 4X65J 4WWSA 4X4UA 4WFYA 4L74A 1QDUB 5D0GA 3PKYA 4KE5A 1SH3A 5JUMA 1VC0A 3KDNA 2FJDB 1UVLA 1K9MT 1URNA 4X84A 4ZP9A 4PUOA 3CJ3A 3JYTB 2WTFA 1XR5A 2OPPA 2GVZB 1GMWA 1SB6A 1PJ6A 2LXFA 1JLAA 4DCOB 4EMDA 3BGOP 1VQYA 3DOMA 4EZ9A 2Y9HA 3W2VB 5M2UA 3G6YA 4F3OA 1NSAA 3K59A 4I7FB 1JIHA 4P72A 2Z8QA 4C8KA 4JI6F 1M5OC 2XSFA 4I4BA 2MXYA 1CS4B 3CCSS 4JI3F 2XY6A 1V6HA 4U7CA 1N4LA 3F41A 2VQEF 2DXEA 2XB2D 2W2OP 2FVQA 4U7UD 5F8JA 1JXEA 3K17A 3CTRA 3OTDA 2D3ZA 4MYTA 2IVYA 5BR8F 3EDRB 2RQCA 1FJGJ 1RZMA 2VODA 2OSQA 2HFOA 1SIWB 4KT0C 2I2YA 2FJAB 4IG0B 4OZ0A 1U09A 2HBRB 4KIAA 3U7JA 3H5SA 1S1TA 3V4IB 2FDNA 3NOGA 5GAEU 5AXKA 3M8RA 2VJUA 4USKA 1T9UA 3PJXA 2YKNB 3VF0B 1L3TA 5HANA 4J9UE 2UUTA 3TZYA 3PRBA 2J6TA 3AXKA 2ZDPA 4NLYA 5K14A 4K5RA 2YWFA 2OD4A 4Y6IA 3R1LA 1T3NA 3BDPA 1S0VA 2YVSA 2W1BA 2HS3A 4URSA 1IKVA 2HWHA 4ZITA 1H2VZ 3J81U 2YKMA 4WP9A 1MN7A 2QLBB 5C7PA 5CHCB 3T5LA 3GJRB 1Y0HA 1LNQA 2KKHA 4HL9A 4KY3A 4LF1A 4RUCA 3IS9B 2YX1A 3TJ8A 4QWDA 4TN2A 4DFJA 4CYUA 1UVIA 2QYCA 2X3DA 3PM9A 3H25A 1SXLA 5B0FA 1WG5A 2Q1LA 2WSEC 4MK9A 2CPHA 4DPTA 1IKXA 1Q1KA 3Q8YA 1VI7A 1YJVA 3TX0A 2D9OA 2KTQA 1NB2A 2B5JB 4NA3A 2JFKA 4QIEA 5E3QA 3NMAA 4WFBQ 2R2SA 4KGZB 4IOCQ 2I1RA 1FVSA 4FF2A 3Q86A 3ENVA 4C6AA 1QTNB 4I6AA 1RWVB 3G8SA 1N32J 4WFAQ 4W90B 3ZFVA 1RU1A 1ZA2B 2KI2A 5KFKA 1RHMB 3LOUA 4LIWA 2HK2A 3HHLB 4OZNA 2KFZA 2QFJA 4PABA 1MW7A 1DLOA 1XEZA 2DNMA 4RW6B 1S6QB 1N34J 2OPPB 2CQCA 4RW7B 4M5LA 3AOBA 3KLHA 1Y11A 3G71S 2WCXA 1NK0A 2V4JB 4QCLA 1S12A 1SCJB 3TR5A 1FX2A 3I0RB 3FFIA 4ZHRB 4NEYA 2F8EX 3HT0A 5DG9A 3DLBA 4LF6F 2DB1A 3DU6A 2MKHA 2VASA 1WG4A 4RBUA 2GAGC 4AE5A 1VCTA 8RUCA 5J1EB 5DG7A 2BANA 1T03B 2B4PA 2BMBA 2GVDA 2KT3A 4G1PA 4LBHA 2XLIA 4ECSA 4A8YA 3HJFA 2L08A 5IT9U 3R27A 1HBOB 1YI2S 2MQMA 4EU0A 3K8VA 2DH8A 2R8HA 1RT7B 4CTAB 2DGOA 5A6PA 4I67A 3CC7S 1QAYA 1WSVA 4EBEA 2DKOB 2H5JB 2YX7A 4F4WA 8AT1B 2AIRB 3N6NA 2RT3A 3CD6S 3NCQA 2BVZA 2HBYB 5B08A 2PO4A 2MB0B 5IT0A 2VPWB 3RBEA 1H0HB 3H2LA 2BACA 3MECB 1ZTWA 4OYXA 2R7TA 4CO2A 1KKHA 1R6VA 1UJ6A 1EQ0A 1I3OB 3IAM9 1N88A 1OQ6A 5FLXY 2GQ2A 2ASDA 4TLQA 4ERDA 2GS8A 1FK9A 3GR0A 3PRVA 1T11A 3KUEA 5F8HA 2FD2A 4ZPBA 2J9CA 5F41A 4X4RA 3WC0A 1HD1A 2OEJA 3MPYA 2RU9A 3BKUA 3FCWA 3CCQS 2RRAA 2Q66A 1DQ8A 2OUGA 2LEAA 1D09B 4USWA 3A13A 3VQTA 4B17A 2JNJA 3DMJA 5M2PA 4B9TA 2HSEB 1K1QA 2HQGA 3MMJA 4JI7F 3DKDA 1I5OB 3U1MA 5L8RC 4FPRA 3T5JA 1T0TV 2D7SA 2BE2A 4LR9A 3BH6B 2DPIA 3CCLS 3IFEA 2JFDA 4V19X 1WOPA 2B4OA 3CVKA 3MMBA 4MH8A 2E9ZA 4F0KA 2RF2B 3ICLA 4JI0J 2F7VA 3DM2B 3VAFA 3UCUP 1Q81T 2KZZA 2PE8A 4KH0B 1OS5A 1X5TA 5L1KA 5KFOA 5E2QA 3RB3A 4ZCLA 3OHAA 4A8MP 1CC7A 3DGPA 3DI6A 4MAKA 3BJYA 2GHVC 3A1YG 4ED7A 2ZJPQ 1KONA 5L9NA 2CJKA 1R8PA 1JWWA 1RTJB 2BEFA 3H20A 2VG6B 3I82A 3MOZA 3W9JA 3FBFA 4RLEA 2AU0A 4ZLNA 3TUPA 4B3OB 2IC3A 2QZ8A 4CH0S 1NSPA 3HXMA 5D3GA 3PACA 1F0XA 3T9ZA 1F3VA 5HAOA 3TJ9A 4DV7J 5EWGA 1YKWA 2CQ2A 2NZCA 3L9ZA 4XTTA 4DPYA 3VVUA 2OLWA 8ATCB 1JJ4A 3W60A 3PDNA 1FO1A 1NDCA 4BHQA 1Q0NA 4FXVA 1NK9A 1PBAA 2M0GB 3M1VA 4C8OA 4OL8A 2BW2A 1OY6A 2MJNA 2QG9B 4DUTA 