2FB2A

Structure of the moaa arg17/266/268/ala triple mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
327
structure length
327
Chain Sequence
EQIKDKLGRPIRDLALSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTAAALSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of 5'-GTP to the C-terminal FeS cluster of the radical S-adenosylmethionine enzyme MoaA provides insights into its mechanism
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligand binding protein
molecule keywords Molybdenum cofactor biosynthesis protein A
total genus 105
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2fb2A00
2DZVA 2RDWA 2QCFA 3TV8A 5LHEA 4XWUA 1SFLA 3G8RA 1XDMA 2Y7FA 1W5MA 1OX4A 4Z1CA 1GYLA 2FQIA 1R2RA 3IV3A 3ZR4A 3RU6A 1GVRA 1YDOA 3DGRA 2QF7A 3LLDA 4K39A 3U2OA 3HGOA 3N9RA 3LHYA 4JTSA 5G2IA 1G4SA 3N34A 3OG3A 3PUOA 3EEGA 2E09A 3WK2A 4DF2A 1H7XA 2FIQA 3E0IA 1FUYA 3A23A 1FWRA 4UTTC 4NXKA 4QIUA 3ATYA 1JRCA 1TB3A 1OVDA 3S1UA 4KWVA 1I8JA 1EUAA 3SSJA 1OJXA 3M6YA 5CPOA 4JTJA 1KLZA 1JCXA 2ZZ5A 1BEUA 1GOXA 1KM3A 3BW3A 1ZAIA 1FQ0A 4TMCA 1KBIA 5D05A 1IXPA 3R12A 4JS3A 3M47A 4A2RA 1O95A 2GQAA 4ML9A 4IMEA 2JK2A 4UFMA 5HQEA 1ZALA 4MUZA 1QWGA 5T26A 2ZDRA 5CZSA 3LHTA 1JQVA 4PA8A 4EF9A 3LI0A 1JCLA 3W2NA 5AB3A 3DXIA 2HS6A 2YYTA 4O19A 4WJEA 1Q3NA 4NU7A 5EYWA 1FDYA 1DBTA 1WBHA 5K9DA 3EB2A 2QUTA 3DFQA 5F4SA 2ZZ2A 1WX0A 3P82A 1NVMA 3LV5A 2RFGA 2YYUA 3MMTA 1DV7A 3NOEA 1KTBA 1T99A 1JVNA 1LBLA 4K7YA 2Y63A 1YXDA 2QR6A 2CZ5A 1BTMA 3P62A 2E5BA 1F7BA 4DF1A 4O12A 5D2VA 3ELFA 1ZNNA 3NPXA 1GPWA 2CU0A 3BGGA 2BXVA 5FF3A 5AYXA 3GDMA 1KM4A 1TPVA 3JRKA 4WZHA 4YCPA 2C19A 4OWGA 1WDWA 4FIRA 3W7CA 3SJ3A 3Q2DA 5F2LA 3HPSA 3W7LA 5G5IA 4Q4KA 1L6WA 4FNSA 3WK1A 5I3JA 2YX0A 1BKSA 4OV4A 4LVFA 2C1HA 4H6KA 3O6CA 4NJIA 1I2OA 4FHAA 2BTMA 2QUVA 3P80A 2DP3A 3C3NA 3O8AA 3BV4A 3TJLA 1R2TA 4RZ6A 2PC4A 3LM7A 3GDLA 1W5NA 4LS1A 5D03A 4GNJA 4HNNA 1XFBA 3KHJA 3CIXA 3L2IA 4TX9A 5EY5A 3T44A 4O28A 5A8GA 3VKJA 3B0VC 4HKPA 1W54A 1ZAJA 3CPRA 2J9ZA 3OA3A 3P60A 5FEXA 1H7WA 1S5WA 2NV1A 2YFOA 2RHGA 3ANYA 2BZNA 3DHDA 3NA8A 3P8IA 4LV4A 2P0OA 1QNVA 5KZDA 2YW4A 3TQ0A 2BX7A 3C0JA 1B4KA 4HNUA 4GUJA 4A29A 2A2IA 3L5MA 1WQ5A 3O05A 3W1AA 4PFMA 2V2CA 2OT0A 1Z41A 3GDTA 4UTWC 1W3TA 4GUHA 2ZZ4A 3IGUA 2HS8A 3PUDA 5HWJA 1GVQA 2J27A 4JTKA 5DCDA 1AK5A 3M41A 5AYYA 4WD0A 3KVMA 4UR8A 2BLEA 2A7RA 5DCEA 2FPTA 3HQ1A 5CPNA 3CTLA 1PL9A 3P5ZA 4JX5A 3QW4B 3N14A 3PSVA 2IQTA 1T96A 2WKJA 2EKCA 4ZQPA 3M0ZA 2FDSA 4RR4A 5LKYA 4DO6A 3S8HA 4UTJA 3G3MA 3HF3A 2DJLA 4AF0B 3TJXA 4O50A 2GJLA 3MBDA 2I9EA 3C56A 4WY0A 1S3HA 3WJYA 4BF9A 4TU1A 4KFPA 2C0AA 3PBWA 2YFNA 4A21A 4UNLA 3GK0A 4O18A 3LCFA 4KWWA 2A85A 2X30A 5LNRA 3UYCA 1XUUA 4AHPA 4NNCA 1W5PA 3INPA 3IGXA 2HTMA 2QDGA 1QPOA 1E51A 3N19B 4EWND 1QAPA 4NJJA 1O94A 3BK0A 3LHUA 3LXAA 1FCBA 3QQ0A 4AHOA 3GB6A 1W5OA 2A21A 5LGZA 3BGJA 1VLWA 3P61A 4OQVA 3WJZA 1KBJA 3GR8A 1C9DA 2PURA 3PF3A 3ZS4A 2CLFA 2QAPA 3VE7A 5LSMA 1SFJA 1AG1O 1ME8A 1TRIA 1YPIA 4JTGA 4IMCA 2JKAA 4QNWA 4FO4A 3FS2A 2ZFAA 1Z44A 1TPDA 2YPIA 3HOJA 3G3DA 2ZCGA 4DO4A 4S2BA 3O6YX 4HSNA 4QQ3A 2Y7DA 1FBAA 2G96A 4JEQA 2FPVA 1KM6A 4R34A 3PSWA 2WNZA 1P5BA 3GZ3A 1BWLA 2DORA 3RNDA 1W31A 3TFXA 1Q6LA 4AEOA 2VFGA 2GUUA 4OT7A 4KFNA 3E12A 3NVTA 1DKWA 3G0XA 1VHNA 3TFCA 1LM1A 1FCQA 2QCMA 2OX1A 3B03A 4O1CA 1TSIA 2Y70A 2A5HA 3L0KA 1GQNA 1K3UA 4QAIA 4BWLC 2VEIA 3UY7A 4GBUA 3SW6A 3UXDA 2B4GA 2FTPA 1Y0EA 1F73A 1VS1A 1JQXA 2FLIA 2YXGA 3U8GA 3QQ1A 1XBYA 2A0NA 3TCEA 4MYAA 2QCLA 3LHWA 2NXGA 3VNDA 3FA5A 3HBLA 3DI0A 3HG4A 4X2RA 4LW7A 2E5CA 1OFRA 1ALDA 1KFLA 3NZRA 4UTKA 4PCFA 1ZY9A 4UTTA 5DY3A 3DH7A 3OVPA 1TPEA 1OFPA 4B5NA 2EAWA 4JTTA 1JUEA 3QH2A 5HWMA 4UMAA 5KZMA 5CGQA 5FF2A 3E49A 5KZEA 4G1KA 3S6DA 3TXVA 2OZ0A 3STFA 2HSAA 1OF6A 4DF0A 3EX3A 4WUIA 3K30A 1FWSA 1RV8A 3UD6A 3W7RA 5A5WA 3T40A 4UFIA 4P2VA 1OX4B 4MKNA 4AVFA 2ABBA 2I1OA 3IIPA 1O4UA 3W1RA 4LUJA 3G1HA 3MI2A 3W1PA 1DJQA 1A53A 3SECA 3G0SA 5EBUA 3FJLA 2VEPA 1VR6A 1WOAA 4ZQMA 2QCCA 2W6RA 1QCWA 3LXBA 3FLUA 2E68A 4NVTA 5CZTA 4N9BA 3GAYA 4O0ZA 3FEMA 3LTSA 3KRUA 4OGZA 3W76A 3TH6A 1HL2A 4AMAA 3E02A 3PG9A 4N6FA 1ML1A 3P7YA 1WV2A 5K3VA 1W0MA 4Y90A 2ZRXA 2VENA 3CWNA 3PC0A 4IUOA 5AC7A 4YL2A 1VHCA 1P0KA 3DFSA 2LLEA 2CLOA 3W1XA 5HJLA 2KZHA 4RCXA 3O06A 2XN1A 5DBTA 4WXZA 3NQEA 3UZ5A 1GEQA 1EWEA 1TQJA 2PCQA 1LP6A 3LI1A 5C2XA 2NUXA 3PUEA 4NZJA 3DAQA 4R7JA 1FDZA 1XL9A 2QAFA 1N55A 1SSGA 4UMBA 3HGRA 2FPYA 5DBUA 3MI6A 4JTFA 2ZZ6A 4NQ1A 1OYBA 2CLKA 5I3KA 2G95A 2QKFA 3W7JA 3M5XA 5I3FA 3A5VA 3M16A 3B05A 1DOSA 1EB3A 3G1FA 2DZSA 1O5XA 4JTEA 3W6YA 1XDLA 1GG1A 3GXNA 3M9YA 4LT9A 2Z6IA 1T0OA 1VYPX 4RX0A 3W84A 4P61A 3W70A 2QJGA 1DQWA 5BOOA 1TPFA 3CHVA 5G4WA 3GXTA 4LU0A 2YW3A 3GNNA 2DZUA 3DBPA 4CCEA 4UNKA 4DBEA 3C2EA 1GTEA 3DFTA 3QC3A 3EX6A 3R89A 4N9EA 2AGKA 1YDVA 2ZZ3A 3G24A 3QZEA 4MFEA 3W7GA 3S5ZA 4J9JA 2CZDA 4JN6A 1LORA 1QOQA 3KXQA 1G4PA 4JX4A 1PVNA 3FYPA 1SZGA 3BO9A 2GQ9A 4ALDA 2TYSA 3O07A 5FEZA 3F4WA 1F74A 1G4EA 4A22A 2QCDA 1LCOA 3G1AA 3CC1A 4CQ8A 1L6YA 1KM2A 3TSMA 3KOFA 1IXNA 1W3NA 3IVTA 4MLJA 2GVGA 4KFOA 3RF9A 1OFBA 1VCFA 2X1UA 3N3MA 1YTKA 