2FB0A

Crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
ANSMIRLNVFVRVNETNREKAIEAAKELTACSLKEEGCIAYDTFESSTRRDVFMICETWQNAEVLAAHEKTAHFAQYVGIIQELAEMKLEKFEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of conserved hypothetical protein from Bacteroides thetaiotaomicron VPI-5482 at 2.10 resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fb0A00
1KVIA 4Y2IA 1TZ0A 2N4CA 4OJGA 2HLUA 1AFJA 2IFXA 2KKHA 1GXUA 3KG1A 2LXFA 1S6UA 4Y2MA 4NL5A 2IYGA 2ASYA 2Q3PA 1Q53A 1P6TA 1XBWA 3IWLA 3KG0A 5B0CA 3CJKA 4DL0C 2AP6A 3TNVA 4HL9A 1SQEA 4U9RA 2BBEA 2L3MA 3K7RA 3MCSA 3DXSX 4OJ3A 2ZDPA 4FNIA 3QMQA 4YDXA 1CPZA 1ULRA 3MZIA 1Y3JA 2GFFA 2W4PA 2KYZA 1MWYA 5IXUA 2OAUA 1YJRA 2AJ1A 5T7LB 5B0BA 1FE0A 2FB0A 3E8OA 5F0UA 1LQ9A 4HH1A 3UDCA 5B0AA 1JK9B 2PGCA 2RU9A 1Y0HA 1X0PA 2AW0A 2N4DA 2XMJA 1OSDA 5B09A 2K7JA 2GCFA 4HI1A 4HH0A 5B0FA 1N5VA 1FESA 1X7VA 2PD1A 4EFAC 4OJHA 1Q8BA 1RJJA 4QOTA 3TOQA 4DPOA 4YEAA 4A47A 2N7YA 1WD6A 1OQ6A 2ACYA 4OIXA 1FVQA 1OQ3A 1W2IA 3BB5A 5T7LA 1Y3KA 1TR0A 1FVSA 1GXTA 2OFGX 2BYCA 4OJ1A 1K0VA 1TUVA 4HI2A 1URRA 5B08A 1CC7A 2K7KA 2ROEA 2LQBA 1YJVA 1YJTA 1JWWA 4Q2MA 3IWXA 4A4JA 2LDIA 2QIFA 2GO8A 3GZ7A 3F44A 2OFHX 1YRXA 1IUJA 2KT2A 5B0EA 2RSQA 1AFIA 3BF4A 3BR8A 2RILA 2BUNA 1FEEA 4A46A 4ZOSA 2OKQA 1KVJA 1U7LA 1TL4A 4A48A 2KT3A 1Q4RA 1P8GA 2BJDA 2G9OA 3HHLC 2W4CA 3HHLB 2AJ0A 1Y9OA 2JDJA 5A6PA 3BN7A 3LGMA 1MWZA 3FRYA 2EW9A 3BM7A 2ZDOA 3FMBA 1X8DA 1Q8LA 1FD8A 1N5TA 2OMOA 5B0DA 3LO3A 2VH7A 2W4DA 3KNGA 2OP5A 2OD4A 2ROGA 1SI9A 2GGPA 1S6OA 2GV1A 3KKFA 1OPZA 1YG0A 3FGVA 1SB6A 2CRLA 2FIUA 2HLTA 4NPOA 4Y2KA 1VQYA 3HHLD 3VTIA 4DN9A 3HHLA 2XMKA 2K1RB 3QGPA 1AW0A 3HDSA 2QLWA 2XMUA 2GGPB 2XMVA 5KAKA 2HQIA 2XMTA 4ZA1A 4F67A 2OD6A 4FNHA 1KQKA 2GA7A 3HF5A 1VQSA 2XMWA 2ROPA 2HFNA 1CC8A 4Q2LA 3TRGA 1N5SA 1R6YA 3BGUA 2K2PA 2FHMA 3WDOA 2LQ9A 2XMMA 3LGNA 1QUPA 2K1RA 1YJUA 1N5QA 2BJEA 1FE4A 2FTRA 3CJKB 2QYCA 3T9NA 1TL5A 3I9ZA 5A6WA 1V3ZA 1APSA 2VV5A 2HIQA 3HX9A 3BDEA 3HFKA 2QLXA 5F0WA 2IYIA 5B0GA 2RMLA 5K9FA 3DCAA 2HFOA
chains in the Genus database with same CATH superfamily
4K7QA 2KRRA 4KE5A 1NK8A 4DR4F 2W7OA 1AUSL 3HHKA 1XMOJ 1S1UB 3C66A 3W5XA 3W9IA 3FC9A 1I1GA 4RR5A 1X9MA 4TY8B 2ZH5A 4X4OA 4AYBD 3W8PA 5HI7A 4RUAA 1RTHB 3LP0B 2YQ0A 4MK7A 4KC5A 1RAGB 2B9YA 4R5PA 4JYAJ 3OV7A 4B08A 5KOXA 2SXLA 3W62A 3CC7S 3QT7A 1D9FA 1IJFB 1RCOB 3R27A 4NRUA 1U09A 2CZVC 1HMVB 4W4MA 1PILA 4FXDA 3IP0A 4DR7F 3FFIA 2HURA 2W2NP 4LRAA 4CO1A 3R2DJ 2DHGA 3BM7A 4CNYA 3FCHA 4UZBA 1UA0A 3U1LA 4P7TA 4JI1F 5FDLB 1Q7LB 3CGIA 5CCMA 2P2CB 2GGPB 2HZAA 2UUWA 3BH6B 3TRGA 1SJ3P 1XN9A 2WZ1A 2CQ0A 2F7VA 3LTOA 4OFZA 2YWHA 4LJMA 4JV1A 3S1TA 4OZ3A 2MB0B 2G1DA 1XMQJ 2FHJD 1XNQF 3HSZA 4G1IA 3KOAA 4ZIWA 5LJ3Y 1SJFA 3IAM9 3THTA 4B9NA 2E9ZA 4A8SA 3EVWA 3I32A 5F0UA 3KHGA 1R89A 1X0PA 1NDCA 2DCLA 1MG7A 2DHAA 4ZLNA 3N6LA 3ENAA 2JOQA 2GO9A 3M6WA 4C97A 2CQPA 3NNCA 4NE9C 4USIA 3P45B 5CAAA 3RW6A 4BHQA 4PXEA 4FF1A 3C6UB 3DLHA 1TKTA 4NRTA 2V4JA 1DY3A 4ZVTB 2VZ9A 4F8RA 4AL5A 4OI6A 1X4DA 4KTQA 4X65F 1HBMA 1UCNA 1ZM4A 3DMJB 3PJ9A 2C2KB 3GYXB 2J76E 4KO0B 2R7UA 1FJCA 4LRBA 1VQLS 5FD1A 4O3NA 3HHLD 2Q43A 2MQPA 4ES1A 3FEZA 4IQXA 4IUFA 2C28A 2E1MC 3R6LB 4YB1P 2XY7A 3KFWX 1Z4UA 5IT4A 3JSMA 1YLXA 3EDQB 3BBBA 4KHRA 3VVTA 1UVIA 1N52B 1RTZA 2ABYA 1RT7A 4BS2A 1K1QA 2WW8A 3PEJA 4JI4F 4ZVFA 1OIAA 1S9FA 1VJWA 2OTJS 4ATNA 2L41A 2HQGA 3PYFA 5K5MA 1S49A 1S7HA 1FA0A 4E2FB 4FYYB 1K1SA 1RT4A 2V8PA 5KT4A 5D15A 2IC3A 4PR6A 1SXLA 2E1AA 4YOEA 1GTHA 2KXHA 2X1GA 1Q4RA 3QT8A 3V4IB 4LFAF 3HHLB 2I9SA 1VRTA 2Z58B 3S01A 1BWEA 3S7RA 1RLDA 5F3ZA 3CCRS 1TL7A 5J2MB 3KHLA 1U02A 4DV3J 3DLGB 3AT1B 2J6UA 3IRWP 2Z56B 1EZZB 5KT7A 2GVZA 3B6BA 3MEEA 2ILZA 4B3OA 2MHNA 2XM3A 3C15B 4URQU 2FTRA 3FK4A 1ITPA 2BRKA 2QJ3A 3JQMA 1IKWA 4AFFA 5K9FA 1BWVA 2QA2A 1UJ4A 3OQ2A 5F8MA 3NNAA 4CTAB 3CJKA 5IC4B 5HBMB 5A8WB 2E5HA 1H98A 2WB4A 5EWGA 1A0OB 3GJQB 1FX2A 4UZCA 3TZYA 1ZAXA 4B9TA 2JX2A 4JOUA 2UZAA 4G1QA 4OJHA 3AAWB 3O2IA 3NP5A 5F9LA 3IC1A 4EYIB 3EVMA 5I3QA 4DN0A 1IM4A 4CYUB 3WZ0A 3DI6A 3R2CJ 2CJKA 3R5GA 1CULA 4A8QA 3AQOA 3NAIA 1RTDB 3V6KA 1HNIA 3CCQS 3MPVA 3P4UB 1MROB 2H3EB 4KHPF 2E29A 2JDJA 1U6BA 1AROP 3RJMB 3BBCA 4I7FA 1OPZA 1UVNA 1SPBP 1HR0F 2RDIA 1TFYA 2XMVA 3MAAA 1BQMA 1DQ8A 1T05B 3MPUB 4DPUA 5HQMA 1WG5A 1F9FA 1CSJA 2XLKA 2HFOA 2CG8A 2GJIA 4NEYA 1RXOB 3E2EA 2VJUA 4EUVA 2YKMB 3PHEA 2I6WA 1Q5YA 3WX8A 3VGTA 1FE0A 1F60B 4WWSA 1LXJA 1X0FA 3G9CA 1RT5B 2UVVA 4QOTA 2C42A 1VQ6S 5DGAA 2FY8A 2ZFHA 2X7IA 1NK9A 2KT5A 5JVHQ 4H54A 1S48A 3B54A 4CH1A 4B3MF 1LFWA 4I69A 1NXIA 2KI2A 3PX0A 2CIMA 2GV1A 4GKJJ 2CWKA 2B6AB 1YJ7A 3I0RA 1S4EA 3TEGA 3PW5A 3MM5A 2WOMA 5LJ5Y 2KM8C 3K59A 4DV4F 2GQQA 2DVIA 4LF6F 3EZ5A 3AB2B 3NGTA 1LKZA 1TKXB 1UJ6A 4WIQA 3CO0P 4UOCA 4GRSA 3UW1A 3NS5A 2J7UA 1R43A 5JJBA 4R25A 4RKUC 3CEDA 4ANDA 2XMJA 1WC3A 3SV3A 2DGUA 3SCLE 2H5JB 3R3TA 5IT9Y 3PV8A 3GSDA 4CRJA 2HHWA 1XNRF 2QSWA 1URRA 1J27A 3SIPB 2W8LA 2LQBA 2DITA 1YJVA 4ICLB 4TY9A 3N5BA 3O3LA 2IBKA 2YY3A 3SFGA 4TQSA 4DF8A 4IQMA 2KT3A 4F2SA 3IRXA 1JLAB 3CCZA 1YBUA 2VBXA 4O3PA 4AL6A 3M8SA 2VFUA 1M0SA 4DUTA 