2FB2A

Structure of the moaa arg17/266/268/ala triple mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
327
structure length
327
Chain Sequence
EQIKDKLGRPIRDLALSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTAAALSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of 5'-GTP to the C-terminal FeS cluster of the radical S-adenosylmethionine enzyme MoaA provides insights into its mechanism
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligand binding protein
molecule keywords Molybdenum cofactor biosynthesis protein A
total genus 105
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2fb2A00
3STGA 1SPQA 1T8XA 1T0OA 2J24A 2ATMA 4MFEA 4RLIA 1XL9A 2YXGA 1TYGA 5E1QA 1YPFA 4PTNA 3C2EA 4FIRA 1B57A 1P1XA 1KBJA 2YPIA 1VS1A 5AHLA 3TNOA 1SFLA 4CQ9A 3G8RA 1OHLA 5LKYA 2OCZA 2V5LA 1Q3NA 2DORA 4NJGA 4NZFA 3W7JA 2E6DA 3IIOA 3GX9A 1LRQA 2V9DA 5D2XA 3P81A 1FDJA 2GUUA 3UPBA 4WD0A 3FFSA 1SW0A 3LERA 3UXAA 4MY9A 5AHFA 2BZNA 1BKSA 5CPMA 1HL2A 1W3NA 1U83A 1Q6QA 1QAPA 5E0KA 4H4IA 1TQJA 3HB9A 4R7JA 1ZAJA 3CTLA 5I3KA 1H51A 1Q45A 2J9XA 4KFPA 4YCOA 3NQAA 1SO5A 3TSBA 3MYOA 4MZ1A 4WY0F 4LY8A 3DKJA 4ADTA 1GEQA 3LX9A 4O11A 5G2WA 2QUTA 3C6CA 4N4PA 1A5CA 3BK0A 1HUVA 2E6AA 2R14A 4ML9A 4LT9A 5F4SA 5BOOA 2ZRUA 4LRTA 3MMTA 1MEWA 5DELA 3HO8A 4WY0A 4A21A 3KOFA 4XWUA 1SUXA 5FF2A 2R8WA 2VXNA 4O0KA 3LBCA 1IIHA 2GQAA 3ATZA 4M6VA 3OA3A 1WOAA 3MP3A 1ME9A 2JKEA 4LS1A 3INPA 3PB2A 1PHQA 3GVGA 1K8XA 3BG5A 3W70A 3UPWA 4JICA 3O6DA 3WK2A 3QW3A 1Y0EA 1OK4A 1H7RA 4LVDA 1OF8A 1JULA 2CLEA 2NX9A 3BW4A 3NZRA 2VFDA 1LBFA 2ZTKA 3W1LA 2V81A 3TC7A 3ATYA 3EEGA 4MLRA 2X16A 4N4QA 1ZCOA 5HULA 2X1SA 3CWOX 1M6JA 2RDWA 1LBLA 2A4AA 3ZR4A 5K9DA 1XBZA 3W7GA 1W31A 3U6WA 3W2JA 1W3TA 3LHUA 3LHVA 2EPHA 5K9CA 3HIJA 4QAIA 3WJZA 2VC6A 4O52A 4LVAA 5I3HA 1SFJA 4NNCA 3LGEA 3OIXA 4K7YA 4C1LA 4ZQPA 3L5MA 4K8HA 3QM3A 3LCXA 2QCHA 3I7RA 3LHWA 4O0ZA 4LOCA 3IGSA 1ZAIA 1XBYA 4XQ6A 1EPXA 3S9YA 3W23A 4LUIA 1TPB1 1Z41A 3LI0A 4MZ8A 4HNTA 4XUGA 4FNSA 4QM1A 3P60A 1ME7A 3KRUA 1JRBA 4UUIA 4AB4A 3T40A 4KWWA 1XFBA 2E1DA 4Q33A 2R91A 3W73A 3N9SA 3G24A 5L9FA 3O63A 3NXFA 1A5AA 3F4WA 1UASA 1JCLA 1SZFA 1S5WA 1DORA 3WFAA 1P4CA 6TIMA 3G22A 3S1WA 2B0MA 1UUMA 5BW6A 4R53A 4K38A 4WXZA 4FF7A 1BWLA 5GVJA 5C2XA 1F76A 1H1YA 4IMEA 4RJEA 2GPTA 5BNKA 1LZOA 4ZQMA 2DJXA 1OFQA 2WQPA 2ZCGA 1JRCA 2WO5A 4AHPA 2HS6A 4R34A 3CPRA 4IPJA 5K7JA 3O8AA 3TIMA 1UBSA 1OYAA 3TH6A 3FYOA 4CCCA 1AG1O 4Z1AA 3S1VA 2V5BA 4QSHA 2AAMA 4HKPA 5C6MA 1KBIA 4IMCA 2QDGA 3DBPA 3GYEA 4K8EA 4HT3A 1K02A 3TROA 3L0GA 1SQ7A 2C14A 1KFBA 4N9CA 3T78A 3W07A 1H1ZA 1GOXA 4UTUA 4JTGA 4E2DA 3CT7A 1VCGA 3H53A 5FF4A 3M44A 1GYLA 2GVLA 2J9YA 4CCEA 3BG9A 4YWIA 2QCEA 4LS2A 2W6RA 3UWZA 3L0NA 1FDZA 4TR9A 1OJXA 3WJWA 1JR1A 2DZXA 4JTJA 3TQ0A 2GQ8A 4EF9A 2V82A 1VHCA 4BI5A 5LNVA 1LRTA 2O7SA 1W5NA 3W1XA 3L0KA 4Q32A 1FX6A 3IEBA 2AQWA 1H7NA 2F7FA 3HG5A 1H7PA 3MI6A 4O12A 3UWYA 2H8ZA 3C52A 3VKJA 4GUJA 5H2ZA 2QJGA 3EX3A 1JCMP 4NXKA 2Y7EA 3PUDA 1LOQA 4UMCA 2HMCA 3LHZA 1AW1A 3CIWA 2ZZ4A 3O07A 4KKXA 4M6PA 4JTTA 1TSIA 4G1KA 5ABTA 3P5YA 4NQ1A 3NL5A 3TV8A 5KTLA 3W76A 1GWJA 3W72A 2A0NA 4GUIA 4U28A 1I2QA 1SR9A 1OFDA 2E6YA 5EPDA 2G95A 4O13A 5KMYA 2PC4A 4QQ3A 4NJIA 2NV2A 5AYXA 3MHGA 5DY3A 3SECA 5J5DA 2X2GA 1KM1A 3S42A 4GNJA 1ICPA 1O5XA 3TKFA 4M6QA 3I7SA 4EF8A 4XTDA 5DCEA 4UTMA 1PHWA 3SFKA 4A3UA 2ZRZA 5AOUA 3BARA 4RKAA 1QO2A 2C16A 1W5MA 2P1FA 2ZZ7A 3TW6A 1K7FA 3W7OA 4IGHA 1OFRA 1QO5A 4UTKA 2FJKA 3MBDA 4AHQA 2RDTA 3QQ0A 4FB7A 4H3DA 4X2RA 2CW6A 2ZA2A 3QC3A 3GK0A 4LVGA 3SZ8A 3S1XA 2C18A 5CZSA 4NXSA 3TJLA 3B8DA 2WOQA 2QUVA 3N2MA 1KM6A 4WJEA 4IMGA 2NXIA 2CU0A 1DVJA 4UIOA 4HPXA 1OX5A 1KA9F 3SY5A 1I2RA 1VRDA 4LS0A 1H7WA 4Y9AA 3TCEA 3LTYA 2QEZA 4AH7A 3RNDA 1JQXA 5AHEA 1H63A 5A5WA 1FCUA 2G5WA 3IVTA 4O16A 3WJXA 5CPNA 3MW7A 1XI3A 3P84A 1TMHA 1QMLA 1KM4A 4AXKA 1HO4A 5D37A 1VCFA 3DENA 2CLKA 1OYCA 2E6FA 1XXXA 1PCKA 1WBJA 2C0AA 3MP4A 4UTHA 1SW7A 4JTSA 1KTBA 3LHTA 3R2GA 4LRSA 5FEXA 5A8GA 5DCBA 3PF3A 3A5FA 1W5PA 4HNNA 3P8IA 4Z0JA 1NF7A 3C8FA 3TX9A 2FPVA 3TA6A 5D04C 1XDLA 1JUKA 2ZA1A 3W86A 4O1BA 1WV2A 3I68A 1PS9A 1YDOA 3LRKA 4L4LA 1VC4A 3MHUA 2WKJA 1WOBA 4ZVJA 3PB0A 3GAKA 4JEQA 1TPVA 3GDLA 4TX9A 1GVQA 3MUXA 4LNYA 3W3OA 3UQNA 2EF9A 3NAVA 1QPRA 1YXDA 4GUFA 4WX2A 3HJZA 3ZFHA 2QAFA 2A7PA 1KFCA 2XFWA 4NUWA 1I2OA 2DZVA 1MXSA 1RQHA 3OVPA 1MO0A 3BW3A 4GXMA 1GG0A 4FX7A 2NV1A 2YFNA 3IIXA 1UCWA 5DXYA 3THQA 5EBUA 1NFBA 1F2JA 3QPYA 3PUEA 3EX6A 5HMSA 3EKZA 1LYXA 3FA5A 3O06A 5AYYA 2J9ZA 4FNQA 4DELA 3DFNA 3C2RA 1K8ZA 2BTMA 3HBLA 4HN4A 2W0UA 1W37A 2GJNA 3LM7A 2Y7FA 6ALDA 1PCWA 2FTPA 3MI2A 1YADA 2A7RA 2A1YA 4JIPA 3T4CA 4C1KA 3NQ6A 1XUZA 4X3ZA 1R30A 1JCJA 5D2WA 3EWYA 1WYIA 1CI1A 1VPXA 3IIZA 4O8RA 4Z1CA 2Y85A 5TIMA 1AMKA 4FNRA 3B4UA 5D2VA 1FCBA 4AHOA 3A21A 2CZEA 3O6YX 1K8YA 3LLFA 2E09A 3TMQA 5C55A 4DXVA 5HNRA 3S8HA 1A5BA 3HG3A 2C19A 1SSDA 5D03A 5CZJA 2C6QA 1G4TA 1OG0A 4ZQRA 2NWSA 1YYAA 2QCDA 3TQKA 1LCOA 5EKYA 5CPLA 3G1SA 1TREA 2E77A 2A7NA 3HGOA 1K3UA 2CLLA 2X1TA 2LLEA 3LV5A 2XN2A 3ELFA 3UWVA 5AC8A 3DXIA 1EB3A 3N2XA 4YMZA 3DFSA 3CEUA 1DQWA 1VQTA 