5AHLA 1YTEA 3LB0A 2GQ8A 5D2WA 3I7RA 3G18A 2Z1BA 5AHNA 1R30A 2A7PA 3LCIA 3OVRA 4NUWA 4N02A 1L2UA 4UIOA 2Q8LA 2CW6A 3LRMA 4PODA 1IIGA 1M7PA 2ZTJA 1TTIA 2P1FA 4M19A 1XBVA 4UTWA 4K6AA 4C1KA 5FEWA 4BK9A 3W3OA 5KTLA 3SY5A 1TJRA 3N2XA 4LNYA 3LCHA 3F1QA 4LVAA 3L9CA 1B3OA 2YR1A 3JS3A 1NAL1 1OFOA 4FNUA 2V2HA 1BWKA 3IEBA 2Z6JA 5F2GA 1OYAA 1M7OA 4UTUA 3IVUA 1H61A 3MUXA 3MBFA 4IX2A 1VH7A 4NX5A 4WY0F 1PCKA 4FEZA 3L66A 2I14A 3WJXA 3DFNA 3THQA 4XKYA 1LZOA 1QPRA 1YYAA 3LCGA 1AL7A 1K03A 3W75A 1W37A 1YXYA 2F7FA 2C6QA 2QCDB 4HPXA 1YADA 3W7DA 1F5ZA 4O10A 3W2JA 4RZ4A 4NJHA 3TDFA 2NWRA 3NNTA 2GVJA 3EX1A 3T4CA 1EWDA 4O1DA 4O17A 3GAKA 3SFKA 1AW2A 2V5BA 1VPXA 3MP4A 4R33A 5D2XA 4NX0A 2WSRA 3G1YA 1L6SA 2ZA1A 1X1ZA 1KW1A 5LNUA 3HPXA 3LXCA 4N4QA 4MPQA 4LUIA 5CSSA 2CZFA 4UFJA 3W2MA 5AFDA 4MIMA 4WOQA 5FF7A 3VFLA 4IXXA 3DKLA 1U83A 2NXIA 3I65A 5AHEA 3MP5A 1PCWA 5AYZA 3MHGA 3UPBA 4GWEA 3W7QA 4LVBA 2H3DA 4GE8A 4HSOA 3CEUA 4LWWA 5G1YA 4YXGA 3AJXA 3NGJA 2GPTA 3R13A 2QUUA 4Z1DA 3ABSA 1UASA 1XUZA 1NSJA 2E6YA 1B4EA 1K02A 4O57A 1IF2A 1OK6A 2CLIA 3W07A 3TMQA 4FXSA 2XN2A 1S5VA 3I7SA 4CCCA 3O15A 1OX6A 2Y62A 1TPUA 5CKSA 4DO5A 1M5WA 3DFOA 1TCDA 3W1MA 5CZJA 3FJ6A 2B7QA 1PHQA 5D2TA 5J5RA 5F4XA 3LHZA 3UY8A 1AW1A 3TNOA 1P4CA 3HGJA 4GUIA 3I68A 5KMYA 4JYDA 3CEPA 5K9XA 3TE9A 1KLYA 3LRLA 4AHQA 3O16A 3G1SA 4K36A 4K7VA 1ADOA 2FFCA 3CT7A 5LNSA 1K8XA 3S5YA 1KV8A 3KVJA 4OHQA 4FNPA 3UWUA 4GUGA 1R2SA 5EL1A 3I7QA 1XI3A 5LZLA 1DL3A 4X3ZA 3G22A 1WYIA 1TTJA 2NXHA 3W7MA 1TRDA 1UCWA 4I7VA 1THFD 1GVFA 3NQFA 4PL1A 3ZFHA 4JD4A 1KM1A 4Z1AA 3TQVA 1TPH1 5I3GA 4JDBA 3QRHA 3TAKA 3STGA 2NLIA 4PH6A 3TX9A 5EA9A 3GDRA 1W3IA 1SW3A 2AQWA 4XQ6A 4NNAA 3RLUA 4FNQA 2QCHA 2Q8ZA 1X6UA 2X16A 1RD5A 1VLIA 3C52A 1GZGA 3W7IA 3W88A 2RDUA 1DORA 2V8ZA 4WX2A 4UUIA 4R53A 4C1LA 3TW7A 4IMGA 2NX3A 4HHPA 1H1ZA 7TIMA 2O7SA 5GVJA 3N73A 3EXSA 1QO5A 3DZ1A 4IMFA 3M7WA 4BFAA 3TSDA 3C2OA 4Y96A 2ALDA 1LBMA 1A5SA 4K8HA 1WXJA 3KAOA 1U5JA 2D73A 1LDCA 3M43A 3A21A 1G69A 4XTIA 4O11A 3ATZA 5DELA 2E77A 2H6RA 4N2YA 1JCJA 3A24A 4M7SA 4AWSA 2ZZ7A 2TRSA 2PE4A 5H2ZA 2Y7EA 5DLCA 3B8DA 3NEVA 5U7SA 5FF4A 4H3DA 2ZRZA 5FESA 1FWWA 2VC6A 1H62A 1VJIA 4L4MA 1J2WA 4E38A 4UC5A 3E9AA 2A6NA 3IRDA 2ZRVA 4Y6GA 4S2CA 5KSWA 2DZTA 3NZ1A 3TU9A 1YDNA 3EX4A 4Q33A 3C4UA 4K8EA 5HULA 3EWZA 3OBKA 1I2NA 4CNNA 4YLWA 5AHFA 1K7EA 5AHMA 5D09A 3W86A 2CZEA 3NQ8A 3SIZA 3NO5A 1K7FA 1MO0A 1QR7A 1IIHA 3HG5A 4FIQA 1HG3A 5TBOA 4HNVA 2EPHA 3HGSA 3HG3A 1M6JA 1TQXA 4O1AA 3L21A 1KFBA 3N9SA 1SQ7A 2B7NA 5CG7A 4AWUA 2CLEA 3BARA 2DZWA 1ZJIA 5F2MA 3MW7A 2C18A 3HMJG 2O7QA 1C29A 3M5VA 6ALDA 2TMDA 3NPUA 3NQAA 1W1ZA 3EXRA 3JR2A 3NG3A 5F2IA 4M6PA 1I2PA 1SW7A 4FX6M 2ISSA 1TV5A 3STCA 2P10A 3EWXA 4DPPA 4E2DA 1KFJA 1SR9A 3IIZA 1H63A 1JCYA 1FY6A 3EWWA 1VQTA 2Z0IA 1HUVA 1KFEA 3BG3A 5D30A 4HNTA 3QMTA 4Q32A 3O6DA 1D9EA 1LLZA 2QCNA 5FI8A 3GKAA 2VFIA 1HO1A 5C54A 1EP1A 3QM3A 4M6VA 4N9CA 2WJZA 4JTIA 1B9BA 4LVGA 1PE1A 4BI5A 2VFDA 3MWAA 4JYEA 4M6QA 4WOZA 4RK8A 3W1QA 3O1NA 2WPBA 2H8XA 3RLVA 1VCVA 3FKKA 1VYSX 2ATMA 4JY9A 3TW6A 4Y9AA 1SO3A 5LGXA 4AB4A 4BR1A 4CNOA 4QNEA 1P1XA 5TQLA 5LNVA 4M7TA 3NM1A 1V7YA 3FYOA 1SZEA 3RK8A 3BG9A 3FFSA 4UMCA 1ICSA 4O13A 3NQ7A 1HO4A 1JUBA 1OHLA 2A1YA 3C2RA 5HMSA 1PHWA 4TMBA 1EPXA 4UTHA 4E0CA 3PVFA 1OFAA 3W1UA 3PBUA 3UZJA 5IBXC 2VEKA 1FX6A 2GOUA 3G1XA 1VZWA 1RR2A 2E1DA 3TROA 6TIMA 1LOSA 2DZPA 3MYPA 4QJ1A 1H5YA 2NX1A 2H90A 2F84A 3W7EA 1QFEA 1UB3A 4IGHA 1FXQA 3G1VA 3P81A 3W87A 1KFKA 1TREA 3USBA 5I3IA 1G67A 3FOKA 2EHHA 3PR2A 2R91A 1ZFJA 3HIJA 4YWIA 2ZZ1A 1P0NA 3R2GA 4L4LA 3W2UA 3W7KA 4XBSA 4O4VA 4HIBA 2NUWA 5HR6A 3TA6A 1ONRA 5K9CA 4UFHA 3H55A 3TK7A 1RQEA 1K7XA 3BW4A 5KITA 3T55A 1MXSA 2NX9A 2YZRA 2R8WA 5G2HA 1SO4A 4ADTA 1GYNA 5HWNA 1OG0A 2J6XA 4JTUA 3W1NA 3G8EA 2OJPA 3QMSA 3NQMA 1Q6RA 3LRKA 3W7NA 3OVQA 3HO8A 4YMZA 5G2WA 4ZQNA 4NXSA 3F4NA 1F2JA 2QJHA 2PRLA 4U28A 1R47A 2V0TA 5AN7A 1GWJA 3E96A 4CLMA 5AHIA 2Y89A 1L9WA 4BI6A 3PWAA 1UJPA 3EWYA 3H53A 3LOTA 3P74A 3LDVA 2NWSA 1JJKA 5DCBA 4JYFA 1ME7A 4GFSA 4AF0A 3G1DA 4XTDA 1C8VA 2H8ZA 1TYGA 3LLFA 3M5ZA 1MEIA 5CPMA 3GVGA 3UWVA 4ZQCA 3ABOA 4PC8A 4IJBA 1NFBA 1SW0A 4GXMA 4O54A 3NPWA 5EPDA 3S1WA 2CLLA 4CNPA 1SPQA 4KKXA 5D33A 1W8SA 1N7KA 4FXRA 2C13A 2X1RA 5EKYA 3NM3A 2VFEA 2DU2A 3TC7A 4EVZA 1ZHAA 3P8JA 2J9YA 5FF0A 2X1SA 3NPVA 3PBVA 5L9FA 1I2QA 1TMHA 2W0UA 4FF7A 2G97A 2ATSA 3IIOA 4EF8A 3BLFA 3WFAA 1A5AA 2EF9A 4LS0A 5TIMA 4PL2A 2NV2A 1G7UA 3I6RA 2YGYA 3WJSA 4N4PA 4RJEA 1S5TA 1GVSA 3QEZA 3A9IA 1O5KA 2AAMA 3TC6A 1JRBA 3WK0A 1IXOA 5DXXA 5HNRA 3CQ0A 4Z0SA 5HUOA 1Q45A 4X22A 3QF0A 4MVAA 1F6KA 3GLCA 3BLIA 3BPWA 4WXYA 3NQVA 4IX0A 1LLWA 1H1YA 3GNDA 1GG0A 5D02A 4IXHA 5BRBA 4JXCA 3UQNA 1K8YA 4LC6A 3SGUA 4MY9A 1LOLA 1HFBA 4O14A 1OFDA 3NL3A 1KM0A 3W9ZA 2XN0A 3TKFA 1W5QA 2E6DA 4OV9A 2VFHA 5ABTA 1X1OA 2ISWA 2OCZA 1VGAA 4JDYA 4MJMA 5E0KA 1XKYA 1TPC1 4JIPA 5K4ZA 1GT8A 1ME9A 4Z0JA 1PS9A 2ZA2A 3BVJA 4N9DA 4NNBA 4ORMA 3W7PA 1X8FA 2ZYFA 4LS2A 1SUXA 3U6WA 1G4TA 4O0KA 2VELA 3EKZA 2VKZG 1OX5A 4ADSA 1XBZA 3QYQA 1SZNA 1GVOA 3M1ZA 4IPJA 1QO2A 4WQ6A 4JX6A 5MHBA 1OYCA 4LRSA 4MZYA 2QCEA 