1OPIA 4YUDA 5IV3A 5DO2A 5DG9A 3HF5A 4ILLA 4MK8A 1CS4B 2M8DB 1WG1A 4M8LA 3KNAA 2HVEA 2YH0A 2G2OA 1F9HA 2DNGA 2NSBA 1GTEA 2QRRA 1APSA 2IHR1 1VQ9S 4P2SA 2D7SA 1M90T 2L9DA 4KFBA 2LMIA 2QTWA 3DXSX 2FLNA 2C1EB 4F0MA 1WJ9A 2QSFA 4QIWD 4A8WA 1U2FA 3OTBA 2KO1A 4K50A 3J81Y 4DV0F 3H90A 3ZTQA 4KV8A 3W2VA 1UFKA 4Z7YA 5D4LA 4K4YA 2J8SA 1WI6A 4Q2MA 5HJYA 3QRPA 4ITSA 5D4NA 3NEKA 2WAQD 1QY7A 2BRLA 1DTQB 1RWMB 3G82B 2VG7B 5A6PA 4FF3A 3DM2B 4QR1A 1JLGA 4KSEB 3KMQA 1VQ8S 1VDHA 4MYTA 4LF8J 2D3UA 4JI0F 1MLAA 2G13A 1SUQA 5CYMA 4WXOA 5LMUF 3P96A 3IG1A 1L3TA 2YNGB 4UOHA 3H2LA 1HBUA 4U7CA 1QAYA 2FVSA 5A8KB 3OLBA 1TZ0A 1T8EA 2GVDA 1SQFA 2CQIA 4AXJA 1D09B 2L9WA 2VD3A 2H1YA 1VQPS 2HHUA 2QN6B 1ZS6A 1VQOS 5CZXA 5ETMA 2RHQB 2B7BB 4GC7A 3P6YC 2QO3A 3CNQP 4Z2XA 1IVZA 3OHBA 2EC0A 3GFXA 2J7KA 1B7FA 4DMZA 1T9YA 2HKEA 2MKSA 4RW9B 4CO5A 4F4AA 5GAHI 1FNXH 2EWHA 1BLUA 1FXRA 3MM6A 3OSPA 2IJRA 3FMBA 2OPPB 4TLQA 4PQAA 3KJQB 4OZ5A 2RH3A 2RUGA 4NPOA 4KT0C 1RHRB 4S0MA 2APOA 2HQ3A 1N56A 3VAMA 3UD3P 1SIWB 3JTOA 1WKJA 2DNOA 1EX8A 1LWEB 5ETPA 3A8EA 4FBUA 1Q81T 3GILA 3BGLA 2V63A 1S6UA 4J9LA 3SMZA 1U49A 3TEHB 4ILRA 4C8LA 1RKJA 5LSRA 4WE1A 3CULA 4LFCJ 1FRJA 5H9FJ 5DDRC 3ZZTA 5KFVA 3PY8A 3ENWA 1HI1A 2MLZA 2O01C 2A0FB 1YI2S 4RZRA 2VFRA 2F8MA 2V2KA 5HSPA 1F0XA 2CVEA 2L48A 2BJ9A 3P5BP 1YJTA 4J5OA 2I5JA 4NLOA 4RW6B 3MTKA 3RZAA 3GB0A 1JJ2R 3GIRA 3FZBA 4K59A 1HBNA 5J2PA 3OR1B 3F0NA 2BW7A 1X4EA 3KK3B 1P8GA 2A18A 4J9RA 2AJFE 2BABA 1A7GE 1J5EJ 3PXGa 2ASJA 3QIDA 4JI8J 4JI6F 4K4VA 3G96A 1U2CA 1G7CB 5HJXA 3IGVA 4I6WA 1UZDA 3QLHB 2ZE2A 1L5UA 1NHKL 1PG5B 4C0OC 4WJBA 3CJQA 2GIFA 5E3CA 4DUZJ 2DCUB 3PG9A 2FQQB 4OYIA 2XO7A 1SIZA 4I2QB 5EN1A 2JLEA 2QX0A 2FJBB 5DGBA 2BEFA 2MXYA 5GADI 4JI5F 3I5AA 4O3OA 1X4BA 2RKIA 4TXSA 1FRXA 1QTNB 3I4HX 3QGHA 2EBGA 3FSIA 3J7YU 3CJSA 1QDUB 2YX4A 3HZGA 3I87A 3TYTA 1C1BA 4H4KC 2OEMA 3OR2A 3HT0A 1I3OB 1U1OA 2DY1A 3DHWC 2HBRB 3MECB 2FY1A 1S1XA 3HVTB 2BACA 1NHUA 2ZDOA 1HMVA 2IA0A 3JXOA 1Q5VA 2QYGA 2ZD1A 5HROB 4JV5F 3SSRA 1C0UB 2JLFA 4DL7A 3MR3A 3M8PA 4K5RA 2VA2A 4DL2A 2HNYB 3BGUA 5KFUA 4KH0B 5AXMA 2J6SA 2F1FA 3M2VB 4WFBQ 1ZA2B 2EI5A 2VICA 3MD3A 4QYRA 5HK4A 1SKSA 1P6TA 3W1YC 1BY9A 3VALA 2QV6A 2XG8A 2BOAA 4O0IA 2RB7A 4KGVB 5AT1B 2MQ8A 2F4VJ 1S1TA 1J5OA 3ETMA 1FFGB 4HHHA 3C16B 2WBMA 2HHVA 2DPIA 1DURA 2V2ZA 1R8HA 4HHUA 4F4KA 1AXQA 4RW7B 5EHHA 5EDWA 3UN5A 5D77A 3AHPA 5DS7A 3SQGA 2ZKTA 3RRHA 2HWIA 3IR7B 2OKQA 3BSAA 4NCBA 2XI3A 2LVWA 1JLFA 4F4WA 3WHIA 4RO0A 1FX4A 1UJ5A 1XR5A 2WONA 2HMIA 3MFIA 2C3PA 4Y2KA 4WYWA 2HBYB 4PUOB 4O4RA 2IJFA 2A3JA 4RBUA 4NLRA 3RAXA 2LU2A 4RNHA 3Q2SC 3M30A 1XMOF 3N6NA 4Z37A 2HIQA 3WX4A 5EX3A 2QLXA 2FHJA 2LU1A 2JEIA 1RWUA 1RTJB 4OHXA 2Q3PA 4NLSA 2XYHB 2YTCA 3CJRA 2RQCA 2HPUA 1WSVA 5EGYA 2XB2D 2CQBA 2MKIA 3GJSB 2V69A 4F04B 1U8SA 2JNJA 4JYAF 2MZRA 2AYMA 1UW9A 4RW4A 1QD1A 2PD1A 1IBLJ 3HT3A 2N3LA 1G3OA 2OH2A 1W2IA 1IKVB 1K0VA 2A6OA 4YHHJ 1KHVA 3DRYA 3Q83A 4UF4A 5ETRA 2CQ3A 4OYWA 3O8WA 4A8FA 1N0VC 4DPXA 2U1AA 1FEEA 4A8KA 4PEOA 1M5SA 4U96A 3J7A1 4JV2A 1NJZA 3EGZA 5G0RA 1D8YA 2B5JA 3GFYA 3MM8B 1D9AA 2OLWA 4C4WA 2H5EA 3HHLA 3NGDA 3KJVB 2MHEA 1XMQF 4TU7A 3CD5A 5F8JA 4MMOA 1ZM9A 1HWUA 3UFCX 2QLJB 3ZNJ1 3Q22A 5ETVA 3DLGA 3HULA 1TL5A 2DB1A 2HHSA 3N0VA 1JLEB 4YY3J 1WF2A 4CCHA 4ED2A 2DXFA 1C0TB 1GH8A 4PWDA 1FKPA 2E1RA 2LKZA 2RT3A 4NLVA 3PRBA 5K20B 3NKYA 2KM8B 2YPZA 3CD6S 1TAQA 3RB0A 3MM7A 1KVKA 5HBMA 5A8WA 4X4VA 2DGXA 3UWTA 4DUYJ 5CYQA 2NS1B 1JLCB 1IJEB 1Y3KA 1XC9A 2AX1A 1HHSA 3R5BA 1KRPA 5E3RA 2VB6A 3QAUA 4IH5A 5A8RB 3B82A 3G6YA 3VZHA 4EBEA 1FDDA 2OHDA 2AMCB 1TL4A 3AH6A 1B70B 2Z2YB 4YFUA 1QM9A 1XR7A 1RTDA 3LP1A 3OW2R 2EEYA 2MKKA 2DR5A 3KXDA 2KTQA 3F73A 4MIWA 2LLZA 4PPZA 4ID5A 1WNEA 5CYJA 2B43A 3DGPB 5EWEA 1FE4A 4DX6A 5A6WA 4ECXA 2ERRA 4C6AA 1TP7A 1FKOB 1T05A 2O66A 1VOMA 4EEYA 4GVBB 3GONA 1U1MA 2Z4PA 3H4DA 2PGCA 4MJKA 2KRBA 3SSSA 4ECQA 2FJEB 5AXLA 3H5YA 2FHKA 4A47A 2HRYA 3J80Y 4I0WA 4IG3B 4KKOA 1Q79A 3SXLA 4YN3B 4U7UK 1CC7A 5HAOA 5DZ7A 3ZZPA 1RT5A 5I3UB 3NL0A 3K5PA 2XZDB 1TELA 2YNIB 4QYZK 2JVOA 3Q8VA 3OFGA 1IBMJ 2C2NA 2G9OA 4IKAA 4DV3F 2GHWA 2AJ0A 4TYBA 2QEXS 2OMOA 4ZS6A 6FDRA 1RKIA 3ZZYA 2AQ4A 1RAJA 3ZTRA 4OX6A 4K4WA 4LF9J 1WORA 2B9XA 3D28A 4DSFA 2QL5B 1AW0A 3IS9A 4L3NA 3DOLA 2NZCA 3EPGA 1WI8A 4WK3A 2R7QA 2V8HA 5DETA 3N28A 3FQKA 1T9UA 5J1EA 5HVGA 3VAHA 3HFKA 2G1HA 3GU0A 4WU2A 2HQCA 3ZFVA 2M0GB 5DLGA 2ZNZA 4ZPWR 2AP6A 4OQJA 3IGNA 2OELA 3H2UB 3QZ8A 4PG6A 1Q82T 1YSJA 1Y0HA 3CCLS 4ED8A 1JXEA 4HH0A 4Q5VA 4L3KA 4FN5A 1S9EA 5KFJA 4A8OA 1NSPA 1Q86T 3O5TB 5C25B 4DU7A 2VODA 2N7CA 5HANA 4USMA 3GV5B 4ICLA 3J7AN 1YBTA 4AT1B 4LVOP 4MYUA 1RUSA 3M6XA 1JLAA 1O8BA 1CJUB 1WEYA 4DS5A 5ADZA 3THVA 2X3GA 2FJXA 1HNVB 5L46A 4RLEA 4M5DB 2XYPB 3IWNC 5CA5A 5E3QA 4DFPA 4NL5A 3D7SB 1JLQB 2DH9A 1CPZA 1MWYA 2J0WA 1RQ0A 1TFWA 3EICA 2YQ1A 3MWBA 1OSDA 4ZVUB 1RWXB 3DN9A 3MEGA 3R1HA 4ELUA 1O6XA 2V4QA 2E7VA 3MF5A 3ZZRA 4I1TA 3D68A 1JWWA 3PZPA 3PR4A 1Z2LA 3NRBA 3KLIB 1YRXA 3L95X 2Q6CA 4GKJF 4LF4J 1KQGB 2X1BA 1ZAVA 3C14B 1TVRA 3T3FA 3BYRA 2VFVA 3LWLA 3OUYA 1Y5NB 4URSA 4A8MP 3NS6A 3C6TA 2ZHAA 3G82A 