2FB2A

Structure of the moaa arg17/266/268/ala triple mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
327
structure length
327
Chain Sequence
EQIKDKLGRPIRDLALSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTAAALSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein A
publication title Binding of 5'-GTP to the C-terminal FeS cluster of the radical S-adenosylmethionine enzyme MoaA provides insights into its mechanism
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligand binding protein
total genus 105
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2fb2A00
3PULA 3DFSA 1DORA 3MYOA 5AHIA 2J6XA 3AO0A 4MZYA 3CC1A 2VFEA 3S0CA 3P5ZA 2WSQA 3L0GA 2DZSA 1F73A 5K4ZA 4JY8A 4J9JA 3VKJA 2CZFA 2ZA1A 3KAOA 4N2YA 1NSJA 1ONRA 3BK0A 3LXAA 3ANYA 6ALDA 3MI2A 3VE7A 4K7VA 3P8IA 1FQ0A 5FEZA 1ME8A 3C4UA 5E93A 3TROA 3V1PA 4JX5A 3CQ0A 4N4QA 3I7QA 1MXSA 1C29A 1EA0A 4O0KA 2QCGA 3I6RA 1SW7A 1FCUA 3TXZA 4YCPA 3P7YA 3PBUA 1S5VA 3PSVA 2C19A 2B4GA 4RZ6A 1LOLA 2QUUA 3C8FA 4M5PA 1OK4A 3O06A 4YXGA 3P60A 1W5NA 3NPVA 4OWGA 4ZQNA 3O6CA 1DBTA 4KWWA 4GUFA 1F74A 3GDRA 3GKFA 3I7RA 2ZDRA 4EF8A 1ALDA 3EKLA 3QW4B 2YW3A 1W56A 3KX6A 4QNEA 2R14A 4GC4A 1Z42A 4DPQA 1M5WA 1FXPA 3LRLA 3A23A 1UJPA 4OGZA 1HUVA 1YDNA 1TTIA 1Q6OA 2CLLA 5LGXA 3KHJA 4IMFA 5I3IA 3S8HA 3GDKA 1XDMA 3M9YA 3GXPA 1FDJA 1GPWA 4H6KA 2Y62A 3LBCA 3RU6A 1FCVA 1BWKA 2R91A 4DO4A 3LCHA 1JULA 3FKRA 3BVJA 1VLIA 5FF4A 1UUOA 4E38A 4Z1BA 2ISSA 3NNTA 2I14A 3TV8A 3W7HA 4BI7A 2GVLA 2C16A 2Z0IA 3S6DA 4RZ4A 2QUVA 5I3HA 5IM51 1S5WA 5CZTA 2XN2A 2FPTA 4NU7A 2Y63A 4CQ9A 1XBXA 2ISVA 5D09A 1OX4B 1HG3A 3G1DA 4Z08A 1DVJA 4IQLA 2V0TA 3BPWA 3HBLA 4M6VA 1QFEA 4UFLA 3M41A 3PUDA 5FF0A 3W2NA 3OA3A 4JTKA 5LHEA 4OU1A 1OF6A 2CLMA 1X6UA 4HNUA 3A24A 3QPZA 1HTIA 4NZFA 4N9EA 3FJ6A 3QF0A 2KZHA 1GYNA 1D3GA 2P0OA 4PL1A 3PAJA 2ZRUA 4X3ZA 3W1TA 2ZRZA 4UFIA 2NX9A 1TPC1 2DZVA 1KFLA 3NVTA 3NA8A 3QH2A 2Y7GA 1K8XA 2P1FA 1WXJA 5AHLA 3LGEA 4KWVA 1V7YA 1ME9A 3GKAA 1TV7A 2F84A 3C0JA 4UIOA 1YPIA 4LOCA 5KZMA 2E5DA 3BW2A 4FNRA 5HR6A 3IIOA 3BG5A 3BGGA 3L21A 3W7RA 4N9CA 3PWAA 5FF2A 4JEQA 1EPXA 2VFDA 3GDLA 3O6DA 4N9DA 3EWWA 4O0ZA 3G1SA 4P61A 2CWNA 1GVRA 3R12A 4XBSA 1GZGA 4AB4A 3M5ZA 3KFTA 1KV5A 3TFXA 5G2IA 2V9DA 3PB0A 1XBZA 4O13A 5DCDA 2YDAA 1KM6A 3CU2A 3N19B 4NX0A 2ZRVA 3IIXA 4Q4KA 2GOUA 4UTWC 3LHVA 3R5EA 3SGZA 3NZ1A 4LT9A 3PR2A 3C61A 4WY0A 3NZRA 4M6QA 3HG5A 4GUIA 4JDYA 4FHAA 1SQ7A 1JRBA 2BLEA 1QO2A 4OT7A 4JD4A 2BXVA 1LLZA 4JR5A 1OFEA 3W73A 2VFFA 2Z6IA 3B4UA 1DHPA 3U8GA 2FB3A 4O19A 4UFMA 4CQ8A 1SZGA 3MP3A 4GWEA 1W31A 3ATZA 3M43A 3RNDA 5HUOA 3W6YA 3M16A 3UWQA 3GYEA 1DQXA 1PE1A 2QJIA 1W37A 3I7SA 3LXBA 3EB2A 2BWGA 1IXPA 1XKYA 5E0KA 1WOAA 4UMAA 3EEGA 3W7LA 2RDWA 4TO8A 3NQ8A 4R33A 2YCEA 3LLFA 3LI0A 3ZWSA 4UFKA 2DZTA 3F03K 3MI3A 1GVOA 3PC0A 2JKEA 3SY5A 2NX1A 3UXDA 3MP5A 5HQEA 4GJ1A 1XI3A 3ABSA 1SFJA 3TFCA 3LOTA 1W54A 2DZPA 4O17A 3IIVA 4UC5A 1K7FA 1OYAA 2QUTA 4G1KA 4O52A 5H91A 3ATYA 3HGRA 4LC8A 3FFSA 1A5CA 2YPIA 2YYUA 3W86A 3NAVA 3UY8A 4DBEA 1X8FA 3VE9A 4Z0SA 1TPVA 2QCCA 5TQLA 1YDVA 4X2RA 3HPXA 2GUUA 1OJXA 3W84A 2E6FA 3W1AA 4BR1A 1CX9A 4MJZA 3OHIA 4LUJA 4O12A 3STCA 1RR2A 3NGJA 3M1ZA 2RDUA 1O5KA 1VRDA 1W3TA 3N9SA 1FY6A 3CEUA 2ZZ2A 3LCIA 4LVGA 2NXHA 2ZRWA 2O7SA 3N2XA 1H1ZA 5CPOA 1XBVA 5CZJA 1UB3A 1H7WA 1TCDA 3FOKA 4NNBA 3U2OA 1HO4A 2OMAA 1QPOA 4RLIA 5CPLA 3S5OA 4CNNA 1LP6A 2Y89A 1MEWA 4LVDA 3TDFA 5CG7A 3STGA 3LV5A 2ZZ7A 1ZY9A 4QJ1A 2NLIA 2PRHA 1JCXA 3KVKA 4EVZA 2J9ZA 3UNDA 4KFPA 1O94A 3S5NA 3USBA 4DF1A 2LLEA 4GUJA 1AMKA 1K02A 5HR7A 2QCNA 5K9DA 1GYLA 2ZYFA 4IMDA 1GJPA 3N34A 2ZTKA 4M7SA 3HPZA 2HS6A 4WZHA 3HB9A 3RMJA 1EP3A 1I2OA 1ML1A 4O53A 4O18A 1AG1O 2QCDB 2QKFA 2BSLA 4HSOA 4XZ9A 2VXNA 2X1RA 2CFFA 4TU1A 4DF2A 2FPVA 1G4PA 3MWAA 2H8ZA 3E0IA 4YCOA 1SUXA 1VLWA 3LCLA 2ZZ4A 3W23A 1KM5A 4XKYB 2AGKA 4Y90A 4DO6A 2VOMA 4L4MA 1W5PA 2C6QA 3BO9A 2CU0A 1M7PA 1T96A 5BOOA 4N6FA 3P61A 3W88A 4AHOA 1EP2A 4UTJA 2OT0A 1KA9F 3GX9A 4UNLA 4MY9A 1UASA 3GK0A 1VCGA 4EIVA 4LU0A 1QMLA 5F1UA 1JQXA 3NPWA 1UCWA 3GDTA 1TTPA 2A21A 1TSIA 3QQ1A 1JJKA 4NQ1A 1G4EA 1OFOA 2R8WA 3MBFA 4NXSA 1GG0A 4NZJA 4IPJA 4N6EA 3NQDA 1X1ZA 1EB3A 4N9BA 3JRKA 2Y70A 4ZQCA 1OFDA 3EWBX 1KTBA 3SJ3A 4O57A 5DELA 2V8ZA 5G1TA 2P10A 2CLIA 3QRHA 4PODA 3SIZA 3TXVA 3H53A 3BW4A 3GB6A 1ME7A 3C2VA 3O05A 1NF0A 1G69A 5KZDA 2RKXA 2JGYA 3L2IA 3S1XA 3LHWA 4PA8A 1Z41A 2DZWA 1DV7A 3GXTA 4AF0A 4MVAA 1W3NA 1P0NA 4Z0JA 3HQ1A 1F5ZA 2DP3A 3F4WA 1FXQA 4TMBA 2NX3A 2E77A 3WFAA 3HGSA 2CLOA 5CPMA 5I3FA 4Y96A 1YTDA 4KFOA 4MJMA 1YTKA 1GG1A 2OCZA 3WJZA 4WOZA 3T4CA 4LWWA 5CZ0A 2PRLA 4FIQA 1GQNA 4DO5A 5EL1A 3TSBA 1OABA 1AK5A 3E49A 1ZALA 3OVRA 1H60A 3PBVA 4JIPA 4UFJA 3LXCA 5F1VA 3YPIA 5F2GA 4HN4A 4JX4A 2E6AA 3UWZA 4TMCA 2W0UA 2ZRXA 3RLUA 1XUZA 4KKXA 3TMQA 1O95A 4JTIA 3W70A 3KRSA 3C2FA 3MO7A 4MOZA 1N8FA 3G22A 5FF7A 4ZL1A 1L2UA 1L6YA 3T44A 3W75A 3MYPA 3LM7A 2A85A 4Y6GA 3LHZA 4RXFA 3DFNA 3N9RA 3P62A 1I2RA 3S42A 2CLFA 1KFCA 3G8EA 2GJNA 3G8RA 2FDSA 3DBPA 2RDTA 3O8AA 1Q3NA 1K8ZA 2NWSA 5D33A 4EF9A 1B4KA 3IEBA 3UPBA 4LV4A 4K39A 4WX2A 3QMSA 1C9DA 1QOPA 