The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
105
|
sequence length |
327
|
structure length |
327
|
Chain Sequence |
EQIKDKLGRPIRDLALSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTAAALSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Binding of 5'-GTP to the C-terminal FeS cluster of the radical S-adenosylmethionine enzyme MoaA provides insights into its mechanism
pubmed doi rcsb |
source organism |
Staphylococcus aureus
|
molecule tags |
Ligand binding protein
|
molecule keywords |
Molybdenum cofactor biosynthesis protein A
|
total genus |
105
|
structure length |
327
|
sequence length |
327
|
chains with identical sequence |
B
|
ec nomenclature |
ec
4.1.99.22: GTP 3',8-cyclase. |
pdb deposition date | 2005-12-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04055 | Radical_SAM | Radical SAM superfamily |
A | PF06463 | Mob_synth_C | Molybdenum Cofactor Synthesis C |
A | PF13394 | Fer4_14 | 4Fe-4S single cluster domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Aldolase class I |