1FCVA 1SSDA 4GJ1A 2VOMA 3MHFA 4U4MA 4RZ5A 3HB9A 3S1XA 4GC4A 3IGSA 4TR9A 1YPFA 3W23A 1NEYA 3KRZA 3LTPA 1H7NA 4LRTA 2WQPA 5CSRA 5K7JA 3CU2A 1CX9A 3P67A 3P84A 2X1TA 3M44A 4D2JA 1IGSA 3HG2A 3H54A 3NL5A 3UWWA 4ZVJA 1XCFA 1KM5A 3ZWSA 3LX9A 2X2GA 1V5XA 3W2KA 2VFFA 1YLVA 3L5AA 2V2DA 1K8ZA 2R14A 3L0GA 4FX7A 3QFEA 2ABAA 5D04C 3B06A 4ZZ9A 4HPJA 2ZQ0A 3TXZA 3C8FA 3NXFA 1N8FA 3LV6A 1UUOA 1SZFA 3N2MA 3S9YA 1I45A 2W79A 4H4IA 4O1BA 1KTNA 1Q6OA 4I7UA 4QISA 1UBSA 3NQCA 2V81A 1JULA 3BLEA 2ISVA 2PRHA 2ZA3A 4DBDA 3W71A 3SR7A 2ZRUA 1SO5A 4NJKA 4DQWA 5EMUA 3T7VA 3DKJA 3CB8A 3B4UA 3W22A 1Q6QA 3THAA 3C2VA 4FNRA 5LHFA 4CCDA 3WJWA 4QM1A 3R8RA 4A3UA 3LTYA 1H7PA 1OK4A 4JNMA 4IMDA 5DY2A 4Y8FA 1JCMP 3NYZA 4JR5A 1F76A 4M5PA 3FKRA 1VRDA 2RDTA 4DELA 4MYXA 2J9XA 3OIXA 5KINA 2J88A 3NL6A 1LOQA 2H3BA 2Y88A 1FWNA 2BSLA 2WV8A 4ONVA 1VCGA 1W56A 2Y7GA 4LOCA 3R5EA 4TO8A 3QPZA 1OFEA 1AL8A 4CQ9A 1QDSA 2GJNA 2E6FA 4N6EA 4JTHA 3ABQA 5AC6A 2Y61A 3UWZA 1RQBA 4NT0A 3QJAA 1FCUA 1HTIA 4O16A 3LCLA 3W74A 1VYRA 1TIMA 4Z1BA 5BNKA 2NZLA 1PV8A 5HINA 2VEMA 5FEPA 3LERA 1EUNA 1EP2A 4LY8A 2DZXA 3SI9A 4AAJA 3UWYA 2CLMA 4UFLA 5C5YA 1OF8A 1A5BA 3LBMA 5D2YA 1IXQA 4JTLA 2ZBTA 2V5LA 5BW6A 4FX8A 3PULA 1F6PA 1YXCA 2BWGA 3D0CA 1LRNA 1ZAHA 4O15A 3GYEA 5D38A 2PRMA 1WAUA 4K38A 3EWBX 5HUPA 4X9SA 4MY8A 3QMRA 3TAOA 1NF0A 1LRQA 2DJXA 3GXPA 3B04A 5IBXA 1FWTA 4UTIA 2OT1A 1TPWA 4IWWA 4IPIA 4LV9A 4JIQA 1SO6A 4PTNA 2Y6ZA 2YDAA 3IIVA 3LBCA 1GJPA 3PY2A 5AOUA 4IQLA 4O8RA 3B0UX 1QOPA 4DXVA 4NJGA 1LTDA 3RMJA 1MSSA 2C15A 1TO3A 3CIWA 3KX6A 3UWQA 1I4NA 1D3HA 2TPSA 4AXKA 3W1TA 5G4EA 1SU5A 2G5WA 2V9DA 2Y85A 3MJYA 3PM6A 3UXAA 5C55A 3S5NA 3S5OA 1T8XA 4ZL1A 3MYOA 1EP3A 3W72A 3GX9A 3KFTA 2Q3OA 1KA9F 3EXTA 1DHPA 2FB3A 1DJNA 1ZCOA 2QCGA 5SWUA 4EIVA 2FJKA 1A5CA 2UV8G 2ZRWA 1TPB1 3L65A 3GIYA 3A5FA 3DHFA 3EX2A 5F1VA 1MZHA 3W73A 2Z2UA 3W2LA 2E6AA 4RLIA 3TMLA 5E93A 5D32A 3NR0A 5DN1A 3CM4A 1JR1A 3O63A 4JGDA 2WNQA 4QITA 1KV5A 3L5LA 3KVLA 3PG8A 3T78A 4OBTA 1JCNA 1XBXA 3NQ6A 3NDOA 1G6CA 2A6LA 1QPQA 4XKYB 4S1FA 4NZFA 3MI3A 3STEA 4OE7A 4I7WA 5DXYA 4JICA 2V82A 3VI2A 4POCA 3DI1A 3UPWA 2JKPA 2VXNA 2WSYA 4JY8A 2R94A 1ICPA 3Q37A 3G0UA 4OU1A 3F03K 2ZRYA 1EA0A 2RKXA 3LCWA 2V30A 1AW5A 3VE9A 3MHUA 1A50A 4GUFA 1O60A 3NQ2A 4RXGA 4UTLA 4UR7A 4XBKA 1KFCA 4BWLA 3V1PA 1DQXA 1FXPA 3GDKA 1H51A 2EGZA 3BG5A 3RFAA 4BI7A 4FB7A 3QSRA 1X7FA 2ZTKA 4TIMA 1RVGA 3IVSA 4MOZA 1VC4A 4ICNA 2JGYA 3LGEA 4IOTA 4RKAA 2QEZA 4O52A 4UTMA 1WOBA 3P5YA 1G7VA 1LBFA 4XZ9A 5BMXA 1WBJA 4MLRA 5LNWA 3L68A 3PBYA 2B7OA 3GKFA 1JUKA 1AMKA 3FIGA 3L0NA 3Q58A 1F05A 3W7OA 3TIMA 2YSWA 1XM3A 1WA3A 4Z08A 1R46A 3TR2A 3DU0A 3ABRA 3NAVA 3NL2A 4W9TA 3SGZA 3NQGA 1XXXA 2CFFA 5E1QA 4AH7A 2C14A 1ICQA 3QW3A 3S0CA 3A22A 1B57A 4MFDA 3DFPA 5BMWA 1J4EA 3SZ8A 3L67A 2B0MA 1I2RA 4DEFA 3MO7A 4HT3A 4LVDA 1TV7A 5D37A 2XFWA 1MEWA 3HJZA 3W7HA 5AC8A 4UXDA 1KTCA 4RV8A 1RZMA 3ZWTA 3C6CA 2WSQA 3B0PA 3C61A 4CQAA 1UUMA 5H91A 4A2SA 5I3HA 1LROA 3IIXA 2JBMA 4O53A 3UNDA 4ZMGA 4DPQA 3W83A 2CLHA 1EIXA 1MEHA 3KVKA 3OEXA 3CWOX 4MJZA 2J24A 3HPZA 5HR7A 2JKEA 4LC8A 2JGQA 3OHIA 4WY0B 8TIMA 1TTQA 2WO5A 3WK3A 2A7NA 1CW2A 1Z42A 3TUUA 5IM51 1EX5A 3NQDA 1PIIA 2QJIA 5K2ZA 3S1VA 3QSTA 1QPNA 5CPLA 5U4NA 1TTPA 1TV8A 3LHVA 1Z48A 3M5YA 2A4AA 1RPXA 2HMCA 1OFQA 3GR7A 4PEKA 2Q3RA 3S42A 3BW2A 3AO0A 4ADUA 3PS7A 2YCEA 2OMAA 2C3ZA 3LCXA 3TSBA 4HN4A 4O4WA 4RXFA 4E2BA 3Q94A 1LYXA 1OABA 2C16A 1EEPA 1NF7A 3PB2A 1ZENA 4QSHA 4ORIA 3QPYA 2GVLA 5J5DA 3V75A 4ZQOA 3C2FA 2FB2A 1D3GA 3MP3A 4ZQRA 1LRTA 4UFKA 4FNTA 4XUGA 4EOUA 5K4XA 4YCOA 3VCRA 5F1UA 2WOQA 4I9AA 2B7PA 1TJPA 1DVJA 2RH9A 3YPIA 1XC4A 1H60A 4AWTA 1H7RA 1CI1A 1H7OA 3CLMA 3DENA 4MZ8A 3EKLA 3W85A 1YTDA 4K37A 3KRSA 3EWUA 3TQKA 1J5TA 1RQHA 4GRSA 1H50A 2QDHA 3PAJA 5L6UA 2NUYA 2WNNA 1QMLA 3PB0A 5G1TA 4MY1A 1GTHA 5CZ0A 2CWNA 3W1LA 5C6MA 2E5DA 5F4WA 4UCGA 2TSYA 1FDJA 4LTSA 4MZ1A
chains in the Genus database with same CATH superfamily
2DZVA 2RDWA 3NZPA 4I90A 2QCFA 4DIAA 2X09A 3KUMA 4QG8A 4Y9OA 1D2KA 1W5MA 1FOBA 1IZCA 1R2RA 1P1MA 5DFAA 3RU6A 3ZR4A 4B9YA 1JYVA 3L4UA 1YDOA 3LLDA 3WH8A 4W84A 3N9RA 3LHYA 1XRSA 3PUOA 2J66A 2R1MA 3JU2A 2FIQA 1FUYA 4US5A 1LF1A 4UTTC 1JRCA 2E40A 3AHZA 4UBPC 4HTBA 4KWVA 3ARVA 4P5UA 1EUAA 4JKLA 9RUBA 3OYXA 2UBPC 2ZZ5A 1ZU8A 2F6KA 1ZAIA 4H6EA 4TMCA 1KBIA 5D05A 1T8QA 3WQDA 3ARXA 3M47A 4BHYA 1YPXA 1O95A 3OLDA 2X1IA 4UFMA 3MO4A 4Z2HA 5HQEA 4KH2A 3FCPA 3PZIA 3H2CA 4GQ0A 2W9MA 2BY3A 2VT0A 3CUXA 3V0SA 5M1TA 3C0QA 2DW6A 5D9MA 5T26A 3C8NA 3R0KA 1IWPA 3WQWA 3ABZA 1R87A 2TAAA 1ENUA 4PN2A 3VOIA 5EYWA 4DBUA 2GDUA 1IWBA 1DBTA 3OBAA 2J7GA 5K9DA 2ZZ2A 1F07A 4HZ7A 4YPJA 1VBGA 1DV7A 1N82A 3MKCA 3M0VA 1LBLA 2Y63A 1UBPC 1BF2A 1H41A 5A2CA 2DY3A 2CZ5A 5I7GA 1BTMA 3RPTA 3T0BA 4H9MA 4JZ5A 4O12A 5AZ1A 4IIEA 5IFPA 1GPWA 2CU0A 3SAZA 3IJIA 2Y8UA 3GDMA 3DYPA 1GW9A 1I60A 4WZHA 4OWGA 4FIRA 3W7CA 1XCXA 4D8ZA 3Q2DA 5F2LA 4H9VA 4XAGA 3LQGA 1HX0A 2WWCA 1YBQA 3WK1A 2GVYA 4N0RA 3CH9A 3SCVA 2C1HA 1I2OA 1UH2A 3VU2A 2QUVA 2DP3A 1JPHA 4HGXA 4X0VA 5I07A 4LS1A 4M51A 3L2IA 1J10A 3T44A 4BZYA 3H2NA 3POCA 3VKJA 3SY1A 1K4HA 4PTVA 2PWEA 2OWCA 