2VEMA 3W85A 1PS9A 3B0PA 2J9YA 3TCEA 1OFPA 2ZZ1A 1QPRA 3SECA 4FXSA 1ADOA 2WOQA 4NJHA 4OHQA 2DZXA 4JIQA 1FWRA 1KFJA 3QC3A 2FFCA 3BG9A 2CW6A 4O16A 3WK0A 1OFBA 1OF8A 3D0CA 5GVJA 2C14A 1SFLA 3TUUA 4O8RA 4L4LA 3THQA 1SZNA 1YXYA 3R89A 1UUMA 2X2GA 4XQ6A 2ZQ0A 2E1DA 1I2NA 4AH7A 4AWUA 1XFBA 3TAOA 1YADA 3IVTA 1D3HA 4S1FA 2H8XA 5D03A 2JK2A 3G1FA 1JCJA 1XC4A 1WDWA 5CGQA 1KBJA 3L67A 3B8DA 3LX9A 2ZFAA 4RK8A 3QJAA 4O15A 4FIRA 3O6YX 5G4EA 2DJXA 3FA5A 4QAIA 2WSRA 3W1MA 3E02A 4DEFA 2BTMA 1THFD 3TJXA 1DL3A 2WV8A 2WSYA 2EPHA 1AL7A 3LLDA 3BARA 1H51A 4ORIA 1ZAHA 2HMCA 2XFWA 4B5NA 3MHGA 3EX1A 1TRDA 5AYXA 1R46A 4RV8A 1B3OA 2B7OA 3HGOA 4IX0A 1PL9A 2OT1A 1KM0A 3L5AA 1DQWA 5G5IA 3W7NA 1GVQA 4RZ5A 4MLJA 3LDVA 5FEPA 3PY2A 1O4UA 1NFBA 4M6PA 4JY9A 4CNOA 3TJLA 1OX5A 1LRTA 2A7NA 2WQPA 3S5ZA 5D05A 4NX5A 3NL5A 4AMAA 4FF7A 3GXNA 5EBUA 3W1QA 1H7OA 5TIMA 1VCVA 2PC4A 4UTWA 2H3DA 5HINA 2NUWA 3TC6A 2TYSA 3O1NA 4IJBA 1LROA 4IXHA 3UWYA 3QQ0A 4R7JA 2ZZ6A 5IBXA 1DOSA 4A22A 1KBIA 1L6SA 3CEPA 1FCQA 1OVDA 4FNTA 4ZZ9A 2ZRYA 3DFOA 4IGHA 4LC6A 2G96A 4A21A 5AC6A 1LYXA 4BK9A 2Y7DA 3W2LA 3L65A 1QNVA 1YTEA 2NUYA 3IIZA 1VHCA 2PURA 1A50A 1M7OA 1BWLA 2XN1A 3F1QA 3SFKA 4NJIA 3A21A 3EWZA 3QFEA 3W2MA 3W7CA 3IGSA 4WXYA 4Q33A 4BI6A 1RQBA 4K37A 1AL8A 3G1YA 3L5LA 1ICQA 2A7RA 4TX9A 4DQWA 2V81A 4WY0B 5G4WA 3C6CA 1SZFA 2ZZ3A 3G0XA 3IVUA 4LS2A 5KSWA 3QM3A 1R2TA 3FEMA 3L0NA 1JCYA 1KFKA 2HS8A 2D73A 4LS1A 2C15A 4BWLA 1VC4A 4UMCA 1GTEA 1LLWA 2JKPA 1RZMA 1TPUA 5AN7A 4MY1A 4UR7A 3TU9A 3TQ0A 2BX7A 3W7GA 3KOFA 1F76A 3MUXA 1R2RA 5FF3A 4ADSA 2TMDA 2QCMA 1A53A 5CZSA 2ZCGA 1DKWA 2C0AA 4WJEA 1LOSA 4HT3A 3SGUA 3IV3A 2CLEA 4Z1CA 1K7EA 1JR1A 2W6RA 2FTPA 3LCXA 3IIPA 1IF2A 5AOUA 3ZS4A 3HJZA 4K8HA 4FEZA 4M19A 4CLMA 2G5WA 4JTTA 3PS7A 3HG2A 1KW1A 5BNKA 1LZOA 3W7DA 5IBXC 3E12A 3R13A 3TC7A 1T8XA 4JTGA 2CLKA 4JTJA 4HPXA 3NPXA 4UTLA 1FDYA 5D30A 1A5AA 3PBYA 3M5YA 3OVPA 1TYGA 3TH6A 3LRKA 5DY2A 2BZNA 1JUBA 1XXXA 1XUUA 2WJZA 3CT7A 4NNAA 4LRSA 2GPTA 3NQGA 1IXQA 1H7PA 5AHFA 1L6WA 3GR8A 1SSGA 1MEHA 3GNDA 2G95A 3LBMA 2ABAA 2NZLA 4JYFA 3EWXA 1WV2A 3TW7A 1G67A 1M6JA 3ABOA 3P8JA 5D2XA 5H2ZA 3QMRA 1H7XA 1VHNA 5F4XA 3O63A 3NM3A 3RF9A 1BKSA 3NQ2A 4BWLC 4UTIA 4PEKA 3LB0A 3W7QA 2OZ0A 3G3MA 5HWJA 7TIMA 3GLCA 4LVAA 2JGQA 3W1XA 1A5BA 4UTMA 5LNRA 5HMSA 1K8YA 1TV5A 4PL2A 4C1KA 2B7QA 5HJLA 5K9XA 5EMUA 3GZ3A 4FNPA 4UR8A 4LUIA 3A5VA 4IOTA 4HIBA 5HNRA 1VQTA 2ZTJA 4D2JA 3NQEA 4O11A 4NUWA 1VYPX 2ABBA 3SZ8A 5EPDA 5A8GA 2WKJA 1FCBA 3CB8A 2VC6A 1MEIA 2GJLA 2IQTA 2QDHA 2F7FA 5D2YA 4O50A 4RR4A 1X1OA 2QEZA 4ICNA 3PB2A 5DBUA 1RQHA 3TAKA 3L0KA 1GVSA 4MFDA 1VS1A 1D9EA 3GDMA 3KRZA 2VFHA 3NQ6A 1QAPA 1BTMA 3WJXA 1VJIA 1LDCA 5LHFA 4C1LA 5C54A 4WD0A 5BW6A 3DI1A 3FS2A 3PG8A 2QJHA 3QYQA 3KVLA 4JXCA 5D04C 2Z1BA 4Y8FA 1DJNA 4ZQRA 1OG0A 2ATSA 3DFPA 3UWWA 4QNWA 2CZEA 1MO0A 3DI0A 3G0UA 4S2CA 3IRDA 4JS3A 4GUGA 1U83A 1I45A 2YFOA 3CLMA 4XUGA 3TQVA 3MP4A 5AHNA 3CTLA 2V30A 3G24A 5F2MA 3M6YA 4POCA 4NJJA 1EEPA 1MZHA 2CLHA 3W07A 1TJRA 4FXRA 2GVGA 2FB2A 3DU0A 3OG3A 1XL9A 3B0UX 4MLRA 4BF9A 5AHMA 2A1YA 1VH7A 3NEVA 2PCQA 5CSRA 3NM1A 1LTDA 1YYAA 1PV8A 1TPEA 2C13A 4JTHA 1N55A 3ZFHA 5BRBA 5KTLA 4CQAA 4YMZA 1IXNA 2ZZ5A 3HF3A 3MW7A 4HNVA 2QDGA 1AW1A 1W3IA 3C56A 3L68A 4X22A 4K36A 5DLCA 3DENA 3OVQA 4O1CA 3I65A 4LY8A 3GNNA 3A22A 1H50A 3S1WA 4YL2A 1WYIA 3G1AA 4IPIA 1PCKA 1XDLA 3HOJA 3W1LA 5I3JA 2A0NA 1I4NA 5LNVA 2J24A 5A5WA 4ADUA 4K7YA 2OJPA 1CW2A 2VEIA 5AC7A 4HNTA 4ZQOA 5CKSA 5HUPA 4XTDA 3M44A 3T78A 5LZLA 3O16A 3UWUA 2AAMA 3CIWA 5LGZA 3RFAA 5DXYA 5FEXA 4AF0B 1TO3A 4E2BA 1JQVA 4M7TA 1KM1A 4HSNA 3LHYA 2X16A 1PCWA 4JDBA 1J4EA 3W2UA 2RHGA 2C3ZA 2I9EA 5G1YA 1T0OA 5FI8A 3W1UA 5D37A 2NV1A 3TQKA 5EA9A 2HTMA 4NVTA 4YWIA 3G0SA 3KVJA 2E68A 1JVNA 3WK3A 4DF0A 4U4MA 2Y7EA 3CIXA 1VYRA 3NQVA 2A4AA 3L9CA 1ZHAA 4E2DA 3WK1A 1K7XA 1KM4A 5DBTA 1F2JA 2Q3RA 1K3UA 3W2JA 1TPH1 4PTNA 4CNPA 4I9AA 3W7KA 3NQFA 2DZUA 5CSSA 1LRQA 3KXQA 1VPXA 3G1VA 4EWND 1OHLA 3ZWTA 2W79A 1SO3A 4O1DA 3TIMA 5DN1A 3C52A 1BEUA 5K9CA 5C55A 3EXSA 4EOUA 3OIXA 1YDOA 5L6UA 4HNNA 5ABTA 5AFDA 2QJGA 1TIMA 3LTPA 3TKFA 3W3OA 5FEWA 4N02A 4DPPA 3NXFA 5AB3A 1NF7A 1G4SA 1WAUA 4OV9A 2Y6ZA 2YSWA 3HG3A 4GRSA 4A3UA 5SWUA 3WK2A 1Z48A 1EIXA 1WBJA 2Y61A 3C2RA 3T40A 3P80A 1A5SA 4FNSA 4Z1DA 2VEPA 2CZDA 3LCWA 5LNUA 4MZ1A 4NXKA 3P5YA 2ALDA 3BV4A 1CI1A 1R30A 3F4NA 4UTKA 3STEA 3UD6A 3TSMA 4GBUA 1ZNNA 1EUAA 1KLZA 3H55A 3W2KA 1FDZA 4JYDA 2Q8ZA 5C5YA 3W7IA 1W0MA 3HGJA 3G18A 3LRMA 1SW3A 3DXIA 4QQ3A 3NYZA 5TBOA 3QSTA 3TMLA 2QAPA 1FWSA 3N73A 5LKYA 4JTSA 3P67A 5D38A 3UY7A 3WJYA 1F6KA 3W7MA 1RPXA 4K38A 2ZA3A 3S1UA 1OYCA 4UTTA 2EAWA 4ZMGA 2JBMA 4K6AA 3W76A 3P74A 3QZEA 4AHPA 3C2EA 1ICSA 1OFQA 3NOEA 3S9YA 2TRSA 4UTHA 1B9BA 3U6WA 3O15A 1G7VA 1OFRA 2EF9A 4O14A 3BLIA 5U7SA 1I2QA 4CCCA 2NWRA 4XTIA 2YXGA 1TTJA 1FWTA 3FJLA 1SPQA 4MZ8A 1PHWA 3EX4A 5DXXA 1S5TA 2VELA 1RQEA 2FLIA 2NUXA 4UCGA 3QPYA 1YXCA 1ZFJA 4GE8A 5K7JA 5LSMA 1C8VA 5KITA 3GIYA 1OK6A 3P82A 4JTLA 3A5FA 3NQ7A 2E09A 1QPQA 2Z6JA 1R47A 2QF7A 1V5XA 4O4WA 2H90A 1IGSA 3DAQA 2VKZG 1HL2A 5CPNA 3Q2DA 5K3VA 3IGUA 4H4IA 2A5HA 1H1YA 