5J2PB 3NGRA 1ZBTA 4RW9B 5C42A 4PQUB 1XK8A 3LW5C 4ECXA 1C0TA 4ZVQB 3RJMB 1Q5YA 2E5LF 2R7OA 4DR6J 5D0RA 1H2UX 2QEXS 3A3NB 2AWZA 2ZNZA 4KR0B 2HBZB 3OPKA 3UW1A 3EVMA 3D6FB 3FBBA 1TKTA 3I0SA 5ETTA 1Z2ZA 2ILZA 3KLEB 1BLUA 2IM3A 2HHPA 3HFZB 4LF4J 3D5MA 2M9KA 1URRA 2GJIA 5K8PA 4NRTA 2ZHBA 1RU2A 3ISZA 2FJVA 2AGOA 4TYAA 5L1JA 5C24A 5HL7Q 1V9OA 4B9LA 1F5BA 1S9EA 2QL5B 2BA9A 2DNRA 2B8PA 4YHHJ 3QFWA 2F5GA 3KLHB 3KLGB 2KHDA 1KFDA 3DMJB 3F0NA 5G0RB 1N5SA 2JH3A 1TFWA 1WNEA 1CPZA 2MQOA 1VQOS 2DISA 1K0TA 4LSLB 4NASA 4X4TA 1HNVB 1DTTB 3MMBB 4WP8A 3H0PA 1HMVA 3QZ7A 1ZOTA 2MJUA 2CQIA 4DX8H 2CZ9A 4E98A 3DM2A 2MLZA 4OHXA 4DCPB 1K8AT 2DGVA 5J2MB 3KUGA 4IG3B 2XSJB 4ZLLA 1U1RA 2XYPB 3DGPB 3DI6B 3C6TA 1VFJA 4P9SA 2XMUA 2HHVA 3E01A 1GMUA 1YBUA 1NH8A 3ISND 5FDLA 3OFHA 4ETZA 5DM6Q 1UA1A 5JXSA 1ZYQA 4PG4A 1KC8T 2ADCA 4B9SA 2ZBRA 3T3FA 3IM8A 4FNIA 5KFMA 3NXZA 5HVHA 4IO9Q 3BBBA 2OPSB 3FDSA 3A3PB 5D4PA 4EK2A 3IBFB 3CMES 2B9XA 1PBUA 1NMEB 3T41A 4CDIA 4B3TF 1TL5A 4RNHA 3LQVA 5KG3A 4AFFA 4FBTA 1REVB 2RDJA 5KOXA 1HYSA 3NS5A 2RKIB 2EFGA 3M6VA 5K8OA 1F2HA 2D41A 4OJ3A 3M9MB 1H7XA 2CDRB 3M8PB 5IWAJ 3KK3B 1TL1A 4P73A 3D0IE 3GYGA 2HQFA 5FLXU 1N5TA 1Q7LB 2MKIA 1N34F 1SC1B 3LP2A 1RTHA 2W8KA 3FKBA 1WEZA 2KL8A 1CJUA 3GWCA 3ZZPA 3M4XA 3OLBA 4ANCA 3KK2A 4DSEA 1HNZJ 2E7VA 2ZUAA 1TR0A 2B7CB 5CCLA 2R42A 4UF4A 3HD2A 1KHWA 3OXLA 1ZETA 3T6BA 3QT8A 4F4YA 1LWCA 4V19J 4OI4A 3DXBA 5BYQA 3QNWB 3SCIE 2MKSA 2L3MA 1DHMA 3DYAB 4NLWA 4OYAA 4XDCA 5F8LA 1NJXA 4UY8T 4DQRA 1EARA 4RUBA 4YB7A 1WJ9A 2GMLA 5T14A 4MKVA 1ICEB 4KSEB 1R0AB 1IM6A 3T6JA 5A6WA 1QSYA 2DGSA 2XMVA 3RYLA 2N3OA 4X64J 1GNKA 2ILYA 2FVRA 1MMNA 1NPPA 1VRTA 3GU0A 2MQPA 2G0CA 4DPWA 1UWAA 4RUAA 1HHQA 2WW4A 2Y1RI 1RAEB 4AQYF 4JI4F 1RLCL 3GLJA 1CLFA 3TEGA 3QGGA 2LXUA 4Q43A 4CIOA 1VHFA 2HVZA 3TW0A 3NNHA 4C8LA 2EFQA 3EGVA 2V2VA 2HRYA 2RUGA 3NGUA 3PTWA 4ZVGA 3W66A 2B4VA 4CQ1A 4WCEQ 1RT3B 1TMJA 5L1IA 5DDPC 3VGVA 3KLVA 3CJKA 4I69A 4DV4J 2G13A 4DQSA 2W9BA 2XMKA 2WVBA 4GKJJ 1I51B 1QUVA 4JI7J 3VWSA 2BJ1A 2E44A 1T9WA 1TUGB 4F25A 1HI1A 2G9OA 5DQHA 1TMMA 2IRXA 1Y5NB 4PR6A 2VC1A 2BYCA 3FJ2A 4QPXA 3SZ2A 2HHSA 4NCBA 2HZCA 2KH9A 4PXCA 2F9DA 2QSWA 3CO9A 5KFIA 4Y65A 4DR6F 4DN0A 2EG1A 2V94A 5SUHA 5E3RA 4DV3J 1I94F 4HHUA 1HI0P 2CJBA 3O2IA 3H2VE 4TU7A 3PYEA 3PX4A 1S1UA 1FEHA 2JHEA 4NI2A 2O3DA 1YZ6A 7AT1B 2BQ3A 1QLNA 3G9CA 1S49A 3C15A 2VFUA 2I8EA 2HG4A 4NCGA 4ZIVA 4AL5A 3IR6B 2ZNYA 2QA4G 1SKWA 1GX6A 3VAHA 4NLVA 2AJ0A 3CCWA 3GMGA 1XNRF 3D7SB 2IRYA 2CNKB 2J7WA 5CABA 3CXCR 2PT0A 1S1XA 4LBPA 3D0GE 3C6UA 3D4JA 3MDFA 2VPXB 2M70A 4TLRA 2LXIA 4ILLA 1F6TA 4WPAA 3FEZA 3IO1A 2DIUA 2XY7A 1VQ9S 3G6ES 4CLYA 2EC2A 2B3TB 2CVEA 4TY9A 1XTZA 6FDRA 5L46A 3T1YJ 2KJVA 2VZ9A 3W8PA 3JXOA 4KO0A 2MKKA 1V3RA 2P6SA 4IH7A 4ED4A 4AD6A 1ZAXA 5DLFA 2OGUA 5LMUF 1CEZA 1L3KA 3DN9A 1HNXJ 3D1OA 1QSSA 3PZPA 5IM0B 4DFPA 2ZD1A 3W5XA 1NZAA 1JNRB 2L9WA 2V67A 3JSYA 4IO1A 2AJ4A 4J91A 4MIWA 3S7RA 5DJBA 5F9NA 1H7WA 2W4DA 2R7WA 4KGVB 3K89A 3TRGA 2BJ7A 2FY1A 1U0HA 4EWTA 3EX7B 5HLFA 3AA9A 2HAIA 2BRLA 3TI0A 2HVDA 2ZKTA 4A8FA 