2K1RB 2VG7A 4DXLA 2XS2A 3DM2A 4ZA1A 4QWBA 2YKNB 1MN7A 2K8GA 2CDRB 5GAGU 1N5QA 2XSJB 4OYOA 4GKKJ 3NOGA 5GMDA 3RU0A 1SH0A 5ETTA 3A3NB 4U95A 1HW9A 4IRKA 4F36A 2R8IA 4D3GA 2MGZB 1Q53A 2XQCA 1WKKA 3FUYA 3I6PA 2FHOB 4UOGA 2Y1JA 3Q8SB 3LP2B 2KFZA 5B09A 4ED6A 2E5IA 1H38A 4ES3A 1URNA 4OIXA 4CZCA 4FS1A 2R7RA 1R7IA 2ZOFA 3M2UB 3CCSS 1RHJB 3PTWA 4CO4A 2F8HA 3D6MB 1N48A 2R8JA 4FYDA 2HWHA 1U1LA 5GAEI 5LSLA 4RW9A 1E6VB 5FJ4A 1WTBA 2GX8A 1UL3A 3UDEA 5KFQA 2XNRA 3OXFA 1G2EA 3IR6B 2OPPA 2C2MB 4M5MA 3D1OA 1MMNA 2QMXA 1VMBA 5ETOA 1L3VA 3G71S 5B0GA 1OYDA 3KLVA 3DCAA 4DX5A 2IA6A 3HCXA 4A8XA 2BANA 4ILMA 4CO0A 4IFYA 1BHNA 3IM8A 3ISND 2D3O1 1LWEA 5D4PA 4CT9A 4CM2A 1D3WA 2JLGA 4KB7A 1S79A 3M1VA 3CE8A 3QWUA 4CQ1A 5LL6d 1SH2A 1DTTA 1FJGJ 4ZVEA 4DPOA 3KDNA 1FVQA 2DNQA 4IRCA 3DRPB 2PEBA 3W7BA 3AJDA 1K47A 4O4GA 4RU2A 3SEOA 4Z7CA 4ZHRA 1NSQA 2RS8A 3GG1A 2HHTA 1ZTWA 2A10A 2VIHA 2MQMA 1AZSB 2CPZA 4IRDA 4LF8F 2CPYA 2DIUA 3BR9A 2Q66A 2CUYA 2DGVA 1HI0P 2VH7A 1BE4A 1EB0A 3CMAS 2HGNA 3FGVA 3DFEA 3UN2A 5BR8J 5KFLA 3PO5A 2HFZA 1KR4A 1RWPB 2MTLA 1CJKB 1S9GB 5D0EA 5ETLA 2B9EA 1R6YA 4I67A 2W2OP 1OO0B 4IG0A 3NMAA 3ISZA 3QSYB 1IKYA 4ECZA 4IO1A 2OSRA 2BBEA 3SV4A 2RAQA 4YDXA 2FUG9 4OI0A 4X4NA 5C42B 4NX9A 2N4DA 3QJLA 1DBDA 4ZVOB 5B0FA 4DSKA 2IJNA 5T14A 1MMLA 1EETA 1HPZB 3H98A 4B9SA 1FTRA 1IKXA 1N4LA 4NLDA 5DM6Q 3T5LA 3D1HA 4O3RA 2RF2B 1UWBA 3PW7A 2FJAB 5KFHA 2DBBA 1S10A 3MECA 3RAQA 4DDFA 1VQYA 1Y11A 3MMBB 2XMUA 1UEKA 2DHSA 1JKHB 1A6LA 1XMBA 2OD6A 4FF2A 2ATLA 1X5PA 1HWJA 5KFOA 5IT0A 4V19X 4NEZA 2E9RX 3I0SB 4P7VA 3CJ3A 1HIYA 1NB2A 2VG5B 1UPMB 4LFCF 3QRRA 4BCAA 2HNYA 5D0RA 2MSTA 1NKBA 4P71A 1FHTA 2WSFC 1QSLA 3M2VA 3K7RA 3P8BB 2C2OB 1B0VA 1EKRA 3LQVA 1M5PC 3BO3A 3EDRB 5FIIA 1M1KT 4YS2A 1IQTA 1DLOA 1YZ7A 4FKYA 3E51A 3AFGA 1K0TA 1NK6A 4W90B 1T03B 2EKNA 4N41A 2EBEA 2ZJQQ 1J5EF 4TKTA 1KHWA 4JI8F 2C3YA 1P27B 2ZH3A 5M2UA 4Q8FA 2BXJA 3NWRA 1H2UX 1I51B 1NJXA 2ZZMA 2HRTA 2G0IA 3BYPA 1VC6A 2QLWA 3BSCA 2XMAA 2HQDA 2VL1A 2MDAA 2YNFA 4DUZF 2FVRA 5HQ8A 1JQGA 3GIMA 3CCMS 2Z2ZA 5J2NB 2VPZB 3I9ZA 1VR6A 1WSRA 1RAAB 3A1YG 4Q0BA 2IVFB 2JHEA 3E01B 1LK7A 2PI5A 3TARA 2POKA 4ECSA 1RWNB 3H42A 2AJ1A 4DQPA 1Z2ZA 1RTJA 4F3MA 3CT9A 3H8YA 3EXYA 1H72C 1HYSB 4N8OA 4NLGA 4DV1J 2J7WA 3W66A 1WDDA 1S1VB 1TUVA 3N5FA 2DH7A 1T9XA 4J9NA 4J90A 2HS0A 1NH7A 2FGOA 2VDIA 3NBPB 2NZ4A 4EGLA 2HVDA 4PQUA 3MMAA 3M8ZA 2N82B 3DRRB 2W9BB 3RBXA 1QE1A 3KLFB 3CJTA 3LO3A 4Y2CA 3A12A 4NXMJ 2YKQA 3NS7B 3CCVS 2GA7A 4WZMA 2PDAA 3JYTB 1LFPA 1N5SA 3K5NA 2OPQB 1HQUB 1VC5A 3DU5A 5HL7Q 2LQ8A 3AA8A 3KJVA 5DQIA 1RT2A 4BLGA 2QMWA 5F8HA 2EFVA 1T9WA 2CZ9A 3T41A 2GIRA 3DDIA 4TU8A 2HIYA 2CNKB 4OJ3A 3MM9B 1JLEA 2JJ4D 3ISNC 4NLUA 2UXBJ 5KFKA 2HYIB 1ZTTA 3D3CJ 3Q2TC 3M32B 3MR6A 5D8HB 5DZ6A 3VAKA 1BGXT 3K5LA 4IOCQ 2HGMA 4M1KA 2FZGB 2DNKA 3K8WA 2HS3A 1EP4A 2D9PA 4DQRA 2XNQA 2AGPA 5GVQA 2Z2LA 2A2CA 2CKWA 2E5GA 2DD8S 2Y8YA 4RUBA 2XYGB 2LA4A 5A8RA 1X4HA 4CH7A 1KC8T 3QPIA 4CLWA 1KONA 2LA6A 4WFXA 5IZHA 4QCLA 2IMOA 2DKOB 1YIJS 2BW2A 3M6VA 4YQWA 1NDPA 3A3OB 3KLGB 4P2MA 1GNKA 4AQYJ 4JUZA 2MSSA 1O51A 3G6ES 2HGLA 3HFZB 4C8KA 2B3TB 4ECUA 3DGPA 4NZ6A 4DR1J 3RB6A 3BKTA 9RUBA 2QL7B 4I64A 1IBLF 2NYHA 1WELA 3OBIA 5A76A 4C7QA 3QIPA 1UVKA 3J81j 2DNLA 2HFVA 2E7XA 4YHHF 2ADCA 2W7AA 2C2RA 2M8HA 4EBDA 3C3LA 5D0GA 2MKCA 4GVBA 4B02A 2BJ8A 2DRDA 3I55S 4EZ6A 2XSFA 3KK2A 2YX1A 1A9NB 4DR5J 5IQQA 4ZOSA 4ZMMA 2Y0BB 2PE8A 1NJYA 5JUMA 2DRBA 3H20A 4LRCA 3HJFA 5I3UA 2X3DA 1U26A 5KFZA 4DLEA 3KMSA 3ZXWA 4YY3F 1CQNA 5BYQA 1HW8A 4OHYA 3FDSA 3BGRA 3GJTB 1PGZA 2GQCA 3BS9A 3TANA 2YKOA 4IFVA 4DG1B 4DUYF 4CI0B 3L4BC 4OHWA 1YQHA 2CPHA 5T7LB 4EZ9A 2CPDA 2XC9A 3A4TA 3OPKA 1NJIT 3HP6A 1LW0B 2DNNA 3JQJA 2XHWA 1ZA1B 1HWKA 2V9KA 1VQ4S 2K06A 5HP1A 2ZNYA 2FZKB 4RPFA 5HLFA 5KG4A 4M5HA 4KRWA 3RB4A 1B7YB 1HARA 4O44B 2BVZA 4OI2A 4O0NA 3MMCB 3MXHP 1H7WA 2NPIA 2XTJP 2DNZA 3RBEA 4WZQA 4LQ3A 1RDRA 5K14B 1RK8A 3E3XA 3R8YA 2HNDA 4XDDA 2XMTA 1H6KX 4RW8B 5EWFA 3JAMY 5KT3A 1X9WA 3EVOA 3CVKA 3BPSP 1M5OC 1NJWA 4ZVPB 2R8GA 1YJUA 3Q8PB 2Q6BA 1CJUA 1KNZA 4UUXA 4QR0A 1HLWA 1V5IB 4ZLPA 1SJRA 1VFJA 2YH1A 1HNVA 1JNZB 1BUXA 2ZDPA 3ETOA 4Q45A 4L73A 3K58A 3HVWA 3TZWA 4J91A 3W9JA 1F9EB 1KBRA 2GMLA 4JI7J 2VHGA 1JLQA 2VG6A 3TQ1A 4F25A 4ZVGA 2I0XA 3ILLA 4ZCLA 1X7VA 4U8VA 2JVRA 4RNOA 1OQ6A 4LVNP 2V8GA 3TO8A 1X5SA 2HHHJ 1IBMF 3TAMB 4MT1A 4I56A 2IM1A 4LIRA 2JC0A 4K2JA 1PYOB 1JX4A 4LF9F 3X3UA 3KLEB 4RL1A 1S57A 3KLIA 4X4UA 3SBMA 3DLLQ 1KD1T 3CCWA 1TU0B 2CRLA 1WEXA 2J9DE 1XTZA 1CC8A 2HHPA 4U67Q 2AYEA 1S0OA 3PYDA 4KJIA 2K1RA 3ELHA 5IOLA 4RJVA 1CQMA 1NK7A 2Z30B 4TNOA 1CG2A 3GQCA 1VGYA 4MK9A 4DJBA 2XGQA 1NUEA 3MAHA 1TAUA 2YPYA 2CA9A 5C24B 1R31A 2FB0A 2DY9A 1QAXA 5GMKa 5AE1A 4YEAA 1R0BG 3S6EA 3WC2A 5JMNA 1MWQA 3V81B 4B9LA 1VC0A 1SC4B 4RNMA 2C22A 2LDIA 2GIQA 2EFOA 2Q1LA 3OLAA 4G6VB 2P9GA 3LAKA 4WF9Q 2BJDA 5HQLA 3M2UA 3LGMA 2CQ4A 1RBAA 1U47A 4Y0FA 5IM0A 4UW2A 3OTEA 4HACB 5DG8A 4ED7A 4Q43A 2GS8A 3GV7B 2OPSB 2J9EA 5HMYA 1VHIA 2CFXA 1WUUA 5J2QB 2D3ZA 1RWVB 2AD9A 3OVBA 3H0PA 4QIVA 2DO4A 1TV6B 3EXCX 4H4MA 4ZIVA 2DPJA 1FFSB 3GMGA 1IBCB 