4DYKA 2G50A 2RHGA 4LF1A 2P0OA 5AKQA 1B4KA 1R86A 3IRSA 2BY2A 4DAIA 1WUEA 1B2YA 2QLYA 3TZNA 3GNPA 3VOJA 3SCRA 4LSBA 3SCNA 4GUHA 3VD4A 4W85A 3IACA 5HWJA 3TYCA 4JTKA 5DCDA 4WD0A 3KVMA 4KERA 1WXZA 2A7RA 2FPTA 4Q4MA 1RBLA 5CPNA 3WBXA 1AJZA 1M7XA 1PL9A 4XIAA 4JX5A 3QW4B 3PSVA 1T96A 2EKCA 3M0ZA 2FDSA 3N11A 6CGTA 3S8HA 2WJDA 3UW6A 4GY7A 4UTJA 4HB7A 4M82A 3HF3A 3MBDA 1R5YA 2ACRA 1S3HA 2C0AA 3C5QA 3CQHA 2IXVA 4YTQA 3UYCA 3ZYZA 4PTWA 1DQUA 5HA7A 2DIKA 2HTMA 4ERAA 2QDGA 1QPOA 2WJFA 3DFHA 4EWND 3PTQA 5XIMA 3BK0A 3FDKA 1W5OA 2A21A 5LGZA 4D6JA 2EEXA 3P61A 3DHUA 4NZ1A 1MRAA 4PE8A 3BDKA 3KCOA 2XFRA 4XSMA 1KBJA 1S39A 3ZMRA 2PURA 4LJ3A 4PMNA 2CLFA 3AZSA 2PMQA 5LSMA 2R24A 1OD8A 1XSKA 4F9JA 2XGIA 1E4LA 4IMCA 2FTWA 3DN5A 2FYMA 1MW1A 3CUHA 3WF3A 1MUCA 2YPIA 3HOJA 1EXPA 4DI8A 1KXHA 1S46A 3EOOA 1PAMA 4S2BA 3O6YX 3K46A 1TR9A 2RJHA 3VUPA 1DP0A 2BG5A 2XTKA 2PI6A 4JEQA 2WLZA 1FHLA 3A9BA 2FPVA 5A6BA 3GZ3A 1BWLA 4GINA 4GIAA 1V4YA 4AEOA 5IRPA 4K1GA 4OT7A 3AZRA 2J7DA 1DKWA 4ERIA 3TFCA 4P8VA 4ZODA 3BQ5A 3F5LA 2WMGA 1ZRQA 3B03A 4BEUA 3WQEA 4LYRA 1NOWA 1TSIA 2Y70A 1K3UA 3UY7A 1Q2RA 3SW6A 2B4GA 4NASA 3C0SA 2YXGA 3WENA 2A0NA 5DF0A 3LHWA 2Q02A 3PHAA 3FA5A 3L4ZA 4X2RA 1OFRA 5HOSA 3NZRA 1ZY9A 3QTGA 5DY3A 3HQNA 3WX7A 1R9ZA 3ITYA 3AWNA 4JTTA 4L1GA 3KCLA 1JUEA 1QVBA 5B7ZA 1GYMA 5CGQA 1CLVA 3NXLA 2PF0A 1Q7ZA 2QF8A 4QE5A 1J96A 1BG4A 3OHMB 3TXVA 2PDCA 3N2TA 1M65A 3T9PA 2V3GA 3K30A 5BOEA 5A5WA 2G4FA 1ONWA 2OR2A 4UFIA 4P2VA 4MKNA 1KC7A 3GY1A 3KTXA 4LUJA 1AJ2A 3W1PA 5A69A 1IHIA 3FJLA 2VEPA 1VR6A 4ZQMA 4F66A 2QCCA 3LXBA 1QCWA 2QIIA 3FLUA 4NVTA 5CZTA 4N9BA 4GZJA 3LTSA 4OGZA 1HL2A 3GM8A 2PDWA 1ML1A 1G9HA 3P7YA 1W0MA 2ZRXA 3CWNA 2JEPA 4M0XA 4MHBA 5AC7A 1CGVA 3L2LA 1A5NC 4YL2A 4NG3A 3V5OA 1VHCA 2HVNA 2NVCA 1ISVA 3DFSA 1X39A 1ITXA 3WBAA 2ANUA 5HJLA 2KZHA 3CAVA 2IKGA 4DUVA 1Q6GA 2XN1A 2PDHA 3PAOA 2I5QA 5DT7A 5E5CA 1EBGA 3UZ5A 1GEQA 3AYRA 1LP6A 1EO5A 2REQA 4NZJA 4R7JA 3HGRA 4WGXA 3G6MA 4NQ1A 4PEEA 1QXLA 1QBBA 4QP0A 1LQAA 4RV3A 3OLIA 3W7JA 3AAMA 3M0YA 4MB1A 3M16A 1ZS2A 3QC0A 3UBPC 4WSJA 3G1FA 4XZNX 4E8DA 3OP2A 1QT1A 2HEJA 3GXNA 3M9YA 4LT9A 2Z6IA 3BLOA 3UNTA 3EBVA 4XB3A 4HHMA 4CU6A 1DQWA 1J9YA 3RX4A 4LH8A 2TODA 4F0MA 1U5VA 2YW3A 3GNNA 2DPEA 4DBEA 1UQZA 2BB0A 1GTEA 2BHZA 2XIIA 4N9EA 3U9IA 3QZEA 3REQA 3S5ZA 2XVPA 1LORA 1QOQA 1R9YA 2DEPA 3KXQA 4ZB5A 4ALDA 1JDAA 2VGIA 1E6ZA 3OG2A 4A22A 1LCOA 4URIA 4MPKA 2W91A 1OC7A 4WSKA 1W3NA 1E4NA 4MLJA 4KFOA 1OFBA 1VCFA 1RLDA 1YTKA 3WNOA 5AHLA 4H9YA 1O1HA 5C2CA 3I7RA 3RR4A 2A3EA 2PDGA 3S2LA 3WMBA 4KESA 2WANA 2Q8LA 2CW6A 3LRMA 4E6MA 5BU6A 1TTIA 3F2BA 4OUIA 3GRIA 1E9LA 4M19A 4UTWA 1E6PA 4C1KA 1J18A 1QJWA 1DWAM 5KTLA 4FXFA 3Q65A 4JN7A 3WN6A 1UPMB 4REQB 5ABFB 4HP5A 3NSXA 4I8DA 1OGGA 4FZIA 3MVIA 1WKFA 2V2HA 3IEBA 3IWPA 1OYAA 4IGSA 4MB4A 3AIRA 1M7OA 1V7AA 4IX2A 4WY0F 1PCKA 3L66A 4MNJA 3O6AA 4ZFMA 1QPRA 5BOFA 2GGHA 3WQOA 1I1XA 1YADA 2AQOA 2RGLA 1V02E 3AROA 1N8IA 4GXPA 3ME3A 4O10A 1XLLA 3N4EA 3W2JA 3TA9A 4BKNA 2NWRA 3NNTA 3F4VA 4HYRA 5D4YA 1EWDA 3VAVA 2YL6A 4O1DA 3T0DA 1X6NA 2WSRA 3IGHX 1EJXC 2INEA 3HPXA 3SB0A 1N2VA 4LALA 1RY8A 5FJJA 2VGFA 4UFJA 3W2MA 4HA0A 5AFDA 2HBVA 1YKWA 3UZXA 1YNPA 1CXEA 4G6CA 5I09A 3UEQA 1C8YA 5AYZA 4A8NA 2PTYA 4GWEA 3VDBA 4LVBA 3MUAA 3SGGA 2H9AB 3ONBA 5G1YA 4YXGA 1W1PA 3ABSA 4O57A 2CLIA 3O0KA 3W07A 4JQ2A 5CSYA 4TUFA 1S5VA 3I7SA 3VABA 2BDQA 3EOSA 3P93A 5EB8A 1XHGA 4UB9A 3L4XA 2A3BA 4LBRA 4PUWA 2B7QA 1V77A 5BU9A 3VMPA 1FTXA 5J5RA 4DAFA 4GUIA 4AW7A 2X42A 3I68A 2I57A 1J11A 1GORA 1ISYA 3TE9A 4HK6A 4XD3A 5CAHA 4K36A 2FFCA 5LNSA 4KCWA 3S5YA 4QDMA 4FNPA 3UWUA 4GUGA 1UKQA 1HGYA 4MM1A 2WBGA 2UWFA 5EL1A 2AGTA 2VZSA 4ZBCA 3WFZA 1TTJA 3F2DA 3W7MA 4GVHA 4DBWA 3V5CA 4PL1A 3MZNA 4EPBC 4JD4A 4A3HA 1KM1A 4ICCX 4Q8QA 1KCKA 4WDTA 3STGA 5EA9A 2DSUA 1CWYA 1W3IA 3AUOA 5I78A 3BAJA 2QCHA 2Q8ZA 4TV5A 2WKGA 1RD5A 1GZGA 3E1F1 1DORA 3RIKA 1E40A 3WUFA 3COTA 4H7CA 4R53A 3ISIX 4C1LA 3TW7A 4RNFA 3GR4A 2NX3A 4HHPA 4GLEA 1H1ZA 4B3KA 5GVJA 3WLIA 4NIRA 1EHNA 2GOKA 1KXVA 2GL5A 4IMFA 4BFAA 3N13A 3TSDA 3QY6A 3TR9A 4Y96A 4MDPA 5BXRA 1SJDA 1UIPA 1LDCA 3A21A 2A79A 5BWFA 2OZ3A 4O11A 1UR8A 5DELA 3VZZA 3URNA 1JD7A 2E77A 3IJQA 4N2YA 4H8UA 4KQNA 3I6TA 3A24A 5EMKA 4GX8A 4CQCA 4K2SA 4AWSA 1EC9A 1GONA 2ZZ7A 3ZLGA 5JUVA 1XH0A 1HN1A 2P8BA 1KRAC 2QULA 5FESA 3UR5A 1R0MA 5FJUA 1VJIA 4L4MA 3CV2A 4E38A 3MPGA 3E9AA 1C7SA 4Y6GA 3BJTA 4S2CA 1LWJA 3A4AA 4RNIA 4PCSA 4Q33A 1MXDA 1C92A 1VB9A 1H5VA 2HXTA 4CNNA 5AHFA 5AHMA 1G0CA 4XKMA 3UP8A 1FWAC 3W86A 2QXWA 1VPYA 3LYEA 3E2VA 1UD4A 4PSRA 3E5PA 4E4UA 2BY0A 2WC3A 4HNVA 3WQPA 2VC9A 3QGVA 5BXTA 2ZC8A 1M6JA 2C7FA 1TQXA 3PTKA 2NSXA 2CHOA 3R4IA 1A3XA 6ENLA 2CLEA 3BARA 4QG6A 4J5NA 3E3HA 2PPGA 1ZJIA 3TYUA 2E8YA 3WH9A 6ALDA 4K3ZA 3TVAA 4J35A 3JR2A 4PMOA 4FX6M 1QI5A 1H63A 4TOQA 3BAWA 1JCYA 1FY6A 1TV2A 1Y5VA 2Z7KA 1UR3M 4HNTA 3O6DA 1NQ6A 4GI8A 1ISXA 3H23A 2QCNA 3BTNA 5FI8A 3QM3A 2WJZA 4LVGA 2HNHA 1SGJA 3NJ3A 2JE8A 3FGCB 4XD5A 5CBIA 2G3IA 5BXSA 4CQDA 3RLVA 4XAYA 3K1GA 4KW2A 1UMYA 3TW6A 4Y9AA 2J8FA 3MANA 5LNVA 1QWKA 4AQLA 4M7TA 3N9KA 1W2PA 3R58A 4JFWA 3DBNA 5I79A 1Q85A 