1OY8A 3FVYA 4OFZA 1VOMA 5D4NA 4ZP8A 3TAMA 2G1DA 5DG8A 3BYPA 2BZ2A 1NAQA 2GW8A 5LSLA 2B0GA 3I31A 2JEFA 2ZITA 2H3EB 2VFSA 4HTJA 4ID5A 3BF4A 1JMTA 2ZZTA 4TQSA 2FVCA 2JJ4D 4IRDA 2LVWA 2V4JA 2P5VA 4DL0C 1XR6A 1AUSL 5KFTA 1WG1A 1WELA 4DJBA 3JAMY 1R7IA 4H4MB 2DO4A 5DETA 2KXHA 1OJ4A 4DSKA 4ES3A 2BW7A 2IYGA 3IGNA 1HBOA 4A4JA 4DU8A 2DY1A 2F3JA 4ZCIA 1AFJA 4CNZA 4DV5J 2KJWA 2OP5A 3MD1A 3WX8A 2AYMA 2OFHX 2VG5A 4FXWA 3AH6A 4NZ0A 4P7TA 4TNOA 5HBMA 4C3MA 3KJVB 4K4VA 2J0QD 3PW7A 3MI7X 2GNKA 5KFQA 3HFVA 2ZVSA 5DGAA 2EKYA 4R5PA 2XM3A 2R3VA 5F8MA 2RE1A 1FRMA 2IA6A 1S6PB 1YGYA 4X62F 2B4UA 2ZJRQ 4CRJA 2XYHB 2I5JA 1HLWA 3MECA 5L9XA 3ILOA 4CO5A 4JI5F 3D28A 1TKZB 2HAFA 2VH7A 1LW0B 4KPCA 3CO0P 3ELHA 4B08A 3LWMA 2DCLA 4AQYJ 4JI4J 5D8HB 2EBEA 1YRXA 2DBBA 2PGCA 1QD1A 1RWXB 2FHMA 2YKQA 3FUYA 3IWXA 2IVFB 2GIQA 4OZLA 2OIHA 3GYNA 5HROB 2KZMA 1HPZB 4CLKA 1DAXA 2FHJA 1S48A 6AT1B 2QJ3A 2ZEJA 3E3XA 2AEFA 4ANDA 4USVA 3C66A 4GRSA 1UFWA 5A8RB 3QJPA 4USTA 2I6WA 1HBNA 3I4HX 3NLCA 4M5NA 1FWPA 3BN4A 4CO1A 5KG1A 3EGZA 5KFDA 1WWHA 2DTJA 2ACYA 2HS0A 1U49A 3SDEA 4WU2A 2YWKA 3ZNJ1 1F60B 5E3PA 4F4ZA 4YDXA 2COLA 2ZUGA 3AA8A 3CIMA 3MMAB 4LT6A 1I1GA 3HHDA 4B9VA 1HWKA 3CJQA 4KHRA 4ZOSA 2VKRA 5AJ3F 5I42A 1RT4A 4QOTA 2W4CA 5AT1B 3K58A 2DITA 4GVBB 4PG8A 4NYZA 2JC0A 4DR5J 1WHWA 1H2TZ 3RW7A 2KU7A 3IXQA 1E6YB 3SBMA 4ZN1A 2E1MC 2Z57B 4IDKB 4J9VA 4GVLA 4F3QA 4TVAB 1UCNA 2YY3A 2G0IA 2M2BA 1K47A 2RNEA 3AY0A 3D54A 4IOBA 3SQGA 4DZDA 2XCAA 1VJQA 3MUTP 4HACB 4GC7A 4DF4A 2V6AA 3JQJA 1IWGA 1U25A 3MD3A 4USIA 3TA0A 4DV2J 2CG4A 4NRUA 1PGZA 2HMIA 4ELTA 3BKTA 2Y8YA 4RNMA 2OAUA 3W3SA 2VDHA 2LEBA 2AD9A 4KHPF 2HZAA 3K2YA 1VQMS 1PG5B 5LL6d 4CLZA 3MM6B 5GMKa 3W9HA 2KM8B 3BSCA 4U95A 1S72S 5D6GA 1U0HB 5CXTA 1B4SA 2B9WA 4DU7A 4RO0A 5LMUJ 1SKRA 2HGLA 2VPYB 1MSWD 1X0PA 2PFDA 3M8SA 3W63A 3N6MA 4WKYA 3ZZRA 4FPIA 2P9GA 3SCJE 2PEHA 2HNDB 4YUDA 2AP6A 2OTLS 2RAQA 4E0DA 1VJWA 5KFEA 5HMZA 2YPZA 3ILJA 4H4OA 2V9WA 3H5UA 1XNRJ 4J7CA 4RBVA 4O3PA 2HFNA 3WDOA 3PYDA 3EICA 1KQSR 1L3VA 3KLGA 3OTCA 4ECUA 1UVKA 4DR4J 1JXVA 3R8YA 3PJ9A 3TANA 4A8KA 4ELUA 3DRRA 1TV6B 2CVIA 2PSZA 1VK8A 4WIQA 2AYEA 3NY0A 1G3OA 2BX6A 4LR8A 1O51A 4OI1A 4YR0A 2ZH8A 3MR6A 1HKAA 2ROPA 4MJKA 4ZP6A 4LFCJ 5CZVA 3J80Y 3HJVA 4LRCA 2ZDOA 2FZGB 2YWEA 3GCXP 3OFFA 4RL1A 3PV8A 1AA1B 4B9MA 5HATA 1HW9A 2IAJA 3W62A 4ZLJA 2X7IA 2XNRA 4DUYJ 4M5JA 3V5RA 4EUVA 4DR1F 2GMHA 3DRYA 4F2RA 1J2VA 1NDLA 1UJ4A 1RWMB 1SUQB 3G82B 4YY3J 4B3MJ 1D9DA 3A4TA 1V3SA 2QA2A 1U8WA 2VFRA 4Q7AA 3TVKA 1VQKS 4P75A 2VBWA 5GMDA 1QAXA 1XBWA 2LA4A 4XAKA 2IBKA 1MWQA 1KR4A 1R6YA 3JTNA 5ETQA 4YR2A 2BJEA 2Z56B 4Y3CA 2BDPA 3G6XA 1S1TB 2BE9B 2AEMA 2FZKB 4NYOA 2CWXA 3C2PA 2DR7A 2HMIB 3C14B 2RB7A 4ZVRB 4N7TA 3ZTSA 4A48A 3OL9A 2AMCB 1B7YB 3C3LA 5LSRA 2BQUA 3BB5A 3UN3A 2NPIA 3BO2A 3GYXB 1A0OB 4OV1A 1IKVB 1WKKA 2JEGA 4JP8A 2H1YA 3OFEA 4PWDA 2JEJA 3T5KA 4CLSA 4TYBA 3JQMA 4O44A 5E7OB 2HLTA 2W2MP 4JI0F 2IM1A 4P2FA 2KXNB 2X3GA 2Z2MA 5E33A 1IKXB 1DURA 4CLFA 2VUGA 1GFWB 1DLOB 1SVDA 4P71A 1X4CA 3S1TA 1RT4B 5CQGA 4Q2LA 4LQ3A 5JVGQ 1EAYC 