3DH7A 4Z1BA 2E5DA 3KXQA 4IUOA 3UXDA 3W1QA 3QW4B 1M5WA 2EHHA 5HJLA 4IMDA 1IIGA 2C13A 2E5BA 3NG3A 3FEMA 4ONVA 1TTPA 2TPSA 1VYRA 3W74A 3DZ1A 1GT8A 1JQVA 4UC5A 7TIMA 3GDMA 2NUWA 3UD6A 2UV8G 1H5YA 1FY6A 2A2IA 1ZHAA 3NPXA 4WOQA 3KVKA 3N14A 1P0KA 2CZFA 1OX6A 2C15A 3E49A 5HR6A 3GXNA 3KVJA 4IJBA 3LB0A 1FCQA 5BMWA 4N9EA 4WUIA 3C2VA 4TU1A 4GFSA 2FB3A 2H6RA 3EWUA 2D73A 5G4WA 3TSDA 2ZZ2A 3EXRA 2G96A 4XBKA 4X9SA 5U4NA 1L2UA 5EL1A 1MZHA 4N2YA 4N6EA 5K4ZA 1I2PA 3PBWA 4BWLC 3Q2DA 3G0UA 1KFEA 1ZAHA 1SZNA 2NUYA 3GNNA 3BO9A 4JXCA 2NLIA 3PVFA 3CQ0A 4O19A 4IWWA 4H6KA 5DXXA 2CLIA 5IM51 2VELA 3LTPA 1K7EA 3C56A 5U7SA 1ALDA 3L5AA 2O7QA 3OVRA 5LNWA 4JDYA 4NJJA 1AL8A 1VH7A 5FF7A 4MY8A 2H90A 1A5SA 3A23A 1C29A 1IGSA 4NX5A 3EKLA 3CU2A 4IMFA 2PRMA 5I3JA 4OT7A 2CZ5A 4DBEA 3PY2A 3WJYA 4S2CA 4DF2A 4O14A 1BWKA 2CWNA 3FIGA 3LXBA 1I2NA 1Z42A 2ZYFA 3G3MA 4JYDA 1VJIA 5G1TA 3CM4A 4MLJA 5FI8A 4MY1A 1FWTA 2WNNA 2WV8A 1DOSA 4MKNA 3DI0A 5D02A 3W2NA 3PAJA 2FFCA 4QNWA 1S5VA 3PM6A 3NQDA 3GDKA 5TQLA 1RQEA 1VCVA 1XBXA 4M7TA 4PODA 1ML1A 3UZ5A 5LHEA 2V0TA 1JCNA 3C4UA 3SJ3A 1TCDA 5EMUA 3NZ1A 4MJZA 1GG1A 5G2IA 1W0MA 5BMXA 1FUYA 2JKPA 4JGDA 3C3NA 3BPWA 2Q3RA 2Y70A 4XKYA 3GKAA 3GB6A 3QQ1A 3W84A 1BEUA 4JIQA 3Q58A 4DO6A 2BX7A 4GC4A 4RXFA 3QPZA 2Y62A 4JDBA 3SIZA 2ZA3A 1H7XA 5DCDA 4FXRA 1K7XA 1TPH1 2YCEA 5F2LA 3GKFA 1NSJA 1W54A 3GIYA 4QNEA 1PE1A 3VCRA 1ICQA 2TYSA 1DKWA 3NOEA 4EIVA 4UTJA 3CC1A 4ORMA 3W1UA 3WJSA 3P67A 4I7UA 3CEPA 4K6AA 4LUJA 1THFD 3G1DA 3BV4A 2JBMA 1GVFA 3MJYA 3DI1A 3P62A 5KINA 4ADUA 3NQMA 1EIXA 2YX0A 3NDOA 2EGZA 3ABRA 4BK9A 1XBVA 5CGQA 2A85A 3L68A 3BLIA 1FXPA 2A6LA 3A22A 3W6YA 4LC6A 4OQVA 3RMJA 3W88A 3QSRA 4Y6GA 4YLWA 1G7UA 1C8VA 3QFEA 4JTLA 3CHVA 2QKFA 5D2YA 4EOUA 1R2RA 5G5IA 3CB8A 3W1PA 3SGZA 1XKYA 3GDTA 4DF0A 3E02A 3W71A 3MYPA 4RX0A 1YTEA 4MVAA 4ADSA 3NQ2A 4NJHA 1QFEA 5HUOA 2OX1A 1GVOA 4FHAA 4QJ1A 2V2DA 1TTJA 2ABAA 1WX0A 4JR5A 4D2JA 2X1UA 3TFCA 3W2UA 2PE4A 4U4MA 4R33A 3WK1A 1OFBA 2VFEA 4JN6A 4O1CA 3LLDA 4UTLA 2Q3OA 3B03A 4KFOA 2ZZ1A 4LTSA 4S1FA 1DQXA 1H62A 3TW7A 3GNDA 1TIMA 3S5YA 3SGUA 3TQVA 4A22A 1W5OA 4FO4A 3KRZA 2DJLA 4RZ5A 1JUBA 3TR2A 4LVBA 2Y7GA 3LCLA 4NNAA 1TTQA 2E5CA 1MEHA 4DEFA 1R46A 2W79A 4GWEA 1WXJA 1FCVA 2WSQA 3EXTA 1RD5A 2NZLA 4ICNA 3TAOA 4CLMA 1G4PA 4JTFA 4O54A 3YPIA 2QF7A 3IVUA 1YXCA 3QMTA 3HQ1A 4Z08A 5AB3A 1U5JA 1G67A 2TSYA 1O94A 5LGZA 3FYPA 2QAPA 4UNKA 1RPXA 3KHJA 4E2BA 5KITA 3LV6A 4JX6A 4LC8A 1KM5A 3G0SA 3UZJA 2VFGA 4RK8A 3RLUA 2QJIA 5DLCA 1O4UA 1Z44A 3NGJA 4MYAA 1KLZA 4OWGA 4JS3A 2PCQA 4GUHA 4O57A 3G1HA 1OF6A 3O6CA 3R12A 1T96A 2YR1A 1OABA 2C3ZA 3F1QA 4UFHA 1LP6A 1K03A 2FB2A 1JVNA 2V2HA 1QPOA 3BVJA 1XUUA 5CKSA 4WOZA 1W5QA 3Q94A 2V2CA 3N9RA 3DHDA 3O15A 3GXTA 2RDUA 4KFNA 2ATSA 4K39A 2NX1A 2ALDA 3GAYA 2BLEA 1X1OA 5LNSA 4I9AA 3SW6A 2Z1BA 2DZWA 4LW7A 1PVNA 1S5TA 1OX4B 3W7QA 3B0UX 5EA9A 4UFLA 3SSJA 3P80A 3TMLA 4XKYB 5KZMA 2OZ0A 2ZZ6A 4N9BA 1KLYA 1UJPA 2DP3A 3FKKA 3PR2A 2DZTA 3ZS4A 4K37A 4BI7A 3M5XA 2B7NA 2JGYA 4FNPA 1O95A 1XCFA 4AVFA 2B7QA 3WK3A 2JK2A 5CPOA 5CZTA 2QCDB 5FEWA 3ZWTA 1HG3A 4O10A 3W9ZA 4A2SA 3W7DA 3T55A 3NQEA 4JY8A 1DJNA 4MUZA 4NVTA 4UMBA 3S5NA 3T44A 2QCMA 4YCPA 1D3HA 4P61A 1W1ZA 3W2KA 4QITA 1A50A 4OE7A 1M7PA 1SZGA 5F2IA 3S6DA 3RU6A 3IIPA 3I6RA 3G1VA 3QRHA 1B3OA 1L6YA 4EVZA 3EXSA 3S0CA 3G3DA 2I9EA 3NPVA 3PSVA 3DFTA 3R89A 3IIVA 4N6FA 3P7YA 3VI2A 1NVMA 4PFMA 4O15A 2QJHA 3NQGA 3AO0A 1JCYA 3LI1A 1OFEA 3STCA 4WY0B 1GZGA 1SZEA 4A29A 1ZALA 2ZZ3A 1LLZA 1JUEA 3QZEA 3TK7A 5LZLA 3V75A 3LXCA 3M6YA 3C2OA 1BTMA 1S3HA 4ZZ9A 1PIIA 2VOMA 5F1UA 3TU9A 2P0OA 3W7RA 2J88A 1V5XA 1TV7A 1LLWA 3LRLA 3NA8A 4HNUA 4JX4A 5K4XA 2H3DA 3BG3A 3UY8A 2VEPA 2RH9A 4WZHA 1N7KA 4L4MA 3DHFA 1SW3A 1TPEA 2QCGA 1UUOA 4AWUA 2QCLA 5I3GA 4FIQA 2VENA 3QJAA 3HPZA 2OMAA 1OK6A 1TPC1 1M7OA 4UFJA 2FIQA 3S1UA 3SI9A 5AHMA 3P8JA 5HWNA 4JX5A 4JYFA 4BWLA 3M1ZA 1A53A 4X22A 1EP1A 1HO1A 1MSSA 4UNLA 4JNMA 4IX2A 2Y88A 2X1RA 3U2OA 3B0VC 1R2TA 1G6CA 2YYTA 1Z48A 3TDFA 3TSMA 2YGYA 3UWWA 2YW3A 3NPWA 2BXVA 1O60A 4WXYA 3W75A 2FDSA 4GRSA 1CW2A 3RFAA 3LRMA 3G1XA 3NQCA 3O1NA 5HWMA 1QOQA 2WJZA 3WK0A 4AF0B 2Q8LA 1OFAA 3W83A 1GJPA 3OVQA 3QMRA 2CLFA 3MI3A 2VEKA 4FEZA 1TV5A 1TRDA 5MHBA 1HFBA 1QWGA 2FPYA 4B5NA 4RV8A 4Y8FA 1IXQA 4MYXA 4LV9A 2WSYA 4QISA 3M47A 4UTTA 1ME8A 3M5YA 2RHGA 3Q37A 1B4KA 4PEKA 3CLMA 3NL3A 5G4EA 3NL2A 2WSRA 3W7LA 1L6SA 4O18A 4PL1A 3RF9A 1SSGA 4M19A 1H61A 3L65A 1OVDA 3W1AA 1TJRA 3E9AA 5F4XA 1EA0A 1VYSX 2KZHA 1P5BA 2ISWA 5HWJA 1F5ZA 4OHQA 4CNOA 4M5PA 4ALDA 1EWEA 3IGUA 1V7YA 1CX9A 2P10A 3F03K 5LNUA 2OT1A 4UTIA 4DBDA 2PURA 1IXOA 2VFFA 3HPSA 1W8SA 1OYBA 5K2ZA 4RZ6A 5T26A 3W85A 2ISSA 5DN1A 3G8EA 4ZQOA 2F84A 2ISVA 2VFHA 2V8ZA 3BGJA 2ZRXA 3ANYA 4NJKA 5F1VA 2OT0A 1Q6OA 1L6WA 3M0ZA 2XN1A 1G4EA 3NYZA 4A2RA 5DY2A 1TPUA 2Y7DA 4XBSA 2Q8ZA 2DZPA 4FX8A 1KM3A 3BLEA 3MP5A 3NNTA 3B04A 1QPQA 3FJLA 3GZ3A 3P82A 1TV8A 5AN7A 1ZY9A 4JTEA 1ZENA 4UTTC 5FEZA 3VE9A 3W7EA 2TMDA 5FEPA 2GOUA 1DV7A 4JTIA 4MFDA 4MJMA 3JS3A 4O1DA 3G1FA 3F4NA 3MWAA 2EKCA 1WBHA 4IPIA 1XDMA 1ADOA 3W2MA 3EX1A 2I1OA 1YDNA 4Z0SA 1W3IA 1WA3A 1LM1A 2CLMA 3CIXA 