1HQ2A 1SC1B 4FNIA 7FDRA 3F56A 3MZIA 2IM2A 2CYYA 3BEGB 4Q44A 2OPRB 1BD6A 2CPJA 2W9CB 3CJ8A 2RNEA 4LF4F 2QE5A 2ATCB 1VQNS 1GXTA 1BQXA 4C8NA 2D1CA 5DDQC 4JI2J 2E5JA 2GO8A 3MCNA 4F4XA 3MOJB 2CJBA 4Y2AA 1RP5A 2EVZA 2GAHC 2AWZA 2ZUGA 1FDBA 2QA4G 2HNZA 4OYZA 2ALYB 2P8IA 3O44A 4LSZB 3FSXA 1S59A 1UAWA 5HATA 3VTIA 3HZEA 4GKKF 1KQSR 3SCKE 1HWIA 3WDOA 3FVYA 3PKMA 2P6TA 2XMMA 1FK9B 4YB6A 4WP9A 1HI8A 4UY8T 4PWWA 2NXNA 2VASA 1S9GA 4OZJA 3RB3A 3T6JA 1NNDA 4ETXA 4CWBA 3WQPA 1K73T 4F3OA 4ZLJA 3MEDB 1RBOB 3HMJG 1R0AA 4G1PA 3C2PA 2AJ2A 1O0PA 3SCJE 2ZBPA 5A2QY 2JZ5A 3ENVA 2V34A 1Q7YT 5IFMA 1ACMB 4C11A 3CTRA 2XULA 3BR8A 5DRKA 1FWKA 1KDNA 1B64A 4JI3J 2UVUA 4ZDNA 2E9TA 2RDDA 2KHCA 3BV8A 3NMRA 3AA9A 3UNGC 4LUBA 2OP5A 2M9KA 2R7XA 1SI9A 1WC4A 3Q89A 3JTNA 2F9DA 2XCPA 2DH8A 3EGWB 3JS9A 1C1CB 4H4OB 2DXDA 1KOHA 1NDKA 2ZWOA 2BQRA 1VQSA 1VBXA 1YJ9S 4C98A 2WHOA 5M2RA 4OX8A 5H1SV 3UCGA 2VBWA 4F02A 2ZJPQ 1HQEB 4LFBJ 2W2QP 3D6TB 2CAJA 2RUSA 1OY8A 4G3IA 1HNWJ 2DGWA 1FJGF 2Z2MA 4HL9A 5E3AA 2VG5A 2HVZA 4NASA 5KFFA 5B0BA 4HH1A 4J9VA 1DRZA 3CCTA 2BKPA 1YX2A 3DKDA 4KYZA 3UD5A 2MZQA 4PCQA 1RAOA 2I38A 4R5PB 5J1NA 7AT1B 3TVYA 5BR8F 4CLYA 3FEXB 4BBYA 2AYGA 3T9ZA 3LOUA 3DLKA 2OUGA 3FFIB 2FLOA 1HBOB 3D66A 1HHQA 1RB0A 3VAGA 5AJ3J 3OFEA 3PRVA 4P10A 2DT9A 4FXVA 1VIXA 2YVSA 2J5AA 2MY7A 3HD1A 4GMKA 1EJ7L 3IBCB 3EGNA 4J9UE 4ELVA 2RVJA 2W1BA 1RTIA 5JVGQ 1IR1A 2DEIA 1S6PA 3GLJA 4M5JA 4R0EA 2CZ4A 4E0DA 3TUZC 3BQ1A 3ZTOA 4X4SA 2ZBQA 3D2WA 5D3GA 1JJCB 3LAMA 2RS2A 3E01A 3R5DA 3POTA 4KGMA 1SC6A 1ZZFA 1KOOA 5H9EK 3GWCA 3DOMA 4ER8A 2CQCA 2EFQA 2E44A 3W61A 2CNOB 2XLJA 2ASDA 4HEA9 3D1QA 4CM0A 4LBIA 3AD8C 1MWZA 2AEJA 2VOOA 1K44A 1X4GA 2XO6A 4OMFG 4YB7A 1S7IA 3VWSA 1HBMB 4NCGB 2IPOB 2MZJA 1HD1A 3DRRA 4DSEA 2BX6A 2DK2A 4DU8A 5IQ6A 3QRQA 4B9VA 2CJ9A 3I4PA 1TMJA 1PJ5A 3PM9A 1LK5A 1T0TV 3JYTA 1FRKA 1RA7A 4QWCA 3JSMB 2FC9A 1TMMA 1NAQA 1RT7B 3IBWA 3VV2B 3ET6A 4ZPTR 1NRKA 2IAJA 1M5VC 3M2RA 3MM9A 3BBFA 2RQ4A 3S8SA 5L9NA 2IM3A 3I56S 5KFIA 3C8YA 5AXNA 1X4AA 1KKHA 3M32A 3BDPA 4M5NA 1IN0A 4IYQA 3BREA 2IC3B 6FD1A 3HLUA 3KJFB 2M88A 2J8AA 2RU3A 2CPEA 4QZVB 1VRTB 1W2BR 5KFYA 4ECWA 4CLUA 3ZC4A 1YITS 3BO2A 1SVDA 3ITHA 1SL1A 1UTAA 1GQEA 3ILOA 4ZCIA 5F8LA 2HS4A 2EFPA 3GFZA 4LF5J 1OSCA 4PG8A 3MEEB 2CJXB 3KLGA 4B3OB 1T11A 3PNIA 3UVJA 5J1PA 3CCUS 5L1LA 1IKWB 3QMQA 4DV1F 2RE1A 3CSKA 4MIAA 1P1LA 3VAFA 2MEWA 1FDNA 1UEUA 2V8DA 3FBCA 3BGFA 3RBZA 2JL9A 1Q8BA 2UXCJ 3W65A 2VPXB 2W7PA 1IR0A 4G1QB 3UNYA 4NLPA 4PXDA 3N6MA 2DR9A 2ZHBA 4NYPA 4LSNA 1P1TA 3U02A 3BPDA 2FDNA 2JFDA 1NSKL 4NXMF 4LSLB 1CULB 1S1WA 2GJ2A 4RNNA 3AJ2A 1BQNA 2CXEA 4KPCA 1JIHA 2UXDJ 1HNIB 4OZ1A 1RAFB 3A3PB 3DLJA 4ZCMA 2AU0A 5LOQA 4IDKA 2B8PA 1LNQA 1VISA 1F3FA 1ZETA 1VK3A 4I7FB 3I9V9 4DR3J 3CCJS 3MEKA 4F67A 3T1YJ 4AL7A 1GXLA 3GYGA 4QR2A 3A8JA 2B7CB 5DQGA 3O6QA 2DIVA 3MAAB 1BQMB 2AHOB 1LEOA 1SCJB 1U45A 4GC6A 1U25A 2UXBF 2PEHA 2WVEA 2VPYB 1QVGR 5CH7B 3PIPQ 1PYTA 1VLOA 1Y3JA 1UPPA 1G6BA 5K8NA 1YDLA 3L7PA 1VQKS 3NXZA 5T7LA 2CDQA 2IVMA 1KTQA 4F0HA 2COLA 2M3DA 2WVCA 2B51A 2D9OA 5KG3A 3HHLC 4IOAQ 5HMWA 3KWMA 2FGCA 1KTVA 1RT3B 2QLFB 3UQSA 1KFSA 3M8QB 3OFFA 4B3TJ 4AQYF 4DR2J 3R7SB 2XEXA 1CJTB 1UKUA 2HBZB 4X4PA 2XWXA 1GT8A 1S77D 3J7YI 1WHVA 3T5KA 1PO6A 4DR1F 1S97A 2ZVIA 4O23A 3J7ZT 2E1CA 5K14A 1FCAA 2WOMB 4F3QA 4WFZA 4I2PA 2WVDA 4C0BA 2A1BA 3K17A 5E2QA 5B0CA 5D6GA 3PYGA 4N76A 1DQAA 1NZ8A 2ZH6A 1F2HA 5GMEA 3GIIA 3R7NB 2H9ZA 2UUBJ 4I6YA 1XR6A 2UV8G 4DR5F 1CVJA 1N36J 2PO4A 2CQ1A 3KLHB 2YBVA 5EX0A 2LP4A 4Y65A 1TKDA 1N34J 4OYXA 4DLGA 2W4CA 4XAKA 1XQIA 2ZC3A 1T94A 4G65A 3IRXB 4PWUA 1HKAA 1BC6A 2YKAA 2VUGA 1F2GA 3MPWA 4OHVA 1REVB 4ZPDA 2BQ3A 2UV8A 4ED3A 2WCXA 3QFHA 2DEJA 3UE2A 4WFYA 4FYVB 3D4JA 1UP1A 3Q8QB 2EG2A 1VQ7S 1Y5LB 3SDEA 3KDOA 2BE2A 2P5VA 3CJ0A 2XY6A 3LW5C 4KFBB 2V68A 3RUBL 3HPOA 1QSSA 1NU4A 2H5IB 3DLEA 3FCWA 4ED0A 2K7JA 2ASLA 3RG6A 3OSNA 2J9CA 2BOPA 4DPTA 5E0OA 2HBQB 2R9LA 3CC4S 4KV8B 3W2VB 3PFOA 3PYEA 3DRSA 4OI1A 5LSOA 4Q7AA 1TL3A 4NI2B 1Q8IA 1B0PA 2QGFB 4ZP8A 1X8DA 3CDAA 2M52A 3H25A 1QAIA 1JLGB 2QFJA 4MIBA 2KH9A 3B4MA 5KFRA 4FPRA 2F65A 1OY9A 5KFMA 1VQ5S 3T5JA 4HACA 1XIQA 4ANEA 5CYMB 3HX9A 3GSIA 4JI7F 1S6QA 2B4UA 4DEZA 1QAJA 1RWOB 1VI7A 4ELTA 1HBUB 5J2QA 2DRAA 2YNHA 4IH7A 3R9LA 3W8GA 2HHHF 2GVDB 5KT6A 3BSOA 2JC1A 4FZVA 3R6GB 2Y9HA 2VF3A 2CNNB 4J9MA 1RHMB 2HAIA 3HKZD 2VQFJ 4QWAA 2G2ZA 3W5ZA 3ZNUA 3DGVA 1TKZA 2ZH4A 1SKUB 4PYDA 4MKAA 4NLXA 5A0YB 3KUHA 2PFDA 4NLQA 3LH2S 3O1LA 1N6QA 3VGVA 2MQNA 1ELOA 5IT9U 3IBFB 3MM6B 1X31C 1D9DA 2HLTA 5DDOC 5C2GA 4N56A 4DL3A 3QT5A 3GP9A 4LR8A 1RT1B 1N5YA 2R2RA 3Q23A 2PC6A 4FF4A 5KFBA 1N8RT 1VCTA 3CDWA 4QBUA 4KPYA 5KFTA 2C3UA 1S1UA 3HO1A 2JH3A 4TY8A 1RTHA 3LP0A 2ZHOA 2ZH9A 4WE1B 3MEDA 1H7XA 3HJVA 1PJ7A 3TZZA 2EG1A 1U6ZA 3L7OA 3PW2A 2XI2A 1KP6A 2K7KA 4OV1A 3BN4A 1JXLA 2OTLS 3G4SS 3NNHA 4DHVA 5I3PA 2I5JB 3QSIA 5FDLA 3RR8A 2V2VA 2V67A 2VONA 1HBNB 1GAOA 1FD8A 1KS2A 2GGPA 3J81U 2KJVA 1SB6A 2C2ZB 2KB2A 1FXLA 3Q24A 2UVWA 4C9DA 1SL2A 3V5RA 4CLTA 3PW0A 5DQHA 1FJEB 5HMXA 4RBVA 1VRUB 1UETA 3SCIE 2VQEJ 3F41A 1QUPA 1VBZA 4H4OA 3T9NA 3THPA 