2XFFA 1UG6A 4UZUA 3BAIA 1ICSA 1QHOA 3KLKA 4H19A 1A5KC 3O9NA 2AOSA 1T41A 1UP3A 2EPOA 3GH5A 3QKEA 3QV6A 2O55A 2VWTA 3OYZA 2OX4A 1PHWA 4TMBA 1EPXA 3BH4A 3DIPA 4UTHA 3WLNA 4ICMA 4EXBA 3OPSA 1L6GA 2ACSA 3UZJA 2GGIA 2BVYA 4I9TA 4GOAA 3JW7A 2VDIA 3NWRA 1RR2A 2NQ5A 4IFRA 4UQDA 1KBKA 6TIMA 2DZPA 4MKSA 4QJ1A 2H90A 2YA1A 2F84A 1M53A 1UB3A 4IGHA 2X41A 2PDIA 4FLSA 1TREA 4M6UA 3USBA 5I3IA 2D2JA 2EHHA 1ZFJA 2D0HA 3U5UA 1UWAA 5C0QA 3E6EA 3H21A 5FSDC 1P0NA 2PZ0A 4L4LA 1LUCB 4DN1A 1S2VA 3M0MA 1WKYA 3KBVA 1C7TA 1ONRA 5K9CA 1RQEA 3T55A 4ZOEA 2NX9A 4GHRA 1SO4A 5CLWA 1DWIM 1GYNA 2ODOA 4KGLA 4JTUA 1OWQA 2DQXA 4CN6A 1FH8A 3CZKA 3OVQA 3VZYA 4NXSA 3F4NA 1F2JA 2CETA 1PTDA 3VNYA 5AN7A 3E96A 5AHIA 2Y89A 5DEZA 3M0JA 1UJPA 3IK2A 1G1YA 2OG9A 1RUSA 3LDVA 1PDZA 1JJKA 5DCBA 4D72A 3L2MA 2E0PA 2QGHA 2AQVA 3M5ZA 3GVGA 4ZQCA 3O0FA 4LGXA 4OJYA 1EL3A 3F5JA 1RSCA 2CLLA 5D33A 1W8SA 1R38A 3OGSA 3VOFA 1DPMA 4FXRA 2PSNA 2VFEA 4OFCA 3PZMA 3SUUA 2DU2A 2CBIA 2C1GA 3W29A 1M3UA 3W01A 1ZJAA 1XDJA 5J04A 4F0LA 3VTRA 1WAWA 5FF0A 3PBVA 1TMHA 2W0UA 4FF7A 3IIOA 4EF8A 1A5AA 2VVNA 4AX6A 3S6TA 4LS0A 5TIMA 1AODA 3VKAA 2FZ8A 1G7UA 5BRPA 4N4PA 1B3ZA 3VA8A 3ARWA 2AAMA 4X22A 4MVAA 3BLIA 1HF6A 3KL0A 5CH9A 3NQVA 4H9TA 1V0KA 3TWBA 1H1YA 3BSGA 3V16A 3U57A 3A3WA 1BVWA 1E43A 3A3HA 4IXHA 4NYYA 4M1BA 5BRBA 3W02A 4LC6A 4LFYA 3SGUA 2ZUMA 4O14A 4GO8A 1XIDA 3GNOA 4U3AA 1KFWA 2E6DA 1SJAA 2ISWA 4DNHA 1ME9A 4Z0JA 3SUVA 3BVJA 4ORMA 4NNBA 2DFAA 1X8FA 1CENA 2VELA 3BOLA 3EEZA 1W1A1 5HBFA 4Z1YA 1R3VA 4ADSA 5BRQA 2NSOA 1QO2A 5T9BG 4JX6A 1OYCA 1NY1A 3CBWA 5CPSA 4XAFA 1S3TC 3MHFA 4B2DA 4GC4A 2YBUA 4PMQA 3BMVA 3IGSA 1YPFA 1WXYA 5CSRA 1KCXA 3P84A 6XIAA 3A64A 4EANA 2EG8A 3UWWA 3NL5A 3KW3A 1KM5A 3NCOA 4U5IA 3ZWSA 5D9NA 3VOGA 2EPLX 4M80A 2XZ7A 3B40A 1ZQ5A 1K8ZA 5D04C 4NI3A 3HMCA 3NXFA 3LV6A 4ZXOA 3N2MA 3VIFA 1OZMA 4NILA 3S3GA 2F2HA 5XINA 3B8VA 2ZA3A 2ZRUA 3R6IA 4DQWA 3GU2A 2QS8A 5B7YA 4FNRA 2D1ZA 4CCDA 1NIUA 4QM1A 5T91A 3N1AA 3TC3A 4DM2A 1OK4A 5DY2A 4ROQA 3HM7A 1F76A 4MYXA 4RZBA 4Y9MA 3BE7A 3NL6A 1MVYA 2Y88A 1FWHC 4GVFA 1J01A 1CXKA 1VCGA 1KR0A 3B8TA 1PWMA 2QVNA 4LCQA 4N6EA 2X0HA 4L1WA 1Z89A 5AYBA 2PAJA 3PPFA 1TE1A 2Y61A 4GISA 3KL3A 3LCLA 5A6TC 4HOWA 1OQFA 2WC4A 1TIMA 5BNKA 2NZLA 3V4BA 1TX2A 1S2TA 1EP2A 3W4RA 4PTXA 4C90A 4LY8A 3FA4A 4G7FA 1XH1A 4PRTA 1OF8A 3HPAA 2GJXA 1A5BA 1PIFA 1TZ9A 5D2YA 3WF2A 2XUCA 1IXQA 2XVLA 2ZBTA 5FACA 5BW6A 1JI1A 1V0LA 2BWGA 8CGTA 1NP0A 3OZMA 5TD4A 4ZSTA 4I5RA 3GYEA 5D38A 5DX7A 1I75A 5D9PA 2XIBA 4ZE4A 3DFYA 2OT1A 3M64A 4MB5A 4NI8A 4IWWA 4HU0A 4IPIA 2VUYA 5PTDA 4TVUA 4BJHA 3IIVA 1GJPA 1GOOA 3GBEA 5H8UA 4O8RA 4WLCA 1JDDA 5H8PA 3N6QA 3NZGA 3LK6A 3NIYA 3UJSA 3CIWA 1I4NA 1D3HA 3PN8A 2TPSA 3ARTA 2PTWA 4AXKA 3LSCA 4WEVX 4FLRA 2G5WA 4WR3A 2V5CA 3PPCA 3EXTA 4S3FA 1NWRA 1FWGC 2FB3A 2YB4A 1ZCOA 1PBGA 3LD5A 4A3YA 3VNKA 2WWDA 4EIVA 2XISA 4Q8WA 2UV8G 4WHBA 3L65A 4IG2A 3BJSA 3WLSA 5F1VA 5ENLA 4JKMA 3T2QA 3L4WA 4KWSA 2WMJA 1US0A 1E1FA 4RLIA 2DV0A 2Y24A 5E93A 5D32A 1JR1A 2WNQA 2O92A 4QITA 3KVLA 3PG8A 2YDSA 4CD4A 2C0HA 1JCNA 1XBXA 3RM9A 3NDOA 2A6LA 5I2UA 1M03A 1QPQA 3DESA 3MI3A 4OE7A 4I7WA 1AQHA 2V82A 3PWIA 4ZTXA 1IEQA 4JFSA 4JY8A 1Q6DA 3F03K 1GJUA 3LCWA 2V30A 1PTGA 3MHUA 4S38A 1D8CA 2R6OA 4RXGA 1AD4A 1E0UA 1GOMA 4OUEA 4BWLA 1DQXA 1VFTA 3WLKX 1XLFA 2PWGA 1VP5A 3QV9A 1UH4A 3CUGA 4AIOA 5C2GA 1VBHA 3PP7A 1W1YA 1AH3A 1RVGA 3UG5A 3BL3A 3VDGA 4HMNA 4YU1A 1UD2A 1WOBA 3P5YA 1G7VA 4XZ9A 1WBJA 2C79A 2FMOA 3CHFA 3L68A 3GH7A 3GKFA 1AMKA 4IIBA 3L0NA 3W7OA 4GIYA 2J25A 2DVUA 3I3EA 3WEZA 1ZP3A 1XXXA 1ICQA 4AIEA 2R1KA 4TX6A 1FKWA 3SRKA 4BY3A 3A22A 1B57A 3P14A 3L67A 4PB3A 4JAWA 4DEFA 4HT3A 1MEWA 1OCNA 3MT1A 3BMXA 2OLHA 3U7VA 2WSQA 3AOFA 4NRSA 2Y5SA 4CQAA 2WVTA 5H91A 4OOUA 4DPQA 3AXMA 3W83A 1MEHA 3N12A 3KVKA 3OEXA 1TWDA 1PZ3A 2Q71A 1YEYA 3UF9A 2J24A 3ALFA 2JKEA 3R11A 2JGQA 2QPSA 3OHIA 3RM8A 2FHCA 2W66A 2WO5A 3N29A 2A7NA 2PTDA 1IE7C 1GPFA 1Z42A 3TUUA 1EX5A 3NQDA 2Y4SA 4GYJA 1H1NA 1MNZA 2HPIA 3OBEA 4LX4A 3QSTA 4QCEA 1TTPA 1HKWA 3BXWA 3M5YA 1OFQA 4PEKA 3U3HA 1RAKA 4ADUA 2OMAA 1VJSA 4GIRA 1NFPA 4KCVA 5EMLA 4O4WA 3Q94A 1XS2A 2ALRA 4ZE5A 1EEPA 1JNEA 3OGVA 4S3JA 3FY1A 4EPEC 1YX1A 1M41A 4H00A 2FB2A 1XSIA 4X63A 3SUTA 5K4XA 1VRXA 4GYPC 2NQHA 1MWOA 3ERPA 1LL6A 3O3RA 4AWTA 4IFOA 1KWGA 1QNOA 2YXXA 4OBSA 3JVAA 3TQKA 1RQHA 5CJNA 1QMLA 2CBUA 5G1TA 3QHNA 4JN8A 5F4WA 1XWYA 2V63A 4MZ1A 4FPSA 5GJMA 2YB1A 2GSJA 4B5XA 4DO7A 5CZKA 1M04A 1SFLA 3WNLA 3G8RA 1XDMA 2Y7FA 5CJ5A 1OX4A 1TG7A 2HK0A 1GVRA 1Q63A 3CUZA 3DGRA 4K39A 5DRIA 3R0UA 2VRJA 4JTSA 3N34A 3EEGA 3T07A 4GKTA 1H7XA 4S3BA 4W7VA 3WL1A 3A23A 1FWRA 1FP9A 1OIMA 1TB3A 3S1UA 4US6A 1MI3A 3SSJA 3VDAA 3N04A 3RJXA 4JTJA 4FS9A 1ISZA 1JCXA 1LL4A 3CNYA 2XJ7A 2PWVA 1UWRA 1BEUA 4HBKA 3GTXA 2XVGA 1UR2A 2WKLA 2E28A 4DWDA 3BW3A 4QRNA 1BYAA 3R12A 3WQFA 4L9YA 4ZTYA 2GQAA 3D6NA 4AX7A 1ZALA 1HNYA 3TTSA 1WB0A 1QWGA 3EB4A 4I3GA 3LHTA 4PA8A 1TJ0A 3LI0A 3W2NA 5AB3A 1EJSC 2YYTA 1AD1A 1YE6A 1Q3NA 3UERA 2VC7A 1TMQA 3P6LA 1WBHA 1YNYA 1WX0A 3P82A 2VX5A 4RE0A 4JHZA 5CBJA 5I02A 3D3AA 3ABXA 5JBFA 1T99A 1JVNA 2ZOXA 4K7YA 1F4AA 1YXDA 3AXHA 