2FB9A

Crystal structure of the apo form of d-alanine: d-alanine ligase (ddl) from thermus caldophilus: a basis for the substrate-induced conformational changes
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
322
structure length
322
Chain Sequence
MEFMRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine:D-alanine ligase
publication title Crystal structure of the apo form of D-alanine: D-alanine ligase (Ddl) from Thermus caldophilus: A basis for the substrate-induced conformational changes
pubmed doi rcsb
source organism Thermus caldophilus
molecule tags Ligase
total genus 87
structure length 322
sequence length 322
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fb9A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fb9A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fb9A01
1GGOA 4J6EA 2YZMA 1KJJA 3E5NA 3N8DA 2PBZA 3R5HA 4FFPA 1C30A 2I80A 3TIGA 5C8YF 3RV3A 5CB4F 1WR2A 2GLTA 2YL2A 2W6NA 4EA8A 1GSOA 4M9UA 4EGJA 2NU8B 2CNVA 1Z2PX 2R82A 2R7NA 1GLVA 1E4EA 2YYAA 2DLNA 4HNVA 5KX5F 5JQWA 1JKJB 1B6RA 3U55A 5CA1F 2YRXA 4IWYA 1AUVA 3RFCA 2FPGB 2QK4A 1DV1A 1UC9A 1M6VA 4C5CA 2FP4B 3VA7A 2YZNA 2NUAB 3LWBA 2OLSA 2R85A 2YZLA 2W70A 2W6OA 4FGRA 5J2TF 2SCUB 5FNVF 2DWCA 4IZOA 3RV4A 5LA6F 2P0AA 1EHIA 2R86A 3GLKA 1B6SA 2GQRA 3MWDA 3Q1KA 1VBHA 4M9CA 1EUCB 3KAJA 2Z02A 4M99A 4FFNA 3K5HA 5H80A 1BXRA 4O2AF 4MV1A 4XZ3B 1Z2OX 5JH7F 2R7KA 5LYJF 3RUPA 3V4SA 3R23A 3WNZA 3BSSA 3VPCA 1CQIB 5LXTF 3TIIA 2W6QA 2CNQA 1CQJB 5CA0F 3BSYA 4EA9A 3N6RA 2V58A 5EZYF 4O7WA 4QSHA 3U54A 3AX6A 5BPHA 2YW2A 4DLKA 3HB9A 3I12A 3KALA 4O7NA 3OUUA 2C00A 4MV6A 4O7TA 1Z2NX 3ORRA 4XX0B 4XYMB 2R7MA 4MA5A 4MV8A 4O82A 4ME6A 2R87A 3DF7A 4O2BF 2R6FA 3TW6A 4O7ZA 2W6ZA 3OUZA 4HR7A 2GPSA 4MAMA 1EUDB 1JLLB 4WD3A 5C1OA 4YAKB 4O4IF 3R5FA 1A9XA 2YRWA 3TINA 1PK8A 3U9SA 2V5AA 4EGQA 4FFMA 4MV9A 1CE8A 4ZQIA 