1SJFA 1DRZA 2LQ9A 1RAHB 2ZC4A 3NKYA 1Q82T 1S0MA 4QIGA 1UZHA 1ZS6A 3KUHA 2BANB 1HWIA 2BJDA 2MSSA 3S01A 4I6YA 3EXCX 1V5VA 3MM5B 3SQGB 3M9OB 4DN9A 3JTOA 1IXKA 2AZ3A 2NREA 2R4FA 5RUBA 2L9DA 2JLFA 5B09A 1RT7A 3TZXA 2CPFA 4RUHA 1WORA 2UV8A 3NS6A 1SL0A 1WTFA 4HDHA 5K8NA 5GAGI 3PEJA 3NCRA 4X66J 1UWBB 4ZVEA 7FD1A 4LRFA 4WJBA 2CPJA 2IA0A 3U1LA 4Y34A 4KJIA 2CZ4A 2DHHA 3RBDA 3I5BA 4USMA 2FC9A 3CDAA 2HHHJ 3CJ4A 1HNWF 1VMBA 3MAAB 3OR2A 4UOHA 4WYLA 3BGRB 2L48A 4NX9A 4QWCA 4OHYA 1NO8A 1LWFA 3A3OB 5ADZA 2GMJA 2MDAA 2OELA 2LLZA 1NBEB 2ZWOA 1PKUA 1NSQA 1GMVA 1RHJB 3R6GB 3M9NB 2QLXA 5DQGA 2Z2ZA 2KG1A 2VJVA 2E5LJ 1ZH5A 1HW8A 1UPPA 2J7KA 2MSTA 2V0NA 3G86A 4G65A 4KBIA 4NLUA 4URGA 3MFIA 2E1AA 2EK6A 1UA0A 1KN6A 3EGWB 1SJ4P 1NEEA 3K57A 4J9KA 1VQ5S 3IGVA 1RXOB 1YJWS 3RAMA 1IQZA 1M90T 1RDRA 2RS8A 1AXQA 4ZPDA 2F8HA 2J6UA 3BPDA 3CC2S 1U45A 2MYFA 2HW3A 3BM7A 1SJ1A 3BGLA 2VG7A 5SZTA 3BEGB 3NNCA 4MK7A 3MMCB 3CUNA 3BQ0A 1DQ9A 2JOQA 3A8IA 4NMXA 4ZVFA 2YQ1A 3AQPA 3VCDA 3MEDA 5I3UA 1SQFA 2BE2B 1RAAB 2GJ2A 4QYZK 1XQIA 3J7AN 4ZA1A 3AHPA 1S59A 1NB7A 1Z2LA 1M5SA 1R0BG 1JLFA 3AT1B 5B0GA 3D2WA 1I6JA 2FVPA 3PYGA 4W92B 1VR6A 1BQXA 4PXEA 5D3GB 4F8RA 2QSFA 3V6DA 2GO8A 2R8KA 1UVJA 1FDDA 4JYAJ 3GTYX 3AD7C 4U96A 1U1KA 2PA3A 3BKFA 5DO2A 3N28A 3C16B 3L95X 4O4GB 4EI2A 1FNOA 3GIMA 2ZKUA 2CPEA 4K4ZA 2D3OR 4OZ3A 2FHJD 2HIYA 4UTGA 4WP3A 1FERA 3T19A 5J2PA 1NK4A 2J76E 4PQUA 2YXLA 1FT8A 4CH7A 4OZ5A 4I68A 3K0JA 2M88A 2YNGB 3V6JA 1S57A 4FNHA 3I5CA 4ED5A 1L5UA 1FKOA 1KQGB 2NXUA 2ZBQA 5KFUA 4L76A 1KD1T 1KLNA 4F2SA 4RZRA 3VHQA 3MAHA 2FJXA 2NUUG 3KJFB 3M8YA 4F04B 2CPDA 3FZ2A 3EYZA 4OJHA 1FDBA 5DRKA 2UZAA 1M1KT 5GAEI 2BJ9A 4O44B 3P4UB 4I2PB 1R8AA 4WFZA 4N47A 4DFMA 1D9FA 2UV8G 3HDSA 5KFXA 3I56S 4LFBJ 1AZSA 1VRUA 2IM2A 1Q79A 3M8QB 4QJVA 3SMZA 5THWA 4CT9A 3HKZD 1U1QA 1FX4A 1TQLA 4LSNB 4O3QA 2QN6B 3UCGA 2NQPA 5KFYA 2HQ3A 1S9EB 3ISNC 3KYLA 4LRBA 4NYPA 4P74A 1ZM4A 5B0BA 3I0SB 4EYHB 3DLKA 1DQAA 4LF7F 4JI2J 3GJTB 5C2GA 3Q8SB 2HURA 5G0RA 3PR4A 4O23A 2M52A 5HQMA 2CG8A 5KFHA 1WACA 1QY7A 3R2DJ 2WONA 3GCWP 2VQEJ 2ZM6J 4H4MA 3FBCA 4FDFA 3AB4B 4UZCA 2CQ1A 2VG7B 3LAKA 3ZO7A 4JI1F 2YNIA 3KHGA 3QGPA 3PKMA 3NOCA 3KG1A 5KG0A 2JZ5A 1UPMB 2DNQA 1EZZB 2QIFA 1HWJA 4I7FA 4DPOA 4LMZA 1ZM2A 4L6V3 2OHDA 4U8YA 4KGMA 3ZTOA 2B43A 2XULA 4PEOA 2DD8S 2DNZA 1S6UA 3D6MB 2K3IA 4MT1A 3SQOP 3G4SS 2DR5A 2KDOA 4GC6A 4CLTA 3HVWA 3HSGA 3NBPA 1HA1A 2WW8A 1K73T 2UU9F 2XO6A 4MK8A 4NOHA 2POKA 2ASYA 2BKPA 2ZH2A 4USUA 2EBGA 4C11A 1DARA 1YK9A 1LK7A 4IFVA 4M5DA 4QW8A 5KFCA 1GXUA 2I9SA 1K44A 1G6BA 3K7RA 1OQ3A 1IR2A 1RSCA 2F1FA 4L75A 3QQCD 5F3TA 2F9JA 3GFXA 5EDWA 4X4SA 1RYSA 2DRBA 4K50A 2ZHOA 2R9LA 1HYSB 3OJSA 2V2QA 3NWGA 4NLRA 2RKIA 4TXSA 3OTOF 1FRIA 3KDOA 3KTQA 4GO7X 3PO4A 3HT3A 3CDWA 3AJ1A 5EHHA 1AROP 3U27A 1TL1B 1OSCA 3M32B 5KT5A 2FZCB 3R5GA 1QE1B 1C4CA 1FRLA 2FHKA 5C25B 3HHLC 2Y1JA 1OPZA 5E5NA 3KK2B 1VLOA 1WC1A 2J7UA 5DDOC 1X4HA 4FF1A 5F8NA 1CJVB 4AXJA 3MMCA 2Q3PA 3W7BA 2RQMA 1ZPWX 2BKOA 3CJ8A 4P7VA 3TVYA 1QM9A 1M5PC 2B5JA 1NDKA 1S4EA 2HQDA 3UNGC 1JLQA 