2V4RA 2VV5A 2H65B 4YB5A 4WK1A 4C3MA 3T6BA 2BDPA 1UW4A 3KG0A 4AD6A 4LMZA 2BJ7A 1IR2A 1HQEA 1HD0A 4KIAA 2M7SA 2ZJRQ 2YWEA 5B0AA 3CXCR 1GMWD 2E1PA 3CJ4A 4JI2F 3UCZP 5CD4H 2H51B 3AY0A 3BZQA 4CLPA 2RKIB 2NCKL 1TR0A 4FYXB 2M4MA 2P9CA 3C6UA 1U1NA 1EKSA 5ETQA 1RE1B 4KAIA 3GZ7A 1IUJA 2HK2A 3DMJA 2W24A 1C1BB 1Q8KA 2DR8A 4KO0A 3OR2B 1Y9OA 4CO2A 3D0HE 4PYAA 3GR0A 1S1XB 2ACMA 1FDAA 3KNGA 4EO8A 4EYHB 3QGPA 4B3SJ 1UVJA 2MZ1A 1Q16B 2ZD1B 3VCDA 2FHMA 1HBOA 3FZ2A 2MLYA 2JFKA 1NMEB 3M8PB 2CJAA 3AODA 4JBCA 4HT7A 3N01A 1B4SA 1FO1A 5KFAA 1P9QC 1RAHB 4J7CA 1N0UA 1Y7PA 4L74A 1MW7A 3TJ9A 4CO3A 2KYZA 1S4FA 2R8KA 4ES2A 4ZKAA 2R7OA 4QQBA 3GG0A 4U7UD 1EAYC 5K8OA 3C46A 3UDLA 1C2PA 3UDVA 1S1TB 1J5OB 4JI3F 4C8OA 1SH3A 3RTVA 3VVUA 2R7VA 3V4IA 3D9BA 2RILA 3AOAA 4ED1A 5IWAJ 3IXQA 2XY5A 3SQGB 2MY8A 5J2MA 2W9AA 1PSDA 1JLFB 4NYZA 8RUCA 1FKAF 2WONB 2HMIB 3VGSA 4FS2A 3MHYA 3QGIA 4LFBF 3C15A 4OHZA 4CLSA 3US5A 3L7UA 5KFGA 2HVIA 1HNWF 5I42B 4NCGA 2HK3A 2DNYA 2EPIA 3QBCA 2W8KA 2QYCA 4CTAA 1NHVA 2QZ8A 1SKWA 1EQMA 4GVLA 3MR7A 4Y2IA 4ECRA 5AXKA 3M30B 4EU0A 3EJMA 4Y28C 3M4XA 1VJQA 2Y1LB 1AUDA 1SJ4P 2FJWA 4CYUA 4ZN3A 4RW4B 2BYCA 3EE3A 4YR2A 5GAGI 4DV6J 3LWMA 1MROA 3EM1A 2KT2A 1FWPA 1AFIA 1F5BA 3IFEA 1TK5A 3MTJA 5E5NA 5KT2A 2NSCA 5AJ3F 3RYLA 3NY0A 4DS4A 1KQFB 3EPIA 2UUAJ 4R8UB 3QFWA 2LYVA 5B0DA 5E41A 2ZH8A 1LWFB 1KLMB 4C0HA 3IR5B 5G0RB 1M1GA 1KLNA 2B5JB 4DN9A 1TUWA 2CJYB 4QW9A 4ZN1A 2BMBA 2NYIA 1U2RA 3CJ2A 3W60A 5L38A 2IDLA 2Y1IA 2PSZA 3LGNA 4MTPA 3L3CA 3B4DA 2MQLA 2KHDA 2CVIA 4K4SA 4DL5A 4ECTA 1FJ7A 2YKMA 1UEVA 1VBKA 2D69A 3CB4A 1JJHA 1RA6A 3JQKA 2X51A 3BSNA 4PWDB 5L39A 4X4RA 4ALZA 1FKPB 5F9NA 2R4FA 2GC8A 4XDCA 3MR2A 5BYSA 3PVXA 4ZITA 1N33J 5L9XA 1DAXA 3MM7B 3VHQA 2ZBIA 5B08A 5CYQB 5HVHA 5KG1A 3K57A 3F44A 4V1Ak 3DOKB 4MKVA 2YWGA 2XLIA 2IBOA 1NPPA 2ADBA 2P6SA 2B6AA 2EW9A 1G1XA 3QGGA 4M94A 4CT8A 2ZOGA 4LSLA 2WW4A 2AIRB 1DHMA 2WSCC 2BZ2A 3LP1B 1F5CA 1ROFA 2V0NA 2B0GA 3UR0A 2XS7A 3MUTP 4ID5B 4P75A 1REGX 2FJDB 2G0JA 3CD7A 1TKXA 4WPAA 1R8CA 4QYZJ 1HNXJ 2R7WA 3KG1A 4CLKA 4DPYA 5IS2A 2VKZG 2DJWA 1WOSA 2CQGA 4NXNJ 4USKA 3W3SA 5KG0A 2D74B 2W2PP 5KFXA 3M8RA 3M9MB 3TR5A 3GYNA 4J9SA 4OLPA 2OFGX 4F4ZA 2J6TA 3H7HB 2V5HG 2WSEC 3IO1A 3R1LA 4KKOB 4WKRA 2DGTA 2VA3A 1VHFA 1PIEA 1YKWA 2L08A 2UP1A 3OVSA 3A8IA 4X66J 3QWPA 1ZZNA 1D8ZA 4ZP6A 3NGSA 5M2PA 2JWNA 1CS4A 1RT3A 4LF5F 3M8QA 4DCPB 2RJZA 3OL6A 1HFEL 2MZTA 3QO9B 4FVCA 3IS9B 3DOLB 1CJTA 3GCXP 1IM6A 1IWGA 4OZNA 4ZPVR 3UN3A 4OYMA 3W2WB 4ERDA 2LECA 1U8WA 4FPIA 1CEZA 4OX9J 3HSJA 2I1RA 5J1EB 1WOOA 4EMDA 2HG4A 3TZXA 2UXCF 2L3MA 2AJ4A 2IVYA 3NAHA 4B9MA 4YP3A 1SL0A 5DDPC 2HRUA 3ILIA 2UUTA 2FVCA 1GMVA 4FDFA 1TTHB 3PCOB 5K8MA 3QNWB 4X4TA 2AV5A 5KG5A 4KQZA 3MCOA 2YXLA 2UXDF 2DGQA 1DTQA 1S9EB 2YX7A 2IY5B 4N77A 4ECYA 1GFWB 4NOHA 3TUJC 3U1MA 2ZH7A 3KLHA 2FJVA 4NA1A 2DISA 4OZLA 3ZTSA 4DR3F 4BC9A 3T1YF 4C48A 2MKYA 3ILJA 1LV5A 1I94J 3BH7B 4ZVQB 1YVFA 2D3OR 1U1KA 2YNGA 2AGOA 2UU9J 3VZIA 3WIVA 2ZZNA 4WYLA 5A8KA 4KR0B 4WFNQ 2QG9B 1FD2A 1V3ZA 4C8MA 5HN0A 2IYIA 1L3KA 1REVA 1J2VA 2CQHA 1SJQA 3D5MA 4K4XA 4YR3A 1CBKA 4K4ZA 1HHTP 1QUVA 2OAUA 3OJSA 2XWYA 2EK6A 4TN2A 2F63A 2CPFA 4HI1A 5F3TA 4WIIA 3HHNB 4F26A 3TAPA 2ACYA 3IAS9 3R7BB 2ZH1A 2R2UA 3MEGB 3IMQJ 4W98A 3IWXA 1NKEA 3LPEA 4B3TF 4DR2F 1T95A 3PHTA 2C3OA 4K4TA 2DNMA 2C3MA 4DV5J 1S0NA 2AZ1A 2W4DA 5EUHA 2VKRA 1CLFA 2PFFB 1TVRB 3J80U 2XS5A 4NI2A 3OUYB 3QT6A 4P9SA 2EKYA 3AB4B 3I96A 3T1HJ 2IRYA 3C6TB 3Q86A 2K2PA 4DQIA 2MPUA 5HVFA 2V2QA 1W26A 4L75A 3PKYA 4NZ0A 5KFSA 2UUBF 1LW2B 3OT9A 1XBWA 4AE5A 2BJ3A 3TX8A 2NXCA 1OWXA 4P6QA 1U1RA 1N36F 2HFUA 3NOCA 2Q79A 3E8OA 2B9WA 1LQ9A 1VS3A 1N5VA 3T19A 1NCLA 3X1LB 3MDFA 1N34F 3NGRA 1FVSA 4RW6A 2DHHA 4J9PA 4LF2A 2QFIA 3OR1A 2QLBB 3KK3A 3D3BJ 1FNOA 5C5JA 1T02A 4HTJA 4ZJQA 4DFKA 2OO4A 4DZDA 2EFNA 3QLHA 5H9FK 2FIUA 3BQ2A 5A0YA 1EIYB 4QIGA 2GW8A 2F3JA 2H4WB 5BYRA 2AT1B 2WRMA 1DQ9A 1UWAA 3V6DB 4DSJA 1T3NA 1FRLA 3KG4A 4I2QA 1RT1A 3BDEA 3KTQA 4UY85 5IC6B 2LQJA 2J0SD 1YRUA 2BANB 2W4PA 4IFYB 2R42A 3GJRB 3FSYA 2B4OA 1AA1B 2K3KA 3LGHA 4P73A 1X4CA 1XK8A 3M1VB 2CJQA 5LXRA 1E6YB 1HL6A 1DTTB 3PEHA 4QPXA 3DRXA 1QSYA 5LMNJ 3HVTA 4C8YA 2MYFA 2R2TA 1HNZJ 1TL1B 4O4GB 1VLYA 2V9WA 4ZHRB 1P9YA 5HROA 1K9MT 1C0UA 4FVMA 3VGUA 2F5GA 4ZJOA 3TJ8A 2N3OA 1Z1ZA 3MPDA 2CPIA 3RR7A 1BXNA 1R8BA 3MUMP 1VRUA 4IG0B 2FLLA 3W64A 2LQ5A 2IYGA 2LEBA 1NPRA 2VBYA 1IKYB 4TLRA 3CWJA 2VQFF 2RD5C 4AXIA 5IV4A 1XERA 3C16A 2HEKA 1RHUB 2M70A 4C2MA 4CLZA 3TOQA 2ZWPA 4RW7A 3H40A 5LM7E 2V6AA 2BKNA 1SBRA 4EO6A 1H74A 4DI6A 1ZAWA 3R5AA 3HM9A 1U6FA 1KEKA 2ZH2A 4PABA 1EETB 3PDNA 4C3KA 1Q95G 3UO0A 3DLBA 4Y00A 5KTQA 5KG6A 2PA8D 2DR6A 1IKXB 4LF1A 3AXMA 2ZOMA 1RI7A 2LFVA 1V3RA 4NYOA 4V19J 4ZPAA 4PUOA 1UWBB 2YKPA 5ETKA 3B78A 2DYAA 3HD2A 2GQ2A 2HSEB 2BA9A 2HQIA 4K2XA 4J9OA 1YJNS 1FRHA 3HI9A 3G8SA 2GHVC 2HVHA 4Y34A 4DL4A 1KVIA 3RRGA 4NWBA 4DCJB 3QJPA 2QMUB 4J37A 4J9KA 3P5TL 1QJHA 1Y4ZB 2DGOA 5BXIA 1UZHA 1GMWA 1T9TA 3K89A 2X1AA 3D67A 2CPXA 2JRSA 3VAJA 4C8ZA 1IKVA 5ITHA 4LF7J 2OMLA 1L3UA 3V6JA 4OI4A 2IM0A 3JSBA 3UCUP 1M5HA 1DLOB 3OL8A 4IO9Q 3TI0A 