1OBDA 1C3OA 4YJ2F 5BMVF 1VBGA 2ZDQA 2W6MA 4FFRA 3SE7A 1SCUB 3ORQA 4IIJF 1JDBB 4I50F 3KAKA 4O7LA 3MJFA 1JDEA 3JZIA 4O84A 1E4EB 4YB8B 1KBLA 2NPOA 1GSHA 2W71A 1DV2A 2ZDGA 1KJ9A 5IYZF 4O81A 2HGSA 2YWVA 3JZFA 4FFOA 3R9RA 3U9TA 2FB9A 2GQSA 2NU7B 1CS0A 4YJ3F 2DIKA 2X0SA 1DIKA 2FPIB 1KC7A 3K3PA 3VMMA 2VHEA 1KJQA 3TQTA 3G8DA 4ZOLF 3MWEA 5I47A 3G8CA 3AW8A 3JRXA 5K2MA 4MA0A 5D8DA 4EG0A 3VPBA 4YAJB 4TV9F 4WBNF 2FPPB 4RZQA 3NUAA 4ZHQF 5HV6A 1GSAA 2DZDA 4I55F 3ETJA 4HQ6A 2YZGA 1I7NA 2V59A 2XD4A 4O83A 4O4LF 3BG5A 4O86A 5JVLA 4EABA 5KKNB 1KUTA 2IP4A 5LOVF 2CNUA 2NU9B 4L1KA 3LP8A 2CQYA 1IOWA 1AUXA 4HNTA 2GPWA 1M0TA 3VPDA 3WO0A 1BNCA 4TUYF 4MV7A 4C5AA 3HBLA 3HO8A 4TV8F 4HNUA 5JVDF 2YS6A 3Q2OA 1A48A 5DMXA 2PVPA 4DIMA 4NYEA 3BFPA 2QF7A 4FFLA 4ZI7F 4Y8VB 2VR1A 1EYZA 4M98A 3K5IA 1M0WA 2VQDA 2YS7A 2ZDHA 4C5BA 2XCLA 2PN1A 3GIDA 4O4HF 3R5XA 1EZ1A 5CAEB 3BSWA 2CZGA 1ULZA 1VKZA 2HJWA 2R7LA 2WYOA 4MV3A 2NU6B 3WO1A 4O7YA 3JRWA 3V4ZA 4EAAA 1PX2A 5LP6F 1KJIA 4EA7A 2Z04A 4FU0A 3KREA 4O7VA 3VOTA 1I7LA 5JQGF 4O7RA 4FE2A 4XYLB 4E4TA 2I8CA 1KEEA 4O4JF 4MV4A 5BPFA 1OBGA 3QFFA 1KJ8A 2VPQA 3UFXB 1UC8A 1W93A 3ETHA 2I87A 2W6PA 4I4TF 5GONF 1IOVA 4O7SA 4YBZB 5J2UF 1T36A 1W96A 2R84A 5C1PA 2J9GA 4GGMX 4IWXA 4IHJF 5HBRB
chains in the Genus database with same CATH superfamily
4RF4A 4RW0A 2CFOA 4II3A 1PV4A 1XDGA 2P6PA 4E88A 4BC1A 2PVSA 2OVBA 4MB6A 3AQ4A 1JYFA 1JEYB 1WUKS 3HR8A 2DABA 4WSOA 5IJ9B 3B5IA 2O2EA 1GPDG 2H0AA 3AUFA 4FLEA 2J0UB 2O7VA 3ZX5A 4LOLA 1F20A 4AWBA 2GDJA 1B2LA 1MC4A 5FR1A 1IBLH 3AXTA 1H0KA 1G5FA 5BN1A 3SC6A 4Q45A 3KL4A 4KBYA 3LFTA 1NVMB 2WAOA 4HDOB 3MWLA 3C3AA 4PZCA 3UJAA 3VAYA 4UM9D 4PC7A 2WW8A 3K0KA 2BFBA 1GO3E 1D1SA 1OBVA 4O2AF 2DHEA 2GZRA 4NU5A 5CW2A 2XUPA 4MUFA 1UEXC 4DIUA 1E7WA 4E2WA 4M7EA 2R1UA 3C48A 3R5JA 4CGYA 2H3EA 1JAXA 5KT7A 4PZ8A 1KDVA 5EJFA 1QIIA 2ZVDA 2Y6VA 2YHIB 3MERA 4DR2B 