3S5ZA 4M7SA 4FNTA 1VLWA 1VZWA 2YFOA 4O4VA 4AMAA 2NX3A 3NQ7A 2R94A 1TPFA 4ZL1A 1E51A 3M5VA 3NM3A 1DL3A 3GR8A 4UR7A 1N8FA 4WQ6A 1NEYA 4O1AA 4OV4A 4Z1DA 3UNDA 3USBA 5J5RA 1ZJIA 2RKXA 3HGRA 1HTIA 4RZ4A 4YL2A 5LHFA 3TE9A 2XN0A 3ZWSA 4CQAA 3B0PA 3VE7A 5BRBA 1R2SA 3BGGA 5KZDA 1I4NA 3PWAA 4KWVA 5F2GA 5LGXA 1L9WA 5AHNA 4TMBA 3QMSA 3CWNA 4HHPA 4RR4A 4JTKA 3KVMA 1WDWA 1FXQA 4DO4A 2NWRA 1H60A 1YPIA 4IXXA 3LHYA 1EWDA 5I3IA 2JGQA 3EWZA 2BSLA 3BLFA 1R47A 4ORIA 1KFJA 5CG7A 4PCFA 4E38A 2VFIA 2WNZA 1ZFJA 3FJ6A 4O17A 1TPDA 1F6KA 4CNPA 2Z2UA 1TO3A 2WNQA 3R13A 3NO5A 1FWNA 5CSRA 1KTCA 3W1NA 3A9IA 2E68A 3DGRA 3PBVA 3N19B 1ONRA 3FKRA 5D09A 4FXSA 4DF1A 3PBYA 1IF2A 3KFTA 4LVFA 4MOZA 1D9EA 2DZUA 2ABBA 4CQ8A 3STEA 5KSWA 4S2BA 1LRNA 3UWQA 1FWRA 3PUOA 1FBAA 5D32A 5D33A 4UFKA 3L66A 2GVJA 3W1RA 2RFGA 1QR7A 3HG4A 4GBUA 3W87A 4UFIA 3O05A 3W22A 4RXGA 3PC0A 4XZ9A 4LV4A 3B06A 1QOPA 3DFOA 2JKAA 1YLVA 1G4SA 4O50A 2QCFA 2Y6ZA 4I7VA 2NUXA 2I14A 3M43A 2OJPA 1X7FA 3C61A 3HGJA 4ZQCA 3DFQA 1TRIA 5G2HA 4HSOA 3PG9A 5FF0A 3UY7A 3TXVA 2A21A 1C9DA 1KFLA 3G18A 3NVTA 5AC7A 3IVSA 4NU7A 3GDRA 3NEVA 4OV9A 1G7VA 1YTDA 5IBXC 3JR2A 2Z6JA 3LDVA 2FLIA 2DZSA 3O16A 1WQ5A 3HF3A 3M16A 1EUNA 3H54A 4NX0A 1MEIA 1EP2A 2Z0IA 2NXGA 2ZRYA 4IXHA 3RLVA 2NXHA 2GQ9A 3QSTA 4JTHA 4NT0A 1NF0A 1VR6A 4HNVA 1TPWA 3KRSA 3NQ8A 5HQEA 4TMCA 3EWXA 4AF0A 5K3VA 2X30A 1IXNA 1G69A 3LXAA 3VNDA 1TB3A 1J2WA 3HG2A 3LCGA 4W9TA 3QH2A 4N9DA 2ZBTA 4UXDA 1X8FA 1FWWA 1KV8A 2HTMA 3L5LA 3NR0A 1F7BA 1O5KA 1ICSA 1GTHA 4XTIA 3W7MA 2QCCA 4NNBA 1LBMA 1Q6RA 2YW4A 2HSAA 4UTWA 3R8RA 4DPQA 1QPNA 2CZDA 5D38A 2BWGA 4N02A 1GQNA 2QR6A 4GJ1A 1GTEA 1YTKA 3M7WA 2FQIA 5AHIA 1QDSA 1J4EA 2TRSA 1J5TA 4IX0A 4DQWA 3DAQA 4Y96A 5DBTA 4NZJA 3GR7A 8TIMA 1F6PA 4LWWA 4OBTA 3EB2A 3L21A 3C2FA 4GE8A 4DPPA 2VKZG 3GXPA 5FF3A 3W7CA 3KX6A 1OFPA 1IXPA 3IGXA 4JY9A 4Y90A 5KZEA 3IV3A 3E96A 4AWSA 5K9XA 2IQTA 2VEMA 4AWTA 3W7NA 4PA8A 5HUPA 1LORA 2QDHA 3AJXA 3STFA 3M5ZA 3ABOA 4RCXA 4DO5A 1LOLA 2YDAA 1EX5A 2ZDRA 1KM2A 1QNVA 2CLHA 5AYZA 3BW2A 4JYEA 3PSWA 1EUAA 2QCNA 3G1YA 3OHIA 4FX6M 2B4GA 1P0NA 1LTDA 3MHFA 1PV8A 2A5HA 1I8JA 1H7OA 2ZRWA 1VGAA 3D0CA 5SWUA 4HSNA 4P2VA 4O28A 2CFFA 5HR7A 3HMJG 1T99A 5TBOA 2QUUA 4CCDA 3NQVA 2FPTA 5D2TA 1KFKA 2Y89A 3RK8A 3EX2A 1EP3A 2H8XA 1W56A 4BI6A 1SO4A 1EEPA 3U8GA 1KM0A 5HINA 4UCGA 3LCIA 4UR8A 4HPJA 3TUUA 5LNRA 1GVSA 2Z6IA 4MPQA 1X1ZA 5AFDA 5D05A 5LSMA 3NQFA 1YXYA 1B4EA 3JRKA 3W7IA 1FQ0A 3H55A 5CZ0A 4BR1A 1JJKA 4TO8A 2J27A 3I65A 3THAA 3DKLA 3W1TA 5H91A 4HIBA 1DJQA 1F74A 3LCHA 5IBXA 4IOTA 4O4WA 3W2LA 5DBUA 3OBKA 2EAWA 2GJLA 4PH6A 4MIMA 4EWND 2G97A 4UFMA 2Y61A 3HOJA 4K7VA 2VEIA 3PBUA 3TAKA 1I45A 4UMAA 3S5OA 4GUGA 5F2MA 5L6UA 3B05A 3A5VA 1UB3A 3KAOA 3QYQA 4BF9A 4ZQNA 3L2IA 3HPXA 3G0XA 2A6NA 3L9CA 3TC6A 3ABSA 4PC8A 3UWUA 2ZFAA 1LROA 1RQBA 2Y63A 3PG8A 3LCFA 1RZMA 1SO3A 3LTSA 3FOKA 2YZRA 3DFPA 1DHPA 1YDVA 4OU1A 3T7VA 1Q6LA 1B9BA 1QCWA 3EWWA 4JTUA 4QIUA 3TXZA 3M41A 2V30A 3NL6A 1TJPA 1D3GA 1AW5A 1VYPX 3P61A 1GPWA 2H3BA 3K30A 3R5EA 4TIMA 2AGKA 3UYCA 3HGSA 4I7WA 1LOSA 2WPBA 3N73A 1RVGA 4UTWC 1NAL1 2B7PA 3C0JA 5F4WA 3M9YA 4FNUA 3E12A 4K36A 5D30A 3OEXA 2C1HA 3VFLA 4CNNA 3E0IA 3L67A 3P5ZA 3W7KA 4JD4A 4ZMGA 1TTIA 3G1AA 3W7HA 5C54A 5EY5A 3LBMA 5EYWA 4E0CA 3TFXA 3FS2A 2DU2A 1F05A 1OFOA 1WAUA 4AEOA 2YYUA 1XC4A 2PRLA 4LU0A 5E93A 3NM1A 1XM3A 3SR7A 4IQLA 1OX4A 1AK5A 3LCWA 5G1YA 3EX4A 1GYNA 1JCXA 3MO7A 2B7OA 3QEZA 1KV5A 1TQXA 4Q4KA 3W1MA 3ABQA 3LOTA 3QF0A 4YXGA 1SU5A 3KVLA 1AL7A 1SO6A 3PULA 1LDCA 3NPUA 3I7QA 2GVGA 1FDYA 1ZNNA 4J9JA 3TJXA 3OG3A 1AW2A 3PS7A 3FLUA 5C5YA 2ZZ5A 1DBTA 1GVRA 1PL9A 3EWBX 2ZTJA 1RV8A 3IRDA 1KTNA 1VLIA 1H50A 4O53A 5FESA 5CSSA 3N3MA 4OGZA 3A24A 1VHNA 3W7PA 3P74A 3GLCA 2PRHA 2J6XA 4POCA 1N55A 2ZRVA 5I3FA 2ZQ0A 4MZYA 3V1PA 1KW1A 4BFAA 2CLOA 3N34A 4AAJA 1X6UA 5AC6A 1RR2A 2HS8A 4PL2A 1F73A 3MBFA 1FWSA 2YSWA 3DU0A
chains in the Genus database with same CATH superfamily
1XHGA 1T8XA 4CNTA 2J74A 1UQYA 1RLCL 3CWHA 2L5HA 3H8AA 3C2EA 4FIRA 1P1XA 3VMOA 2ESCA 2YPIA 2VM8A 1VS1A 5AHLA 2X8RA 2CZVA 1SFLA 1IGWA 4IIHA 1NQKA 4US5A 5LKYA 1JNDA 3CPUA 3LG3A 3WNLA 2F38A 4NJGA 1W9DM 1E1EA 1LRQA 1ISVA 3OGRA 4H8UA 3T0CA 4HA4A 1KGXA 3AU6A 1TV3A 3BAWA 4WD0A 4D1IA 4GQGA 1BKSA 4ATWA 5CPMA 3THCA 1W3NA 2E40A 1K9FA 1ZAJA 3T0TA 1H51A 3SN1A 4IIFA 2ZC8A 2OYKA 4WKFA 2G37A 3E0WA 3NQAA 1SO5A 3APTA 1HN1A 4MZ1A 2ONEA 1P7TB 1W3LA 4DLMA 1BXBA 2VJXA 1J5SA 1OY0A 3B9NA 3TLLA 3LX9A 4N4PA 2INZA 1A5CA 2UY2A 3FDKA 4MJ4A 5BOOA 3WLTA 4LRTA 3GG7A 3MMTA 5AC5A 4H9ZA 4NZ3A 4HB7A 3ORWA 3VOIA 2BY1A 2R8WA 3VKKA 4UOJA 4IQDA 1IIHA 3ATZA 3L4UA 1ME9A 1PTGA 3GFYA 4LS1A 3WFZA 3INPA 5A1AA 3QLDA 3BG5A 3W70A 1Q7ZA 3QW3A 3GUWA 5LA0A 3Q45A 1H7RA 2V3FA 1TX0A 4BEQA 1XG4A 3BW4A 4WDUA 4EPEC 2XIBA 3T2PA 4MNKA 3VFCA 3DFHA 2X0HA 4NAFA 4Q6XA 3SAZA 1GHSA 3CWOX 5A69A 1LBLA 1M41A 1AMYA 4Q8OA 3ZR4A 5K9DA 1XBZA 2XWEA 1FH7A 4PRTA 1DJYA 4QAIA 1VFFA 4CN6A 2VC6A 1SFJA 1QASA 3CYVA 3OIXA 4ZQPA 1NY1A 5I0DA 3WNMA 4F2UA 3LCXA 1TE6A 4DUOA 4LOCA 1XLIA 4RDWA 2OYLA 1XBYA 1U33A 3S9YA 2I16A 1HP4A 1TPB1 3ARYA 1Z41A 2WVSA 4V1YA 1XIJA 2QPSA 3DIPA 