3AJXA 3TX9A 3JR2A 3UPWA 3PUEA 3P84A 4FO4A 1AW2A 2ZBTA 3OBKA 3PSWA 1LBMA 4H3DA 3TK7A 2TPSA 3N14A 4AHQA 1W5MA 4DXVA 1TTQA 4O10A 3C3NA 3CHVA 1XBYA 1TQJA 1W5OA 1AW5A 2RH9A 3W9ZA 2WPBA 3QMTA 2H3BA 5HWMA 4LW7A 5LNSA 3MBDA 1W5QA 3PF3A 4Y9AA 5K4XA 4NJKA 1RV8A 5KINA 3EKZA 4PH6A 4X9SA 3Q58A 1TV8A 4UXDA 5J5DA 2AQWA 1T99A 3R2GA 4UTTC 3T7VA 3TW6A 2C18A 2CZ5A 1P4CA 1ZAJA 5D02A 4JICA 2V5BA 2X30A 5AC8A 4ZQPA 1P0KA 2YYTA 4ONVA 1RVGA 4MUZA 4JN6A 1I8JA 1TB3A 3DZ1A 1NVMA 3NPUA 3NL2A 1Q45A 4JTEA 1JUKA 3HG4A 4UNKA 5EKYA 2QAFA 3DKLA 1FWNA 1QCWA 3L5MA 3EWUA 4JTUA 4U28A 5F4WA 1F05A 2Q8LA 4PFMA 4DELA 3MMTA 3FKKA 1TRIA 1W8SA 3THAA 2QCFA 3ELFA 1F7BA 1TPB1 1YPFA 3KRUA 4JGDA 5U4NA 2B0MA 1VGAA 2C1HA 3I68A 4OQVA 1G7UA 4MPQA 3MHUA 4MYXA 2WNZA 4LRTA 1ZENA 4O1BA 4QM1A 4OE7A 4OBTA 1IIGA 4LV9A 4R53A 4DBDA 1GTHA 1SO5A 3EX3A 5G2HA 1SR9A 3DHDA 1QDSA 4O54A 2EHHA 4A2SA 1O60A 3W22A 3TSDA 2X1TA 4RKAA 3K30A 1Z44A 4RJEA 4AXKA 3M47A 1H62A 2YR1A 4ALDA 1ZAIA 4O28A 1XM3A 1JCMP 1L9WA 3LTSA 3M0ZA 3S1VA 3IVSA 2NXGA 3W74A 4BFAA 1Y0EA 5J5RA 3VCRA 2O7QA 3UZJA 1X7FA 2EGZA 3TE9A 5KZEA 3O07A 3PM6A 2YGYA 2YZRA 2FJKA 1LBLA 4P2VA 3SW6A 5HULA 5K2ZA 3NR0A 3KVMA 1YLVA 2X1UA 4XWUA 3Q94A 3NL6A 2QCLA 1OX4A 3R8RA 1ZJIA 3CPRA 5LNWA 5DCEA 4IMGA 3WJWA 4WXZA 2R94A 3LHUA 1NAL1 4QSHA 3PVFA 1H5YA 4IUOA 4AWSA 2Y85A 3VNDA 4ADTA 1IIHA 2J27A 4JX6A 5HWNA 1KM2A 3E9AA 2DJLA 3TR2A 3QW3A 3W7EA 4BI5A 2JKAA 4FX8A 4QITA 2OX1A 4AEOA 1S3HA 4IX2A 1GWJA 3FLUA 4LVBA 1H7RA 3W71A 4FX7A 2GVJA 1OFAA 4MY8A 3NDOA 3B0VC 2E6YA 3M5VA 4IXXA 5BMXA 3UZ5A 1EUNA 3DH7A 1LCOA 1FX6A 4MYAA 3L66A 1HFBA 2A2IA 1KM3A 3HMJG 2XN0A 1P1XA 1FUYA 3CWOX 3MI6A 5DY3A 1EWEA 5I3GA 4GUHA 4I7UA 4MKNA 1TPFA 1F6PA 3E96A 2WNQA 4FNUA 4Q32A 1UBSA 1PVNA 2V82A 3G1HA 1PHQA 2WO5A 3GR7A 1JCLA 1Q6RA 4JTFA 4JYEA 3EXTA 3HIJA 3T55A 1KFBA 2EKCA 3EXRA 3ABQA 4NJGA 4LS0A 1B4EA 4QIUA 1TREA 4UMBA 4HKPA 4O4VA 4RCXA 1IXOA 1H7NA 2J88A 4JNMA 1SO4A 3W1RA 1WA3A 1GEQA 5FESA 3VI2A 1WQ5A 4LTSA 3LERA 4WOQA 3DFTA 5MHBA 4PC8A 2B7PA 4GFSA 5AHEA 5AYYA 3NQCA 2ATMA 4N4PA 5E1QA 2J9XA 2V5LA 2QCHA 2ZA2A 4ML9A 3N2MA 2NV2A 3NL3A 2X1SA 3TNOA 4ORMA 2PRMA 3BW3A 3LCFA 1J5TA 1SSDA 2VFGA 3MJYA 4S2BA 1U5JA 1TJPA 1SU5A 4RXGA 4YLWA 2UV8G 4ZVJA 2A7PA 3TA6A 3Q37A 4AWTA 1TQXA 5G2WA 3RLVA 1QWGA 1LOQA 3JS3A 1GVFA 2NXIA 3HO8A 2B7NA 3EX2A 2FIQA 1PIIA 4TR9A 2RFGA 2VFIA 1EX5A 1EP1A 1WBHA 3LI1A 2H6RA 1KTCA 1NEYA 5D2VA 1LM1A 3NO5A 3UWVA 4AVFA 1R2SA 3NG3A 4OV4A 1OYBA 5C2XA 1HO1A 3W83A 3B05A 2A6LA 1GOXA 3NQAA 4WQ6A 1I2PA 4RX0A 4WY0F 1SW0A 4E0CA 1W1ZA 2QR6A 2DU2A 3BGJA 2WNNA 4W9TA 4FB7A 1KV8A 4FX6M 3VFLA 1GT8A 1SO6A 5EY5A 3FYPA 4IWWA 2Q3OA 3CWNA 2V2CA 3S5YA 1VCFA 8TIMA 1TPDA 1YXDA 1Q6LA 2DORA 2Y88A 3NQMA 1MSSA 1B57A 4HHPA 4A2RA 4UFHA 2GQ8A 2VENA 3B03A 1JRCA 3W72A 1WOBA 5F2LA 3P81A 1O5XA 4Z1AA 1WX0A 5F2IA 5D2WA 4GNJA 5EYWA 2HSAA 3ABRA 5D32A 1QR7A 3OEXA 5DCBA 3ZR4A 1LBFA 2YX0A 4AAJA 1QPNA 2G97A 1G6CA 1KFEA 1KLYA 5T26A 3V75A 3DHFA 4CCEA 3LV6A 1VR6A 5F4SA 2FPYA 1J2WA 3BLEA 1N7KA 5KMYA 5BMWA 1H63A 3EWYA 3PUOA 3M7WA 1JUEA 4ZQMA 1VZWA 3PBWA 3QEZA 3N3MA 1DJQA 3EX6A 2E5CA 3C2OA 4PCFA 4NNCA 6TIMA 2QCEA 1JCNA 4TIMA 3B06A 3BLFA 4QISA 1XCFA 3STFA 1H61A 3MHFA 1FWWA 4LVFA 2QCDA 3LHTA 2E5BA 3H54A 2I1OA 3G3DA 1SZEA 2FQIA 4NT0A 4R34A 2ISWA 1ICPA 1P5BA 2GQAA 4I7WA 4XKYA 3DKJA 3PG9A 1TPWA 2V2DA 2PE4A 3W7PA 4IMCA 1RD5A 3W87A 3UYCA 5L9FA 2VEKA 3W1PA 1QO5A 1ZCOA 3GAYA 4A29A 4UTUA 4WUIA 1TMHA 3RK8A 3FYOA 1Q6QA 1G4TA 1LORA 4MFEA 1QOQA 1EWDA 2YW4A 4HPJA 5I3KA 3SI9A 3GAKA 3INPA 2TSYA 3DGRA 3LTYA 4LNYA 2V2HA 3UXAA 4I7VA 1LRNA 3A9IA 2GQ9A 3BG3A 4XBKA 3LCGA 3W7JA 3SR7A 2E6DA 2Y7FA 3G1XA 3FIGA 5C6MA 4CCDA 3W1NA 4O1AA 3CM4A 4UUIA 3W7OA 1KTNA 3SSJA 5D2TA 4MIMA 4K8EA 4GXMA 3B04A 1VYSX 1E51A 4KFNA 3HPSA 1K03A 1OX6A 2YFNA 4IMEA 3GVGA 3DFQA 2Z2UA 1FBAA 4FNQA 5AYZA 3WJSA 3UQNA 3IGXA 2A6NA 3M5XA 3QSRA
chains in the Genus database with same CATH superfamily
1NJJA 1DORA 5AHIA 3AO0A 1VBHA 4MZYA 2VM8A 2VFEA 3S0CA 1TVNA 2AAAA 3WDPP 5K4ZA 1P6WA 3VKJA 2CZFA 1H11A 3MI2A 3VE7A 2WM0A 2E25A 1FQ0A 4C7FA 5FEZA 4PUEA 4MM1A 3E0LA 1EDTA 2VZSA 1JL8A 2FVKA 2PTWA 4O0KA 4MWAE 3I6RA 2J4GA 3PSVA 2C19A 1A0EA 3O06A 4YXGA 1ZP4A 5I24A 2DH2A 2RJGA 3AS3A 2W3ZA 3NPVA 4HNCA 4KWWA 4DWDA 3GKFA 4EF8A 4JQ1A 3QW4B 2WHJA 2R14A 4GC4A 2EG6A 1Z42A 3D47A 4LUYA 1M5WA 4X2PA 1FXPA 4KCUA 2J47A 3RX4A 3GE7A 4IMFA 1CB7B 2HQAA 1GORA 1TELA 3M9YA 4H6KA 3UZWA 2HWGA 6TAAA 1BWKA 2NQHA 3FKRA 4H1ZA 3CUHA 2QYGA 1DHKA 3RDKA 4Z1BA 4HMCA 2XH7A 2C16A 7CGTA 4MWAB 1AMYA 5CZTA 4JHOA 2ZWYA 4YVPA 1YDYA 4L56A 1EJXC 3H2FA 4QEEA 4CQ9A 3M46A 1XH2A 1JPMA 1OC5A 1XFCA 4AZBA 2VRJA 4MSSA 1L6FA 1HG3A 1K4HA 3PJUA 4JAWA 4YJ5A 4Z2HA 4IQLA 2V0TA 2Q6ZA 4J5NA 5DQPA 4LUSB 1N2VA 3VM7A 3R8GA 3SQLA 3H2EA 1SFTA 1QFEA 5FF0A 3BGAA 4ZA0A 4JIIX 4OU1A 1FWCC 1X6UA 4EXAA 1FKWA 2OZ3A 2KZHA 4HU0A 1OSEA 2D1ZA 2P0OA 3PAJA 4X3ZA 4H8HA 4UFIA 1TA3A 2NX9A 1WKDA 2CESA 1XX1A 3UF9A 2POTA 1JPIA 3ZM8A 1UJQA 4IIFA 3EDKA 2DZAA 2P1FA 7A3HA 3MKCA 3LYEA 2YBTA 3WSUA 4AYGA 4KWVA 1V7YA 3WLLA 4D6FA 1ME9A 2F84A 1XS2A 3C0JA 4C6FA 4DYJA 1VBJA 1YPIA 1IE7C 2PTXA 4FNRA 3PJWA 