4KIWA 3U1TA 1EE1A 3EMKA 5IBCA 2LVBA 2JI4A 3OTGA 1PSDA 4M2LA 1Y3CE 4HUJA 4R54A 1DAOA 4R9RA 3OX2A 1Z5NA 1CWUA 1PD1A 1NNUA 2PZMA 1YDWA 5H1YA 4H77A 1A50B 4QVKA 2XUKA 4KQFA 3ASVA 1Z16A 2Y0EA 4WKGA 1F8XA 1Z38A 5JXGA 4N7RA 4FX5A 4G1EB 5B4UA 4DL9A 3IMFA 3V34A 2ZYGA 5LOVB 2WPDA 5EJ9A 1QYVA 2DSNA 3QF4A 1N7GA 1T2UA 2EDAA 4C7KA 2I1LA 1KZHA 5TC4A 4UTPA 1KYVA 1SC1A 3H16A 3NW9A 5BSGA 4XARA 2CDBA 3STUA 2PXHA 3N6XA 4C76A 2P75A 1EFTA 3V33A 1Q1AA 3MTJA 4UM5A 1L1RA 1PS9A 4LZJA 2X7JA 3ZWNA 2YCHA 3AIMA 4C6HA 5ALIA 4Z3KA 4KE8A 5C8VA 3F5FA 4UBNA 2BBOA 1X1TA 3F7OA 5IM4A 3O3CA 4JODA 4E07A 5P21A 4PAGA 4JUFA 4NMHA 3A3NA 1RYMA 3EXEB 3RUEA 2CUKA 2NNWB 4GLJA 1SUPA 2FEKA 1V1RA 5EQDA 1DX6A 4EUSA 2JC3A 2JPDA 2FGKA 4B3SH 1DRKA 1R3UA 4GM0A 5DP2A 3K70C 3FDSA 1G0NA 1T2AA 4M1EA 3HVJA 1NRJB 1C50A 2Q1UA 4RU1A 4RETA 3C70A 2HRQA 4CTNA 2ZIUB 4Z0HO 4J7AA 2I33A 4RAZA 2H11A 2WFZA 1QB8A 1XAJA 4PN3A 2WWTA 2BKXA 4ZJUA 1L7BA 3KTAA 5AWFC 1DB3A 1RLMA 2A84A 9MHTA 5ITZB 2CWDA 4JJ6A 4AN0A 1GQOA 5KUTA 1J09A 4F4YA 2BOVA 1MOZA 3GTPA 3T3OA 5HNEA 3HWWA 3OZCA 3DXZA 3TL2A 4ND8B 3GJQA 4ZKDA 1WS6A 2JLUA 2QN7A 2BJHA 2J7PD 3S2SA 1D2MA 3V97A 1NL3A 1CKOA 2PSFA 3GCGA 1N6KA 3BIXA 5I45A 1A5BB 4JJ8A 1KJIA 3D3WA 3KKOA 2LBPA 3NWOA 2ZRKA 5B4VA 2IYTA 3D6AA 1V1MA 4TS4A 2I03A 4HWGA 4OHCA 5AKGA 2OP1A 2GPNA 1XP5A 3RC9A 1GG5A 3GFTA 2ZUFA 1COWA 1TUBB 1CUIA 3IHWA 1WMDA 5GONA 4FP9A 4KVZA 1FNSA 1E5XA 3PGKA 3I92A 3NHUA 1JQLB 2E3JA 4X1KB 1H6DA 3F71A 1XG5A 5I3CA 1RR6A 2J9YB 5HUJA 4C7OB 1RM0A 4TN1A 4JLBA 1ORDA 5BNZA 2QVCA 2KBEA 2OMKA 4HLUC 1C7ZA 3GT3A 1XQ1A 2QQ0A 1P7VA 4I7HA 3IDZA 3UXHA 2H7YA 1F3LA 1LW6E 6LDHA 1XZIA 4E2ZA 1LGYA 3PR4A 4NBRA 5GM1A 2CC2A 3GPIA 4HH4A 3GRKA 2A9FA 1F38A 3H8SA 4D9KA 5C8DA 4BNZA 2FMIA 4AY6A 2DH6A 5DE3A 3WYFA 3LCMA 2O6HA 3P0JA 2NAFA 3QI7A 4D9IA 1YF3A 3P52A 5LZ7A 2VTEA 5FUQA 3D0KA 3IIKA 3AESA 5HKOA 1QYIA 1SBZA 3MT0A 3DBLB 3FPAA 