3G86A 2KN4A 1U0HB 3D6FB 1U7LA 1ZH5A 1CJVB 3MM8A 4XK8C 5F8GA 2AX0A 4DF4A 3M9NB 3VAIA 2X1FA 3FNNA 1V9OA 2VQEF 2R8HA 3G2XA 4KGXB 3OVAA 5DJBA 5LT5A 3PIOQ 3ZZUA 2F4VF 2WTFA 4KBIA 4K8RA 1R0CB 3PFEA 3Q8RB 2GJFA 2VDHA 2WVBA 3OTDA 2YNFB 2ZBRA 2FD2A 1RYSA 4X64J 1C0TA 2Y0SD 4FKXA 2V8VA 1OS5A 2FVPA 4FXWA 5L1IA 5GAHU 4EWTA 1VQMS 1NK0A 3TP2A 3MI7X 5KFNA 5I42A 1QVFR 4W92B 2LDYA 4B9UA 4Q0BB 1X4FA 3G6VA 4F4YA 3TWZA 1JLCA 3CW2C 3Q8UA 3M8WA 5KOWA 4DOZA 8AT1B 1RJJA 3P49B 1WHYA 3TA2A 3NGUA 4UUWA 3QZ7A 2MQQA 2CADA 4A4JA 4LBPA 2Z8QA 4E98A 2O1PA 1K8AT 4PG5A 3L09A 4UOFA 2XZWA 2R3VA 1R8PA 2MLXA 4B3SF 2P9EA 1DFDA 5DG7A 4PG4A 2J9DA 4PQUB 4WXWA 3MMAB 4R0JA 2ZM6J 4ZLLA 4ZP7A 1QE1B 2NXUA 3DDNA 3LF0A 1S72S 4N8NA 4R8UA 2J0QD 2XMWA 1RWWB 1LWFA 1S5ZA 1KLMA 3W9HA 2IMWP 4LR9A 4TVAB 5HO4A 2NLWA 4URGA 1FKOA 2EK1A 5E33A 4DBQA 1AFJA 4DR6J 1RT2B 1I5OB 2YWWA 2G0CA 3IM9A 3FBEA 2GAGC 1N32J 3SFUA 2KYXA 3C19A 1IBKJ 3UDCA 3BKUA 3V4MA 3CDBA 5MLCV 4IG3A 5IWAF 2BV3A 3BB5A 3CPWR 2YNIA 1MU2B 3N9UC 1JLBB 1NM2A 3DC2A 3U27A 4MKYA 1PYSB 4EK2A 3G87A 1EP4B 2CNLB 3MUVP 3EZOA 4OLOA 3HHDA 2GHPA 2ILYA 4HHJA 4KGKA 2VU5A 1IQZA 3DOKA 3BQ0A 5GADU 4U6PA 3FCVA 2NQPA 2AEFA 1F5AA 7FD1A 3SQOP 1JB0C 3DYAB 1PBAA 5JXSA 4TU9A 1AYEA 4L72B 2VC0A 1H2VZ 1RU1A 5CXTA 3OTOJ 4DV7J 2RMLA 2E66A 1RBLA 4P72A 5RUBA 4DL0C 3K8VA 2HWTA 2UVRA 2DR7A 3GIKA 4OX7A 4ZJLA 2PIIA 4I4BA 3EX7B 1H2TZ 4DV6F 5C2CA 1AB8A 3TUPA 1RADB 3MMJA 3QIPB 2DXEA 4DV2J 3FMWA 1PC4A 2VC1A 3ADAC 5C25A 4ZK7M 1TQLA 4TQRA 3GIJA 4GO5X 4WU3A 1PKUA 2UUAF 1B3TA 2BKOA 3RAMA 1MN9A 2HAFA 4F2RA 2ZC4A 5D78A 2VJVA 3KK2B 4RWXA 3UI3A 2A6MA 1GMUA 1F1BB 1FNMA 5T41A 2RHSB 3KKFA 1WEZA 3EMTA 5THWA 5KAKA 2Y8WA 3EWGA 3PW4A 4M5DA 4P2XA 4LIWA 4QW8A 3A8KA 1L3SA 4HDHA 3J7Z5 4ID8A 4C3LA 3OD2A 5G4DA 3BGRB 3QO9A 3V6HA 4DQSA 1KFDA 1N33F 4LRDA 4Q8EA 3W2WA 1FWLA 2GFFA 4IFVB 5CHCB 3WC0A 2ZVSA 5E7OB 3VF0B 4X2BA 2GMJA 3U1NA 1S12A 3CD0A 4RBTA 1RSCA 2LEPA 3GCWP 4PPDA 3C14A 5HP1B 2W2MP 1X60A 4A48A 1U48A 6AT1B 2M5YA 2NUUG 5HLFB 2DGSA 2DNPA 3PR5B 1UVLA 3SSQA 4KY3A 1NEEA 2YKNA 3FRZA 3N79A 3HDSA 4AUKA 1JNRB 2MJNA 4FNHA 1HNXF 2XSJA 3ZO7A 1DZ5A 1UMJA 4ED5A 4QPTA 3HKWA 4CLLA 2HNDB 2B8QA 2YWFA 1TK0A 4K0KJ 4BWMA 4JB8B 3RRKA 2MGZA 1NDLA 4NXNF 3LALA 4Y6IA 2N4CA 4USJC 4L76A 3TVZA 2D41A 1WC5A 3LP2A 3M9OB 1O5JA 1EARA 3Q0AA 3FJ2A 2PA3A 2LXIA 3CF5Q 5BJRA 2MQOA 1ZBTA 4DSLA 2GZOA 1WD6A 2VG6B 2CWXA 4X66F 1XJWB 3M8YA 2QIFA 3OJUA 4DX8H 2FC8A 2XBPA 4ECVA 4E8UA 3PX4A 1E6VA 3KJNB 1FT8A 9ATCB 1PC5A 1WDTA 1OMSA 3IA0A 5CZVA 4H4KA 5KFWA 3HXMA 2NUHA 3ENQA 2UUCJ 3JTPA 4B3RJ 4N47A 4QJVA 1YWXA 3CIZA 2ROPA 2HFNA 4Q2LA 3DNCA 4NZ7A 4OX9F 2JEGA 4X62J 3V2UC 2I2YA 2KXNB 2CG4A 2KKHA 2MZSA 3WIUA 3G6XA 2E5LJ 1LWCB 3MAQA 1LW2A 4DR4J 2GCFA 3DRPA 3CCES 3NLCA 3K5OA 1RT6B 1KWMA 2W01A 4YR0A 3JB9k 2F8EX 3NCQA 4ZPBA 1I94F 2B4VA 1AZSA 2OI2A 2KVQE 4MFBB 2AJQA 3CMQA 2UU9F 1Q8LA 1MNEA 5L1KA 1YZ6A 4FBTA 1CJKA 4DR7J 4DQQA 5DLFA 1RWKB 1PCAA 1KQKA 5IM0B 2WB1D 3KHHA 5D4OA 4JI1J 4FYWB 1I6JA 3KUGA 3MCMA 1JMTA 5KFDA 4MKBA 4KGZB 4MH8A 3V6DA 5C42A 3OXGA 5CABA 5F8NA 2O5DA 4H4MB 2KU7A 2R2SA 1V6HA 1XNQJ 2XGPA 3H5XA 3JAMU 1HPZA 3AQPA 2LEAA 3D54A 1NPKA 1H0HB 3HVAA 4HTIA 2MMYA 3KK1B 4OI3A 1WF1A 1SV5B 4ZCKA 4M5IA 4CDIA 2AYBA 3SZ2A 2VOPA 4CIOA 4NLTA 2RF2A 1IWAA 4DV5F 3KHRA 4UQGA 2HZCA 2VPWB 4HKQA 1KVJA 3CC2S 1E6YA 2KFNA 1FERA 3A13A 4DX7A 5ETSA 3T1HF 3MMBA 4ZVSB 1TL1A 1JKHA 2HNZB 4UT4A 2PMHA 2KZZA 3MD1A 1GX5A 3OL7A 3I0SA 4X65J 4LT6A 2NXEA 2VBZA 3I31A 1WKLA 4WFAQ 1D1UA 4RU9A 2F9JA 3AD7C 2HLUA 4UQTA 2IFXA 3CIMA 4QWDA 3IWLA 1R6VA 3DHXA 5AE3A 2Z0GA 5SZTA 1VRQC 3AOBA 1YJWS 1ULRA 5IXUA 4A8YA 3KYLA 3GR1A 1IXKA 4PAAA 3MURP 3M05A 1R0AB 1T03A 1C4AA 1MSWD 3H4BA 2KG1A 1XWLA 4JI4J 1W25A 1FTCA 1S0MA 5E3PA 2JEFA 2XZTB 3TW0A 1GK8A 2FZCB 4P74A 2OFHX 3UPFA 2XHCA 2RSQA 1NB7A 2DNHA 2VFSA 4C11B 2OEKA 3GPAA 3QYYA 1M5KC 1RYRA 4XO0A 1R27B 3OL9A 2ZZTA 1R3NA 4LFAJ 1UA1A 2KXFA 1M1HA 2Y1RI 1U0SA 2MKJA 5J2NA 3M7VA 3HFVA 3P3DA 1FI4A 2Y3YA 1FRIA 4LR7A 1U4BA 4HVZA 4WTOB 4PG7A 2ROGA 5I4MA 1U1PA 2EFGA 3PJWA 1MMDA 2K3IA 2HZVA 3R5CA 3OFHA 1HYSA 1WACA 2OEJA 3LA0A 1JK9B 4BC7A 5LMNF 1S1VA 3QJJA 2C2EA 1FEHA 2HQFA 3MFHA 4EFAC 4DCOB 3BKFA 3K5MA 1HNZF 2RRAA 1TKTB 1S76D 3HSGA 4P2FA 2V4JB 3NBPA 4OJ1A 1RHKB 2BM1A 4JP8A 5MAOA 2W9BA 4A46A 4M63A 2Z57B 3ULHA 3KLFA 4XIUA 2OJ3A 1FF2A 2BR0A 3GFHA 4EI2A 3H5SA 4O3QA 5FLXU 4OL8A 1U0HA 2DTJA 1XEZA 1CJVA 3EZUA 1F3VA 1YHQS 3DLKB 2NREA 1Q1KA 4HYKA 4OYPA 4KHPJ 2AF6A 2OPQA 4EBCA 3D0IE 1HQUA 1NSAA 5KG7A 3AXKA 5K8PA 1T9VA 5H9EJ 1R8AA 1X5OA 2PMWA 4B17A 4YDDB 4CLFA 1VBYA 1HR0J 3NCRA 5F0WA 1WC6A 3U7JA 2EXUA 1YBAA 1AT1B 1WG4A 4NMLA 1RTIB 3TNVA 2BE7D 4PKDB 4U9RA 1HA1A 4USHA 5GAEU 1S6PB 2QA4S 3ZZZA 2ZITA 4NLWA 2RU9A 1H73A 1RT4B 5U47A 3H2VE 2IIHA 5D3GB 1FESA 3W5YA 2MKHA 3POTB 1OJ4A 4DL6A 1RLCL 4OYBA 2PN6A 4RNFA 3DOMB 5B0EA 3W63A 1NLKL 3QQCD 4RX6A 1G4CA 2BUNA 4PZVA 1TL7B 4ZPCA 3RW7A 4ZVHA 1DARA 2BJ1A 1F6TA 2NXJA 1RU2A 2QA1A 3BO4A 1SQGA 3DXBA 2GMHA 2OD4A 4U8YA 4RUCA 5A2QU 4WKYA 2C2DA 2GVZB 1W7WA 3UR3C 1X9SA 1HWLA 2JSXA 2IRUA 4B3MJ 3AJ1A 1D0EA 1DJ0A 2BQUA 2F40A 