3IIOA 1NOUA 5EMJA 3BGGA 3C2YA 1E0VA 3PWAA 1EPXA 4DJEC 2VFDA 4NILA 1V6WA 3AS2A 3WH7A 3G1SA 1QHOA 1F9CA 1VD6A 4AZ6A 1YE6A 1XF0A 2V9DA 1XBZA 2YDAA 4XD4A 4NX0A 1OC7A 2GOUA 3WLHA 3R5EA 3SUWA 3VIJA 2YJQA 3VIHA 4AISA 2ASHA 4M6QA 4GUIA 1EBHA 1FWFC 4FHAA 4PTMA 4CD4A 2PWEA 1QO2A 3H2NA 4RNIA 2J6VA 4PCPA 3B4UA 1DHPA 4H6QA 2FB3A 1DJHA 3HV8A 4IQDA 5I03A 4HMEA 4G7EB 5D8WA 3AHTA 4GWEA 2UY5A 4MKSA 3RNDA 2BGQA 4V28A 1YKWA 5I23A 1H3GA 1RAKA 1O68A 3I7SA 3W02A 4ROQA 1IXPA 1E5NA 3VD5A 1WOAA 2D0HA 5I02A 3P14A 3W7LA 3MVIA 2RDWA 2OEJA 3K2GA 3NQ8A 3G5EA 1SJBA 3WD2A 2CKRA 1WUFA 4U10A 1U22A 4DWSA 3MI3A 2JKEA 3SJNA 3UXDA 1JI1A 4GJ1A 2VTFA 3FVMA 2G3JA 3OB8A 1J5SA 5IDZA 4GYFA 4DVOA 3FCPA 4O17A 1C8YA 3IIVA 4D8AA 4G1KA 4KEUA 1NP0A 1A5CA 1HZYA 1SGJA 3UY8A 3KP0A 1AH4A 4QE1A 1E6PA 1VFFA 4X2RA 2GUUA 3BZGA 5E09A 1OJXA 2CYGA 2G50A 4BR1A 5A6KA 4LEQA 1CX9A 3SN4A 3GTXA 3WCZA 2CBVA 2QUNA 5EMMA 1RR2A 3NGJA 4IL2A 1BLIA 5AECA 2X40A 2J74A 3SBFA 3CEUA 3LCIA 4LVGA 1PKMA 5D9OA 3SQMA 1UB3A 1TCDA 3FGCB 1HP4A 3LGDA 4INFA 3U2OA 3TVAA 3PZOA 1CYGA 3CUZA 3NDYA 1W32A 3CZJA 4RLIA 1Z3NA 2OU4A 5A8OA 4P8WA 4B2DD 3H2CA 3FHAA 4CVUA 3TDFA 4HBKA 2FZNA 2CHNA 5A6MA 3WD1A 3EZ4A 2X05A 3LV5A 1EF2A 3C0SA 1JFHA 4CN1A 4IHCA 2ZUMA 4WGHA 1UPMB 3LG3A 4EVZA 4HA1A 3S5NA 2QIWA 3DESA 4MJ2A 2IW0A 4DF1A 5HR7A 2QCNA 1GYLA 2ZYFA 4H7VA 1XQLA 1QTWA 4Q4PA 1RD6A 4HHHA 3U4FA 4RDYA 1Y8BA 3CTTA 3P6LA 1D2KA 3GU1A 2HNEA 4WZHA 4ACZB 4NAFB 3E2VA 2QCDB 4HSOA 2VXNA 2PZNA 2PDJA 4TU1A 5C0QA 2YDRA 1R8LA 3LSCA 5A95A 1KM5A 1P43A 2W63A 3O2LA 2AGKA 4Y90A 3OP2A 2C6QA 3FEQA 3BO9A 2CU0A 3A3HA 1T96A 3QN3A 5BOOA 4N6FA 2BFGA 2W61A 1EJRC 1EP2A 2OT0A 3CB3A 4D6EA 1V79A 4MY9A 4EIVA 1FVPA 4LU0A 5F1UA 4GCXA 4BQ4A 5E0CA 2ZX7A 4AQLA 3ZYZA 4RV3A 2JE8A 3AMCA 1BPLB 5I09A 4CKQA 2GOKA 4N9BA 1EB3A 4ZQCA 3K5XA 3V4BA 1KTBA 3SJ3A 3BOXA 2V8ZA 2Z29A 4B15A 3RM4A 1UHVA 3SIZA 1ME7A 3IUHA 2GJPA 2JGYA 3L2IA 3AIVA 3VDCA 1DV7A 4MVAA 4DLFA 1P0NA 4Z0JA 4DJED 4TMBA 2NX3A 3TTOA 4CEUC 1YTDA 1W8GA 4MJMA 2XSAA 2OCZA 3WJZA 1KQZA 5DO8A 3T4CA 1Q66A 4LWWA 1EOKA 1GQNA 3TSBA 4I9TA 1ISXA 1H60A 3PBVA 3CQIA 4UFJA 3LXCA 3N4EA 2GDUA 4UQBA 2D24A 5F1VA 4LBUA 3BCDA 3YPIA 2VX4A 3AMGA 3WL1A 2E6AA 2DY3A 4L4PA 3HTWA 3MO7A 2YZ5A 1L2UA 1CBGA 4OJYA 3VFCA 3LM7A 4Y6GA 3ONCA 2PCEA 3DFNA 1B3VA 3N2TA 5FJPA 3S42A 2CLFA 1X8CA 3G8EA 3G8RA 3DBPA 3B97A 3OLIA 2PTDA 1ZBVA 1B4KA 3IEBA 2F8QA 2HJPA 4BF5A 2GJRA 4JQ3A 4XX6A 1QOPA 5FACA 2VEMA 3KBVA 3W85A 3ORWA 1PS9A 2Z2AA 1OFPA 3ES8A 4OHQA 3OO2A 1FWRA 3QC3A 3S3GA 4XKMA 2CW6A 1AH0A 3GNXA 3QQWA 4O16A 3WK0A 2X09A 5EB8A 1R0MA 3CUFA 4DYKA 3TUUA 4O8RA 1GQIA 1B90A 4XSMA 1WZAA 1UUMA 4QDWA 3SSZA 1O1HA 2XVLA 4LAOA 3QTGA 1O7AA 3TAOA 1YADA 2W27A 5A8NA 2OFJA 5CH9A 5I6SA 5M2FX 1W17A 2H8XA 5D03A 3G1FA 1QK2A 3L67A 2NV9A 4RK8A 1MFVA 2DZBA 1MYRA 1NM9A 4D6GA 3O6YX 5G4EA 2DJXA 4JIHA 1XP3A 3E02A 2BTMA 4S39A 1J0JA 1THFD 3LZ5A 2UZ9A 2XPKA 2QDEA 1AL7A 3PAOA 1WDDA 5CC5A 1FWJC 3CBWA 2GDQA 1UW9A 3MHGA 1TRDA 5AYXA 1PSCA 5FSEC 1VEPA 5IDIA 1R46A 4RV8A 1ZQ5A 3CMGA 2PUZA 3H26A 5IOBA 2Y2WA 1FWIC 3HGOA 3VIFA 3WF0A 1V0MA 2YB4A 3BLDA 5G5IA 3VD3A 3W7NA 1YNPA 4M51A 3WQGA 4DM1A 4AD5A 2DUAA 3PTMA 2AMXA 2IQDA 2FZMA 4JY9A 3TJLA 4KGLA 3Q65A 4JPGA 2A7NA 4C90A 8XIAA 3FDKA 3ZLHA 1VJZA 2PFHA 3BMVA 2YKKA 4ZE5A 1VCVA 2UY2A 3VCCA 3ZIZA 2XFRA 1Y7VA 3TC6A 3O1NA 1BQCA 1QXLA 1MWOA 2ZZ6A 4B92A 4PCSA 3WEZA 1L6SA 3CEPA 3DFOA 2WXDM 4HA0A 5B80A 2ZADA 4LC6A 4Z2JA 3KLKA 1TR1A 5AC6A 2JF6A 3ARSA 1PO9A 3DFHA 3W53A 3W2LA 3OYZA 1VHCA 1XDJA 4JTRA 3F1QA 3SFKA 3W2MA 3W7CA 1OQFA 4WXYA 4Q33A 2W9MA 1YIXA 4YHEA 2KX9A 2O92A 1ICQA 2A7RA 3RO6A 2PP3A 3N12A 4DI8A 2HPMA 1T41A 2AL2B 1MQPA 2D0FA 4U5IA 4LS2A 5KSWA 3B3DA 4NY2A 2C15A 4N42A 1J11A 1FWBC 1Q2RA 5CJMA 4MY1A 4UR7A 2XIIA 3WNLA 1KB3A 4GGHA 3OTRA 4YN5A 4H01A 5EGRA 4PTWA 3WNNA 1KD0A 7REQA 3K8KA 4GJJA 1E73M 4AZ5A 4Q3MA 4OZOA 1UR2A 2VGIA 2ZCGA 5FA5A 4HT3A 3WMSA 1EO7A 1K7EA 3WQCA 4ATLA 3APGA 5CEWA 3IIPA 1ESWA 4B16A 2DVXA 3TQPA 2VX6A 4L1WA 1KGXA 4G8TA 1OZQA 1V03A 3HG2A 2CKSA 5BNKA 3B9NA 1LUCA 1WZLA 3E12A 1OD0A 3TC7A 3OOQA 2ZICA 4AZCB 3NPXA 1A5AA 3PBYA 2X8RA 2BGNE 4X63A 1AQ0A 4KEMA 1YQ2A 4JBRA 4WJ8A 5BRQA 9XIMA 1JUBA 1XXXA 3V18A 1A80A 1FHDA 1W1IE 1IXQA 5AHFA 1ZJHA 1SSGA 3GNDA 2BHYA 1FWGC 2ABAA 3EWXA 1W1VA 3QMRA 3FN9A 3GWQA 4DNHA 1M7XA 2PLMA 2CBJA 5BWFA 3SRHA 3W7QA 4E3TA 3T4WA 3GLCA 3UG3A 1A5BA 5LNRA 4WSHA 1K8YA 1TV5A 4PL2A 4C1KA 3ARRA 4C5ZA 4ILSA 4UR8A 4HPNA 2BNJA 2ZUUA 4LUIA 4F9DA 1KR1A 2WKJA 1KCKA 4DZAA 3N04A 1UZDA 2GJLA 2IQTA 4H04A 2E67A 3VMOA 2QEZA 4G7FA 3PB2A 5BZAA 5DBUA 1RQHA 1VS1A 2XIMA 2DDXA 4XV0A 4Z17A 2VFHA 1WKEA 2WSKA 1XLJA 3NQ6A 1BTMA 1FWEC 4ROPA 3BAKA 5LHFA 2Y8UA 3DI1A 1K6AA 2VDIA 1DJNA 4W5ZA 2ATSA 4B5WA 1E40A 4L4OA 3DI0A 4S2CA 5LA1A 1EJUC 1A4MA 1U83A 1PYMA 1RUSA 1C9WA 5CC3A 1E71M 1WZMA 3N3TA 4B3KA 3CTLA 2V30A 5F2MA 3VUSA 3UETA 1XGDA 2CLHA 4W7VA 4MLRA 4BF9A 3NEVA 4XZNX 1LTDA 4GI4A 1XYCA 1TPEA 2GSJA 1XIJA 1N55A 3ARWA 3KCOA 5C2GA 1F6YA 7TAAA 1F3EA 1NDWA 2OLAA 1UD8A 1E9IA 3MSGA 2QDGA 4D6DA 3NYDA 1AW1A 3C56A 3L68A 4JTDA 1QT1A 1KKOA 2ACSA 4Z2LA 1GOKA 3EB3A 4TVUA 1TE1A 4AWEA 3A22A 