4CNTA 4GVGA 1W9DM 2E5BA 1F7BA 3RU8X 4DF1A 5DMLA 3NPXA 3MSGA 5FF3A 5JIPA 5AYXA 3SQLA 2I56A 4YCPA 2Y8VA 2EJ1A 1WNOA 4R27A 3U7BA 3LA4A 4NRRA 3LPOA 1BWVA 3W7LA 4Q4KA 5I3JA 2YX0A 3W28A 3AICA 4LVFA 1FWBC 5CPQA 2VX7A 1K77A 1S5NA 1IR1A 1E0WA 3GW0A 4FHAA 4D6EA 3P80A 4X2PA 1TX0A 3C3NA 3BV4A 1R2TA 2PP3A 3SSZA 4RZ6A 3VIMA 4C65A 4HSHA 4KETA 2HWGA 2FHBA 3GTHA 5EY5A 1NQKA 4G1NA 3AJ7A 2J7FA 3VD5A 1SMDA 3AMCA 1ZAJA 3CPRA 2YFOA 3ANYA 4ZA0A 3DHDA 3N18A 3NA8A 3P8IA 4RUBA 4LV4A 3VM7A 1S38A 5KZDA 4XUYA 3C0JA 2GK1A 4HNUA 1UP2A 4GUJA 2A2IA 2DW7A 3RCYA 1WQ5A 3W1AA 4PFMA 2V2CA 3W81A 1PO9A 1DJGA 4UTWC 4L6OA 1R8LA 2G37A 2WZMA 1GVQA 5HATA 2J27A 4HCHA 3M41A 1M01A 2WCGA 1TZZA 5DCEA 3CTLA 3N14A 2IQTA 4ZQPA 2WKJA 4V1XA 3MS8A 1OCJA 1EGMA 1L2QA 4DYJA 1CB2A 4O50A 3TOYA 2PD5A 4PCNA 3R94A 4TU1A 1UC5A 2PWFA 2YFNA 1T5AA 4XVEA 3L7RA 2CYGA 4UNLA 3LY0A 4O18A 5LNRA 2A85A 2X30A 1E56A 3QGAC 4NNCA 3IGXA 4KBXA 1CGXA 1RLCL 4AC1X 1JDEA 1XYZA 5EMJA 5IXEA 5I23A 3QQ0A 1U30A 3PZOA 1MRQA 2ZC1A 1BFNA 4MG4A 4J3VA 4JTQA 4JTRA 1UD6A 4F0KA 4PTDA 3ZS4A 3VE7A 1E73M 3NQBA 1OM0A 1AG1O 2C1IA 4JTGA 3QPEA 2JKAA 4FO4A 3HFTA 3GU9A 2KX9A 3WF1A 4GX9A 4DO4A 1VFSA 2PP1A 3FVMA 3OVGA 1BGAA 3CZJA 1KM6A 2ADAA 1P5BA 2J77A 2VFGA 4LEFA 3E12A 3G0XA 3DHPA 4ACYA 2DT0A 3BZJA 4O1CA 4PMVA 4L56A 1BRLB 1EO7A 2A5HA 3L0KA 4BWLC 1E6NA 2BP1A 2VEIA 1XICA 2O9RA 4IIGA 3APGA 1NTHA 3UXDA 1F73A 1JQXA 2HVOA 2VP8A 3U8GA 1V6UA 3WFLA 2QDDA 1XBYA 4L80A 3V3WA 3MCOA 2HROA 2W61A 1IEVA 4QJ4B 2BOGX 2WMHA 1HJQA 3WLTA 3GIQA 2CLPA 2J79A 1JAKA 4UTKA 4UTTA 4LAOA 3DH7A 4E3VA 3FA3A 3OVPA 1OFPA 2ZUNA 3AS1A 3NYDA 3AXXA 3QR0A 5C7HA 4A6GA 4DNMA 3KTSA 3PANA 4E3TA 2GVEA 1UROA 2OZ0A 4MTVA 5BCAA 1OF6A 3HQOA 3EX3A 1VFFA 1MFUA 1RV8A 3UD6A 3VGBA 4LBUA 4LYQA 2ABBA 4MWAA 3ARUA 4OBRA 3ZO9A 4XV0A 2C8NA 1MXGA 1A53A 3SECA 3M4HA 1ODUA 2V5JA 1WOAA 3NSNA 2W6RA 4L1XA 3TYEA 3AYTA 4EXQA 4O0ZA 3TH6A 2F61A 1W9BM 9CGTA 2CNCA 2B31A 3TTYA 3GIPA 3BCJA 4R7OA 4IUOA 2VENA 2WMIA 3CUIA 3ICJA 3TTQA 4Q4QA 2EJAA 1EDQA 4C6JA 4RCXA 3O06A 4R5EA 5DBTA 5REQA 4WXZA 3MZ2A 3NQEA 1TQJA 2PCQA 2QV5A 3LI1A 5C2XA 4AVOA 1US2A 3AXKA 2ZKMX 1SSGA 4UMBA 3IANA 2FPYA 3RRXA 3PFMA 2ZZ6A 5CC3A 2I9UA 1HIZA 4J7RA 1OYBA 2XG9A 2G95A 1BPLB 2CHNA 2QYGA 4PMUA 3M5XA 7TAAA 3W38A 2AL2B 3B05A 1J0JA 3SN1A 2DZSA 3GXDA 3LU2A 4Z2IA 1UH3A 3WD0A 1PWLA 3KZPA 1EYEA 3GFZA 1GG1A 1VD6A 4W87A 1GQLA 1VYPX 4PUKA 4RX0A 4P61A 4JEJA 1XFCA 3UGVA 2BV9A 1E1CB 1TPFA 3RYSA 3HJEA 1EOMA 2OWWA 2DZUA 3DBPA 4CCEA 4UNKA 4W5ZA 1FHDA 3EX6A 3NFUA 1ELSA 1YDVA 4LANA 1GEHA 2WPGA 4J9JA 2CZDA 1L8NA 4XBJA 3FYPA 1SZGA 3QOKA 2GQ9A 2D20A 1P48A 3O07A 5FEZA 4B16A 2OB3A 3WNPA 3WBEA 4DX3A 4LB4A 1YRRA 4CQ8A 3QVQA 3TSMA 3IVTA 1ITUA 3RF9A 3ZJ7A 1DXEA 5C7VA 4US5D 3LB0A 2GQ8A 3C3UA 4C6CA 4IIHA 4NZ5A 5AVHA 4UIOA 1W8GA 4AC7C 3GYCA 2D3LA 1KB3A 4PODA 1EQCA 2PDKA 1HVXA 2YL8A 3ARZA 1OC5A 2OYMA 3B9DA 4MJ4A 3AWOA 1E9ZB 5CXPA 2EG6A 3H6OA 3VIPA 3W3OA 4BK9A 1DIOA 4CD6A 3WD1A 1MW2A 2GK1B 2OU4A 3LCHA 4CEXC 2VMFA 1B3OA 3L9CA 4HNCA 3VNZA 2QJMA 4DJED 4DB7A 2BMBA 4A8IA 3LNMA 3NO1A 5CJMA 1TJ2A 5F2GA 1E6SM 4B4HA 2XWEA 1GVEA 3IVUA 1H61A 4GABA 4FEZA 2ZX7A 5KZ6A 4XKYA 2YL5A 4F40A 1AL7A 1K03A 1FKXA 5EFFA 1O5RA 3QGKC 2F7FA 3BUVA 1F5ZA 3ZT7A 5M5DA 4NJHA 2GLKA 1FH7A 1I6NA 2ICSA 7XIMA 1YIXA 2V5BA 4LCRA 5FJRA 5D2XA 3G1YA 3HTWA 2ZA1A 1L6SA 1M68A 1X1ZA 2PTZA 3D46A 3LPGA 4WKAA 4YJ5A 3SCPA 4EK7A 4LUIA 3QY7A 4PCPA 5BXPA 1BRLA 1E55A 3AIUA 2HQAA 3NDYA 4MIMA 5FF7A 1U33A 4L61A 3LM3A 1W17A 1O66A 3I65A 2NXIA 4YVPA 2AKMA 3MHGA 3UPBA 4C7GA 1V3LA 1B3XA 1UWSA 1MDRA 4P7LA 1JAEA 3WQVA 1HXJA 4B90A 3NGJA 3ZZ1A 3CGTA 2YCKX 1K02A 2YCIX 1IF2A 2HCVA 4WF7A 2Z29A 4GI9A 2DIJA 1ONXA 3UXKA 3BANA 2PGRA 3T6CA 3O15A 4H7VA 4NAEB 2DZAA 2Y8KA 4F9DA 4DO5A 1M5WA 2VO5A 3W1MA 5CZJA 3IJ7A 1LQ0A 4GQRA 2VCBA 2OPJA 1PHQA 3N2CA 5F4XA 3LHZA 3UY8A 1AW1A 3LPPA 2NQLA 3E0WA 3HGJA 2GQ3A 2I17A 5GQBA 1J6OA 2PCEA 3UA4A 2EPKX 1W91A 3KVJA 4P7RA 2PP0A 3GFXA 4Q6XA 2X7WA 4IFKA 1R2SA 1WDSA 3IK4A 4J28A 2F6UA 3VGEA 1JCTA 3PZQA 3WDHA 1KRCC 3I4KA 4YS1A 3WQGA 3HPFA 1BHGA 4C7DA 4PMJA 1T40A 2OXNA 1CZ1A 3CS2A 1SW3A 4XQ6A 1C3FA 5HMDA 3PFRA 2VZVA 2XGBA 4GVIA 1VLIA 3M46A 5I24A 4WX2A 2POTA 5C9ZA 1JZ8A 1K9DA 4RDZA 1RXOB 4ENLA 3W37A 1XP3A 3VCNA 7TIMA 2O7SA 1MMFA 3VNIA 1QO5A 3DZ1A 4QDWA 2Q8XA 3UZZA 2ALDA 1A5SA 4MF4A 3ARRA 3KAOA 3UJ2A 2D73A 3GVRA 4F3HA 1G69A 5M17A 2J7HA 4XTIA 4ZB0A 1P6CA 1S2WA 1W2VA 3CUJA 4H41A 1M9HA 3PZVA 3ZT6A 1Q66A 1TELA 2BOFX 4LQ1A 1V3HA 3T0CA 7CGTA 4MAVA 4LPCA 4E5TA 3NEVA 1VFLA 1ZJBA 2VC6A 1J0HA 3WLHA 2DZTA 3TU9A 4NAEA 2PODA 4IICA 5HULA 2WB5A 4WJXA 3EWZA 4AYGA 4AIUA 4KCTA 2CITA 1K7EA 3T1GA 1WCGA 2W3ZA 3ARSA 2V69A 4EPKA 3SIZA 1MO0A 1PKMA 3HG5A 3WMSA 3WH6A 3HG3A 4Q4SA 5FL0A 1R3QA 1XIEA 1KFBA 5MKGA 4V2XA 2HZGA 3H4WA 5AC5A 1NDWA 4RDWA 3T0AA 5F2MA 1E5NA 1C29A 3NDZA 4PMDA 1W1ZA 3EXRA 3NG3A 5F2IA 2OTDA 1J93A 1I2PA 2D23A 1YW1A 2ISSA 3P3BA 3EWXA 8RUCA 4E2DA 4ZEPA 1RPKA 1Q65A 3IIZA 2WZTA 3EWWA 3TN5A 1VQTA 4FF5A 1XYLA 2Z0IA 1RK5A 2PGWA 2DUXA 5DMMA 5HMEA 1E6RA 3BG3A 5D30A 3H2EA 2XDFA 3QMTA 3M07A 3GKAA 2VGBA 2VFIA 1EGVA 1EP1A 4M6VA 3U48A 4DJFC 1B9BA 1UWQA 