3UD4P 3FBEA 1RHUB 3AJDA 4F4KA 2N82B 3Q22A 4OIXA 2NXEA 3MPVA 4M1KA 1AYEA 3LWLA 3GB0A 3QSIA 4X66F 1KVKA 1D8ZA 1KFSA 2ASLA 4DI6A 5LMNJ 4ZJLA 3W64A 1IKWB 3THVA 5KT6A 1RWPB 1VQLS 1S76D 3OBIA 5F3ZA 3LANA 4FXDA 1N52B 1NNDA 1VRTB 4E8UA 1A6LA 3EGNA 3NP5A 3DDNA 1YG0A 4N8OA 2AV5A 2LFVA 3L3CA 3D66A 3P49B 3PJWA 1RWNB 2V5HG 1EP4B 4ILRA 2V4RA 4U9RA 3RB6A 3MM7B 3TYTA 2NSCA 1KVJA 4QR2A 3CC4S 3K5PA 4ZCMA 1X5SA 1CULB 4R8UB 2DY9A 1DTQA 1X4FA 2OI2A 1F5AA 1NH7A 2PIIA 1HNIA 1RWKB 2EXUA 2J8SA 4KB7A 3UI3A 3T1YF 1JLGA 2P2CB 1PC4A 2Y1LB 3MUMP 2W9CA 2J9EA 2F4FA 2VC0A 4DR7J 3L7PA 2UXCF 4C11B 3MCSA 2FGOA 2OEKA 4Y0FA 3V2UC 1YJ7A 5LJ3Y 4NMLA 5HO4A 1U26A 4I2PA 1YZ7A 3J7YI 1X9SA 2FJWA 1S1VA 1FRXA 3MR2A 2R7QA 2XMJA 3J7Z5 1S7IA 3OTBA 2C2OB 4C97A 5IV3A 5HP1B 2ZOMA 1G7CB 2W9BB 4GKKJ 2CRLA 3EZ5A 2Z58B 1J5OA 2IVMA 3ZZYA 2EI5A 3PG9A 3ZTQA 1MROB 1JLEA 1RAFB 1TTHB 3I9V9 3VR1A 3DLEA 5GAGU 2XLJA 3HHKA 1FK9B 3NAHA 2CQGA 5ETOA 4QW9A 2W9AA 1FI4A 3GZ7A 3ZZ0A 1DZ5A 1HHSA 2QX0A 2QT7A 3OV7A 3FEXB 1BUXA 4KGXB 2KG0A 1LV5A 2GO9A 5EUHA 4WXOA 2B51A 3CJ2A 4ECWA 4N41A 4CO3A 4LBIA 4LUBA 4ZVUB 1T02A 4YQWA 1EETA 1X4BA 2KVQE 3Q2TC 1RTIA 1MMDA 2DT9A 2HQIA 1N5VA 2LU1A 3DGVA 2CJXB 2QC3A 3QIPB 3GPAA 4WE1B 2MHNA 3HFKA 2NR0A 3FSXA 4NEZA 4I6WA 3TWZA 3QZ8A 2PFFB 4DPUA 3F44A 1EX8A 2DGTA 2R8IA 1JXLA 1IR1A 4NLGA 1HIYA 3OHBA 2Y3YA 1SH0A 1H98A 1XN9A 4PXDA 1OPIA 4O3OA 1Q53A 5KFSA 2MKJA 4Q45A 1JLCB 2OD6A 4YEAA 3LGMA 1C4AA 2DHGA 5CD4H 3G87A 2VQFF 3M8WA 1JLBB 3NG8A 2XHWA 2ROEA 1T3OA 1S9GB 1Y5IB 2AJ2A 3Q8VA 3DOLB 3QGHA 4NLPA 1SI9A 2L9NA 3H4DA 4K4WA 1HNIB 2LYVA 2MTLA 1RK8A 1XMOJ 1JLGB 1BWVA 1O6XA 5AJ3J 3AD9C 2VV5A 3MWBA 2Y1IA 1NM2A 1YIJS 1U8SA 3GIRA 4BDPA 4O3SA 3LA0A 4U8VA 1AT1B 4DS4A 5IT9Y 4Y2IA 1QE1A 5HI7A 1QJHA 3PYFA 4PWDB 1XIQA 3Q8QB 2ZBPA 2GGPA 3I32A 5KFVA 1X31C 3DHXA 5EWFA 1VS3A 3GV5B 4LF5J 4DZ6A 1NPKA 3H98A 4NLOA 3NGTA 4D3GA 1F3FA 4J9RA 5IC4B 5HLFB 2EVZA 2RSQA 1SC3B 4USJC 1P9QC 1C2PA 4ZVOB 3CEDA 2AGPA 1AB8A 3CSKA 1UFKA 3H59A 1VBZA 3MPUB 4FF3A 1ULRA 2MQLA 2VBZA 3NRBA 5CH7B 1IKWA 1IKYA 2H51B 2KXFA 2VU5A 2C3PA 1KOOA 4ID5B 3UFCX 3RG6A 1FRJA 1TKDA 5D0HA 2E29A 2GFFA 2RILA 4U6PA 5EWEA 3CCRS 2YQ0A 3JSRA 3LALA 1WDDA 3DLHA 3W2VA 2E7XA 3WC2A 2NUHA 3AFGA 4ITSA 5J1NA 4ZK7M 1SV5B 3QSYB 4LF4F 1P1TA 1DTTA 5HJYA 3R5BA 4UQGA 1Y10A 2C1EB 4OJ1A 4EBCA 4CO0A 2YX4A 4KH1B 1CVJA 3KWMA 3DXSX 3MEGA 1N33J 1FHTA 3OR2B 5ETKA 2DHXA 1R43A 4F50A 1WC3A 5L38A 3QT7A 5D77A 5J2MA 2UVVA 1N8RT 3KJVA 4HT5A 2F65A 1SPBP 4IG0A 4EEYA 3P8BB 1TL3A 1ZA1B 3UDLA 5K20B 1YBAA 2P9CA 2PI4A 4ILMA 2RVJA 3R9LA 4OI2A 4Y28C 4NA2A 1XJWB 2WOMA 5IC6B 5GAHU 2GCFA 4K0KJ 1P27B 1WKLA 1T7PA 3HVTA 1H73A 4BLGA 4Z2XA 1WC5A 4RPFA 2PEBA 1VBKA 2G2ZA 5LM7E 5CAAA 3FCVA 5LXYA 3LP1A 3MM9A 3ADAC 4IKAA 1X5OA 4QIFA 4DUYF 2XWYA 3N79A 2XQCA 4J9LA 1RT6A 1HFEL 1MU2A 3KJQB 3HCXA 2RHSB 1REVA 4FYDA 3MCOA 4Z7CA 5AXNA 3OL8A 4HH1A 3U02A 1FRHA 1YBTA 2MZTA 3QWPA 4OZ2A 3RR8A 1YJTA 2RD5C 1S5ZA 2QO3A 1Q8BA 2XHCA 3AQOA 4M8LA 3SSRA 4DFKA 4P2XA 2RRBA 1X9MA 3OL7A 2KO1A 2N7YA 5F0WA 4BWJA 1RTIB 2GJFA 2LQBA 5KFPA 4GVBA 