1A47A 4KRZA 1H50A 4YL2A 2NT1A 5A8QA 4IPIA 4HMNA 2INEA 3F5KA 3WUFA 4IJCA 1KWGA 2J24A 4ADUA 5H8UA 5CKSA 4XTDA 2PWUA 3UWUA 2X0SA 1K70A 1QASA 4AXNA 3CIWA 4F0SA 4XSLA 4X60A 1NTHA 4AF0B 4M7TA 4M0XA 1MNZA 1NDZA 2GWGA 3I10A 5I2UA 4AY7A 3MSRA 1J4EA 2RHGA 2C3ZA 1EIBA 1G0CA 4M24A 5FI8A 3XINA 3M0HA 4YWIA 2VGFA 3WUBA 3CASA 3RM9A 3H7UA 1W2PA 4DF0A 3CO8A 3AAMA 1S5NA 1JZ7A 1XIDA 4GQRA 3WYZA 4AD1A 4IFRA 3A6OA 3MC5A 4E2DA 1QRQA 1TPH1 4CNPA 4I9AA 3W7KA 1J0IA 3A3XA 1VEMA 1X6NA 5DRCA 7XIMA 1CGWA 3KXQA 4DB7A 1VPXA 3EMCA 1YMYA 1OHLA 1SO3A 4O1DA 1IV8A 5K9CA 4MADA 2ZKMX 5L6UA 1PKLA 3GZAA 5AFDA 8A3HA 1TIMA 3W3OA 3J7HA 4N02A 3ZO9A 5AB3A 2WMJA 1VFTA 2Z26A 1WAUA 1OIMA 2CXGA 2Y6ZA 2YSWA 3PTDA 2OVLA 3BCJA 4DJDA 1Z48A 1EIXA 5BU9A 2WYSA 3C2RA 1JAKA 4FNSA 4GVGA 2D22A 1EJTC 4MZ1A 2ALDA 3F4NA 4QJ4B 3UD6A 4JFTA 3H55A 3GH7A 1E4NA 4JYDA 1B3XA 1GZJA 1TV2A 5A1AA 3R0UA 4RL3A 1SW3A 3CV7A 1G1YA 3NYZA 4IJRA 5TBOA 2PWFA 2Y24A 3GS6A 2QAPA 3A4JA 1FWSA 3D5HA 3T0DA 4K38A 2ZA3A 1WDRA 4K6AA 4AHPA 3C2EA 4YVVA 1OFQA 3DDMA 3VKAA 1C7TA 2TRSA 4UTHA 1B9BA 3T81A 3U6WA 1XYZA 1CDGA 2EF9A 3BLIA 1I2QA 4AEFA 2YXGA 1TTJA 3WFZA 2Z4GA 1CLVA 2WMHA 1C8QA 1E0XA 1UA7A 3T07A 1RQEA 3VX1A 2VZUA 4FMVA 2FLIA 3L4XA 2NUXA 3QPYA 4GE8A 5K7JA 1OWQA 1YNYA 1TMLA 2GLKA 4H9MA 3XIMA 3RXZA 1DJYA 3A5FA 3GXFA 2E09A 4YWSA 3SCUA 1IGSA 3IJIA 3KL3A 3RPTA 1QI3A 2BS9A 2O55A 4LF2A 1K9FA 4BZYA 3AJXA 1K77A 3NJ3A 3P84A 1SMAA 4FO4A 2QNEA 1AW2A 2EPMX 4TX6A 3U2EA 3NWRA 3GIPA 1LBMA 3WH9A 3AUJA 4JN8A 4S3GA 3C3NA 3CHVA 1AW5A 4JL2A 5I5RA 4LPCA 1T5AA 4L7ZA 5B7ZA 1HL8A 5LNSA 1R5YA 4ZR8A 3AQUA 3PF3A 4Y9AA 4D9PA 5CPSA 3TC3A 5KINA 3EKZA 4PH6A 4ATDA 4GBDA 4Q4SA 3Q58A 3U0HA 2HE5A 2W66A 2AQWA 3R2GA 4I90A 4UTTC 1S1RA 2XU2A 4D6CA 2CZ5A 3MMWA 2OOFA 4ONVA 1RVGA 1W9BM 3CGTA 3SDOA 3DZ1A 3NPUA 4GVHA 3VZZA 1Q45A 3AXIA 1JUKA 3HG4A 3RLGA 4RPPA 4NKCA 2X42A 1FWNA 3L5MA 3EWUA 3ABXA 1Z6KA 3EOUA 4S3BA 5F4WA 1F05A 2Q8LA 3ZJ7A 1BWVA 3MMTA 1XWYA 3OBAA 1W8SA 3THAA 2QCFA 3ELFA 1I0BA 1TE6A 2C1HA 3E3HA 2EPNA 5BOEA 5PTDA 4LCSA 1G94A 3K8MA 4ERAA 2YB1A 3MHUA 4O1BA 3JW7A 4LRTA 1BFNA 1GTHA 3EX3A 2DUXA 5G2HA 1QDSA 4O54A 4YTTA 1GONA 4PUUA 1LQ0A 1NWUA 4DZ5A 4KRTA 4EX4A 3K30A 1Z44A 4ALDA 1ZAIA 4UB9A 1PKNA 3BJFA 1E0UA 2IKHA 2PODA 3IVSA 4WVXA 1VPQA 3ZLFA 3VCRA 2ISDA 5BXRA 5KZEA 3RPDA 4MWAA 3PZUA 4G56A 4I5RA 3BMXA 1ZLPA 1YLVA 1DWFM 3TWBA 4FXJA 2BOEX 3E1F1 1V3LA 3IARA 2WCSA 1ZJIA 3CPRA 2GUYA 4GD0A 3F7JA 2R94A 4LUSA 3O7UA 4AY1A 5C70A 4IUOA 5EMYA 4H2HA 1TJ2A 2OWWA 3VNDA 4GISA 1EJVC 2QVHA 3VIGA 1KM2A 5DMLA 1H2JA 1HJXA 1B3YA 3TR2A 3QW3A 1PZ3A 3ITVA 4BI5A 2PDQA 4FX8A 4QITA 4GY7A 5BYWA 1RLDA 4EK7A 2GVJA 5LIWX 3B0VC 5A8MA 1S1PA 3OVGA 1EUNA 3MSDA 4XAYA 1LCOA 4TVCA 2NVCA 1QNPA 2OPJA 3LU2A 1HFBA 2E28A 1OGGA 1KM3A 3DN5A 4RDZA 3ZQ9A 3WUGA 1F6PA 3GC4A 3H2MA 2Z7KA 1GOIA 1KXTA 4Q32A 3U3HA 1TWZA 1TIWA 4P7RA 3DG3A 5A2AA 4YVXA 2DVTA 1XRSA 2CXEA 4PMXA 2JIEA 3HIJA 3LQGA 1BG4A 3T08A 2BXYA 1C3FA 5T91A 2R1PA 1GQLA 2Q09A 4PFHA 1E6QM 2EJAA 4HKPA 4RCXA 1DIDA 2J88A 3W1RA 2VX7A 3E0WA 1S2AA 3DFTA 4JFUA 2FMOA 4I6VA 4GIEA 2J9XA 2V5LA 4G7EA 3NL3A 5C8BB 4ZO6A 3QZ6A 3L4UA 3LCFA 2G3FA 4DZHA 1SSDA 4S2BA 1U5JA 1TJPA 4A3YA 4ZVJA 4REQB 3H2AA 3TA6A 4ZTXA 5G2WA 1ZSXA 2G4FA 4DAFA 3IJ6A 1VJSA 1JG9A 2B7NA 4TR9A 1PIIA 2RFGA 3OLGA 2F6XA 1UKPA 3KL0A 1EP1A 2FJUB 4US6A 1KTCA 4JOMA 1JZ6A 3QR3A 1R2SA 1OYBA 3IJ8A 3WENA 1KXVA 3B05A 3IJ9A 3S9ZA 4FS9A 2J75A 4CQDA 1GUVA 3DIPA 1ONXA 3WH5A 2QR6A 4HZMA 4JCLA 4W9TA 4W84A 4GO8A 4ZO7A 1B5TA 3VFLA 1JEZA 5AYBA 3N11A 4IWWA 1DYSA 1PTAA 1MMFA 3R94A 1HT6A 1WB0A 4ZOAA 4WF7A 4V15A 1JPDX 3F5JA 4TOQA 1UP0A 3TTQA 1Q6LA 1CEOA 2RGMA 4YYFA 1SMDA 3FDGA 3TZNA 4HHPA 3VK5A 2NLYA 4UFHA 2GQ8A 2Q71A 3A3WA 2O9OA 2JFEX 1O5XA 1WX0A 5F2IA 2R1LA 4L5ZA 4GNJA 1UH4A 3FGCA 4NP7A 2HSAA 3O0FA 4BJHA 4DXXA 5D32A 3WF1A 3U5UA 2PDKA 1OCQA 1V6TA 2EPKX 4GYPA 1L8PA 2RJHA 3LV6A 1VR6A 5F4SA 3B9OA 3BLEA 2XIJA 1N7KA 5KMYA 1H63A 3EWYA 2DEPA 3PUOA 2VZVA 1VZWA 3PBWA 4O1FA 3EX6A 3S2MA 4TIMA 2R9RA 3B06A 4QISA 4ZB2A 2QT3A 2HK0A 4ACZA 4HYVA 4NAFA 4LVFA 4DBUA 2R82A 2QCDA 1BRLB 2E5BA 3T2OA 2I1OA 3G3DA 3CWHA 5CSYA 1RK5A 2ISWA 2ZUNA 4CN4A 2GQAA 2QGHA 3DKJA 3VO0A 1VP5A 2DT0A 3LMYA 2PLKA 2V2DA 2QZRA 1WE5A 3W7PA 4P7NA 2YL5A 3W87A 1UKSA 4UCFA 3UYCA 3MCNA 4H00A 3TNBA 5KEZA 4NIRA 3WDIA 1ZP3A 5A94A 3T1GA 4WUIA 1TMHA 1KFWA 3RK8A 2PU0A 3UT0A 1XQKA 3GXMA 1Q6QA 1G4TA 1US0A 2X1IA 4XZWA 3E74A 4HPJA 3FAWA 3INPA 4QHRA 2V2HA 4UWMA 2QPXA 1VFHA 4I7VA 1LRNA 2GQ9A 3M07A 1AODA 4PBGA 3LK6A 1NQ6A 1QW9A 2DT2A 1UR1A 2PI6A 3W7JA 2A3EA 2Y7FA 3G1XA 2PZ0A 4CCDA 1Q65A 4UUIA 3W7OA 1KTNA 1GYMA 2XSXA 4ZO8A 4DBSA 4JKMA 1DP0A 3DFYA 4KFNA 2PU1A 2NQJA 1TR9A 2NSOA 2VYOA 3GVGA 5KZ6A 1ITCA 1J2BA 1FBAA 5AYZA 4IPLA 3EGJA 3IANA 4C6NA 3DYPA 3QPEA 1PWMA 2I9UA 2QQ6A 4F40A 2HZGA 2FHCA 4WDUA 3A9BA 1VAHA 4PRWA 1OD8A 4NASA 3DECA 3L0GA 4JY8A 3TYCA 2ZA1A 4N2YA 4NYUA 3GDBA 1ONRA 3BK0A 4PUKA 4K7VA 3MCOA 3SCRA 2OO0A 3C4UA 1F4HA 5E93A 3TROA 1XH1A 3UESA 1P0BA 1MXSA 3PFMA 1LF1A 3NZPA 3ITGA 3N18A 4JL1A 1SW7A 1TVPA 3T8LA 1IEWA 3QOKA 4YCPA 3PBUA 2B4GA 5I06A 4RZ6A 5EU9A 3C8FA 1J01A 3KBJA 1V0KA 1W5NA 