3TN3A 3FSTA 4FNSA 1PJ9A 4UUIA 1J96A 4AB4A 1XFBA 4EPKA 2YL6A 3ZOAA 2R91A 4B3LA 3BMVA 3WMLA 1YW1A 3VNZA 1ECEA 2ODOA 3V36A 5LIUX 3H23A 3NZQA 4GYPA 3F4WA 2QJNA 4XZWA 4N7QA 5A95A 2V67A 4RNJA 1P0EA 3CHEA 4AD1A 2VUYA 4G2DA 4ICMA 3LY0A 4E3TA 4K38A 5GVJA 3H24A 4DJED 4KWSA 3T42A 1PZ3A 4IMEA 3G6LA 2GPTA 5BNKA 1KCZA 2DJXA 1OFQA 2WQPA 3RM9A 3S2NA 3GR4A 1JRCA 1UD2A 2PS2A 2XYLA 3ITVA 2GVYA 1OYAA 3MPGA 3PTQA 3TH6A 5CPTA 2KAUC 1AG1O 4F40A 1J79A 2FTYA 4HU0A 3IV8A 4HKPA 3C2YA 2REQB 3L0GA 1LWHA 1EFZA 1H1ZA 1GOXA 2PWGA 4JTGA 5CJMA 3CT7A 1S5NA 1J2BA 1DXIA 3FA4A 2J9YA 1YHTA 3GW0A 4UOZA 3BG9A 5FJPA 3LD5A 3UWZA 3D6NA 3L0NA 3UVIA 3D3AA 4TR9A 4DWSB 1OJXA 5DFAA 3WJWA 1JR1A 1IEWA 5H8UA 4JTJA 3C0SA 3TQ0A 3W6MA 3W82A 3AYVA 3N17A 4BI5A 3UXKA 1LRTA 1UKOA 3TA9A 4Z2IA 1W5NA 3L0KA 1FX6A 3G6MA 3UWYA 3MT1A 4GUJA 2YJQA 3HA1A 2YDRA 4NXKA 5BWAA 2Y7EA 1LOQA 4AIBA 2D24A 1GKQA 2A3LA 2X7VA 2ZZ4A 3O07A 5DEZA 2J7DA 1MW2A 5ABTA 4Q7IA 4I6KA 3RXZA 3KDOA 1UKTA 1GWJA 1AJ2A 5IXEA 1S2WA 1SR9A 1OFDA 2E6YA 5EPDA 4Q6JA 1GQKA 3S6TA 1NDWA 4O13A 1NQ6A 2PC4A 4ATDA 4QQ3A 4NJIA 2NV2A 3HQOA 1K77A 5AYXA 2ZE3A 2WVUA 1DWHM 1O5XA 4EF8A 4UTMA 3I10A 3SFKA 4G5DA 3VZYA 2ZRZA 3F4CA 2HJPA 4GIAA 3R4IA 4E4FA 1W5MA 1AA1B 1W2VA 1PDYA 3N18A 3PTKA 4IGHA 1NIUA 1OFRA 2QZRA 3FNDA 2ZUVA 1XQKA 2C7FA 3ZR6A 4LANA 2FJKA 5E0FA 1QI4A 3VD5A 3AS0A 1EBHA 4X2RA 1XCWA 3QC3A 4AZHA 3S1XA 4AY7A 4NXSA 1QNQA 3S2CA 2V5DA 2QXWA 3IAPA 3CIVA 1DVJA 1T41A 5HMDA 1I2RA 4Y9OA 3S2JA 4C65A 4D71A 4E6MA 1JPMA 1C8YA 2QEZA 1DHKA 4AH7A 3RNDA 4XAZA 1H63A 1BD0A 2J13A 1BQCA 3IVTA 1YBQB 2CXEA 3E0VA 5HQMA 3TYAA 1KM4A 1KNWA 3R58A 1E9YB 3DENA 3CV1A 3UYIA 2E6FA 2YL8A 3OZOA 1XXXA 5EFFA 4LCRA 1WBJA 3RO6A 3K5XA 1FWAC 1SW7A 4JTSA 1S2CA 1CGUA 2QUNA 3A5FA 1HJUA 1W5PA 4AEEA 2XVGA 3P8IA 1NF7A 4ACZA 3TX9A 5D04C 1XDLA 1JUKA 3W86A 4O1BA 1PS9A 3RR1A 4L4LA 2WKJA 1WOBA 3PB0A 3GAKA 4JEQA 4JEJA 1TPVA 4PUUA 4C6PA 2WWCA 4CQCA 4D8LA 3W3OA 2WBKA 2EQDA 3AHZA 3NAVA 1YXDA 2XVNA 3ZFHA 2P50A 4YWSA 6TAAA 3AMGA 5C7HA 3SSZA 3TOYA 5CCZA 1MO0A 4A8NA 5A8MA 3ZYZA 2YFNA 3IIXA 3VDHA 1UCWA 4IT1A 5KZ6A 5D9OA 3SCVA 1QU4A 2V5JA 3VGBA 1F2JA 1W1PA 3EX6A 3EKZA 4IICA 2J78A 3MKVA 4FNQA 5GJNA 1W37A 4P5UA 1REQB 3LM7A 2FTPA 5HNTA 2J7GA 4LBRA 2R1LA 4IQEA 2YOCA 2OGJA 5CH9A 1B30A 3UBPC 1CI1A 5TIMA 3DUGA 5CLTA 2J66A 2EPMX 3BXWA 3B4UA 3NTYA 1LWJA 1UYQA 3QV6A 4LX4A 3O6YX 2OEMA 2E09A 3S8HA 4PB3A 1E9IA 1K6AA 4Q4SA 3U3HA 1JZ8A 2C19A 4XAFA 1CZ1A 5CZJA 4F0LA 3B8UA 2FMOA 1LCOA 3HGOA 3WCZA 3LMZA 1K3UA 3ITGA 4HNOA 3LV5A 2XN2A 4F3HA 1R3QA 4PMJA 3LA4A 1LWIA 1EB3A 1VQTA 3KXQA 4B15A 1OINA 4H8NA 5D9NA 1HNYA 3NOYA 3QW4B 4HCDA 4IMDA 3WMCA 2NV9A 1V4YA 1IIGA 2BDQA 2C13A 3SB0A 1VIWA 3FEMA 1I9CB 1VYRA 3QZAA 4GACA 3W74A 3DZ1A 3FW6A 4UC5A 3DHUA 2XZ9A 3WDPP 1KC7A 3N14A 2BV9A 4KETA 1IT8A 1BRLA 2OVLA 3GXNA 4IJBA 1FCQA 4XD4A 5I03A 2FB3A 3GHTA 5G4WA 3CO8A 2EPLX 1D8WA 5BCAA 4CD7A 1MRQA 5EL1A 2WMIB 4N6EA 5K4ZA 2NQ5A 2R1PA 3Q2DA 5JMUA 3G0UA 1KFEA 1Q5MA 1SZNA 4GVIA 2NUYA 2VCAA 2BY2A 2NLIA 1ZLPA 3CQ0A 1E6SM 1MXGA 2CHOA 1DTNA 4O19A 4JQ4A 5FAGA 1ZZMA 5IM51 2VELA 4L9ZA 3KW3A 2GUBA 1M68A 3ZO9A 4AYSA 2DIEA 1K7EA 3C56A 1AH0A 4J7RA 1V02E 2O7QA 5TAOA 3ZXWA 4N0RA 4NJJA 1VH7A 4MY8A 2H90A 1A5SA 3WL1A 1C29A 1IGSA 3EKLA 3CU2A 3WLSA 4IMFA 3SCRA 4OT7A 5A6SA 1JYWA 4I8DA 1E15A 4JYDA 2ZYFA 4WEVX 2VQUA 4OBRA 2BODX 2CETA 3CM4A 1EJ7L 2WNNA 2E9LA 3LSBA 3MSGA 3DI0A 4AD4A 1Y65A 1WZLA 2I9UA 1YNQA 1S5VA 4QNWA 3NQDA 4WLCA 1TWIA 5TQLA 1ZGDA 3VOFA 2WCAA 1ML1A 4OZOA 1Y5XA 2VEFA 4HNLA 2Y8KA 1V93A 3SJ3A 1TCDA 3WBXA 3IUIA 1W0MA 1EJWC 1FUYA 4YU1A 1V8EA 2NQHA 3WQ4A 2OKTA 1E3ZA 4IG2A 4XKYA 2PGWA 4H8HA 9XIAA 3Q58A 4DO6A 4RXFA 2JF7A 3ABZA 3PZ9A 3QPZA 2Y62A 3B8VA 1Z32X 4FXRA 3TW9A 2OEJA 2YCKX 5C9RA 5F2LA 9RUBA 1NSJA 1W54A 4C6FA 1EXPA 4QNEA 3VCRA 1JZ5A 4HSHA 4UTJA 4W7UA 4J3TA 3DG3A 2HVOA 2JBMA 4QROA 3MJYA 4L9XA 2Y8UA 4O8AA 3NQMA 2NT1A 1XBVA 4DYEA 4OUEA 3L68A 2ISFA 3W6YA 4LC6A 5DQPA 3QSRA 4Y6GA 2FMNA 1B1YA 3QOMA 1C8VA 3QFEA 3R8GA 1VKFA 5D2YA 4EOUA 1R2RA 5BROA 3MKCA 1EO5A 4GZIA 2ZUUA 4RX0A 4LAZA 4MVAA 4WCJA 4Q8PA 3NQ2A 1MZRA 2OX1A 3FVMA 1NWRA 1WX0A 4D2JA 3W2UA 1W1TA 1NFGA 3WK1A 4ERGA 2BVTA 3O7UA 2P8BA 1QNSA 2JIWA 4M1RA 1FP9A 1DQXA 3TW7A 5HOSA 3S5YA 1R8LA 3WG6A 4F0HA 4YTQA 4FLQA 1XYMA 4JFVA 1W5OA 4FR1A 4FO4A 1RK6A 3GNPA 3WQ8A 4PMVA 1K4HA 4GWEA 3EXTA 2NZLA 2RAGA 3TAOA 2E7FA 1G4PA 2EG7A 3S9ZA 4ZXLA 2QF7A 4A4AA 1YXCA 4Z08A 4KQNA 1U5JA 3FSUA 1RH9A 2TSYA 5LGZA 1RA0A 2QAPA 4E2BA 3WF1A 2D22A 4H7CA 4JX6A 4LC8A 3G0SA 3UZJA 3NSXA 4RK8A 1QHPA 1XP3A 4MPKA 4MYAA 4GUHA 3G1HA 1OF6A 3PUGA 3UA3A 1T96A 4W4QA 3RCYA 1HJVA 4AG0A 2ZUSA 1PAMA 3F1QA 4GVFA 1ITXA 4PBEA 2AKMA 1JCTA 3V16A 2D0HA 4MM1A 5CKSA 2VURA 4WOZA 1W5QA 7REQB 3GXTA 1JFXA 2XIIA 1J93A 4K39A 1RJRA 4Y7EA 2G4JA 1BF2A 2GK1B 2VRJA 5ENLA 4HJFA 5E09A 2NQJA 5I24A 2DZWA 4LW7A 3W7QA 3WNNA 3H2FA 1UG6A 5IDIA 3IACA 1GOKA 3PANA 1GQIA 1Q6FA 4N9BA 3PR2A 3J7HA 1OC6A 3M5XA 2W27A 3BJFA 1V02A 3PJTA 1PBGA 1BXCA 1L8PA 1O95A 1XCFA 2INFA 1KR0A 2B7QA 2XIOA 3BCFA 1BYCA 2QCDB 3OQEA 4I9MA 1W1B1 1VBHA 2DFAA 1SFTA 4D6IA 2OX4A 2PTXA 3W9ZA 1MUMA 1EDGA 2ZX5A 3PJUA 