1G6KA 2ZM5A 1XUOA 3KUCA 4MVCA 1KO8A 1OXUA 3M2TA 1CQIB 4ESVA 2GK7A 1ZLXA 5E4FA 5CA0F 2XB2A 4G5QA 2NM0A 5TPWB 5EIOA 3ZU6A 4LSAA 4C4AA 2BN4A 3HM2A 4F6LA 2NUBA 4F3NA 2GJSA 2F3SA 3VYRB 3A06A 1GQYA 4HWKA 4RACA 3KQWA 2EFGA 3RPEA 3DYIA 3WVNA 1C3VA 1FSSA 2IP1A 2Q9CA 3L8HA 2WE8A 4KWEA 3BK2A 2N47A 4LXTA 3U3MA 4ED6A 3TZ6A 3FPKA 5IAJA 3NC4A 3OUZA 2XWQA 3K32A 4P6VF 3AFNA 1XD8A 3NVKI 2V8OA 2R1ZA 3EARA 1E8NA 1N5KA 2O05A 4WZAA 2VBIA 4EH1A 2ZSHA 4LA4A 1OB5A 1KA9H 2YJ3A 1PD0A 1GZ6A 4IAJA 2BGTA 1NA5A 3H6GA 4B47A 4DEVA 4X1IB 3LIPA 4IH1A 4BMOB 4MLPA 5AW0A 3PHCA 1XT6A 2XSZD 3Q7TA 3IBSA 4QELA 4CM4A 1G8KA 1DT5A 1K2VN 2FSVC 4II7A 3WKBA 2ORIA 3H5WA 5GIPE 3U0GA 1T2CA 1L7MA 1UDXA 2VHEA 4DRYA 3OESA 2G7ZA 1E1NA 3LRPA 3IB3A 4F1KA 4RNNA 3KKPA 2C92A 2ICAA 4Z7NB 5FOSA 2VZLA 3ZK8A 1JAYA 4D0SA 3OSZA 4F11A 3WG9A 3WGVA 3ZNNA 1UT8A 4DJFC 1D5CA 1WE2A 1QMGA 4IZIA 4KE6A 2A9PA 1SR8A 4PLHA 2BFWA 1ICEA 3Q6IA 2CNUA 4Q00A 4MUXA 3RTEA 3VV2A 3KWLA 4GH5A 4OLHA 3KUUA 1FB5A 2OORA 2HAEA 2WFMA 1UBLS 4EG3A 1GNVA 3IX7A 1JR3A 4GHWA 5JYCA 4TQUS 3HK2A 1E5DA 2ZE8A 4X7BA 3TLGA 1YMVA 4A3KG 1IUPA 2E4XA 1KZ9A 4KDEA 5E0OA 2OO5A 1M0SA 4L7QA 1ULZA 2ZUVA 1XXHB 4WLFA 5IBRA 4CT0A 2R6ZA 1SOWA 3K1JA 3BMXA 1EG7A 4NU0A 4UJ5A 3I42A 3K53A 3KD2A 1YKFA 2QAIA 4F9TA 3T4XA 1ZITA 2PKWA 3T8YA 1Z6AA 4TMKA 4MVJP 4HAZA 5E3JA 2I8CA 3LCUA 3SHWA 3AILA 4E51A 1UP7A 1PFGA 1U80A 3BEDA 2F4VB 3VX4A 1TQ8A 2WINI 4WN9B 1ONSA 2W6PA 4Q3NA 2YJNA 4ED1A 3QKRA 4JLJA 3GRPA 3A1VA 2CK3D 1BA3A 3ZH9B 1BYIA 3NBKA 3ORHA 4IMPA 1A69A 3KHHA 5ES4B 3U7HB 3IKLA 4ZRNA 1NJ6A 1FSZA 3ZXYA 2PYZA 2PH3A 3DQZA 3P45A 3CONA 4G4SP 2DFVA 3LY8A 3K1YA 4S0ZA 3FUUA 1XVTA 4D25A 2IZ5A 1E4EA 4YALA 3G5LA 3H3JA 3L18A 2FDRA 2O0MA 3GV7B 1E5LA 3CC8A 2OZLA 2C7VA 4BNJA 1NY5A 4JUCA 1RKXA 4MYUA 5HOQA 4ALLA 2O03A 1U2ZA 1UWCA 1FMTA 4JXJA 2NG1A 3HADA 1BMFD 2DQ4A 2P2GA 3JASA 4F9EA 3RABA 1D5WA 4Y2HA 2R86A 