5AVHA 3GNRA 4S3AA 2PF8A 1F74A 2YLAA 1ALDA 2FKPA 3B8SA 1U5HA 2TAAA 2XFYA 4FPSA 1PUDA 1ZCCA 1AJ0A 2YA2A 1XICA 3LRLA 3KZPA 3QY8A 4OGZA 1UR0A 3R1ZA 5JU6A 5LGXA 2HNHA 4NRRA 5BOFA 2IXUA 5I3IA 3N6JA 3S8HA 2DQWA 3R6IA 1XDMA 3GXPA 4HHMA 3RU6A 3LBCA 2R91A 3N15A 4DO4A 3GHRA 4IL0A 2VC5A 1CXHA 1M04A 1NARA 5FF4A 1UUOA 4E38A 5BXPA 1Q13A 4IQEA 2I14A 4V2XA 4IIBA 3THUA 3S6DA 4K1WA 1KCLA 3IAQA 5FJRA 5I3HA 1S5WA 3UJFA 3VOJA 2FPTA 1EC9A 5I07A 3CL7A 1R86A 3EA2A 2P8BA 2Q01A 3QHOA 4EP8C 1K1DA 1CECA 4Y8EA 2C1IA 2GL5A 3MO4A 4Z08A 1LG2A 2PSNA 1ZBWA 4M6VA 2WLYA 3BQ5A 4GY0A 4UFLA 1ZGDA 3PUDA 3CAVA 4IICA 1W9XA 4KESA 1A5MC 2O4QA 1OF6A 1D8CA 3H7RA 3A24A 3F5LA 1L6GA 1YW1A 2PTZA 3FJ6A 3QF0A 1D3GA 3AIQA 4JIRA 2ZRZA 4CD8A 4V1XA 1JIBA 2V3DA 1J6PA 2DZVA 3O6AA 2IXVA 3NVTA 3R10A 3A4AA 3LD5A 2V63A 1AQMA 3QH2A 3RMEA 4LYKA 1TX2A 2VZTA 3CV1A 2OSYA 2CBIA 2VT0A 1LWIA 3K1GA 3WBEA 5MKGB 4BCEA 3NSXA 3FXGA 2YCKX 4XVDA 3N4AA 1PB0A 1XRTA 4F0LA 2XYLA 4O0ZA 2CWNA 1GVRA 2NQZA 2WCAA 3BURA 3R12A 2AOSA 5I0DA 3M5ZA 3TFXA 5G2IA 5M03A 3U2CA 1V77A 1D7KA 1EQPA 1KM6A 2BASA 3IIXA 4Q4KA 2EG7A 4UTWC 1OCBA 4QG9A 1KNWA 3M64A 4AEEA 4IQJA 4LT9A 1W1PA 1HJVA 1WXZA 4R7OA 3WLPA 3NZRA 4JDYA 3UG8A 2AL2A 1JRBA 2BLEA 4JD4A 1ITQA 1REQB 1BF6A 4JIEA 4NG3A 4C6IA 1DWGM 1KRMA 3CK5A 4UFMA 4DJFA 1ZU8A 4MB3A 1SZGA 1XD1A 4L61A 4J28A 4IISA 2XM2A 3M43A 1LG1A 1M3UA 5HUOA 3W6YA 2QMKA 3EEZA 4NHVA 3DUGA 4JKLA 1WDQA 4X0NA 1V93A 2PWGA 1XKYA 4UQEA 3MZNA 1A3WA 3UFYA 2Y5JA 1QVBA 5D9NA 4R85A 5F7UA 3VX0A 3LA4A 4TO8A 4DZIA 3UGVA 1R9ZA 2YCEA 3LLFA 4YIWA 4J3XA 3SN1A 2VC9A 1PYFA 1XSKA 3SCSA 3PC0A 4ICMA 3SY5A 2NX1A 3G2GA 3QZAA 3MP5A 1XI3A 3ABSA 4NAEB 1SFJA 1OIFA 1KBKA 3TFCA 4AZCA 2DZPA 4HTYA 3KBSA 3ANUA 4QSFA 4UC5A 2QUTA 5H91A 4O52A 3ATYA 3HGRA 3FFSA 2YPIA 2YYUA 3LM3A 3W86A 2YCIX 4XVEA 2VCAA 3EDEA 4DBEA 4W93A 3PPGA 1MW2A 1I60A 4JHZA 2OXNA 5HNNA 4B5UA 4Q6XA 1S2CA 3RX2A 1JXJA 3STCA 3EOSA 6REQB 4LBSA 3M1ZA 3UEQA 3MKVA 2WVVB 1AQHA 1GNXA 1IWAA 2ZZ2A 2NXHA 2ZRWA 2Y8KA 1B30A 1XBVA 4QX4A 3BJTA 3FOKA 4D72A 2F9RA 1HO4A 2OMAA 3BH4A 1QPOA 1GCYA 5CPLA 1PBGA 4U3CA 1M41A 3KBNA 3VKDA 3SY1A 4LVDA 4HU3A 1ZY9A 4QJ1A 1FWAC 2NLIA 2PRHA 1QHZA 3KVKA 4YTQA 2J9ZA 4KFPA 4TX8A 4EPDC 5GQBA 3S2LA 1AMKA 5AYIA 4A8RA 3ID7A 2JEPA 4DWSC 1OGSA 1TCMA 4HQVA 2CCRA 2G3NA 3NDZA 3HPZA 3N9KA 1U30A 1I2OA 2VOTA 4KIEA 1ML1A 4JFVA 3Q45A 3UYIA 4XZ9A 3CMFA 2CFFA 3QBUA 2H8ZA 3VKCA 1ODZA 3PN8A 3E0IA 1VLWA 3LCLA 3OQ8A 3H21A 4L4MA 1W5PA 1IWBA 1M7PA 1UWTA 3P61A 4GVFA 1GOQA 4UTJA 1WDSA 2VCBA 3GX9A 4FR6A 1VPYA 1QMLA 1KRBC 1JQXA 4G5DA 4Y2WA 4IH3A 4XZBA 1TSIA 5LYRA 1LQAA 2J77A 1V02E 1VFSA 3KOXA 1E3XA 1PKYA 4UBPC 1ZRQA 4Q4RA 1E6SM 4J3SA 2O9TA 3EWBX 1E15A 3UG4A 2P10A 2GK1B 3CIVA 2NW0A 3TXVA 1KBLA 5FOOA 4YNGA 3C2VA 3O05A 1NF0A 1QI0A 2RKXA 1K8CA 3GG0A 1ODUA 4AF0A 3H2OA 1MRQA 1W3NA 4PBFA 3HQ1A 3WQ6A 3UXKA 4J4KA 4L64A 3EOEA 4F48A 2CLOA 4LGXA 1PPIA 5I3FA 3VABA 3P2VA 5HANA 1JGIA 3W37A 5CZ0A 2YA0A 4OVXA 4DO5A 5GNXA 4DLMA 3ARVA 1OABA 3E49A 4Y9OA 3DC0A 1J6OA 3RAOA 1E0WA 3HQNA 4HN4A 3UJRA 4OIFA 1DPMA 2Q8XA 3MPGA 3NVDA 4TMCA 2W0UA 1NELA 3TMQA 4S3CA 1N8FA 1IR1A 1ADDA 1L6YA 3T44A 3TCSA 1Z8AA 4ZE4A 4B2DA 4RXFA 3T42A 1J18A 3N9RA 2QLYA 4JFSA 2PDHA 5C9ZA 1KFCA 2GJNA 3QY6A 9CGTA 4HYRA 3O8AA 3RJYA 3ISIX 2NWSA 5CPTA 3WLMA 3UPBA 1FP8A 3QMSA 2OWCA 1HX0A 5CG0A 2EJ1A 3WL0A 4E5TA 2J9YA 2ZZ1A 3SECA 3AMDA 1QNSA 3SRDA 2DZXA 2G41A 3KOWA 2J7BA 3LNPA 4IFKB 4XZMX 1KFJA 1EXBA 4GX9A 3QR1A 2OOGA 5HAOA 1OF8A 3MJMA 4ERIA 1LQ2A 4L4LA 2OSXA 3IAPA 3THQA 1C7SA 4QFUA 3R89A 2OQHA 2X2GA 4MAZA 3LNMA 2ZQ0A 1I2NA 4PMJA 1DQUA 1XFBA 1R3TA 1AZ1A 3M0MA 4M81A 3M0KA 4S1FA 1BD0A 4C6EA 2JK2A 1JCJA 3OODA 1WDWA 5CGQA 4BKNA 3QJAA 4GFIA 1Y5XA 2YBUA 1NH6A 1Q8JA 4FIRA 1ONWA 2XHYA 2WSRA 5AY7A 4HCDA 3W1MA 4A35A 4DEFA 1DL3A 2WV8A 2EPHA 3I3DA 1H51A 3LGGA 1ZAHA 2XFWA 3MMDA 3EX1A 3CT2A 5A8PA 4Q8QA 1AJ2A 3NZGA 3KP1A 1R6WA 4MB4A 4Q7NA 3UA4A 2WZMA 3BUVA 2Y0FA 3L5AA 3QHMA 4YU1A 1CGUA 2ZIDA 3WEMA 1GVQA 3R4IA 4L9XA 3WQ8A 4H9YA 3I4KA 4W88A 5FEPA 1O4UA 4IIDA 2I16A 4CNOA 4H9TA 5D9PA 1OX5A 2WQPA 5D05A 4AMAA 4D1IA 4DWSD 1H7OA 3IWPA 2H3DA 2BVWA 5KETA 4IJBA 4WK9A 4GX8A 3PZVA 3QQ0A 2PWVA 2WWDA 1FP9A 4A22A 3BLLA 1FCQA 1UZHA 1OVDA 3OYXA 4ZZ9A 1OT2A 5HA7A 3K4DA 3UR2A 2G96A 2XZ7A 1LYXA 3V5CA 4F9JA 2D69A 3WLSA 4RNJA 1ISYA 4OUEA 5CAHA 3IIZA 3TLQA 3L7RA 1A50A 4MMWA 1M7OA 2Z27A 3F4CA 2WNWA 4NJIA 1CNVA 3A21A 3IGSA 2XH0A 2OO6A 1SJCA 1AL8A 4LF1A 4M29A 4F0KA 2XFFA 4WY0B 3C6CA 3QM3A 1E1FA 3WLNA 3VOHA 4ZSTA 3L0NA 1PTGA 2D73A 4IIEA 3AIRA 4JQ4A 1M03A 1GTEA 3HZ3A 5DMNA 1RZMA 4GXWA 4AVOA 4C91A 1TPUA 3KDOA 4JHMA 3TQ0A 2BX7A 3W7GA 1E9LA 3KOFA 3PZ9A 1ELSA 4L6DA 4C6QA 4DYEA 3EBVA 3N29A 5CZSA 4RE3A 1IT7A 4WJEA 1LOSA 3SGUA 1FRBA 3TWAA 1JR1A 4KW2A 2FTPA 3GUGA 4J3TA 3OGVA 3QOMA 2OZTA 3TN3A 3ZS4A 4M19A 2G5WA 4JTTA 2PDIA 2WBGA 3AHZA 3W7DA 2WMGA 1JI2A 4ML4A 1T8XA 5EMLA 2ZUTA 3A4WA 2V5CA 4UTLA 1FDYA 3UA3A 3OVPA 5HNTA 1XIMA 3QYSA 2REQB 3CYVA 3OG2A 1E6XM 2BZNA 2EPOA 2WJZA 5LIUX 4NNAA 4JNZA 4LRSA 2GPTA 3NQGA 3GR8A 4C6OA 1MEHA 1VRXA 3SRKA 3K1DA 4PMUA 1PJ9A 2ONEA 1SR0A 3WMBA 1HVXA 4GNVA 3P8JA 5D2XA 1M01A 