4HBKA 4JY8A 4H2CA 3VZXA 3CUZA 4NVTA 4UMBA 2WQDA 4F2BA 3T44A 4CEXC 2QCMA 4YCPA 1XQLA 1A50A 4OE7A 5F2IA 3GVWA 4QG6A 3G1VA 4JHOA 3K1DA 2OSXA 3MCNA 1CT5A 3EOLA 3NPVA 1ENUA 2YBTA 3DFTA 3QN3A 5CXPA 3CQIA 3VI2A 6REQA 4PFMA 1JCYA 1TUFA 4WY0B 3AMDA 4A29A 4ZA0A 2ZX6A 2RGMA 3LXCA 3WLNA 2DSUA 4UZSA 3FCPA 3T8LA 2G3FA 3QQWA 2AL2A 4BQ5A 1L6FA 3WQOA 1NARA 2J88A 1VEOA 2UY5A 1TV7A 1LLWA 3LRLA 4JX4A 3AHYA 4RE0A 5T8GA 2DH3A 2H3DA 3BG3A 2UY4A 3UY8A 3AISA 4GI6A 1XIFA 2W63A 3PBGA 4XK2A 5FD0A 4AYGA 3RITA 4JHZA 5BXSA 3DHFA 3EMZA 1FFQA 1E56A 2QCLA 3HMCA 2CBIA 3QJAA 1OK6A 5DRIA 2Y4SA 4WGXA 1M7OA 2FIQA 3S1UA 2HEJA 3TCSA 5B80A 4D6JA 4JL2A 1VBRA 3P3BA 3UR2A 5JIWA 1R3RA 3GHSA 3L4VA 4JYFA 3WLPA 1A53A 3KTCA 1MUWA 1EP1A 2VMFA 1MSSA 3VA8A 3GU1A 4GJIA 2PDHA 2F6UA 1VBGA 4IPNB 2VC9A 3VIFA 1DIOA 4KESA 1Z48A 2DVTA 3DESA 1XH1A 3O0FA 5A8NA 2QVNA 2PLJA 4JNZA 1EJSC 1WDRA 2VR4A 2PBGA 1O60A 3PJXA 3QGAC 3FY1A 4OKDA 3LRMA 3AHXA 2V63A 3O1NA 1QOQA 1US0A 1CLVA 2Q8LA 1OFAA 2Z27A 4IGNA 3UVAA 3QMRA 2CLFA 3FDGA 4FEZA 1QWGA 2FPYA 4B5NA 4Y8FA 3S47A 2PDJA 4MYXA 4LV9A 4QISA 1UPMB 1ME8A 3AYSA 3M5YA 5HJYA 2PEVA 3T9PA 1XLBA 3NL2A 3O0KA 2E28A 4PL1A 3WLIA 1KBKA 2XDFA 4M19A 3LS9A 3L65A 1OVDA 1TJRA 2F2KA 3E9AA 1VYSX 3EPOA 4F9JA 4V15A 4CNOA 4M5PA 4ALDA 4OTKA 3F03K 5LNUA 4UTIA 4AY1A 3CO4A 2PURA 2VFFA 3HPSA 4ZFMA 2YCJA 1W9PA 5T26A 4KCTA 1C9WA 1VEMA 3TZNA 3OU8A 3LUTA 1W9BM 2VFHA 3LU2A 3GFZA 4NJKA 3AMCA 3IWPA 4UQEA 2ZADA 3BLDA 4GNVA 2NW0A 3NO1A 5DY2A 1PZ0A 1C92A 3II1A 1DP0A 3N9KA 5LYRA 5I02A 1FFRA 3BLEA 1V79A 4YPJA 4NZCA 1GOQA 1TV8A 4KIEA 3WYZA 1ZY9A 4PB5A 1K8CA 1ZENA 4K1GA 3W7EA 2J75A 5CGTA 4O1DA 3G1FA 3F4NA 2EKCA 2PUZA 4I5UA 2Z1SA 3T1GA 1EC9A 4YTTA 4Q8QA 1WA3A 5CBBA 2C8NA 3S5ZA 4M7SA 1XF0A 1VZWA 4DAFA 2YFOA 1FHVA 3SY1A 1XIEA 5BRPA 3TEVA 2DW7A 4XISA 2XGBA 4D6FA 3M5VA 1OCNA 2G3IA 4UR7A 4WQ6A 1VBJA 1NEYA 4REQA 4Z1DA 2PODA 3S4TA 4U2YA 3HGRA 4MSSA 5C7VA 3RMEA 3WMBA 5LHFA 1HQTA 4CQAA 3B0PA 3PHAA 4JQAA 1R2SA 3BGGA 4GY1A 1KGUA 1L9WA 2PDGA 4ZEPA 3ZLFA 3STPA 3CWNA 4HHPA 4RR4A 2RJGA 2ZX8A 1FXQA 3ITOA 4DO4A 2QYGA 4H7ZA 3OW1A 1EJXC 4LAKA 1HVXA 3OZPA 1YPIA 1QW8A 4J3SA 4DUXA 1KB3A 2FGZA 3BLFA 1BGGA 1QI0A 2WNZA 1ZFJA 3FJ6A 4O17A 2P8CA 1PO9A 3E0FA 1DJWA 4GINA 1UZDA 3LPPA 3R13A 3RRXA 1PIGA 4HK5A 2WZTA 1KTCA 4F2TA 3A9IA 2E68A 3DGRA 2G50A 1ONRA 3GYCA 2PDMA 2IQDA 2QGHA 4FXSA 1K9EA 3VDAA 3L4ZA 4MOZA 5EMLA 4CQ8A 1UWTA 2OTDA 1LRNA 3UWQA 1FBAA 4I5RA 4UFKA 1V03A 1EC7A 2RFGA 3W87A 1J6OA 5A6JA 5DMLA 3OB8A 3O05A 4EXAA 2WZEA 4B5XA 3SN4A 2FH8A 4C6MA 2Y6ZA 2I14A 1XC6A 2A3EA 3M43A 3K8KA 3C61A 1HGWA 5I79A 1W9XA 4CNUA 2GGHA 1TRIA 4HSOA 1C9DA 3A3HA 4QE1A 4DNMA 4MKVA 3MANA 3NEVA 4L80A 4Q4OA 1YTDA 4JN7A 1EJRC 3O6AA 3CL6A 4CU6A 4NZ4A 3O16A 3HF3A 3M16A 1EUNA 1KKRA 1E0TA 5JUVA 1EP2A 5I5RA 1OADA 4C6CA 1XW8A 3RLVA 1O68A 2NXHA 2R6OA 3R11A 1NF0A 2OWXA 1EX1A 4NI8A 3VIMA 2ZICA 3EWXA 4JKLA 1VFHA 2X30A 1E1CB 3T09A 3T4WA 1KKOA 1WXYA 2X2YA 4IQJA 2KX9A 3LCGA 4CD5A 2V3GA 2GFTA 1FWWA 3L5LA 4DBUA 2HDJA 2HISA 4NNBA 4WRHA 1Q6RA 1JYXA 2VGGA 3MU7A 4ZO9A 3VGDA 2I57A 3ISIX 3OYZA 3QY6A 4WDTA 1QPNA 2BOEX 2CZDA 5BYWA 3M0XA 5D38A 1ZBVA 4N02A 2QR6A 4GJ1A 1QW9A 5AHIA 3GUGA 3NZPA 1A5UA 2TRSA 4DQWA 3AXIA 2VC7A 4US5D 5DBTA 1FA2A 1B2YA 3OZYA 2A3HA 1JG9A 1F6PA 3EB2A 4K8GA 5HMFA 2IKJA 3VGGA 4B5VA 3WF2A 3QY7A 4Y2WA 4GVGA 1OFPA 1IXPA 4JY9A 5JH1A 4V1XA 4WVXA 3SUTA 3GU9A 3Q67A 2IQTA 4W8BA 3A4JA 4PUDA 2CPUA 4C1NB 4XVDA 4QCFA 3CZJA 3OYXA 2QDHA 3TJIA 3STFA 1JAKA 4RCXA 4DO5A 4GKLA 1KM2A 1QNVA 3F2BA 2CLHA 3WUBA 1GGOA 1EUAA 3BAYA 3G1YA 3OHIA 4FX6M 2B4GA 2MNRA 1P0NA 1Z89A 1LTDA 2CIPA 1OG6A 4TUFA 2A5HA 1JI1A 3WEOA 1VGAA 2OODA 5SWUA 3CHFA 4FPSA 4LUTB 4OOZA 1AJ0A 5CG0A 4O28A 2CFFA 3HMJG 4DX3A 3AZTA 5CAHA 5TBOA 1R9YA 4GXWA 2QUUA 3NQVA 5D2TA 3CAWA 1QVBA 3GIPA 3RK8A 4CU7A 3U8GA 3VOGA 5I7GA 3KUMA 5LNRA 3GZAA 3K2GA 1X1ZA 1JD9A 3FHAA 5C9XA 3NUKA 4KIRA 3H55A 1WCGA 5CZ0A 1TV2A 5HK4A 3F5JA 2XH4A 3CQHA 3U2EA 3DKLA 3GVQA 4HIBA 1DJQA 4PN2A 5H91A 3PZNA 4S3EA 3W2LA 1V0KA 2GJLA 4PH6A 4AWEA 4C6EA 4EWND 5IFTA 4UFMA 4IMAA 3KBVA 3TNBA 4UMAA 3A5VA 1EGVA 3KAOA 4AIEA 3APYA 2D2OA 3G0XA 4EAMA 3EOSA 1ISWA 2ZOXA 2NQLA 1RZMA 3B0YA 4GY7A 1YDVA 3WD4A 1E4IA 1Q6LA 3M41A 2H9AA 2GSHA 2W66A 2ADAA 2HXUA 1GVIA 2FGLA 3V7PA 3A3XA 2J79A 3HGSA 1XIGA 4JKMA 1RVGA 2VUNA 4UTWC 2VNCA 2I5GA 4F0RA 4GI9A 1KR1A 1WE5A 2OPJA 4KEUA 3M0KA 3E74A 2PDPA 3OEXA 4CNNA 4DNHA 3ZT7A 4ZMGA 1S3TC 4L64A 5HBFA 5C54A 2PZ0A 1ONXA 3TFXA 4AUBA 1F3EA 1ZP4A 5FJTA 3MUY1 3ARVA 2PRLA 4LU0A 4KT2A 5E93A 1M04A 2OGYA 3NM1A 4QDWA 2PWEA 3SR7A 3AUJA 5LIYX 3U2CA 1J9YA 3WQEA 5G1YA 5T9CE 2PP3A 5C0QA 2B7OA 4PUWA 4BQ3A 3EDKA 3W1MA 1E6PA 4P8XA 3MS8A 3MUZ1 4S3AA 4IIGA 5MKGA 1UZ1A 3WDRA 3T81A 4W8LA 3NPUA 4HOWA 1RSCA 3I7QA 1VFMA 3IPWA 4ML4A 1Q4WA 3PS7A 2PDYA 4DJFD 3EOUA 2ZVRA 1PL9A 3GG8A 2PSNA 4XAYA 4AZ5A 1XYFA 1VLIA 4O53A 3QR1A 5FESA 2J8FA 5CSSA 1VHNA 3LK6A 1CPUA 1KCXA 1BYBA 1BVWA 2J6XA 4DY1A 2D0GA 4PCTA 1B90A 2ZRVA 2WWDA 4IIBA 5IOBA 2HVNA 5H8PA 5ABFB 3UJFA 3PWGA 1ADSA 3DU0A 2WZIA 1JPDX 1SPQA 3NVDA 2J24A 5A6MA 2YXGA 4PTNA 3SUWA 3WKZA 3LZ3A 2GGGA 4X9YA 2QULA 1KBJA 4H9TA 5HAOA 