2MGZA 2DH9A 1T9XA 5A2QU 2WAQD 3A8JA 1RB0A 3JSBA 2UUCF 1E6YA 1ZZNA 1NJIT 1O0PA 1M5KC 3IG1B 3ETOA 4DSFA 4DL7A 3UDCA 3DLGA 2DIVA 1LKZA 1GXLA 1RTZA 3HK2A 3TJAA 3TVZA 4DR7F 2EFOA 1VC5A 3IN5A 4LF2A 4FKYA 1Y00A 4B3MF 1HWLA 1RHRB 1SBRA 3KNGA 5E41A 3DLLQ 4WTYA 1KVIA 5ETMA 3W9IA 3DOKA 1XWLA 3R7NB 2WVFA 2AGQA 4GKKF 1GTHA 2HVEA 5JVHQ 2EC0A 3RRGA 1IJEB 2G0JA 2XG8A 2YKMB 3G6VA 3T1HF 3QT6A 1EKRA 1TVRA 1CG2A 1GX5A 2P6TA 4D3HA 4OX7A 1Y4ZB 1NU4A 1Q4RA 3LO3A 5JJBA 3GV8B 1KP6A 3L7OA 3S8SA 2M8DB 3NWRA 2YWWA 2ZZMA 1M0SA 3N4WA 3KNAA 2R7XA 4HT7A 1L3UA 3AB2B 1R8HA 1IWAA 1UP1A 2ZH9A 4AL7A 4RR5A 4JI6J 2KYXA 1MWZA 4IQXA 4NE9C 4DSLA 5HJXA 1NLKL 2FLNA 3JB9k 2F8MA 1U6FA 2HS4A 3H7HB 3HHLA 4C0HA 1GMWD 1RAJA 2DRDA 4RW4B 1K1SA 4KV8A 3TZZA 4ER8A 1H38A 1RWWB 2YNIB 3P5BP 1J5EJ 3QBCA 1K0VA 3POTA 2V68A 3UD3P 1KRPA 2WSFC 3SCLE 5AE1A 1E6VB 2M5YA 3BBCA 3RU0A 2HHXA 1JNZB 3OW2R 1TL4A 2DGUA 2C2DA 1QTMA 1X0FA 1CJTB 3M30B 2ZH5A 5B0DA 4J9PA 1XC9A 4IOAQ 5IQ6A 2QL7B 1I94J 3G8QA 1SL1A 1OYDA 1RP5A 4PYAA 4DX5A 1UEVA 3CB4A 4A8WA 1RT5A 4OX8A 4MKBA 5MLCV 2CFXA 3IAS9 2C3YA 3N0VA 3NGKA 2BE7D 1GQEA 3BSAA 4K8RA 4DCJB 4HR2A 3MCNA 2UVWA 3PIPQ 2UUBJ 1TL3B 3VAKA 3DRPB 1PJ7A 4DOZA 2V4QA 3KHRA 1MN9A 1RT1B 2IYIA 2MZJA 3RZAA 4F02A 3K5LA 2YNFA 3AOCA 4CH1A 2CQ3A 1XMBA 2HHHF 3PX0A 1UEUA 3GONA 4ATNA 1NPRA 4B3OA 3MM9B 3ZZOA 2Z4PA 3UQSA 2L41A 3B4MA 3M32A 3BN7A 4M94A 3QO9B 3BDEA 4XPEA 2BJ3A 1RADB 5ETPA 2OSRA 4Q2MA 1NHUA 3GG0A 5LXRA 3QJLA 5A8WA 2Q6BA 3CCZA 4A8QA 4DL6A 1Z1ZA 2RQ4A 4JYAF 5H9FK 2ADBA 3K5OA 3V6KA 5GADU 1QAJA 4NZ7A 1U24A 3M2RB 4Q8FA 2FQQB 2V8GA 1T95A 3BS9A 3MF5A 4LFAJ 1HNXF 2VIHA 1M5HA 4IFYB 2AZ1A 4AUKA 2C28A 3NL0A 2NS1B 4DDFA 1JB0C 2DNGA 2Q6CA 2C2EA 1SC6A 2JDJA 4ED3A 3D6TB 4C3LA 2J9DA 2QYGA 3R7BB 4FYWB 2DVIA 2FLLA 4JBCA 3IG1A 4KV8B 5IS2A 2QLFB 2X51A 1JLAB 1JKHA 2WK4A 3MEEB 4QZVB 4DUZF 4UT4A 4DPXA 1NK5A 4IH6A 1IBLJ 2ATCB 3BGUA 1FWLA 2C2KB 1IR0A 1CJTA 3UWTA 1SIZA 5B0CA 4XPCA 4LR7A 2ZE2A 4JI5J 1R0CB 4KFBA 1W7WA 3WIUA 2XS7A 1N32F 2C2ZB 2RDIA 2ZBIA 5EX3A 2APOA 1T94A
chains in the Genus database with same CATH topology
3VAGA 2XY5A 2BXJA 4PPDA 2DNHA 2ZH6A 3D1QA 4ZPCA 4ECZA 2C3MA 1UWBA 2B9YA 1IBMF 2PD1A 2J0SD 2ZH3A 1UKUA 5IQQA 4RBTA 1S0OA 4RW8B 3Q24A 4ZKAA 2GIRA 2OPRB 4IUFA 2MZSA 4DV5F 1MROA 3HLUA 3T1AA 3CPWR 3LUYA 3DFEA 2XI3A 3DLEB 5F8IA 3FRYA 1D0EA 3MM8B 2VA3A 3A8EA 3V81B 4BS2A 2CKWA 2HWTA 5C24B 5L1LA 1ZPVA 3WZ0A 1S9FA 1NKBA 3SEOA 4EYIB 4IRKA 3PW2A 3KFWX 1GAOA 1S4FA 1D9AA 3VQSA 5F9LA 4C8NA 4DR2F 3RB4A 3E2EA 4OLOA 5K8MA 2ZFHA 1WHYA 1LQ9A 2FJBB 4YB6A 2R7UA 3M30A 3VZHA 2ZM6F 3QAEA 2CIMA 1X4AA 3RRHA 1O5JA 2W7PA 3SDEB 3K5MA 3MOJB 1RT5B 1J5EF 1N0UA 2QA1A 4A8SA 4QQBA 1TK8A 5J2QA 4RW7A 3HZGA 2VFTA 3C6TB 5M2RA 3DRPA 3DYAA 3GSDA 2N3LA 2O66A 2ZH4A 2VKZG 4ZHRA 3I55S 2HGNA 2YNHB 3CCUS 1R0AA 3RAQA 1LFWA 4RNFA 3DOLA 3CGIA 2DCUB 1HARA 5K14B 2D9PA 4BC9A 4BCAA 4DG1A 3KMQA 4HI2A 1ZM9A 3J81Y 1TAUA 4GO5X 5KFLA 3CCMS 5KFJA 1FKAF 4FZVA 1NHVA 5AXLA 4LQ9A 2E5JA 5CYMA 3X1LB 1U2RA 2C42A 2AJQA 3N9UC 3LF0A 3WX4A 1RKJA 2WSCC 2H5EA 4OI6A 