1PE1A 4BI5A 2F38A 4PB4A 2NW0A 1RHCA 5GNZA 1DJYA 3MWAA 4WOZA 4RK8A 1I0DA 3K8MA 3VDCA 3I10A 1VYSX 2ATMA 1Q6FA 4Q3MA 1SO3A 4KRTA 4RDVA 4Q4RA 2YDRA 5HANA 3D3FA 4XD6A 3NM1A 3GTNA 4ATLA 1GHRA 4F2TA 1A0EA 3U4FA 2YL9A 3FFSA 3UESA 4O13A 3NQ7A 1WP6A 2VHLA 3RLHA 1IEWA 3KL5A 4ZOBA 5IDZA 1JUBA 2R1PA 1RJRA 2A1YA 3ARQA 3C2RA 1XRFA 2V6AA 1O6IA 1IWAA 4WVXA 4E0CA 1XLGA 1FA2A 3QN3A 2ZICA 1OFAA 4FXJA 3PBUA 2HBXA 5LA0A 2E1DA 2VWSA 1VJZA 2XH0A 3MYPA 1H5YA 1V3KA 4BS0A 1SFTA 4IP5A 6A3HA 1L8PA 1ZGDA 3SM0A 1FXQA 3DCPA 5I3DA 3E2RA 3FOKA 1P7TB 1C91A 2ZZ1A 4NZ3A 3WUGA 3R2GA 3EA3A 3W7KA 4E4PA 2VI0A 4ZO7A 2NUWA 5HR6A 2GDVA 1SMAA 1AH0A 4MWAB 3H55A 1EKOA 1K7XA 1YE4A 1REQB 1QUMA 2R8WA 4GBDA 6TAAA 2XH4A 3IV8A 2CPUA 1OG0A 1HL9A 1F3TA 3J7HA 1EHAA 1KRBC 3NQMA 1Q6RA 1UOKA 3H4XA 4BQ5A 3JZUA 2B81A 3ES7A 4YMZA 4S3CA 1LWHA 1RD6A 2QPXA 4NP7A 2QJHA 4EAYA 3A6OA 1GWJA 1NH6A 1F61A 3PBGA 4U31A 1O68A 4QSFA 3NO3A 2NWSA 3UETA 4JYFA 4GFSA 4AF0A 2H8ZA 4KRUA 1TYGA 3LLFA 2OLSA 1Q7QA 1MEIA 5CPMA 3UWVA 1SM9A 1SW0A 2D24A 4GXMA 5H1WA 3S1WA 1YQ2A 4KKXA 5I5RA 2X1RA 3LZ5A 1ZHAA 2E9BA 2XGZA 4U33A 1PX8A 1V08A 2J9YA 4XVDA 1A3HA 3SQSA 2G97A 2VRKA 1FHUA 2ATSA 1QNRA 3BLFA 2EF9A 4K8GA 4JHOA 2NV2A 1V51A 2VYOA 3I6RA 1VFMA 4LYKA 4JIEA 1GVSA 4OOZA 3A9IA 2INZA 2WVSA 1JRBA 4XAZA 3CQ0A 3O7UA 3GLCA 3TJ4A 1XCWA 3BPWA 4WXYA 1QNQA 1GCYA 3WDPP 3ZXWA 1LLWA 1GVYA 3GC4A 1P43A 1LLOA 1JXJA 5D02A 1E9YB 3ZSSA 3CYVA 1HQTA 3S1GA 4OV9A 1QNSA 2VFHA 5DMNA 3ITGA 4JDYA 4Z17A 4MJMA 1TPC1 4Q4OA 4JIPA 4S3GA 5K4ZA 1GT8A 1XD1A 3ZOAA 4P8XA 2ZA2A 5FSEC 3BOXA 4PBEA 1BAGA 4O0KA 2OYLA 3GNRA 1EJ7L 2VKZG 2BVDA 1QI2A 3S46A 1SZNA 1GVOA 4IT1A 4JL1A 2POZA 1CPUA 4ZOAA 1TA3B 4GJ1A 3W6LA 4IF2A 3CYJA 3DG6A 4E2VA 4Q22A 4G7EB 3PNZA 4I6VA 1PB0A 5EU9A 4TR9A 3W23A 4GZ7A 3OU8A 3KRZA 1H7NA 5K7JA 2R1LA 3K8KA 3GC5A 5JVLA 1HKIA 4QBXA 3ZJ8A 1IGSA 3H54A 3TN3A 1XCFA 2X2GA 3W2KA 2VFFA 3F4CA 1YLVA 4IMAA 3L5AA 4Q7BA 1A5OC 3FXYA 1FWCC 3QFEA 1UOZA 4Q6JA 4XZBA 3TXZA 3C8FA 3WF4A 1WKEA 3S9YA 2W79A 4H4IA 1KTNA 1AA1B 3LQLA 4I7UA 4WDXA 1ZSXA 1XPYA 1NWTA 3ZR5A 2WZHA 5A8OA 2V81A 5BZAA 1JULA 4IHCA 4H83A 2ISVA 3SR7A 1QTWA 4IISA 4Z42C 3EA2A 1BD0A 3VIOA 1GHSA 2WLYA 4AD4A 3THAA 1XF0A 3C2VA 5LHFA 3R8RA 2ZXDA 5CG0A 3A4XA 4P7OA 5FJTA 3GXFA 1J0YA 3AHXA 1IR2A 4M5PA 4ATWA 1XIJA 3JZEA 4DELA 4LUTB 3AIVA 1F3XA 1FFRA 4K1WA 1HP5A 1XYAA 1PTAA 4JQ3A 3PJUA 3R5EA 3QPZA 1OFEA 1G94A 3RITA 4HN8A 2GJNA 3N6HA 2VR4A 4NT0A 2ZX8A 3RM4A 3MY9A 1GQJA 1ADSA 5HINA 2VEMA 1SJCA 1KGXA 2J13A 4C1NA 1CNVA 4AAJA 3UWYA 1GJWA 4UFLA 4Y9PA 5IFTA 4R7WA 1JFHA 1AVAA 2OZ8A 3C0LA 4FR1A 2OSWA 4FX8A 3PULA 1F6PA 3P0XA 3PWGA 3GVQA 3TAOA 2VD9A 5TF0A 1NDVA 1PX4A 3CTTA 1FWTA 3N17A 4AZ6A 1U22A 3W6MA 4B91A 3R1ZA 1NDZA 4JIQA 3DC0A 3RG6A 5AOUA 5HPCA 4IQLA 1DEDA 4ML4A 3URAA 3QR3A 1QOPA 4CCZA 4DXVA 3MUCA 1DJHA 3WELA 3TQPA 1MQQA 1TO3A 3GD6A 3CV7A 3H12A 1CEOA 4HK7A 4QG9A 3XIMA 3EMQA 2PDLA 2Y85A 3MJYA 3PM6A 4WKFA 3QBUA 1AQ0A 4QXIA 3OLEA 5RUBA 4ZL1A 1EP3A 1HKMA 4GH1A 3W72A 3U2ZA 1W3KA 3MDUA 2Q3OA 4TVCA 5JMUA 3N6JA 1DJNA 4FSAA 2Q09A 3HFYA 2CC0A 1VAHA 4DLMA 3VD3A 2Y1HA 1TUXA 4ZENA 3CH0A 1XIIA 2X40A 3DHFA 2Z24A 1EA9C 3VZXA 3W73A 3W2LA 4CNSA 5DN1A 4JGDA 4HK5A 2J8GA 2YA0A 4KWUA 5TNVA 2HDJA 2H9AA 4S1FA 3AU2A 5A3HA 4GFIA 4WCJA 3STEA 1PZ2A 3M0XA 4XO7A 4JICA 3L4YA 3UVIA 4F0RA 3BOFA 1UW9A 3VI2A 4QS5A 4C6FA 1OG6A 3DI1A 4FOUA 5I0DA 4GNVA 2JKPA 2VXNA 3WQ8A 3PNUA 4ZFCA 3IS4A 3VE9A 2VDHA 1A50A 1NELA 4GUFA 4Z2JA 4UTLA 4UR7A 4PTMA 1KFCA 4PZVA 3V1PA 4I8YA 5JBDA 2QQ6A 1H51A 2EGZA 4J3XA 2OKTA 2WCAA 5E6YA 1YDYA 4UQAA 2DVXA 1X7FA 2J78A 3UCQA 3R7MA 3ID7A 4MOZA 4ICNA 2JGYA 4IOTA 4PRRA 3GSMA 1LBFA 2DQWA 4MLRA 5LNWA 1W3JA 2YSWA 1WA3A 1R46A 3TR2A 3ABRA 1RP9A 1ZB5A 3KP1A 1LL7A 3VGGA 3NAVA 2XVNA 3NL2A 3SGZA 1W32A 6REQB 2C14A 3DERA 1YBQB 2J75A 4DJDC 1QOXA 1UUQA 4NL1A 4U3CA 2B0MA 1I2RA 3EDJA 2WZEA 1RALA 3RDKA 3B97A 3W7HA 5D9OA 1W1TA 4G2DA 3ZWTA 3C2YA 1GQIA 2IQ0A 4NAFA 2PDQA 1UUMA 2O0TA 5I3HA 1GGOA 3IIXA 2JBMA 2CLHA 1EIXA 1E6XM 2RGMA 3WEMA 4YHEA 2WJEA 3WDIA 3CWOX 2RAGA 3SN4A 4DWSB 4LC8A 2BODX 8TIMA 3W0KA 3R79A 4H6QA 5A6JA 3WK3A 3UJRA 4RNHA 5HXMA 1QW7A 4UQBA 5B80A 3WF0A 5U4NA 2OODA 3LHVA 1A47A 1Z48A 1VIWA 2A4AA 3KBSA 2Q3RA 1EF2A 1H49A 4FALA 3UG3A 2VX4A 1EQPA 2C3ZA 4DJDA 1MFVA 1JYXA 2WSKA 1PIGA 1BLIA 4OKDA 1Q7MA 4B3LA 4AY8A 3QY8A 3FXGA 1OABA 2PS2A 2E4TA 4ORIA 3QPYA 3H7VA 2ACQA 4AZCA 3V75A 1ECQA 4L9XA 3C2FA 3MP3A 4ZQRA 1LRTA 2HJPA 4FNTA 4C6IA 4HU3A 4XUGA 4EOUA 3VCRA 2PBOA 1GQKA 4DZAA 5MKGB 2D3NA 2B7PA 4M24A 1DVJA 2RH9A 3BGAA 1H60A 1U2YA 2R82A 5JH1A 4H9ZA 3QLLA 1H7RA 2Z2BA 3HV9A 1H7OA 3A13A 4AEFA 3M0HA 1PX3A 6PTDA 4U2ZA 1BXCA 3VD9A 4LAUA 1UR9A 3EWUA 1JZ6A 5L6UA 2QDHA 3KS6A 3PAJA 4D6DA 5H8MA 4N42A 4MY1A 3W1LA 5C6MA 2CWNA 3L12A 1FWFC 1FDJA 1UWTA 4UOZA 2E67A 3TV8A 3GG0A 3PZGA 4HTYA 3RPMA 4HPGA 5HPOA 1ZBWA 3AMKA 1V3MA 4MNLA 4U10A 1UIOA 1FWIC 5G2IA 2E09A 1OCBA 3A12A 4DF2A 3WG6A 1NP2A 2WHJA 1JPMA 1VIZA 3A47A 3UCCA 1VKFA 2QW5A 3BMWA 3E0IA 3WUEA 5CCZA 1GOWA 4QIUA 3U2CA 3ATYA 4C6LA 3PZTA 3AZTA 1I8JA 3EDEA 1OBAA 1BXNA 3APYA 3M6YA 1UWIA 2FVLA 1BVNP 1IZKA 3UJEA 8XIAA 1KM3A 1P6BA 