1Q3NA 2DORA 4RPPA 4B16A 2OZ3A 3AXHA 2E6DA 1E70M 3G77A 4J5NA 1EL3A 3GX9A 4NF7A 1UD3A 4MDPA 2GUUA 2WLZA 5I23A 3GDBA 3UPBA 3T8QA 2Z1KA 3IUHA 3LQGA 2WHMA 1AVAA 3ZMRA 5AHFA 4QJ5B 3KEHA 2BZNA 2AAAA 4H4IA 1TQJA 3HQPA 2D0FA 3CTLA 5I3KA 2FKPA 2J9XA 4XZLX 4KWOA 2ICSA 3MYOA 3TSBA 3DKJA 3N04A 3KTSA 3VM7A 1PZ1A 1T7LA 5G2WA 3C6CA 2E6AA 3H2OA 2ZRUA 3N13A 1E6ZA 3IJLA 1SUXA 3QV8A 2VXNA 8RUCA 3H12A 4MKSA 2WMHA 3KWSA 4L65A 4NI3A 3OA3A 1WOAA 2JKEA 4IGSA 3PB2A 1K8XA 4LUSB 1S1RA 4GCXA 4DM1A 1Y0EA 3WF4A 1XSKA 4I90A 3CXOA 2VFDA 1LBFA 2PTYA 4WJXA 3PN8A 1PYMA 3ATYA 3AXMA 1TVLA 2X16A 1ZCOA 2RDWA 2AQOA 3VIOA 3UJEA 1IEVA 3SBFA 3IK2A 3U6WA 1W3TA 3CASA 2HWGA 3LHVA 5K9CA 2QV4A 3WJZA 4I3GA 5I3HA 3ES7A 3W24A 3LGEA 1QPKA 4HVXA 1FWIC 3L5MA 4K8HA 3G5EA 3LHWA 3IGSA 1E3XA 4WSJA 4HCHA 2YLLA 3ZZ1A 2NVCA 3LI0A 1SGJA 2P0IA 1L8NA 4QM1A 4D6CA 5DX7A 1FWDC 1P7TA 3KRUA 3T40A 3POHA 4KPLA 3N9SA 3DG6A 4WSKA 1OC5A 6CGTA 3H4WA 4J3VA 3UXIA 5LXEA 2GZXA 5HA7A 1JCLA 1EBGA 1SZFA 5CC7A 3THDA 3WFAA 1UOKA 3AIUA 2B0MA 5BW6A 4R53A 4GZEA 1LG1A 1NWTA 2JF6A 3BCDA 4FF7A 1BWLA 3GS6A 2ON3A 3I3EA 3TZFA 2CESA 3ALGA 3MKKA 3UZZA 3VM5A 2VDIA 1PIFA 1JPHA 2XWDA 3CPRA 3WH6A 4DI9A 2O4QA 3FYOA 2PAJA 3T0BA 4Z2LA 4QSHA 2VWTA 4LH8A 4KEVA 2PB1A 4Q7NA 1V3JA 3GYEA 3UG4A 1IEQA 3FXGA 4K8EA 4N9CA 3W07A 4GJJA 4XO7A 4E2DA 2OKOA 3VNJA 1VCGA 2QIWA 2XFRA 1W8GA 1GYLA 1ONWA 3GE7A 2GVLA 1J0IA 1RBAA 4CCEA 1JZ2A 1XSJA 4BJHA 2QCEA 2XISA 1UMYA 3BDKA 2W6RA 3NIYA 1VRXA 1FDZA 4MNJA 4G9PA 3REQA 2AL1A 4MHBA 2DSKA 2XINA 2EO7A 4J40A 3BSGA 1NDYA 4GIYA 4MJ2A 2V82A 1VHCA 4OECA 5LNVA 1V6UA 3W1XA 3WDQA 3RO8A 4Q32A 3H7RA 3IEBA 4IG2B 1H7NA 4MB1A 4QLJA 1CYGA 1C8XA 1R3VA 2H8ZA 3VKJA 4A3RA 5H2ZA 2QJGA 4FALA 3EX3A 5HXMA 4FR6A 3PUDA 3LHZA 4GABA 1AW1A 1O5QA 3CIWA 1KCKA 3RHGA 3IK4A 5IDZA 3P14A 1YMYA 4JTTA 1A5NC 4AZCA 1PKMA 4X2PA 3WQCA 3W76A 3W72A 3UA4A 1I2QA 3K4WA 4PBFA 4DZIA 2XZ7A 3ANVA 2Q01A 3WO8A 4DWSC 3GVRA 4IIEA 1MWOA 3MHGA 2V6AA 5DY3A 5J5DA 1Q2SA 4H9UA 3S42A 4DYKA 3DC8A 1BFNA 3G1RA 3LLXA 2X41A 1SJCA 4PSPA 5A2AA 3BARA 4RKAA 1JZ7A 2BVYA 4S3BA 5H1WA 4AC7C 1O1ZA 4JFSA 2EJAA 3N4AA 1W1A1 3MBDA 4A6GA 3TWBA 3UJ2A 3QQ0A 4LVGA 1UIPA 1VFLA 2BXYA 2C18A 4GYJA 3N2MA 4C6IA 4WJEA 4UWMA 4UIOA 4HPXA 4FOKA 3AS2A 1U22A 3CL8A 2WVVA 4IL0A 1HVQA 3CLWA 4CVUA 1UR8A 4Q7BA 3WQ6A 5M03A 5AHEA 3EOEA 3WJXA 1ELSA 1PX3A 5HJXA 1RBLA 3N25A 1QMLA 3EWDA 4KRUA 1J0KA 4H8VA 5D37A 1VCFA 4C7DA 4PUKA 1BTCA 3N6JA 3MP4A 2BGQA 4JL1A 4UTHA 5A94A 3UW6A 4QX4A 3VOCA 5FEXA 2WZHA 4C6QA 1E4LA 1KCLA 5DCBA 4HNNA 2DIJA 3TA6A 4S3JA 2ZUMA 3W02A 3I68A 3I6EA 4RDVA 1VC4A 5G4HC 4Z2HA 3MSDA 3TTEA 3MUXA 2FVKA 3EBVA 5DO8A 3U9IA 4WX2A 3HJZA 2CWXA 3L23A 2XFWA 4NUWA 1BXNA 1EC8A 2DZVA 1MXSA 1RQHA 2WKLA 2XH0A 1HJQA 3KBMA 4QLLA 1TA3B 1OSEA 5EBUA 1BKHA 4B5UA 5I06A 3QPYA 4QXIA 5HMSA 4I5XA 3ARQA 1LYXA 3FA5A 4G7EA 1JDAA 1CWYA 2Q8XA 1E1CA 3XISA 4JKKA 5JBDA 1L2QA 1K8ZA 1EKOA 2W92A 3VO0A 4F0MA 1UWRA 3R0UA 2Y7FA 6ALDA 1EJTC 3UEQA 2A1YA 2AOSA 3OHMB 3T4CA 4QE4A 4Z1CA 3IIZA 4O8RA 4XAGA 4EACA 2NSXA 1X96A 4FNRA 1FCBA 5MF5A 4AHOA 4C1NA 3RCMA 1O12A 4XZNX 5C55A 4PTMA 1GJWA 3WLOA 1KO0A 1NOFA 2QT3A 2C6QA 1OG0A 4V27A 5LA2A 4M0XA 2C1GA 4YYCA 2VWSA 3MUCA 5EKYA 3R94A 3VNMA 5CPLA 1UZHA 3W37A 5LIWX 2A7NA 4QLKA 2VCCA 2LLEA 2POZA 3AZSA 1J6PA 3UWVA 2AKZA 4YMZA 2YCLB 3CEUA 3HV9A 2E5DA 3UXDA 3E6EA 2MUCA 2FZ8A 3AOFA 4EAYA 2EHHA 3M0MA 1W32A 3SADA 2AQVA 3N6QA 2ZXDA 4TTUA 4ONVA 2TPSA 3U0HA 1JQVA 3GDMA 2NUWA 1KXTA 3UD6A 4TOQA 1H5YA 1AH3A 1DIDA 4WOQA 1XSIA 3GTXA 2OO0A 1OX6A 4R9OA 4LGXA 1R9ZA 1DJZA 3XINA 3B8SA 4AVOA 4MUPA 1JDEA 1RAKA 1N82A 3C2VA 4PMUA 4GFSA 3EWUA 1P0DA 1J18A 1O7AA 4X9SA 2C71A 5FCZA 4ZO7A 3PBWA 1ZTVA 1XRFA 1H41A 1U1UA 3UG5A 4XD5A 3QV7A 2VGBA 4M1BA 4H6KA 5DXXA 3LSCA 2CLIA 2JE8A 4XKMA 3LTPA 1DJIA 1R87A 1QOXA 3EYPA 4JN8A 3PTMA 3RUBL 4NX5A 3K46A 2PRMA 4GX8A 5I3JA 1NWSA 4H9VA 3MY9A 3VD4A 2BS9A 4O14A 5B7YA 2VVSA 1RXOB 1Q65A 3EAUA 4Q8UA 2FYMA 3ZIZA 1VJIA 5G1TA 1UWAA 2PMQA 1W1VA 4MLJA 1XKJA 2G41A 3H22A 1CGYA 4MKNA 4TVUA 3BQ5A 1MQPA 3MVTA 4E4UA 5JQ9A 3VNKA 3W01A 5CJ5A 3PM6A 1ITUA 1ZPTA 1RQEA 1VCVA 2A3BA 3EZ4A 2WC3A 4M7TA 1EGZA 5E5CA 3MTWA 3GU2A 2R24A 2Z29A 1W91A 3MV11 1WDDA 3IJ8A 4MJZA 1YRRA 4HPNA 2JKPA 3C3NA 2GSEA 3BPWA 5FACA 4C6BA 2Q3RA 2WJEA 6REQB 2PI6A 2C91A 3GB6A 3QQ1A 1BEUA 1WXZA 2HNEA 4YS1A 3NSNA 3GBDA 2BX7A 1XGEA 3LPGA 4JDBA 4NRSA 3SIZA 1K7XA 1TPH1 4LEFA 5EFDA 4F0KA 3VCNA 3RYSA 1RVKA 1ICQA 3NOEA 4EIVA 2Z26A 3CC1A 3ZVHA 2DV0A 4EP8C 3P67A 4I7UA 4K6AA 4LUJA 4EXQA 3BV4A 1GVFA 2BFGA 3HTWA 3WQ5A 1XFCA 3WD1A 3P62A 3GTHA 4R27A 3NDOA 2EGZA 4BK9A 2DUAA 1ZSXA 3TONA 5CGQA 1DYSA 3BLIA 3RMJA 4C6JA 4YLWA 4MDOA 1B3ZA 2CITA 4JTLA 4DLFA 2IKHA 4I8YA 3SCQA 3M46A 3I4KA 5G5IA 3CB8A 3SGZA 1XKYA 3GDTA 3IUDA 4DF0A 3W71A 3OA5A 4P7RA 4R88A 4ADSA 1GCYA 1GEHA 3KCJA 4PTDA 4FHAA 1TTJA 1WKFA 1LL6A 2VI0A 1OFBA 4UTLA 4A8LA 5E9AA 3GG0A 4FLRA 3L2MA 4KFOA 1GZ1A 1H62A 2F8QA 1TIMA 3HM7A 3BC9A 1K9DA 2Z1WA 3KRZA 1HKMA 2HE8A 2PU1A 1JUBA 2PBOA 3H6OA 3LCLA 1TTQA 4DEFA 3UCCA 2W79A 1O66A 2P88A 1PXGA 1FCVA 2WSQA 1AZ2A 2WW5A 4CN1A 1KGWA 1NDVA 4OJYA 3QMTA 4LF2A 3WQVA 3ZJ7A 1UROA 5AB3A 