4HLBA 5CD4A 1WHXA 1ICEB 3CJKB 4X84A 4WBFA 1Y00A 2RQKA 3M6UA 4OYAA 4IR9A 2RRNA 1ZOTA 2JEJA 3MR5A 4LBHA 4Y2MA 1RZMA 4DV4J 2V50A 2J0XA 4LF7F 1QTMA 1V3SA 5KG2A 4LF6J 3DI6B 2AW0A 2FLPA 4TYAA 1TK8A 3H5UA 3ET6B 2KDOA 2KVIA 1OQ3A 2IAJB 2R7SA 3GTYX 4XTTA 1NK5A 2FVQA 3TA1A 3M2RB 3TJAA 4X4QA 3I5BA 4F50A 3TQEA 3CO9A 3H59A 3JSRA 1XNRJ 1MU2A 3FRYA 2AEMA 1JLBA 3CDUA 2AGQA 3L9ZA 3FBFA 4IOBA 4JV0A 1PJ6A 2FYXA 2ZBCA 4X64F 3SI8A 2AZ3A 1N88A 4OZ2A 4N5SA 3ZZ0A 2HFSA 1YTYA 3VQTA 5HMZA 3ZTPA 2E7WA 4NA3A 5LXYA 1GX6A 2VFTA 4XPCA 3DYAA 1FFWB 3RBDA 3OHAA 3ITHB 3AD9C 4DG1A 1OY6A 4KHMA 1Q78A 2RRBA 2ASYA 4Y3CA 1EQ0A 3MCSA 3MOZA 3UVJB 2HHXA 1LW0A 2OGUA 1U1QA 2YQ3A 1U24A 2QT7A 1WC1A 3RGIA 2B56A 2L9NA 3G8QA 4OZ0A 3QATA 5KFCA 3I5CA 2WBRA 3ZZOA 4NCAA 2PT0A 4CNZA 4FP9A 4DV0J 4O44A 4ETZA 2ZM6F 3MMCA 4HDGA 3I0RB 1NH8A 4LSNB 4MAKA 1S1WB 2FPHX 2YWKA 1BQNB 3MM5B 4ANCA 3LUYA 4RW8A 5L1JA 2XMKA 4IDKB 1YK9A 1NKCA 4ED4A 3PACA 4DR6F 2KFYA 3DDKA 4CP5A 2BJEA 1S0VA 4K4UA 4OV6A 2O3DA 1N32F 3NG8A 4JI0J 1IBKF 4L6V3 1H3DA 1GXUA 2BE9B 5LMUJ 3FBBA 3MGJA 4P52A 2CQ2A 1RAIB 2NPFA 4IH6A 3R97A 4DZ6A 1Q0NA 5DM7Q 2A2DA 5AE2A 1LXNA 4ZVRB 3TAMA 1KSPA 4WCEQ 1WTFA 3NGKA 3PO4A 4M95A 3VQSA 2BM0A 3R5JB 4PRFA 2ALZA 2QL9B 1C4CA 3SYZA 1FRMA 1ZPVA 3KLEA 2IRXA 1RABB 1S99A 2RQMA 3EGVA 1RGVA 3N4WA 2XCAA 3UD4P 5L8RC 4QWEA 1N54B 3PRDA 1VIOA 2NR0A 2DO0A 1N5TA 1ZYQA 3T1AA 4N7TA 2F4FA 1YGYA 1RACB 3OTOF 4D3HA 3FQLA 1T3OA 2KL8A 3D6HB 4DV7F 3EUNA 1TUGB 3TUIC 2OSQA 2LQ9A 4PXCA 2O67A 2QC3A 3D0GE 4CH0S 3GE9A 1WC0A 2HHQA 3G8TA 5C7PA 3MPYA 4M5LA 5C24A 4I2PB 3TVKA 5F8IA 4DV2F 4PXBA 4IR1A 1NZAA 1EHWA 4O3SA 2DNRA 1SJ1A 4USTA 1YJRA 5B7WA 1RISA 1RAEB 4DFMA 3NWGA 4DWIA 3QAEA 3ICLA 4UTGA 2ZUAA 3WBZA 3V81A 3BGOP 3HK2A 2N7YA 4HT5A 1PBUA 2RIJA 3Q8YA 3FKBA 2ROEA 4QIEA 3OTCA 1UVMA 1GEHA 1LOUA 2WK4A 3GV8B 4WP8A 1WF0A 4NLYA 3CJ5A 1X5TA 3CMES 1ZPWX 2CQDA 4KH1B 4F7VA 4QIFA 4BDPA 2EC2A 4WP3A 1S6OA 1PAUB 3K2YA 3TAQA 1SUQB 2OPSA 2KG0A 3IG1B 4XPEA 5KFPA 1PAEX 1T7PA 4USUA 3ONQA 1JXVA 4LREA 2IDEA 4JI6J 1TV6A 1LWXA 8ATCB 3T5HA 2DHXA 4DSIA 4GO7X 3OXLA 2WVFA 1Y10A 1WWHA 2ZKUA 4OJGA 2G2YA 2V94A 3VR1A 2I8EA 1NK4A 2OPRA 4I6AA 2W25A 1NBEB 4RUHA 2W9CA 2ZEJA 3SDEB 3HSDA 2BE2B 2AKWB 1LWCA 4BWJA 3DLEB 3EYZA 4JI5J 3HHEA 2R7TA 2KJWA 4WTYA 1RT6A 1SKRA 4M5GA 3FEYB 2RDJA 1WHWA 1QLNA 3BN7A 3DRSB 3DU6A 1TL3B 4DFJA 3B8HA 4K0KF 5KFEA 1RHQB 4NA2A 4MFBA 1NO8A 1FK9A 1JJ4A 5F41A 3CUNA 4HR2A 1V5VA 4JV5J 4NMXA 1FXDA 2LXFA 4YMEA 4ENOA 3NCPA 2B4PA 1S6QB 3TX0A 1SQEA 2H48B 2LCWA 3LPYA 4USWA 3AOCA 4RWWA 1Y5IB 1YRTA 1VK8A 4USVA 2YNHB 5ETNA 2PMZD 5D0HA 1KN6A 3TA0A 5CCLA 2OIHA 4ZP9A 1UFLA 4M5KA 1OYEA 1B99A 4LRFA 4DPWA 5J2PB 1VYAA 5KT5A 1BMQB 4HI2A 4K5SA 3PJXA 3KUEA 5SUHA 1ZM3A 2U2FA 3KK1A 3BF4A 2G4BA 1SV5A 5FLXY 2GNKA 2UUCF 4B3RF 1UFWA 1RCXB 1TKZB 2H4YB 4QU7A 3JSYA 2ZE2B 1ZM2A 2LXUA 1C1CA 1B0TA 1WOPA 3CDEA 2PI4A 3PX6A 5CQGA 3BJYA 1YG0A 4X62F 3K0JA 1N6QB 2HW3A 2MJUA 4F0KA 4QU6A 1SC3B 2H54B 4I68A 2E5LF 3IN5A 1N5YB 4J9QA 2M2BA 4LQ9A 2KZMA 3HVRA 3I82A 3LANA
chains in the Genus database with same CATH topology
1HW9A 4IRKA 2UXBF 2KRRA 2PEHA 4KE5A 3TP2A 1NK0A 2VPYB 3MI7X 5KFNA 1NK8A 2R8IA 5I42A 4DR4F 2W7OA 4D3GA 1QVGR 2MGZB 1Q53A 1QVFR 3HHKA 4W92B 5CH7B 2LDYA 3PIPQ 4B9UA 4Q0BB 1Y3JA 1X4FA 1G6BA 1S1UB 3I6PA 2FHOB 5K8NA 3C66A 3G6VA 2Y1JA 4F4YA 3Q8SB 3LP2B 2KFZA 1JLCA 5B09A 1I1GA 3L7PA 5KOWA 1X9MA 4DOZA 4TY8B 2ZH5A 4ED6A 2E5IA 4X4OA 4AYBD 1H38A 1RJJA 5HI7A 4RUAA 1RTHB 3P49B 4ES3A 1URNA 1VQKS 4OIXA 4CZCA 1WHYA 3LP0B 2R7RA 5T7LA 4FS1A 4MK7A 1R7IA 2CDQA 4KC5A 3TA2A 2IVMA 4UUWA 2B9YA 4R5PA 3OV7A 2ZOFA 1KTQA 2COLA 4B08A 5KOXA 2SXLA 2M3DA 3QZ7A 3CC7S 1D9FA 2MQQA 1IJFB 3M2UB 3R27A 3CCSS 4A4JA 4NRUA 1U09A 2B51A 2CZVC 2Z8QA 4E98A 4CO4A 2D9OA 5KG3A 1HMVB 1PILA 2O1PA 1K8AT 4FXDA 2F8HA 4PG5A 1N48A 3L09A 4DR7F 2R8JA 4FYDA 3FFIA 2XZWA 3HHLC 4IOAQ 5HMWA 3KWMA 2FGCA 1R8PA 4B3SF 1KTVA 2HWHA 2P9EA 1RT3B 4CO1A 1DFDA 5DG7A 1U1LA 2DHGA 3BM7A 4PG4A 2J9DA 3UQSA 3FCHA 3M8QB 4CNYA 1KFSA 4PQUB 4WXWA 5GAEI 5LSLA 1UA0A 3MMAB 1E6VB 4RW9A 3OFFA 3U1LA 5FJ4A 4R0JA 4P7TA 1WTBA 4AQYF 2GX8A 4JI1F 5FDLB 1UL3A 1Q7LB 4ZP7A 5KFQA 1QE1B 2XNRA 3CGIA 2NXUA 3DDNA 2XEXA 5CCMA 1UKUA 3OXFA 1G2EA 3IR6B 3LF0A 1S72S 4N8NA 2GGPB 4X4PA 2UUWA 2XWXA 4R8UA 2OPPA 1GT8A 2J0QD 1S77D 2XMWA 3J7YI 1WHVA 3TRGA 3D1OA 3T5KA 1LWFA 1SJ3P 1KLMA 1MMNA 1XN9A 1PO6A 2CQ0A 2F7VA 2QMXA 4DR1F 1S97A 2IMWP 4O23A 4OFZA 2YWHA 4LJMA 3J7ZT 5HO4A 2E1CA 2NLWA 5K14A 4URGA 4JV1A 1VMBA 1FKOA 3S1TA 1FCAA 2WOMB 2EK1A 5E33A 4F3QA 4WFZA 2MB0B 4I2PA 2G1DA 1L3VA 3G71S 2FHJD 4C0BA 5B0GA 1XNQF 3KLVA 3DCAA 2A1BA 2IA6A 4DBQA 4G1IA 1AFJA 3KOAA 4A8XA 2BANA 5LJ3Y 1SJFA 4ILMA 3IAM9 4CO0A 5E2QA 4IFYA 1RT2B 5B0CA 5D6GA 3ISND 4N76A 1DQAA 2G0CA 1LWEA 3THTA 2ZH6A 4B9NA 5D4PA 4CT9A 2E9ZA 4A8SA 3GIIA 1D3WA 3I32A 3SFUA 2KYXA 2JLGA 5F0UA 3KHGA 2H9ZA 4KB7A 3UDCA 1R89A 1S79A 3M1VA 1X0PA 3CE8A 3V4MA 3CDBA 5MLCV 3QWUA 2DCLA 4CQ1A 5LL6d 4IG3A 1SH2A 4I6YA 1DTTA 2DHAA 1XR6A 4ZVEA 3N6LA 2UV8G 2JOQA 2GO9A 4DPOA 4DR5F 1CVJA 3M6WA 5IWAF 2BV3A 1FVQA 4C97A 2CQPA 2DNQA 3BB5A 4IRCA 2PO4A 