1FQ0A 2BGSA 3GDBA 3RILA 4A2RA 3T08A 2NLYA 1HJWA 4IMEA 2JK2A 3VKCA 2OOGA 1XLDA 2HV5A 4HHLA 1OGBA 3G2GA 5A2AA 4EWJA 1BXBA 2VCCA 2WNWA 3MCNA 2ZDRA 2V3EA 4G7EA 2VX6A 4EF9A 1JCLA 5M03A 1A49A 5A8MA 2DUZA 3TNBA 3DXIA 2HS6A 1XYFA 2GJPA 4WJEA 1US3A 1IT8A 4NU7A 1PDYA 3BAXA 3CLWA 4UNIA 3AHVA 2CESA 3EB2A 1E4IA 5F4SA 3P0WA 1NVMA 4W86A 1TWSA 1EYWA 3LV5A 2RFGA 4GKLA 2YYUA 3MMTA 1K70A 3NSMA 3NOEA 1HW6A 3F5KA 4IPNB 2NV9A 3PTDA 2ZADA 4RNJA 4D71A 4CN4A 1DTNA 1MW0A 2W4XA 3APTA 1ZNNA 3DYMA 1W9PA 1MUMA 1CGYA 1KM4A 5ABEA 4BEQA 1TPVA 2MNRA 1IGWA 3EOEA 3WLQA 2VRQA 1WDWA 1JZ2A 3SJ3A 1QK0A 1XLKA 1L6WA 4FNSA 2NVDA 3H2OA 5BROA 1JG9A 1DWHM 2YCLB 2BTMA 3S4TA 2VTFA 4DJFD 1QI4A 4UR9A 2JIEA 3TJLA 1C9WA 1UD8A 4HYVA 2Z28A 3LM7A 3GDLA 1W5NA 3CXOA 4GNJA 5D03A 2IPWA 5IHSA 1B3YA 1C8QA 4O28A 3FGCA 2G41A 3CPUA 4YVVA 3CWHA 3OA3A 1QW9A 3P60A 1S5WA 3URQA 2NV1A 5CGTA 2BZNA 2J4GA 5I06A 3QV7A 5A6SA 1HJSA 4A29A 2GGEA 3CL8A 3CIVA 3O05A 4PBFA 1VEOA 5CSUA 5FD0A 3E2QA 3IGUA 2HS8A 1AK5A 5AYYA 1QHPA 1SZRA 4GNKB 3PZUA 4C6QA 1X8CA 3W53A 4JNZA 2JF6A 1XIGA 1JI2A 2EBNA 4F79A 4RR4A 3MSDA 5AYIA 3CT2A 2DJLA 3TJXA 2GJLA 2F2KA 2I9EA 3WJYA 2MANA 3VIGA 4KFPA 2V3FA 2JEQA 1QNPA 3KHDA 1BKHA 2QMJA 1XUUA 3INPA 3OQ8A 4LNCA 3RO6A 1E51A 1QAPA 2V68A 3S2CA 4W4QA 3LHUA 3LXAA 1FCBA 4AHOA 3GB6A 2VCAA 2DH3A 2GWGA 3BGJA 1VLWA 4OQVA 1K1DA 5IOBA 4ERGA 1ZBKA 1C9DA 3PF3A 1YMYA 2QAPA 3EOLA 4H7ZA 1SFJA 1ME8A 1TRIA 1YPIA 4NY2A 4ZO6A 1E71M 3SUSA 3SCSA 4HOZA 2ZFAA 4QROA 3SJNA 1Z44A 4DUOA 3G3DA 4QTGA 3WH7A 2VVSA 2PLMA 4UQEA 2ZCGA 1KXQA 4B9ZA 4GY1A 2Y7DA 1XIFA 2G96A 4Q8TA 2OQLA 4R34A 3PSWA 2WNZA 4QFUA 3RNDA 1NM9A 1W31A 2P88A 3TFXA 3O2LA 2E7FA 4KFNA 1EPVA 3RCMA 1FCQA 2QCMA 5EMYA 3GBDA 3WCZA 2XSAA 1JZ5A 4MWAE 1TV4A 3OZOA 4GGHA 2E25A 1JNDA 4JTAA 4QAIA 3E5BA 4IQEA 3CZLA 2FTPA 1Y0EA 4XZHA 2FLIA 3T4WA 1S5MA 2QCLA 1UMLA 3T81A 3VNDA 3KBNA 2J47A 5HQLA 3KOZA 3UGRA 3UYIA 4LW7A 2E5CA 1KFLA 4PMZA 4IZGA 4PCFA 3TLLA 5KETA 2DT3A 1EJUC 1X6LA 2BNJA 6XIMA 4C1NB 4GJIA 4OTKA 1O12A 2EXOA 2FFIA 1HKJA 1OT2A 5FA5A 2GJRA 4UMAA 5LIWX 3VIHA 2IMRA 3SCQA 3DYOA 1B31A 3E49A 5KZEA 4G1KA 3S6DA 3STFA 3B8IA 2HSAA 4DF0A 1FWSA 3H2FA 3WLJA 2X7VA 3T40A 1OX4B 4AZIA 2OGYA 4AVFA 1UJQA 4XZIA 1KWKA 1JEZA 3IIPA 3W1RA 3G1HA 1DJQA 1MUWA 3AYVA 1VBUA 2YIHA 3G0SA 4A3QA 3WLPA 2GYIA 5EBUA 4D9PA 5CLTA 3OA5A 5DMYA 2E68A 2P8CA 3MSRA 3FEMA 3KRUA 3OZPA 4AMAA 3HA1A 4PUMA 4WIWA 3RMEA 3E02A 3PG9A 1W9UA 5HDRA 4AWEA 3CB3A 1WV2A 2A3CA 3V7PA 4HPHA 4DXKA 4JL2A 1E1EA 4AY1A 2IQDA 2YA2A 4GYKA 4K68A 3WLRA 1P0KA 1AMYA 1EDGA 5ABGA 2J62A 1HJVA 3E74A 4MB3A 3W1XA 3KDNA 4RDYA 1VBJA 1GKRA 5C71A 3N2OA 3WL0A 5FJPA 5LIYX 3OB8A 2NUXA 4J40A 3EPMA 4ZO8A 3PUEA 1FDZA 1XL9A 4YYCA 3OQEA 3CZEA 2QPUA 1HKKA 5DBUA 3MI6A 3IARA 4EP8C 4AY7A 2WVVA 1XGDA 2ZUWA 5A2BA 2CLKA 4LY4A 1V6XA 4M8UA 2QKFA 3BLKA 2DSKA 1KO0A 1UR4A 5I3FA 3VK5A 4MJ2A 4AZBA 3SFWA 1U1UA 1UP0A 1O5XA 5CPTA 4EAMA 1SR0A 5HK4A 3TCSA 1XDLA 4KIEA 5HNTA 3FNDA 3W70A 1GNXA 2QJGA 3WIJA 3MTWA 4GYFA 3CHVA 2RUSA 3FHAA 3GXTA 4JFTA 1DE5A 2GZXA 3Q67A 3I6EA 1JIBA 3FK4A 5GNYA 3C2EA 3DFTA 3QKZA 3R89A 2AGKA 1FFQA 1WO2A 2WM1A 4JN6A 4JX4A 3UCDA 5A8NA 1PVNA 2NQ9A 3BO9A 2DT2A 2TYSA 4ILSA 3F4WA 1F74A 1EXBA 1IYXA 3VFCA 1IZJA 1KM2A 5KEZA 3MUZ1 1Q5MA 4AZGA 4H8HA 3CJPA 5BYWA 3UR8A 3F4DA 3N3MA 1WDQA 5JQ9A 1CTNA 2FTYA 3G18A 2Z1BA 5D8WA 4D6GA 1ZZMA 5AHNA 4I9MA 3WQ4A 1R30A 2A7PA 1BQCA 4YIWA 3FVDA 4N02A 1L2UA 1UKTA 3QYSA 1ZUAX 1VFUA 3Q4DA 2OO0A 3E0LA 2CIPA 3Q45A 4RW5A 1IIGA 3RCNA 2ZTJA 1K6AA 2WHKA 1NFGA 3R10A 4JBRA 4J2MA 3BLLA 1WE5A 4ZR8A 1NOFA 1XBVA 2PDMA 4X61A 1Q2SA 2W27A 1TJRA 3N2XA 1P7TA 3K1DA 4EXAA 4CU8A 1Q4NX 2YR1A 3WEOA 1OFOA 4FNUA 2E8ZA 4C5ZA 2O9OA 1XYMA 2Z6JA 2CHRA 4OIFA 4IQDA 1B54A 4UTUA 1VH7A 4A05A 1QBAA 4EX4A 1K9TA 2I14A 2FVMA 1IV8A 3DUGA 4ZB2A 4REQA 5ABFA 3KBMA 3ZM8A 4DVOA 2QCDB 2ZXQA 3ITLA 4PSPA 4S39A 4GZIA 3TDFA 3ZLFA 1ZLPA 3R8HA 2HE8A 3T4CA 2JQXA 3OTRA 1U5HA 2VQTA 1O5QA 4KF1A 1VPXA 4R33A 4NX0A 4JHMA 1XLHA 4O0QA 4AIBA 1KW1A 3URBA 5CSSA 3SCTA 2CZFA 4IL0A 1IQ8A 4KT2A 4WOQA 2BHYA 2YOCA 5XIAA 3NTYA 3VFLA 4IXXA 1XG3A 2FHFA 1U83A 3MP5A 3MUIA 1XLJA 1RVKA 2XSXA 4AXNA 1PCWA 3IAPA 4A8RA 3ITVA 3W7QA 3AU6A 1TV3A 4GE8A 2PC8A 1XYCA 3AJXA 2GPTA 3R13A 4Z1DA 5FJIA 5I03A 3CQIA 1UWUA 2E6YA 4Y8EA 1TR1A 2BASA 5A8QA 2XN2A 3BCFA 1BQGA 1OX6A 3G5EA 1TPUA 3VMNA 4BF5A 4L65A 2VZUA 3VKBA 4AVNA 5D2TA 1X96A 2FGZA 5HNUA 5KMYA 4JYDA 3CEPA 1KLYA 2QUNA 3LRLA 4AHQA 1G5AA 3O16A 1TVLA 4K7VA 3CT7A 1EDTA 1KV8A 3KCJA 4TX8A 4IP7A 5AECA 2WW5A 2IKHA 2WSPA 2Z4GA 3H70A 1XI3A 3KZSA 5LZLA 1DL3A 3RO8A 1WYIA 2NXHA 4FLOA 1TRDA 1UCWA 4I7VA 1BVZA 3CAWA 1GVFA 3ZFHA 3WY1A 4JDBA 3QRHA 4FI4A 3TAKA 1VEPA 3GDRA 3GWQA 3SN0A 2AQWA 3RLUA 4P7QA 4TV6A 4FNQA 1EC7A 1RCXB 1DTUA 2Z27A 3PPHA 1X6UA 2X16A 4KEVA 3W7IA 3W88A 1JPDX 1E0XA 3EAUA 4UUIA 1AUSL 3EDKA 4IMGA 1A4MA 2XIOA 2UZ9A 3H8AA 4AEEA 3EXSA 4KWOA 2FZDA 3AS2A 1REQA 5HJYA 1LBMA 4GC3A 4K8HA 4Y2WA 4PCTA 2C91A 3M43A 5REQB 1W9VA 3V5FA 1EJTC 2H6RA 3KRBA 4HZMA 4CKQA 4M7SA 2X8RA 3ARYA 3UZWA 2X0YA 2TRSA 3QFWA 4B5TA 4BQ4A 5H2ZA 2Y7EA 5A8PA 2XINA 2BHUA 3MA8A 5U7SA 1NDYA 1ITQA 3W24A 2ZRZA 1CB7B