2PDLA 1TX0A 3RF9A 3F2CA 1PTDA 2V5JA 2V5DA 4DO7A 3W1XA 4UTMA 1R87A 3SCVA 1ECQA 4MDOA 1VBGA 1RP8A 2B7QA 5ABEA 5K9XA 3NCOA 3IV8A 3BZJA 3A5VA 3FK4A 3IUIA 3M0VA 8CGTA 3NQEA 4O11A 4NUWA 5A2CA 5T9BG 2ABBA 5EPDA 5A8GA 2JIWA 5EMKA 2YL6A 2F7FA 4RR4A 1X1OA 3K8LA 4ICNA 1JYWA 2FZBA 1XYMA 3GDMA 2NT0A 4PSPA 4CU8A 1QAPA 4EE9A 5C54A 1GZ1A 2YDSA 3ALGA 4WD0A 5BW6A 3PG8A 3QYQA 3UZZA 3KVLA 4B5SA 5D04C 3HM7A 3U5YA 2CZEA 4GUGA 4M3PA 3P93A 4LANA 1RBLA 1I45A 3CLMA 2FDMA 4YYCA 3RCYA 1XIBA 1JYXA 4POCA 3W07A 4QS6A 4FXRA 2GVGA 1BF2A 2FB2A 1NDVA 3DU0A 3RYSA 1W9VA 1XL9A 5CSRA 3BSMA 3NM1A 4JTHA 1EXPA 4HU8A 4CQAA 1IXNA 1GKPA 4TVDA 1GKQA 4I5XA 3DENA 4O1CA 1I1XA 3I65A 3KDNA 4TXEA 3S1WA 2VEGA 1HP5A 3G1AA 2P3EA 4EAMA 5I3JA 2JEQA 2A0NA 1I4NA 5LNVA 4C7GA 5A5WA 1DIEA 1KQYA 1CW2A 4UQAA 5AC7A 4ZQOA 2CLPA 7PTDA 1XLBA 2AAMA 4RDWA 2WM1A 4REQA 4GK8A 1KM1A 3N1AA 3F2DA 2BP1A 3WIJA 3W2UA 4L80A 4IGSA 4G2DA 5G1YA 3VA8A 1T0OA 1LJYA 3AZRA 3W1UA 4G9PA 5D37A 1PEZA 3MANA 4WDWA 4C6LA 2OKOA 1J12A 2ICSA 3W0KA 1TFVA 1IZCA 4WJXA 3L9CA 4F2TA 2C1GA 2AQOA 1UZ1A 1Z69A 5DBTA 1XGEA 1F2JA 2Q3RA 4EANA 3W2JA 4PTNA 4HA4A 3G1VA 2OYLA 3LMZA 3ABZA 5ECVA 1T6MA 5CCZA 3TIMA 2XDFA 1BEUA 5C55A 2EQDA 1UOKA 2J25A 5ABTA 2WANA 3TKFA 5FEWA 1X96A 3NXFA 2WC3A 2W91A 3ALFA 1XKJA 4W7WA 5H8MA 1JAEA 3CYJA 1PWLA 1WO2A 4JKKA 3T40A 2VEPA 3EA1A 2BDQA 4QBXA 1GOMA 2B81A 1N82A 3AI0A 1R30A 4UTKA 3TSMA 5GJNA 4GBUA 1KLZA 2BG5A 1P7TB 5TAOA 1XLKA 4FOUA 5C5YA 2PD9A 3W7IA 2YDQA 3GNPA 1OB0A 1ISZA 3DXIA 4QQ3A 3UPMA 3QSTA 4AVNA 3TMLA 4J1OA 5LKYA 1MQRA 2DUZA 3P67A 2DW6A 3EPNA 3SCWA 1RPXA 4ENLA 3S1UA 4WSJA 1OYCA 3T9PA 2JBMA 3W76A 3P74A 1BRLA 4KT2A 3GXIA 3GW3A 4DIAA 3ZXWA 5HMFA 3S9YA 2VMFA 4C7DA 1OFRA 3AXXA 3GSMA 5CGMA 1X7IA 3AJ7A 1L2QA 4PMQA 3FJLA 4GC3A 2F2HA 5FIPA 3MT1A 1YXCA 5LSMA 5CLTA 5KITA 3GIYA 3CV2A 2OKTA 3RR4A 3CMJA 4ZOCA 1Q7MA 4GCAA 1QPQA 2PEVA 1V5XA 4BY3A 4DJDC 3DAQA 1QHPA 2OGJA 1HL2A 1BYAA 1UKTA 4RNHA 4H4IA 2A5HA 1DTUA 5EFFA 1C93A 2WMIB 4HZ7A 4GO9A 4H41A 2BGSA 2HK1A 2ZBTA 2FHFA 3MDUA 4H3DA 1T40A 3N14A 4Y9PA 1W5MA 3EAUA 2XISA 2QPSA 4O10A 5HXMA 1XBYA 1UD3A 3AXHA 1QNRA 2J7HA 5DRIA 4ZO9A 3W9ZA 1UBPC 2I56A 2WPBA 4I8DA 2W62A 2V67A 5HWMA 4PTVA 3GVVA 2YA1A 1ZPTA 5DT5A 4NJKA 3Q67A 2VRQA 4X9SA 4CD5A 1PXGA 1X38A 3R0KA 7ODCA 3QC0A 2PF0A 1B31A 1ZAJA 3VIPA 3HQOA 4JICA 3USZA 3SADA 3VD7A 2YYTA 3WLIA 2ADAA 4MUZA 4R9XA 3VNIA 3XISA 3T2PA 4Q7IA 4JN6A 3CPGA 5LIKX 1NVMA 3HQPA 4JTEA 4CVWA 1ISWA 3SUSA 4A3RA 4UNKA 5EKYA 2QAFA 1AA1B 1QCWA 3CL8A 4U28A 5C9UA 3AALA 5CC6A 4PFMA 2PDPA 2FH8A 4W85A 3UVAA 4H7ZA 3PZIA 5TF0A 1DE6A 1I1WA 1TPB1 1YPFA 3DCPA 1A3XA 3BSGA 3GH5A 2O4MA 2WNZA 4QM1A 1HJUA 1A5OC 1IIGA 4DBDA 3PPHA 1SR9A 5AVNA 5C7HA 5A2BA 2EHHA 3OW1A 3W22A 1BYCA 4XAPA 2YCLB 4RKAA 3VZXA 4AXKA 3M47A 1H62A 2YR1A 2VI0A 3UU0A 4O28A 3S6OA 2WHKA 3AFBA 2PGRA 1RCOB 1XM3A 5G4HC 3CHCA 6CGTA 3AC0A 3MWCA 2GYIA 1GVEA 4WKHA 5A6BD 4XG1A 2NVAA 2O7QA 2QGYA 3TE9A 3AWNA 2WK2A 3O07A 3W24A 2FJKA 4P2VA 3SW6A 1ADSA 2OQYA 3NR0A 1IT8A 3Q94A 5HOSA 4XAFA 3VC6A 5LNWA 5DCEA 4IMGA 4AIEA 5FL0A 4QG8A 2DFAA 3ZJ6A 4F2UA 4AWSA 2YXXA 2XIOA 4IGMA 2Y85A 3QGKC 4ADTA 1IIHA 3W81A 1UMLA 4JX6A 3TYAA 1H0GA 3E9AA 4R7WA 3W7EA 4KIRA 2OX1A 3P0XA 1GWJA 3W38A 3MKKA 3CUGA 3NDOA 2E6YA 3M5VA 3WD4A 4MF4A 3DH7A 5DMYA 1M1BA 4DBWA 1A5LC 1DJIA 1Z7AA 4GH3A 1M7JA 3L66A 4MNMA 1MNSA 3T0BA 2WLZA 5DY3A 1RALA 4I7UA 1XR2A 4E2OA 5CJNA 3WH8A 1TPFA 1JZ2A 1VEOA 3VD9A 1X98A 2WNQA 4FNUA 5MKGA 3OGSA 1PVNA 3RX3A 2Z1WA 3G1HA 1PHQA 2VVNA 2WO5A 1RBAA 1Q6RA 2J78A 1HQTA 4JYEA 3M0JA 3EXTA 3T55A 2EKCA 4NJGA 4FSAA 2O9PA 4WLCA 1TWSA 4LAZA 4CU7A 3CAWA 1KKRA 1BVNP 2OYMA 1UROA 4B5TA 1H7NA 1SO4A 4ZB0A 1WQ5A 4LTSA 4HP5A 4WOQA 2X0HA 4PC8A 3V0TA 4RPQA 1REQA 4MNJA 1F07A 1T7LA 4M80A 2RDXA 3IACA 3ENLA 3LN3A 1R3YA 3NQCA 3EYPA 2CIPA 3KL5A 2PGFA 4L9YA 3KHDA 3I4EA 4ORMA 2PRMA 1KRCC 4LB3A 1J5TA 2Z00A 3PJTA 4OOUA 4W87A 2ZXDA 3MJYA 4GXPA 3BJSA 4TTGA 1SU5A 1PX8A 2A7PA 1X6LA 3VDHA 1GVIA 1S2WA 1TQXA 3EKGA 3RLVA 1LOQA 2NXIA 2ON3A 3IK2A 4F2BA 2OYKA 2VEFA 3CZGA 2VL4A 4DRSA 5B7YA 3NXLA 1SVDA 2VFIA 3WX7A 3RR1A 1XG3A 5CZKA 3SCQA 2ZX9A 1WBHA 3PZQA 2H6RA 4WGXA 5D2VA 3UWVA 4NAEA 2BY0A 3WELA 2WVTA 3WO8A 3W83A 2WCGA 2A6LA 1GOXA 1B3WA 1I2PA 2J7EA 4GHRA 2IUZA 3JVAA 1V3HA 4FB7A 4UQ9A 1POKA 3EDDA 3UGRA 3I3EA 1TPDA 1YXDA 4Q8OA 1EZWA 3WG6A 1XSIA 6REQA 1MSSA 3AMLA 4E3VA 1J8VA 4J3UA 4A8IA 2WVVA 2TODA 5HPOA 3RCNA 2IPGA 4KBXA 3W72A 1GK8A 2GZXA 5FJIA 5F2LA 2P53A 1PX3A 2GGHA 4QS5A 3POHA 5FJOA 1CXLA 5EYWA 3C0LA 2VUYA 2CC0A 2VUNA 1LBFA 1G6CA 1KLYA 1JFXA 3HFYA 3V75A 3SIMA 1ZBCA 3KWSA 2C91A 1XCXA 3DG6A 1ZS2A 4IM4A 3QEZA 3C2OA 6TIMA 5A69A 4QJ3B 4US5D 1E4MM 4AW7A 1G9HA 3STFA 3W01A 1H61A 3N6QA 3TYDA 1FWWA 4GABA 3LHTA 3H54A 1OT1A 1SZEA 3RM8A 4R34A 1EC7A 4M1BA 1P5BA 1JZ5A 4B9YA 4MGGA 2PWDA 3GY1A 1RHCA 3VGFA 2IPFA 3CZKA 3WLOA 1JF6A 3S83A 2XGBA 3BTNA 5L9FA 3CV6A 2VEKA 3KTXA 2F61A 1UKOA 1RPKA 1ZCOA 2DSUA 3TP4A 4A29A 3RCMA 1XIIA 2IKJA 1WXYA 1PZ1A 4HNLA 4GIRA 4P7OA 2XSBA 4Q7BA 1JZ3A 3CLWA 1EWDA 5DANA 1QBBA 2TSYA 3DGRA 3LTYA 4LNYA 4HMDA 1ENUA 4WKAA 2OEMA 3UP8A 3LCGA 4H6RA 2GK1A 5C6MA 3W25A 4EPKA 