3NNCA 3DRPB 4USIA 3W7BA 2CQ1A 3KLHB 3CPWR 2YNIA 5EX0A 4O4GA 4RU2A 3SEOA 3RW6A 1MU2B 3N9UC 4BHQA 4PXEA 4FF1A 1JLBB 3C6UB 3DC2A 4Y65A 3DLHA 3U27A 4ZHRA 1TKDA 4MKYA 1TKTA 2RS8A 1EP4B 3GG1A 4NRTA 2HHTA 1ZTWA 2V4JA 3MUVP 2A10A 4OLOA 2MQMA 3HHDA 2GHPA 2ILYA 4HHJA 2W4CA 2VZ9A 4KGKA 4DLGA 4F8RA 4AL5A 2CPZA 4IRDA 4XAKA 4LF8F 2CPYA 2DIUA 4OI6A 3BR9A 1X4DA 4KTQA 2Q66A 4X65F 1HBMA 2DGVA 1HI0P 2ZC3A 1IQZA 2VH7A 1ZM4A 3DMJB 3DOKA 5GADU 3GYXB 2J76E 1T94A 3BQ0A 4KO0B 4U6PA 3CMAS 2NQPA 2R7UA 1FJCA 3IRXB 5FD1A 2HGNA 1VQLS 3FGVA 4PWUA 3DFEA 4O3NA 5KFLA 3HHLD 3PO5A 1BC6A 2HFZA 1F5AA 7FD1A 2YKAA 1KR4A 1JB0C 3DYAB 2VUGA 5JXSA 4TU9A 1S9GB 1F2GA 2Q43A 2MQPA 4L72B 4ES1A 2VC0A 3MPWA 4OHVA 1R6YA 1REVB 4ZPDA 4I67A 1OO0B 1H2VZ 2UV8A 3FEZA 2BQ3A 4IQXA 4ED3A 4IUFA 2WCXA 2C28A 2E1MC 4YB1P 2XY7A 4IG0A 3KFWX 1Z4UA 5CXTA 3NMAA 5IT4A 3JSMA 3UE2A 2RMLA 4KHRA 4WFYA 2E66A 1UVIA 1N52B 3ISZA 1IKYA 2ABYA 1RT7A 1UP1A 4ECZA 3Q8QB 4IO1A 2OSRA 4BS2A 1K1QA 4DL0C 3K8VA 2HWTA 2UVRA 2EG2A 2DR7A 2BBEA 2WW8A 3GIKA 1Y5LB 4OX7A 3SV4A 1VQ7S 3SDEA 2PIIA 4YDXA 2FUG9 4OI0A 2BE2A 2P5VA 3PEJA 3CJ0A 4X4NA 4I4BA 4JI4F 5C42B 4ZVFA 1OIAA 2XY6A 3LW5C 4KFBB 3EX7B 1H2TZ 3HPOA 1QSSA 4NX9A 4DV6F 1NU4A 2N4DA 3DLEA 1S9FA 3QJLA 4ED0A 2K7JA 1VJWA 2ASLA 1DBDA 3MMJA 3QIPB 5B0FA 3OSNA 4DSKA 2OTJS 2IJNA 2J9CA 4ATNA 5T14A 1MMLA 3FMWA 2L41A 2BOPA 5K5MA 1EETA 2VC1A 1PC4A 1S49A 1HPZB 1S7HA 5E0OA 3H98A 1FA0A 4B9SA 5C25A 4ZK7M 1TQLA 4TQRA 3GIJA 4GO5X 4WU3A 1K1SA 3CC4S 2R9LA 1RT4A 1FTRA 5KT4A 2UUAF 4KV8B 1IKXA 3W2VB 1N4LA 2IC3A 3PFOA 4NLDA 4PR6A 1SXLA 5DM6Q 3T5LA 2E1AA 3DRSA 4YOEA 4OI1A 3RAMA 5LSOA 3D1HA 1GTHA 4O3RA 4Q7AA 1TL3A 2RF2B 2ZC4A 4F2RA 5D78A 2KXHA 2X1GA 1Q4RA 1UWBA 3PW7A 3V4IB 3KK2B 4LFAF 4RWXA 3HHLB 3UI3A 2I9SA 1VRTA 1Q8IA 1B0PA 4ZP8A 3S01A 1X8DA 2FJAB 1BWEA 3CDAA 5KFHA 1FNMA 2DBBA 2M52A 5T41A 3H25A 1S10A 3MECA 3KKFA 3S7RA 5F3ZA 3CCRS 3RAQA 1QAIA 4DDFA 1WEZA 1JLGB 1VQYA 5J2MB 3KHLA 3MMBB 5THWA 2QFJA 4MIBA 2KH9A 3B4MA 3DLGB 2J6UA 5KFRA 2XMUA 4FPRA 2DHSA 1JKHB 5KAKA 1A6LA 3IRWP 1XMBA 2OD6A 4FF2A 2ATLA 1X5PA 1HWJA 3PW4A 5KFOA 4M5DA 5IT0A 5KT7A 4V19X 4LIWA 5KFMA 3MEEA 2E9RX 2ILZA 4B3OA 4QW8A 3I0SB 1VQ5S 4P7VA 2MHNA 3CJ3A 3T5JA 1L3SA 4URQU 2FTRA 2BRKA 4HDHA 2VG5B 5CYMB 1IKWA 3HX9A 4LFCF 3J7Z5 4BCAA 2HNYA 5K9FA 1S6QA 2B4UA 4AFFA 4JI7F 4ID8A 4C3LA 4DEZA 2QA2A 5G4DA 1UJ4A 2MSTA 3OQ2A 5F8MA 1NKBA 3BGRB 3QO9A 1QAJA 3NNAA 3V6HA 4DQSA 4CTAB 1VI7A 1FHTA 2WSFC 4ELTA 1HBUB 1KFDA 5J2QA 1N33F 1QSLA 3CJKA 2DRAA 2YNHA 5HBMB 5A8WB 2E5HA 4IH7A 3M2VA 3K7RA 4Q8EA 1H98A 3W2WA 1B0VA 2WB4A 2GFFA 2HHHF 4IFVB 5CHCB 5EWGA 3LQVA 1M5PC 3WC0A 5KT6A 3BSOA 3BO3A 1ZAXA 4B9TA 2ZVSA 2JX2A 2JC1A 4JOUA 5FIIA 4FZVA 1M1KT 2UZAA 5E7OB 3VF0B 4X2BA 1IQTA 2GMJA 4G1QA 3U1NA 1DLOA 4OJHA 3AAWB 3O2IA 3NP5A 5F9LA 3IC1A 4J9MA 4EYIB 2HAIA 3E51A 1K0TA 5I3QA 3HKZD 4DN0A 1IM4A 3WZ0A 3DI6A 1NK6A 4W90B 2CJKA 1T03B 4QWAA 4N41A 2EBEA 2ZJQQ 3CD0A 1J5EF 4A8QA 3AQOA 4RBTA 3NAIA 1RTDB 3V6KA 4TKTA 1TKZA 1KHWA 4JI8F 1HNIA 2LEPA 4PPDA 5HP1B 2ZH4A 3CCQS 2C3YA 3MPVA 1P27B 4A48A 1U48A 4MKAA 1MROB 2ZH3A 2M5YA 2NUUG 5HLFB 2DGSA 4NLXA 5A0YB 5M2UA 4KHPF 2E29A 2DNPA 2JDJA 1U6BA 4Q8FA 2BXJA 4NLQA 3LH2S 1H2UX 3O1LA 1N6QA 1AROP 3PR5B 1NJXA 2MQNA 4I7FA 1ELOA 2ZZMA 1OPZA 1UVNA 3MM6B 1UVLA 1D9DA 3SSQA 2HLTA 5DDOC 1NEEA 1VC6A 2YKNA 3FRZA 1HR0F 2RDIA 3N79A 1TFYA 3HDSA 2QLWA 3BSCA 4N56A 4DL3A 2XMVA 2VL1A 4AUKA 1BQMA 1JNRB 2MDAA 2MJNA 2YNFA 4FNHA 1DQ8A 1HNXF 1RT1B 2XSJA 4DUZF 2FVRA 1DZ5A 1N5YA 1UMJA 5HQ8A 4ED5A 3GIMA 4QPTA 1T05B 3CCMS 2R2RA 3Q23A 3HKWA 1TK0A 2HNDB 2PC6A 2YWFA 4BWMA 4FF4A 5J2NB 1WG5A 2VPZB 1F9FA 5KFBA 3I9ZA 1N8RT 1CSJA 3RRKA 2MGZA 3CDWA 2XLKA 4QBUA 4KPYA 4NXNF 2HFOA 3A1YG 2GJIA 3LALA 4Y6IA 2N4CA 5KFTA 4Q0BA 2IVFB 2JHEA 3E2EA 2C3UA 4USJC 3E01B 1LK7A 1S1UA 3HO1A 3TVZA 2D41A 2PI5A 4EUVA 3LP2A 2YKMB 3M9OB 3PHEA 3TARA 2JH3A 2POKA 4ECSA 1O5JA 4TY8A 2AJ1A 1Z2ZA 1FE0A 1RTJA 1F60B 4F3MA 4DQPA 1RTHA 1LXJA 3Q0AA 3CT9A 3FJ2A 2PA3A 3H8YA 2LXIA 3CF5Q 1X0FA 3EXYA 3LP0A 5BJRA 2ZHOA 2ZH9A 4WE1B 3MEDA 1HYSB 2MQOA 1H7XA 1ZBTA 3G9CA 1RT5B 2UVVA 4QOTA 4N8OA 4DSLA 4NLGA 1WD6A 2C42A 1VQ6S 2J7WA 2EG1A 1U6ZA 2VG6B 1S1VB 3L7OA 3PW2A 1TUVA 5DGAA 3N5FA 2DH7A 4X66F 4J9NA 2XI2A 2K7KA 4OV1A 2HS0A 2ZFHA 3BN4A 2QIFA 1NK9A 1NH7A 1JXLA 3OJUA 2OTLS 4DX8H 2FC8A 2FGOA 3NBPB 2KT5A 2NZ4A 2XBPA 4EGLA 4ECVA 3G4SS 3NNHA 5JVHQ 4PQUA 4E8UA 4DHVA 3MMAA 1E6VA 5I3PA 3PX4A 2I5JB 4H54A 1FT8A 1S48A 2N82B 4CH1A 5FDLA 3RR8A 1PC5A 4B3MF 1LFWA 3DRRB 4I69A 2W9BB 1QE1A 3IA0A 5CZVA 1HBNB 1GAOA 2VONA 4H4KA 1FD8A 3KLFB 2KI2A 3LO3A 4Y2CA 1KS2A 3PX0A 2CIMA 5KFWA 2GGPA 2GV1A 3HXMA 2NUHA 2KJVA 1SB6A 2B6AB 2YKQA 2KB2A 3I0RA 3ENQA 1FXLA 3JTPA 3Q24A 2UVWA 4N47A 4C9DA 3CCVS 1SL2A 4QJVA 3V5RA 1YWXA 3PW0A 3CIZA 5DQHA 1FJEB 5HMXA 2GA7A 4WZMA 3PW5A 2PDAA 4RBVA 3MM5A 2ROPA 2HFNA 2WOMA 4Q2LA 3JYTB 1LFPA 1N5SA 1VRUB 3DNCA 5LJ5Y 3K5NA 1UETA 2KM8C 3SCIE 4NZ7A 4OX9F 3K59A 2JEGA 2OPQB 4DV4F 1HQUB 3F41A 1QUPA 1VC5A 3DU5A 2GQQA 5HL7Q 1VBZA 3AA8A 4H4OA 3V2UC 3T9NA 3THPA 3KJVA 5DQIA 2I2YA 2V4RA 1RT2A 2VV5A 2DVIA 2KXNB 4LF6F 2QMWA 2CG4A