1O94A 3WNPA 4UNKA 1YNPA 3DHPA 1WUEA 3KHJA 2VZOA 5KITA 3LV6A 1KM5A 3EB4A 3ANUA 5KEZA 3WSUA 3WL0A 1M7JA 1HGYA 3UGRA 1F07A 4OWGA 4ES4A 5M1TA 3FHQA 4XSLA 3O6CA 3KBWA 1OABA 3WEMA 1M3UA 2PWHA 3CTTA 1E40A 1FHLA 4UFHA 4L6OA 1K03A 2OSYA 3EEZA 3GH7A 2ZX9A 1OZQA 2XIMA 2I17A 3BVJA 2X0YA 3Q94A 3N9RA 2QF8A 3WY1A 4ACYA 3KZPA 4Q8MA 1I1WA 1AQHA 4XD3A 1TJ2A 3KL5A 3WLQA 2BLEA 1X1OA 1XYAA 4I9AA 2NSOA 1OX4B 3V18A 2DSVA 1C7TA 3B0UX 3DFYA 2PD9A 3TMLA 2OZ0A 1KLYA 1UJPA 2I5QA 2DZTA 3URBA 2JGYA 4JIRA 5LIXX 1J10A 3LENA 4AVFA 3WELA 3WK3A 5CPOA 4X0VA 5C9UA 1DE6A 3ZWTA 4NRRA 3RPDA 1TA3A 3WX7A 1N8IA 2G4FA 4PUJA 2V3DA 3CZLA 4QITA 1M7PA 1SZGA 4HMEA 3I6RA 3QRHA 1B3OA 3LQLA 2VZSA 3S0CA 4G56A 2C79A 5HPOA 2I9EA 3AIEA 3ZVHB 3TC3A 3IIVA 4MADA 3P7YA 4N6FA 2QJHA 3CBWA 1EHAA 1EF2A 3VIKA 3AO0A 3F5LA 5ABGA 1AODA 3VKCA 1JUEA 2XVLA 5LZLA 1OD0A 1V3IA 2D1ZA 3M6YA 1JAEA 1S3HA 2VOMA 1M1BA 2P0OA 1SMAA 1V5XA 1OCBA 1S2UA 4HNUA 4L5ZA 5K4XA 2FHFA 2ZC1A 4L56A 4HYRA 4KH2A 4WZHA 2CEQA 3OBEA 5GJPA 3AXXA 4TX6A 2QCGA 4CCZA 2DGAA 2YXXA 2VENA 3WZ0E 2OELA 4UFJA 1MDLA 3SI9A 3P2VA 5HWNA 4ERIA 4JX5A 1A5LC 4BWLA 1WKDA 1BVZA 3GG1A 4G6CA 3CB3A 2INEA 1SR0A 3PPCA 4ERAA 3U2OA 1R2TA 2YYTA 2WBGA 4D8AA 3RR4A 2YGYA 2YW3A 2NT0A 2O9OA 2E9BA 3WLKX 5JBEA 1R3TA 3AWOA 4YVXA 2BXVA 4BF5A 3RN6A 3G1XA 1EOMA 1QHOA 4TVCA 5E6ZA 3GY1A 3WK0A 1X98A 4HTYA 3W83A 4JFWA 1GJPA 3QYSA 4ZCWA 5I6SA 4AX7A 4E8GA 4Z1YA 1W1IE 1HFBA 3KBJA 1Y7VA 1OBAA 3KOYA 1TMLA 1EDTA 3RJXA 1IXQA 5BU6A 3UGVA 1OC7A 2OXNA 1FH8A 5G4EA 2WSRA 3VC6A 4O18A 1EH9A 3RF9A 5ECVA 1H61A 4EK7A 3MSYA 4CD6A 3IS4A 1TJ1A 2ISWA 3C8NA 3S46A 4AZCB 2XUCA 1F5ZA 1XPYA 5EGRA 2OQYA 1CX9A 4F79A 2DZAA 4Z2KA 2OT1A 4W93A 2YL5A 1KWKA 1VEPA 1OYBA 4RZ6A 4KWUA 1EQCA 4HMDA 2QS8A 2ISVA 2V8ZA 3MJMA 3VIJA 3MMDA 1KQZA 3QHOA 3TTYA 4FA3A 3NYZA 3MV01 2Y7DA 3W27A 1OWQA 4FOJA 1FWHC 2Q8ZA 3VINA 2VD9A 4LAUA 4OUIA 4ZOBA 4LF1A 2HPIA 4PBGA 1GONA 2PDCA 3FEQA 2DSWA 1DWFM 1QPQA 3GZ3A 1QI3A 3P82A 3VNYA 5AN7A 4DO7A 4DUWA 5IFPA 3AIRA 4D6EA 1OGSA 4UTTC 3VE9A 3OJGA 2GUYA 1PTDA 2ZIDA 3RX2A 2XVKA 4JTIA 1G01A 1CXHA 1RP9A 2WPGA 7ODCA 1WBHA 3ITTA 2PCEA 1XDMA 4H6EA 3R7MA 2JFEX 3EX1A 1TV4A 3UZWA 1UH2A 2GDVA 4CU8A 1LM1A 3ZJKA 4DWSA 3CIXA 1H09A 4FNTA 3MCOA 3VD9A 1H0IA 1EHNA 1LQ2A 1G1YA 2DEPA 3P0WA 2YB4A 5T9BG 1N8FA 4O1AA 3UNDA 2CLPA 3USBA 5J5RA 7A3HA 4F4RA 2HROA 4RZ4A 1LG2A 3ZWSA 2C1IA 1BQGA 4XVEA 1X6NA 4UQBA 1H4PA 1HIZA 4TMBA 3QMSA 2D3NA 4JTKA 3KVMA 4MB3A 3VMPA 5T91A 2G8ZA 3H2MA 3KP0A 3ZLHA 1F4AA 2ZXAA 2J8GA 1EWDA 5I3IA 2POTA 1VPQA 3VIHA 2D69A 3WF3A 4ORIA 3QHMA 1R47A 4PCNA 2GQ3A 4PCFA 4E38A 2VFIA 2ACUA 1UP2A 1TO3A 2W3ZA 1FWNA 3FVDA 3I6TA 3N19B 3FKRA 3MMUA 5D09A 2V5CA 5D8WA 1ZRQA 2XIJA 1EO7A 3F5KA 1Q13A 5KSWA 2VP8A 1FWRA 1E5NA 5D33A 3IARA 3PZVA 2GSJA 3R6IA 3L66A 4LYRA 1QR7A 3MDWA 3HG4A 4UFIA 1J0JA 4IP4A 3W22A 4RXGA 4RV3A 1SJBA 4XZ9A 3B06A 1QOPA 1G4SA 1A0EA 4I7VA 4GNKB 2NUXA 2OJPA 3OODA 2F9RA 1JL8A 1EOKA 2QUMA 3ITXA 3TXVA 3G18A 1F4HA 5AC7A 2VT0A 4QR6A 4B4HA 1Q4NX 2Z6JA 2FLIA 1WQ5A 5FJOA 1XLMA 1WDSA 1GZJA 4HZ8A 4IXHA 3ARSA 1MDRA 1IZCA 1RA5A 1CLKA 2TAAA 3UCQA 3PZGA 1CIUA 4HNVA 4N42A 2WMIA 2JEQA 1CTNA 3RX3A 3NQ8A 4MAZA 3BJSA 3BMXA 3VIIA 4GVHA 4ZTYA 1FWJC 1SM9A 4HA1A 2ZBTA 4UXDA 3VUPA 1HKWA 1KV8A 2HTMA 3AMLA 1ICSA 3W7MA 1YE4A 4RPQA 2YW4A 2HSAA 4UTWA 1R3YA 1W17A 1ECQA 1XLDA 1YTKA 1PB0A 3EA1A 4A3YA 1UA7A 4BS0A 1IR1A 3AXKA 4CQBA 3AHVA 3GR7A 2OU4A 3GXFA 1FWGC 1F9CA 2YDSA 4LWWA 1KRBC 3L21A 3C2FA 4DPPA 2IPFA 2VKZG 3CAKA 5FF3A 1J12A 3EDJA 1V77A 2HCVA 4P7NA 1TZ9A 4QG8A 4Q4PA 3T6CA 3CNYA 3SY8A 1IWPA 1HJXA 3IGXA 5KZEA 3K4AA 1G94A 4R9XA 4K1WA 4AWSA 4JFUA 5A6BA 5K9XA 3CZ8A 4AWTA 4Z42C 1GOMA 2FTWA 1LORA 2XPKA 1PKLA 3ABOA 3TTSA 1YEYA 2PDXA 1LOLA 2E0PA 2YDAA 5AYZA 3BW2A 3EOOA 4J3UA 4PFHA 4K2SA 5EU9A 1UA3A 2XGZA 3D0CA 4HSNA 1F8IA 4P2VA 1S2AA 1EDQA 3MUAA 2VEGA 1T99A 2F6XA 1AQMA 4HCLA 1HKIA 1RCQA 4S3CA 2Y89A 1VFUA 4JCLA 3EX2A 1W56A 5E9XA 3K13A 1KM0A 4NIRA 4UR8A 1GVSA 2Z6IA 2IXUA 5D05A 3NQFA 1YXYA 3JRKA 3W7IA 4WDWA 1D8CA 4BR1A 4TO8A 1Q63A 1DEDA 3SUVA 3AZRA 4ZENA 4RE2A 3W1TA 2DUZA 4JTQA 3SURA 3LCHA 5IBXA 1ZS2A 2QJMA 5C8BB 2BMBA 2RDXA 4LYKA 4O4WA 2EAWA 1FVPA 1E5JA 1UW9A 2Y61A 3HOJA 2Z00A 3GH5A 3OLIA 2VEIA 3PBUA 4L1WA 4C6OA 3MB9A 3TAKA 3S5OA 4GUGA 1V6YA 3WDIA 3KTXA 2ZUTA 1UB3A 3BSHA 1AJZA 4EXBA 4M29A 4IFOA 1XLAA 3HPXA 4EE9A 1TE1A 1X7IA 3ABSA 1PX4A 4PC8A 3UWUA 1LROA 2Y63A 3LCFA 1SO3A 3LTSA 3FOKA 4H7VA 3DFPA 5CEWA 1XRTA 2OZ8A 3NL6A 1TJPA 1D3GA 3P61A 7PTDA 4XO6A 3UXLA 4TIMA 2BVWA 3S6OA 2AGKA 3GH4A 1S2TA 4I7WA 1XIMA 1KXQA 1TVNA 1NAL1 1FHDA 1KQYA 5D30A 1ZP3A 2DH2A 2VDGA 3P5ZA 3W7KA 4JD4A 3G1AA 2G3NA 3CV6A 3LBMA 4E0CA 1FWFC 2FZMA 4KMQA 5IHSA 2YYUA 1XC4A 3VUSA 2O4MA 1H0GA 3CH0A 4IQLA 4E8CA 1OX4A 1AK5A 3LCWA 4W84A 3EX4A 2GDUA 1JCXA 1KV5A 3C3UA 4Q4KA 4GQQA 5EMKA 2QPXA 3LOTA 1OT2A 4YXGA 1BG9A 1E0XA 2V5KA 1GORA 1XPGA 2R82A 3CZEA 1UR4A 3FGCB 1IR2A 1LDCA 4TVDA 2OFJA 2GVGA 1NM9A 3QBUA 3MVIA 1AW2A 5A8QA 2ZZ5A 4DXKA 3CH9A 4E3VA 3FJNA 4Z17A 3WEZA 3EWBX 4LBUA 2Z2AA 3IRDA 4GX9A 3UNTA 3RM4A 5HQLA 3A24A 3UZXA 4Y8EA 2WAGA 4G1NA 1XIDA 3TYDA 1VENA 2ALRA 2W5FA 4H6QA 