4YO7A 4GLLA 4UCXA 3RS4A 3THRA 5A4FS 3EA0A 4ES6A 2RAFA 5BR8B 3HLKA 5CFOA 4EFKA 3IRUA 4IFIA 4KMRA 2B1GA 1EFLA 2D62A 3E81A 1UP4A 4FFVA 4RSHA 3UAGA 4F3CA 2GBFA 4OLBA 5K8CA 3LGAA 4J16C 1NQ5A 3M70A 2NYRA 3B8EA 4ITRC 1M0EA 1J49A 1V5WA 3BMCA 1BE6A 1NP3A 5E3HA 5F64A 4JOCA 4A3EG 5BW5A 3C16C 2O7RA 3RK4A 1CRLA 3AG5A 4CMBA 3DZ8A 5ADVA 1V3VA 4QREA 1JKJA 2AJDA 1REQA 4F06A 1Y9DA 4QUDA 5TPZA 2HK9A 1RP1A 5AP9A 1P19A 4LNHA 2IW3A 2PGJA 4Q4AB 1LS1A 3PXXA 4NAUA 1AGPA 2DB3A 2JFHA 2OAGA 5GOTA 2OWDA 2VXBA 2Q1XA 5EHQA 3I9NA 2VTVA 1IJEA 3O1IC 2G6TA 3R0IA 1FXSA 4JI7H 4HDSA 3WGUA 1EQAA 3KQQA 4L50A 1CE8A 2QU8A 2ZDQA 2PQ2A 2AHRA 4EGCB 4CM5A 5JR3A 4GW3A 1POWA 2KJQA 1KXZA 4IFTA 2H65A 3AR6A 1QR6A 2YXEA 1PEKE 1CQJA 4CV3A 2YWDA 3HDGA 4QICA 4R8UB 4U02A 2RGNA 2OHJA 3TGPA 2P2DA 1LUAA 4D02A 4U7FA 1H69A 3KV1A 3IT0A 5FP0A 3HKBB 1A7JA 5I9IA 1OFUA 2IYLD 5DW3A 4QWCA 3QELA 4XYMA 4ZEOA 3MWEA 3L43A 2P91A 1H0HA 1TM4E 2LR0A 5KPJA 1HEIA 4OF4A 1OC2A 2HQOA 1ZXLA 4GMKA 4O3SA 5HV6A 1MOQA 5KYXA 2FSHA 3EA4A 3UUWA 4CCSA 1ESDA 2MSNA 1KERA 2WLTA 4U3JA 3IAS6 5FUXA 1F2TA 3M5PA 4ED8A 2DCUA 2D4HA 1VIDA 3AGQA 5FYDA 4LDJA 3N0RA 4DEYA 2CCKA 1X1BA 1YTLA 2I99A 3L5OA 4FLMA 1CR2A 3CSWA 5AVOA 5KG2A 5HCIA 4BBJA 1UBTS 3GEHA 4NMMA 1NDHA 2RGBA 3KVNA 4EG1A 3N2GA 1KI7A 3BB3A 1IH8A 5FOTA 1JT2A 5JIBA 2HJWA 4LYJA 4A8PA 4N5DA 5DM70 2Z5LA 1EWTA 16PKA 5KFYA 4NE2A 1TD9A 1WHSA 3CF4A 2HFKA 3C7CB 3MRVA 1XDWA 2VYVA 4YRCA 4N3CA 4LJRA 1YAHA 1YCHA 4PVCA 3I2HA 3NXSA 3AR9A 4KP7A 5SYMA 5L1IA 1WKCA 3GRFA 2VPWA 1PQWA 4M1TA 4H7PA 1Z4IA 1BFDA 3ANYB 4NJEB 1SUWA 3QE0A 1X77A 5BOSA 3P9NA 3QTLA 1BRMA 2ODBA 1D8TA 2R6AA 5CVJA 3JATB 3KSMA 4ZVQA 1T0HB 2I4LA 4ARSA 4XD7A 2BDUA 5A4IS 4LMBA 1W0JA 5EZ5A 5L3SB 5EUBA 1M67A 2HMSA 2NVYA 2OHOA 4GOND 1PLLA 3PNSA 4IR1A 4JJAA 1LBIA 3I9FA 5KQPA 4FFDA 1RFLA 4TQ9A 2W6CX 4RC9A 1MTOA 3D4IA 3AQIA 4EEZA 1ZA2A 1NU6A 2QAGC 1QVAA 3QXGA 