3CM4A 4D1JA 2VP8A 2W5FA 2FTWA 1CIUA 4K8EA 1XSJA 1KRAC 3HMCA 4Q22A 4BQ2A 3HPSA 1QI4A 1K03A 2DSWA 3OJGA 1EHAA 2MANA 4XO6A 5AZ0A 1XIGA 3RUBL 2HXUA 1YBQB 3PULA 3MYOA 2J6XA 4R3UA 2BY1A 4HK6A 1E3ZA 2HRWA 5CBJA 3CC1A 3WF4A 3ARYA 1XCWA 1D3CA 3P5ZA 2WSQA 1S3TC 1F73A 2DW7A 4J9JA 3RRAA 1OGBA 1NSJA 3CNYA 3PZMA 1YHTA 3ANYA 3MMUA 1WUEA 1ME8A 2W67A 1V02A 3GTFA 4JX5A 3CQ0A 4N4QA 3I7QA 5LIXX 3I6EA 1XJBA 3PZTA 1EA0A 3ITYA 1EH9A 2QCGA 4PGLA 4GINA 3M7SA 3UR8A 2RAGA 1MW3A 2D2GA 3GU9A 3ZVHB 3OBEA 5C9XA 1FCUA 1UIPA 3P7YA 1LOLA 1OK4A 3WQPA 2Y5EA 3VIIA 1OEPA 4V1YA 2G8ZA 3RGTA 2P88A 4MUPA 4GH1A 1N8WA 4W8BA 6PTDA 3O6CA 1DBTA 4GUFA 3GDRA 4K68A 3II1A 3A12A 3B8WA 4FI4A 3EKLA 3AZSA 1EX1A 2R6OA 1W56A 3T6CA 1NDYA 4QNEA 3BLOA 4B3ZA 4DPQA 4IFKA 1UJPA 1DTNA 1HUVA 2CLLA 1Q6OA 2DVUA 2PC8A 1Q6EA 4HHLA 2GUBA 4LH8A 3WBXA 3SQSA 4J40A 1NQKA 1FDJA 1GPWA 2Y62A 2MUCA 1FCVA 3LCHA 2NQ9A 1W1A1 1JXKA 4AG0A 2WBKA 2V3EA 3MUCA 4KEVA 2ISSA 2GGGA 2FFIA 2QF8A 2HPIA 4Q6JA 2ESCA 2Z0IA 3COTA 4RZ4A 1JDCA 4HN8A 2XN2A 2D0GA 3A47A 4FP1A 4PTXA 1EA9C 4NU7A 3S4TA 3URBA 3EDJA 5CC7A 3M6DA 4LB4A 1OX4B 2XINA 3GBDA 2CBUA 4LY4A 3SRFA 3QGAC 4ZFCA 3LZ3A 3MDWA 2GQ3A 1RJQA 3M41A 3W2NA 4JTKA 1IT0A 2CLMA 1VBUA 1M9HA 4HNUA 3QPZA 3VMPA 3DHUA 2CHRA 4N9EA 4NZFA 4HOWA 4IIGA 2ZRUA 3APTA 1CCWB 4RUBA 3W1TA 4KRUA 1VBRA 2AKZA 3KTCA 1U33A 4M1RA 4H19A 3IS4A 1AUSL 1KFLA 4IPNB 4L65A 2OELA 4Z2GA 4PTDA 4ZOEA 4TQTA 3NA8A 4E6MA 4KMQA 1K8XA 1YX1A 5AHLA 5HK4A 5ABHA 1TV7A 4UIOA 4HJFA 4LOCA 5KZMA 3AU6A 1UWSA 2E5DA 2A3HA 3BW2A 3ZSSA 2FH6A 5DEZA 5A6SA 3WDJA 2V38A 1DWHM 1CENA 1F3XA 4JEQA 5CAKA 1MVYA 2NQ5A 4P61A 4WEVX 1SM9A 4XBSA 3KFTA 1HKWA 1KV5A 4PUJA 3PB0A 1Z32X 1KGUA 2G3MA 3W27A 3SGZA 3E2RA 1D7FA 1FH7A 5H1WA 1X1NA 4KGJA 3PR2A 3C61A 2ALRA 2QMJA 4WY0A 3VMNA 3MUZ1 1SQ7A 3PWIA 4LAUA 1O12A 4JR5A 1OFEA 3H23A 4LAKA 4O19A 2QPUA 3SCOA 3CH9A 1Q6GA 1E4IA 1DIKA 4PMOA 1VIZA 3M16A 2PS2A 2WAGA 4Q8VA 3T8QA 3GYEA 3UWQA 1PE1A 1DXFA 1V51A 1W37A 3LXBA 1V08A 4HTBA 3T0CA 5E0KA 1B54A 1PIGA 4UMAA 3EEGA 3W6MA 1EJWC 4R33A 1Y5VA 1XPGA 4ZOBA 4QLJA 3ZWSA 4DAIA 1XISA 3F03K 1GVOA 2QULA 3WLQA 4FOKA 4E4PA 3KZSA 4ERGA 3V3WA 4UNIA 2EBNA 1OYAA 3QGVA 4LC8A 2OX4A 2REQA 3F4DA 1LT8A 1X8FA 2WC7A 4QJ5B 3VE9A 1TPVA 2QCCA 2WHLA 1YDVA 3UERA 4DHGA 2PDWA 2DIJA 3HPXA 3WQEA 3VOCA 3W84A 3GR4A 4R5EA 4FAMA 4MJZA 1W91A 1UC4A 1W9UA 3BAYA 1A5UA 1CLXA 2P8CA 4O12A 3DG7A 4BS0A 4AMCA 1Q6FA 4A4AA 1A0CA 1VRDA 4AU0A 1FY6A 2PBOA 2QJJA 3S5SA 3DEQA 1IEXA 1H1ZA 5CPOA 1H41A 4NZ3A 1H7WA 1TV4A 4DJFC 3OIHA 2XZ9A 3H24A 4NNBA 2O0TA 3SUVA 1HXJA 3VKKA 1SYTA 5I79A 5CG7A 1R7OA 1JF5A 3TTEA 1JCXA 2YCJA 3UNDA 1O94A 5TNVA 4GUJA 3B8UA 3QV6A 2VR5A 4IMDA 5ECUA 3WNPA 3VGGA 4LUTB 4M7SA 1V3IA 4M8UA 3HB9A 4O53A 4O18A 4U2YA 3N17A 1NWRA 3V0UA 4FLSA 4LEFA 2WB5A 2FPVA 2CEQA 1TVLA 5JBEA 4DO6A 2VOMA 1RSCA 1B1YA 3APYA 2Z2BA 2HDJA 2ZXAA 3MS8A 1CXKA 1EDQA 1Q6DA 1KA9F 3GXDA 2Z28A 1UASA 4MAVA 3UR7A 1VCGA 2HCVA 3KLLA 4BEQA 1EOMA 2BHZA 1YPXA 3UVIA 5T9CE 4EWJA 2ZXQA 3QQ1A 3E6EA 3WH6A 1G4EA 1OFOA 1UKQA 4NXSA 1GG0A 1XD0A 3P0WA 4NZJA 4IPJA 4N6EA 1XYBA 3NQDA 1X1ZA 3UG5A 1CXFA 2EO7A 4O57A 5G1TA 1FFQA 4MB5A 2CLIA 4PODA 4LFYA 2QW5A 3CXOA 3GD6A 3H53A 4IG2B 3D6NA 1NWTA 2CETA 3TOYA 3K13A 1NP2A 4PA8A 1Z41A 3B9AA 1XHGA 5IXEA 1UR4A 2PP1A 3TR9A 1V3JA 1OADA 2J66A 3W00A 4N7QA 2E77A 2FTYA 4NSBA 3GTIA 1I0DA 3OU8A 4KFOA 1YTKA 1GG1A 1E6ZA 4WOZA 1U1HA 4EXBA 1P1MA 3JUGA 1UP2A 1ZALA 4JIPA 3DERA 3GQYA 3V0SA 1W3JA 2J7CA 2FGZA 3URQA 2GWNA 4GIYA 1XUZA 4KKXA 2GSHA 1O95A 4JTIA 3KRSA 4DM2A 3G1RA 4ZCWA 2WHMA 2AKMA 4Y9MA 4AX6A 4AC7C 3RITA 1QOXA 5H6HA 3LHZA 2OQLA 4P8VA 3P62A 1I2RA 2QDDA 2OZ8A 1TKKA 1DWAM 4R9OA 3NURA 2OTDA 3V7PA 3QTPA 1JZ8A 3AXMA 2VGBA 5D33A 4EF9A 1R7AA 3VINA 1P48A 1F3TA 4ICCX 3EWDA 3G6LA 5JXQA 1RCQA 4RZBA 4UOQA 1QPRA 3HU7A 4I9MA 1AFSA 4NJHA 5FJUA 1P7TA 3IJLA 4XAZA 5CGTA 4AFYA 5JQ9A 4PCNA 1Q2SA 1EL3A 3VOIA 2FFCA 3BG9A 1VFMA 4BF7A 4A8NA 5GVJA 2VGGA 4D71A 4PSRA 4S3JA 1HKKA 1YXYA 4XQ6A 5FJTA 5A3HA 1FKXA 2E1DA 4AH7A 4AWUA 1E9ZB 2QIIA 3IVTA 4XD3A 2FGBA 2BVTA 1W9DM 4GKLA 5I3DA 4I6KA 3KE0A 4I5UA 1YEYA 4L9ZA 2DIEA 1LWJA 2ZFAA 1R38A 4UOJA 4KCWA 2NVDA 5D8ZA 3EMQA 4LNCA 2ZWZA 1GPFA 2ACQA 3TJXA 2D2JA 2ZXBA 4XUYA 2WSYA 4HB7A 3LLDA 4ORIA 5HNUA 4DJFD 2XIQA 2NSXA 3RO8A 4H9XA 4H8UA 3ARZA 1L8NA 2ZC8A 1O66A 1AD4A 4IX0A 1PL9A 2X41A 1KM0A 3WQ4A 5ENLA 3OZPA 4RZ5A 2QUMA 4MLJA 3BXWA 1J0YA 4GQGA 1FFRA 1BSIA 3PY2A 1TV3A 2WMIA 1NFBA 4M6PA 3BMWA 3TYBA 3H4XA 3PNUA 3S5ZA 1LRTA 2Y8VA 3VOFA 4NX5A 4FF7A 3GXNA 2HROA 3W1QA 2XVKA 3CL6A 1A0DA 4PYSA 3B9EA 3UJ2A 4UTWA 2PTYA 2NUWA 2XTKA 2TYSA 3IK4A 2PDGA 3UWYA 3FJ4A 4R7JA 4LQ1A 5IBXA 1V6VA 1DOSA 1MW1A 1KBIA 2XVPA 1E43A 4IGHA 1HJSA 1E0TA 1FOBA 4A21A 4UR9A 4BK9A 4D6JA 1CTNA 4H2CA 4P8UA 1QNVA 3PNZA 1HKVA 3TA9A 1BWLA 2XN1A 3HPFA 3EWZA 3QFEA 4B4FA 3NOYA 5IRPA 4BI6A 1U2YA 4K37A 3WBWA 3NIYA 1CWYA 4W7UA 4TX9A 1B9ZA 4DQWA 2V81A 4HPHA 2ZZ3A 3G0XA 3IVUA 1IZKA 3L23A 5C7VA 3MV01 3FEMA 4UZSA 1OY0A 4BWLA 1VC4A 4UMCA 2JKPA 1W1TA 2Z1VA 3WD0A 3WN6A 3OZYA 4HOXA 2HV5A 2OG9A 2V5KA 3P3BA 4QDMA 3MUXA 1R2RA 1EJ7L 3ITTA 5FF3A 4ADSA 3N2CA 4WHBA 3C8NA 1UG6A