2XSBA 4GQ0A 1J0HA 3C5QA 5H8MA 1A0CA 4MWAD 3TN4A 3S83A 2HS8A 4PL2A 3N2OA 2H9AB 2YA2A 1T0OA 4V28A 4ILSA 3U48A 4MFEA 1OIFA 4XZIA 4E2VA 4RLIA 1XD0A 3R25A 4J2MA 1JXJA 1QK2A 4CQ9A 3G8RA 2OCZA 2V5LA 4GYPC 4QQUA 1H49A 2ZXBA 2AMGA 1PYFA 4PMXA 1H1NA 3UR5A 4H9XA 3FFSA 1SW0A 4MY9A 4H2HA 1U83A 5E0KA 2Z1XA 4R7JA 3E38A 1JDDA 2NVAA 3VVGA 2UY3A 2Y5EA 1E55A 4KFPA 1RP8A 2PGEA 4HK6A 2GDQA 1O1HA 4LY8A 2Y5JA 4UNIA 4EKJA 2AL2B 5PTDA 1VFTA 1GEQA 1G5AA 2QUTA 4WKHA 3BK0A 3CUJA 1JZ4A 4ML9A 4LT9A 5F4SA 1U5HA 1ZJHA 1J0ZA 4WY0A 3D47A 2XM1A 4RDZA 3LYEA 5FF2A 3WBYA 4O0KA 1DJHA 1M65A 5LXXA 3BTNA 3PP7A 1XLFA 3D46A 1D2KA 3UPWA 3BWWA 3O6DA 1Z69A 3WK2A 3ZQ9A 5XIMA 1OF8A 1JULA 2CLEA 3CQKA 4INFA 2ZTKA 1SYTA 5EMMA 2V81A 2RJHA 3FV9A 4X63A 1BYDA 8CGTA 1JYNA 1GQLA 5HNNA 3EEGA 1TJ0A 1I1XA 4GLEA 1B5TA 4N4QA 3V1HA 1M6JA 2A4AA 4DWSD 1VJZA 2X40A 1JZ6A 3W7GA 1XH0A 1UWIA 1QBAA 3LHUA 3DOPA 4PYSA 3WN6A 2EPHA 5CC6A 4O52A 4HMNA 4K7YA 4C1LA 5CQ1A 2ZUNA 1U30A 4AVNA 3QM3A 1QJWA 1R9XA 1XGZA 1EA9C 4XQ6A 4WDXA 3USZA 4B90A 3W23A 4GO8A 1JGMA 4DJFA 2ZE0A 1YPXA 3TVAA 4UZUA 4P8UA 4HHMA 4HNTA 4RNIA 3P60A 2UBPC 1ME7A 2FFIA 1JD7A 2YDQA 3BICA 1PTAA 1RPKA 5H6HA 5A6BD 4R3UA 4B9ZA 3O63A 3NXFA 5L9FA 4DHGA 3RCNA 1UASA 1L0PA 1S5WA 4M3PA 1P4CA 4UCFA 3G22A 1HKVA 1M01A 3S1WA 3CAQA 4C5ZA 2G0WA 4WXZA 1DIKA 3UJSA 4CKQA 5C2XA 1F76A 4ZSTA 1H1YA 3KOXA 3U4AA 4C6DA 4RJEA 1VFSA 3U57A 3AI0A 2YA0A 4WGHA 2ZCGA 4J3WA 2HS6A 4R34A 2Y2WA 2YL9A 4IPJA 3O8AA 3TIMA 1UBSA 9CGTA 1R38A 4WR3A 1VPYA 3SRDA 4Z1AA 3S1VA 1XICA 2OWCA 1KBIA 4IMCA 1GNXA 3IJQA 4HT3A 3TROA 9XIMA 2VZTA 1SQ7A 1REQA 2DVXA 3OTRA 3T78A 4UTUA 5HPCA 3DG7A 1NJJA 4L61A 4FLSA 4MWAB 3TN5A 1BVNP 1JYVA 3HFYA 8XIAA 3NFUA 4LS2A 2QMJA 3VKAA 4M81A 1IZKA 1BHGA 2DZXA 3PBMA 2GQ8A 2DT1A 4O1FA 4E2OA 3F4VA 4JQ1A 2OZTA 3B9DA 2J7CA 2O7SA 1TIWA 3KLLA 1ZCCA 1PX8A 1GW9A 2ACSA 3CT2A 3HG5A 1H7PA 4GC3A 3MI6A 1KXVA 1ZB5A 1QUMA 1JCMP 4BY3A 3GWQA 4UMCA 2Q09A 4KKXA 2FZ9A 5FJIA 5C71A 2JALA 2R1MA 4G1KA 1K9TA 4ZR8A 1JZ3A 4NQ1A 3TV8A 5KTLA 4GUIA 4FMVA 2RGLA 4XD6A 5KMYA 1HL9A 3JVAA 1PKNA 2ZKMX 4W89A 4QJ4B 1DWIM 2X2GA 3MO4A 2VZUA 1ICPA 3TKFA 3I7SA 5DCEA 4YTRA 3SUSA 3PNZA 2BG5A 5ABHA 3WH5A 3UR8A 4A3UA 1TR1A 2VZVA 4MWAA 3SFWA 4WF7A 5AOUA 1Z9AA 2CKRA 2X05A 3T0DA 3W6LA 4GGHA 2ZZ7A 3GXDA 3TW6A 3H2EA 3ARWA 3CUXA 3SJNA 5GNYA 1UPPA 1YBQA 4UTKA 1FH9A 3F2CA 2EPNA 4AHQA 3ECQA 4FB7A 4CQDA 1D3CA 2CW6A 5FJUA 2ZA2A 3SZ8A 4WJ8A 4CEUC 1UJQA 4RW5A 4M80A 5CZSA 1HT6A 1UWUA 5JU6A 4DBWA 3B8DA 3CV2A 1KM6A 1B31A 3RJYA 4IMGA 2OYMA 3TTQA 5D8ZA 3CHCA 2Z4GA 1OX5A 1UQZA 1R3WA 2Y24A 3QVQA 5BWFA 4LUYA 1OIMA 1VRDA 4LS0A 1H7WA 3LM3A 3W0KA 1KBLA 5A5WA 4IL2A 1FCUA 4O16A 5CPNA 3MW7A 1XI3A 3P84A 1TMHA 3WNKA 1XIBA 1HO4A 1K1DA 4ZXOA 1MVYA 1PCKA 2C0AA 3BV7A 2VD8A 1KTBA 3A6OA 1E1FA 3R2GA 4LRSA 6XIMA 5A8GA 3AWNA 3EMCA 4GCAA 4M82A 5AZ1A 2HNHA 1F6YA 1TWWA 4Z0JA 1LL7A 3OP2A 3S5SA 2ZA1A 1WV2A 3LRKA 3TTOA 4DZAA 4ZVJA 3NCOA 3BAXA 2PU0A 4O1EA 1GVQA 3NDYA 1QPRA 4GUFA 3VK5A 2A7PA 1KFCA 1RJPA 1SVDA 4J4KA 3TQPA 3OVPA 3GVVA 5DXYA 3THQA 4PMZA 1NFBA 1EXBA 3PZOA 3ABXA 5CLWA 4IM4A 5AYYA 3AROA 1E9LA 5KETA 4DELA 3C2RA 3HBLA 2GJNA 2FHBA 2PD5A 1Q2RA 1NELA 1PCWA 3MI2A 4JIPA 2J6VA 1XLHA 3M0HA 1CXFA 3TYUA 1TELA 1VFOA 1ISZA 4X3ZA 3OZMA 3UP8A 5D2WA 3EWYA 5CPQA 3VGHA 1A5KC 1VPXA 2V68A 1E0UA 1C91A 5D2VA 3G2GA 1QRQA 3A21A 4UQDA 2HBVA 5HMEA 4IJCA 3BAIA 3LLFA 2NQZA 4DXVA 5HNRA 5A2BA 4GI8A 1UMLA 1SSDA 1TZ7A 4YJ5A 2WYSA 3P0XA 1G4TA 4ZQRA 4DJFC 1YYAA 1U1HA 2E77A 2CLLA 2V3EA 2AGTA 3ELFA 1POKA 3SCTA 3JU2A 4L4PA 5AC8A 3N2XA 2HK1A 3AS3A 1KRAC 3DFSA 1DQWA 3DH7A 1XJBA 4Z1BA 1XIHA 4B9YA 3ARUA 4U2ZA 3N2BA 5GJMA 3EDEA 5M17A 2E5BA 2W61A 1QW7A 1A4MA 1GT8A 4M51A 3QPEA 3FJ4A 2UV8G 1FY6A 3W53A 3KOZA 3KVKA 3AFBA 4FP1A 1P0KA 2X09A 2CZFA 4XV0A 2ISDA 2C15A 5HR6A 1KFWA 2JIEA 4DZHA 3LB0A 2OLSA 1S5MA 5BMWA 3BE7A 4N9EA 5E70A 4TU1A 2H6RA 2YKKA 4P8VA 3TSDA 2OLAA 3EXRA 4XIAA 1E6XM 1MNZA 4I9TA 4ECLA 3DGBA 1UC4A 5U4NA 1L2UA 4BWLC 1UWSA 1ZAHA 2OOGA 2WC7A 3BLPX 3GNNA 3BO9A 1Q8AA 5CC5A 3QXBA 3PVFA 1N2VA 1B3WA 3QR3A 3MSRA 1WDQA 3UERA 4Z2JA 3BURA 4IHCA 1PUDA 3L5AA 3OVRA 4QEHA 1VJSA 5LNWA 1UD5A 4IF2A 3A23A 1CENA 2XHYA 3KE0A 2CZ5A 4DBEA 7XIMA 2IPWA 2E25A 3B8WA 4LFYA 1BWKA 2CWNA 1FWBC 4ZTXA 1I2NA 3G3MA 1QI2A 2QLYA 4GYKA 3GW3A 3VOJA 2GL5A 3LMYA 1CGXA 5FI8A 2WV8A 1DOSA 1GQJA 3KBSA 5D02A 1H11A 4JQ3A 1E0VA 3AAMA 1UR0A 1XBXA 3IANA 3KZSA 4C5YA 4GKTA 4G7EB 4REQB 5E6YA 5LHEA 3ZVIA 1CGTA 5EMUA 1MNSA 3PAOA 1PZ2A 1T40A 3JZUA 5CGMA 4UTFA 2Y70A 1FHUA 3SIMA 4AU0A 3W84A 4JIQA 3F7JA 4W7WA 5D4YA 1FWCC 4PMDA 1UHVA 3AQUA 2ZA3A 1H7XA 5DCDA 1EZWA 2YCEA 3W00A 4DVOA 1C3FA 4UQAA 2TYSA 4QCEA 1DKWA 2XH2A 3ZT6A 3DYMA 5D9MA 3WJSA 3LGDA 1THFD 3NXLA 3WLJA 4NAEB 4AFYA 1EQPA 3DI1A 2EPOA 4FOUA 1EIXA 1RD6A 1D7FA 3ABRA 3ONBA 2XIQA 1IT0A 4S3GA 2A6LA 2GGJA 3A22A 3WFLA 3W88A 4TQTA 1G7UA 1MFUA 3CHVA 3PNUA 2VHLA 1P0BA 1R3SA 3W1PA 3WH8A 3C0LA 3BSMA 4HOXA 3A3WA 1NDZA 4D1JA 4R7OA 4F66A 3U7VA 4NJHA 1QFEA 5HUOA 4QJ1A 1LL4A 4F0SA 3V5FA 2ABAA 4QHRA 3TFCA 4R33A 4O1CA 2VFEA 3LLDA 3DCPA 2Q3OA 1JPIA 3B03A 3VDGA 3DERA 2ZZ1A 2EPKX 3SGUA 3TQVA 2DSZA 3RILA 5BU9A