2HIVA 1YBFA 5FHRA 4XLTA 4KRGA 2ZB2A 4X00A 1C0EA 2VAMA 3Q9UA 4LBVA 1P16A 3NPAA 3AK4A 4EG4A 4YIHA 3C15C 2CVQA 2H06A 1DOZA 5EVJA 4K6MA 2IZ7A 2I4RA 1DO2A 2ZBFA 4S0XA 1JIHA 4MRSA 4BQRA 3IXQA 3QWBA 2WQ6A 1YZHA 1E77A 4M1SA 1UKEA 4BBSG 3GRVA 1ZCBA 3G82C 4JB3A 4NMLA 5CB6A 4CT5A 3USCS 1TT5B 3BSSA 3H4MA 2G70A 2B1IA 1KVRA 4WCFC 4DUGD 1JNXX 1JHOA 2I76A 5ERXA 1YRYE 3WA6A 3GD5A 3IJRA 1EDZA 2PRKA 4K26A 3B1KA 5K3BA 4UBJA 2J0EA 4JH0A 1NJSA 2PAAA 4UDXX 1LZKA 1BC5A 1YH3A 4MWOA 1CUHA 3TW0A 4BGVA 5DDIP 4DWVA 2R0QC 1X9IA 1FUUA 3K1TA 3NIWA 2Q4OA 5AW6A 2VQFB 4YRBA 2Z9DA 1EFVA 1NBIA 1M1YE 2UVPA 3E7DA 3N07A 4V0LA 4UNRA 1Q6ZA 4QO7A 1H85A 1EX7A 5DIZA 3EFOB 4O1MA 3TB4A 4UAGA 1FQWA 1A9QA 3HOVG 3KEOA 1T3ZA 1E32A 3G0HA 4NENA 3IUYA 1U63A 1HOTA 2Z57A 1X9NA 1SB8A 3GJ5A 2GCOB 1JHVA 2R00C 4FUTA 2AJ8A 4M1KA 1XL0A 2P6NA 1VKOA 1GP2A 4G4GA 4N7BA 4GMXA 4D2IA 5KG5A 2G0TA 3A1CA 4AQ7A 1Y63A 2Q3BA 4UVDA 2P7HA 4HXYA 4RKEA 4G1FA 3C1OA 2F9FA 1TA4A 3VX3A 2I9PA 3SQLA 1J5PA 4ZVMA 1NFFA 1E18A 1C7JA 3FGNA 1UDWA 1K6XA 3IV6A 3L1IA 4OHBA 2WD9A 1G7CA 2IF2A 2XKBA 4L5YA 4LZZA 4LF7H 3PK0A 2VHXA 1T2VA 2EVWX 3DAPA 2V98A 5G40A 1Y3BE 1N5LA 5IU6A 1O3YA 4ND3A 2ZI6A 1OLXB 2Q3EA 3E48A 1IOWA 2DVMA 5IM5A 3EAQA 4Q5IA 5SZHB 4C7JA 1RFGE 3AR5A 5FPTA 1A5AB 1PQYA 1NJ1A 5BQ3A 2G67A 3EQ9A 2ASVA 4IQ4A 3SX4A 3O9MA 5IDWA 2Q6LA 2VXOA 4CQMA 3I01M 1V2HE 4G8CA 2J31A 3OD1A 4MGZR 4HQKA 3IP8A 3D02A 4FS8A 5H0IA 3I64A 4YMSA 2C2OA 4BVBA 5B3JC 4L78A 5DNWA 3VISA 2J5RA 4PZDA 3VHQA 4V0QA 4FB4A 3W3AD 2VUIB 1QJCA 1CY1A 1A5ZA 3BQ1A 2FUKA 4RY0A 4B84A 4ETNA 3QX3A 1XKQA 3FFTA 2ZS8A 2E2WA 2GCPA 3IVAA 1NBOA 5DWVA 3PUJA 4O3FA 4I8DA 2QRNA 4MUBA 3VVMA 2A5JA 1T36A 3UJ3X 3ZW8A 1U81A 4U7PB 1WZIA 2NT4A 5I7HA 2YVUA 3LUAA 4W63A 1QX3A 3LJKA 1ZESA 2I80A 1S2NA 1YQXA 2PX2A 2XJ9A 2CE7A 1VFPA 2V4QA 4OBXA 1J8MF 1NXQA 1F0KA 3JD2A 1G1AA 4Q9DA 1CULC 2QLBA 1GL6A 4K2AA 3M6MD 1U2RA 