3H5XA 1QVFR 3US5A 3CIZA 2M3DA 4BBYA 3CCTA 4K59A 1RTHB 3ITHB 5IZHA 5DLGA 1X9WA 2MPUA 3MTKA 4DLGA 2Y0SD 3I96A 2BABA 2OPQA 4YB1P 4USHA 3C8YA 1N54B 4LFAF 1XERA 1S6QA 5CZXA 2YKAA 4DL4A 2MHEA 2XC9A 3OQ2A 1S1UB 3FFIB 3VAIA 2MY7A 2FTRA 4DLEA 3IR5B 4WXWA 2UXBF 4XDDA 2V2KA 2RF2A 2VD3A 4FS2A 4DR5F 3RAXA 3MEGB 3FMBA 4HEA9 4HYKA 3HZEA 4MFBA 4CTAA 3C6UB 3THTA 1NK8A 1WI8A 2RJZA 3N5FA 2XMWA 2K7JA 3BSOA 2IMWP 4UY85 2DNNA 1ELOA 2W4PA 3MHYA 3ULHA 1NJYA 4DV2F 1YHQS 1D1UA 3Q8RB 4B3SF 2DRAA 4WF9Q 2E66A 3FZBA 2M4MA 4L3NA 3TX8A 4A46A 4C0BA 3TUJC 3HVTB 4FP9A 5CCMA 5KT4A 3KLFB 5T7LA 4N76A 3GFHA 1N0VC 1WEXA 3IR7B 2HNZA 4KKOB 2KHCA 5LSOA 4J9OA 4ECQA 2CQPA 4ED0A 2HHTA 3RR7A 4A47A 3GIKA 3HM9A 4RNOA 2YWHA 2J0XA 2QLWA 3HF5A 4NLSA 1T05B 5CYJA 5MAOA 4JI8F 3CE8A 3HX9A 5DM7Q 1S79A 1RKIA 1LW2A 4PG6A 3GQCA 1XNQF 1Y3KA 4QU7A 5F0UA 4MTPA 2JVOA 2DPJA 5IT4A 1TKXB 3FSYA 5E0OA 3RB0A 2MQNA 3H40A 4J9NA 1T8EA 4C7QA 4TKTA 2O67A 4K4VA 2R2TA 2LA6A 1WEYA 3PFEA 1S77D 5FD1A 2CYYA 2OPQB 3CD5A 4G1QB 1BY9A 4OHVA 4FBUA 1UETA 1KEKA 3GIIA 1S1WB 1UVMA 4KGKA 2ZHAA 1C1CA 2HLUA 1C1BB 2HNYA 2YH0A 4LSLA 5J1PA 1U1PA 1S10A 2IC3B 1U48A 4URQU 3TNVA 3HVRA 5AE2A 1FJGF 3OJUA 1SL2A 1HWUA 1GH8A 5CYQB 3N6LA 3PR5B 1RI7A 2LCWA 2R7VA 2ZD1B 3FCHA 2ZH7A 4NLDA 2CQHA 3DRXA 1S0NA 4UUXA 3JSMA 3OXFA 2ZBCA 3M2UB 1TP7A 4DR3F 1YJUA 3B8HA 3T9NA 5KT2A 4MMOA 3U1NA 2GX8A 5KFRA 4I0WA 5DGBA 1XMOF 3THPA 1LW0A 1WF0A 2I38A 3KLEA 3O44A 4NLTA 2X1FA 1N6QA 1FKPA 3D1HA 2EFVA 4FN5A 4TU8A 1B0PA 1PSDA 3O3LA 3TAMB 3PY8A 2MZ1A 3MAQA 1T05A 4ZPWR 3FMWA 2OH2A 4C0OC 2PN6A 4H4KA 4K4YA 1BQNB 1KQFB 2G4BA 2R2RA 1E6VA 3KK3A 3X3UA 4B3RF 4BC7A 2DNKA 3SV4A 3HVAA 1TKXA 4RU2A 2KN4A 1WHVA 3SV3A 4ED8A 1X8DA 1G2EA 2VFVA 3VAJA 1R27B 2R2UA 3I9ZA 4C9DA 3OL6A 3V4MA 3TUIC 4ZLPA 2JSXA 2GC8A 1U4BA 2GQQA 4DL2A 1UL3A 2VG5B 4ZPTR 5G4DA 3MEDB 5HBMB 5I3UB 4NXNF 2CPIA 4KHMA 3D0HE 4PKDB 3UE2A 2YH1A 2N4CA 4R5PB 2XGQA 1RT1A 5I3PA 2D3UA 4PQAA 2PC6A 2J6SA 1RYRA 4Z37A 3DRSA 4JV2A 2V9KA 1BWEA 2GHWA 3DU5A 3TAQA 3HHEA 1HBMA 4RX6A 4FF4A 5LT5A 1KS2A 4YB5A 4DF8A 3OTEA 2N7CA 2IMOA 4IH5A 1CQMA 3V6DB 5HN0A 1WTBA 2BM1A 3E8OA 3F56A 2X1BA 1TFYA 2XMTA 2J9DE 3AJ2A 4ICLA 3GG1A 2VBXA 5I3QA 1JJ2R 1S97A 5GAHI 1Q86T 1HQUB 3O8WA 3ZZUA 4DBQA 2FC8A 5KFBA 4K4XA 2HHWA 5D4OA 1RT2A 1B0TA 2VBYA 1FESA 4TY8A 2AYBA 2K7KA 4MKYA 3RW6A 1TK5A 1IKYB 1GTEA 5E3CA 3TP2A 2KT2A 4PG7A 2XS5A 2EWHA 4Y2AA 5IXUA 3O5TB 1JKHB 3TAPA 1D3WA 3I0RA 3IC1A 1C1BA 4LFBF 2VOOA 2UUWA 4ZPAA 1VK3A 4OX6A 2OJ3A 2ZH1A 4LIRA 4KPYA 4KFBB 2KYZA 3KHHA 4O3NA 7FDRA 4JI2F 2ZC3A 3PEHA 3BO3A 2XI2A 3EUNA 1UW4A 2RU3A 2A10A 4EBDA 4Y2KA 3MR5A 1LXNA 1SUQA 2LMIA 4X4OA 1RT3A 4X2BA 1FD2A 2WOMB 4U67Q 4ZPVR 1OWXA 4J9QA 4AL6A 4M95A 2OPRA 4DS5A 2WRMA 4IFVB 4M5DB 2HNDA 3RRKA 3MFHA 3GFZA 1RT6B 3QLHA 3S6EA 3FQKA 1HQEA 4IR1A 5A2QY 4WZMA 4UUWA 3MR3A 3P6YC 4DSIA 3SFGA 2E5HA 4JOUA 4WKRA 1MWYA 1W2IA 3O1LA 3MEKA 4TU9A 3DRRB 3DHWC 4QWEA 2FLPA 1K0TA 1YJRA 4PXBA 2E7WA 3R5AA 3J7ZT 4HKQA 5LMNF 3PW5A 2MGZB 3TO8A 2AJ1A 2F40A 1N56A 3W2WA 2R7SA 1FVQA 1U7LA 4DV7F 2KRBA 3LP0A 4Q44A 3SSSA 5H9FJ 2IAJB 2WHOA 3DLGB 2KT5A 3GILA 3OUYA 2AW0A 3PX6A 3Q8PB 3TUZC 3QPIA 2XO7A 2K3KA 1QVGR 4F4XA 3P5TL 4B9UA 2Q43A 4KO0B 3UR3C 2FB0A 4CT8A 2WB4A 4B02A 4ZS6A 2IBOA 4QR1A 2KVIA 4C4WA 1KQKA 2LQ5A 1TVRB 3TARA 2LU2A 4ECYA 2D1CA 4JV5F 5C42B 4WZQA 3G96A 1MNEA 2XEXA 3GFYA 2GA7A 2DHSA 3OSNA 1MMLA 3PVXA 5A8KB 4AYBD 5EGYA 4ECRA 4LF5F 1BGXT 3P3DA 3HI9A 4ES1A 1QUPA 3ITHA 3NAIA 3H4BA 2RRNA 3DLJA 1VC6A 4BWMA 1LFPA 1R89A 1NJWA 3FSIA 3WBZA 1JX4A 3CDBA 1RT2B 1ZM3A 4TY8B 2OKQA 3SCKE 1BQMB 1PILA 1YSJA 2C3UA 1RJJA 3OR1A 5J2NB 3HP6A 2DGXA 2KM8C 3KMSA 3MUVP 1WF2A 1J5OB 4NA1A 4QYZJ 3B82A 3I87A 2GV1A 5FJ4A 2DNLA 2A2DA 3OFGA 2LKZA 5B0AA 4A8XA 4FVCA 2KFNA 4DEZA 1HNVA 4KRWA 3HHLD 3TOQA 5HMYA 1SJ3P 3BO4A 4K5SA 3CWJA 1B0VA 3MM5A 1UJ5A 3CT9A 4EGLA 1N33F 3BGFA 1NKEA 4NWBA 5AE3A 1KHVA 2LDIA 1WHXA 3LP0B 4HDGA 4I1TA 1NJZA 3MMAA 4YHHF 4IG3A 2ASJA 1H3DA 1HD0A 4C98A 4ZP7A 2A2CA 3OUYB 3PFOA 3DCAA 1RTDB 1HBUA 3E01B 1CC8A 5CA5A 3DNCA 4KTQA 4WE1A 1YVFA 2DHAA 2YKNA 3J7A1 2I5JB 5T7LB 3F73A 1AFIA 2CQ4A 4R0JA 4OLPA 1RA6A 1YITS 3PHEA 1LWFB 4FVMA 4O4GA 3E51A 3CCJS 4OZ1A 5KOWA 3NGDA 3KHLA 2BM0A 3BREA 1JLCA 1APSA 2A18A 3BQ2A 4DV4F 1KLMB 2YNFB 1HQEB 3SFUA 1VQ4S 1KNZA 2JWNA 3MZIA 4NZ6A 3IWLA 1FKOB 1V3ZA 1U6BA 4I64A 2Q79A 4HTIA 2I0XA 4K4SA 1FTCA 4ED6A 1C0UB 2EK1A 1HBNB 1NRKA 4X65F 2GGPB 4DV3F 4O0IA 1VRUB 2K8GA 3M8QA 4PCQA 2CQDA 1H6KX 4X64F 4DV6F 3SI8A 4OHZA 3TA1A 4G1QA 4DV0F 3HO1A 3FRZA 3JTPA 4P2SA 4IFYA 1TAQA 4K2XA 4DQPA 3CULA 5KFNA 3MEEA 5KG4A 2E5IA 3M6XA 1C1CB 4NCAA 5BYSA 2QV6A 3M05A 4LVOP 1QAIA 3PNIA 3DDKA 4F26A 2ZE2B 2UXDF 3ZC4A 2U1AA 2KB2A 2BUNA 1X5PA 1P6TA 5KG5A 5KG7A 1NK7A 3CCES 3LGNA 4OZJA 4YFUA 2JEIA 2E9TA 2W25A 5KG2A 5J1EA 4K0KF 4OHWA 2JL9A 1FRKA 1HBUB 3I5AA 1U47A 3QWUA 1OIAA 3M2UA 2ROGA 1WI6A 4X4VA 4C8MA 1PO6A 2W7OA 2JLGA 3MURP 3V6HA 4I56A 3KK1A 5KFZA 5IFMA 5A0YB 5ITHA 1U2FA 2Z0GA 3HHNB 1HL6A 2V8DA 1CSJA 2VL1A 1K9MT 4CNYA 4AXIA 3V81A 4RW8A 4KC5A 1KLMA 1RGVA 2MQQA 1ZTTA 3NMRA 5DDRC 1TZ0A 4O4RA 4RWWA 4QR0A 5KFAA 4A8OA 3OLAA 1UVNA 3QIDA 2J8AA 2ZJQQ 4Y2MA 4ZDNA 3OVBA 3MM8A 2WONB 1O8BA 2DNPA 4NCGB 3BSNA 1VLYA 3CJ0A 3IBWA 4G1IA 1C0UA 4HH0A 2QMXA 2CPYA 2DNYA 3UPFA 2HHUA 1QSLA 3PIOQ 3RTVA 2CQBA 2M7SA 2QA4S 4XO0A 1NKCA 4C8YA 5HQ8A 2FVSA 2V8HA 4K4TA 6FD1A 4YR3A 3Q23A 2VG6A 3NBPB 4JV0A 4QBUA 1SJQA 4X4NA 1Q8LA 3BQ1A 4LJMA 3EPIA 3OVSA 4EO8A 1VGYA 1HBMB 4DG1B 3KG0A 4WYWA 2W8LA 4DWIA 1S6OA 5IM0A 3M1VB 4QWAA 2K1RB 4OQJA 5L39A 2YNHA 5KT7A 5CYMB 4X4QA 4CI0B 1LOUA 2AJFE 1DJ0A 2EFPA 2FLOA 3FNNA 2NYIA 3MPWA 4JV1A 4N8NA 5T41A 2OTJS 4HHJA 1UMJA 3KLIB 1RTDA 1U1MA 1Y5LB 3BGRA 2NZ4A 2HPUA 3O6QA 2A3JA 1FEEA 2RIJA 1YJ9S 1VQ6S 1C0TB 2CPXA 4H4KC 4WK1A 1S1VB 1D8YA 2DGQA 2QRRA 1PC5A 1Y9OA 1JJHA 4P6QA 4RU9A 4N5SA 3BR8A 5KFFA 4UQTA 3PW4A 4L72B 1JLEB 2FIUA 4ES2A 2HRUA 5FIIA 3ONQA 2F4VF 2YWGA 3M2VB 2C3OA 3QGIA 5U47A 2VA2A 2XMMA 3CD7A 4IQMA 1RA7A 1Q8IA 4C3KA 5GVQA 4ED1A 5H9EJ 5EN1A 1OSDA 1Z4UA 3MM7A 3B4DA 2XSJA 4J37A 2HIQA 2IJNA 3SSQA 2O5DA 5HMWA 4TQRA 5HMXA 2PA8D 3AAWB 4DL3A 1FDAA 4G3IA 1GT8A 2X1GA 3KLFA 1X4EA 3LAMA 4Q8