4DW8A 5C4GB 4TKUA 4JKIA 1NC3A 1QRDA 5ARCA 5CD1A 5HMLA 1OXBB 2JJ1A 5HK9A 1CUVA 5JUMA 4N0DA 4Q3DA 3F9RA 5SYNA 1SC6A 5KYGA 1BVHA 2VZ0A 5AK3A 3UHJA 5G0UA 5DYYA 2XZPA 3H75A 4NBVA 4KYIB 3SZRA 3OSUA 1O9BA 2PYDA 5BN3B 1DLIA 3EAFA 5CVVA 3DQPA 4PRLA 4MQBA 2BRUA 4EHLA 5EFOA 1J0AA 1JR4A 4YAUA 4CL0A 1QLJA 1WSAA 4NQRA 5FTJA 1XMOB 1CRZA 4ONEA 3PRKE 3PFFA 4J91A 1FP1D 3RQIA 2O5RA 1E4YA 2JKVA 1FS5A 3SKXA 4PC1A 3D6MA 4EYKA 1P0MA 5BQFA 3ROPA 2R8PA 2NXWA 1Q17A 2HBQA 4A6XA 3EXHB 2GAJA 4B44A 2VJQA 4PZYA 3I45A 4FCCA 3UCXA 2WB2A 2ZE6A 1Z2NX 3WRWA 2FPOA 2VPXA 5BN4B 2I34A 2PUTA 1EB8A 1Q6YA 4J4TA 3WQSB 4WXMA 2TECE 1IXRC 3UJCA 3BGSA 2Q45A 1WUYA 2WJZB 2XRZA 4OHWA 3K73O 3RSSA 2Q2OA 2FQQA 1SKMA 3ZBQA 3MPOA 3FF4A 2JIPA 3H9EO 1N6IA 2A92A 4QAJA 3MT7A 5KTMA 1U9YA 1AO0A 4F5EA 3HA2A 1WBBA 1VSVA 4PWQA 2GJ8A 1PAUA 3HG7A 1EFPB 3RNOA 2JIQA 2EBFX 5KDDA 3CEJA 4HZUB 1I80A 5EXPA 4E6NA 2GVZC 1NXWA 3FIUA 4L51A 2GN6A 2I7VA 4OJQA 1YDMA 2MSKA 7ADHA 2P9TA 4DSUA 4R2JA 2EW2A 5IW8A 4BB9A 2FKLA 3KYCB 2GXUA 1AMOA 4RF2A 4MGIR 4EX6A 3ZLVA 5AJXA 1GU7A 3DBHB 1T8TA 3LO8A 4AS2A 3B7PA 5IUKC 3IT1A 2RH9B 4ETMA 2VOJA 3D4BA 1TKBA 3EVNA 4OV6B 4PO1A 2IYYA 3LBAA 4B31A 4CKEB 1ZH4A 4I66A 2QB5A 1XELA 1M1NA 4N7MA 1JE0A 3VJMA 3AKZA 1RK5A 1U0RA 3RS7A 1J0XO 4E3ZA 3PDUA 4FT2A 4HYQA 2H0RA 4Q4DA 4MIKA 4ABYA 3BL8A 2F7SA 5BRNA 4DL3A 3I4FA 1E1KA 1XTTA 3TL3A 1QP4A 3NHLA 2WAAA 2J3JA 3S3TA 3AIOA 2UVVA 5KTYA 4BRZA 3PFWO 2JD1A 4RTPA 2PUCA 4YXWD 3AF5A 1V3QE 3WGHA 3IAM6 3W9YA 5DNCA 1IBKH 5G02A 3UWSA 2QSYA 3HFSA 2XITA 3ONEA 3HEAA 1NV8A 2CD9A 3HUDA 5SZJA 3QOYA 4FYHA 2NPIA 1QCDA 3I4LA 2DUUA 5I7UA 5BWOA 2CJPA 1I6LA 3LLVA 2R6DA 1ZM9A 5E1MA 3UOGA 3ZY2A 1U0GA 5A0VA 1EP2B 3JZAA 3HXKA 3LPNA 4BZZA 4K6FA 1OX6A 1DADA 2FLWA 3I0ZA 5BNFA 1GUBA 1KY2A 5GMOA 3VHRA 3CYFA 1D4FA 2OC4A 4O4LA 4QAQA 4BP3A 4KTTE 4HAOA 1AY0A 2PSEA 1QR2A 3BWCA 1U0EA 5C4XG 4M8KA 3D31A 2DE0X 1FU4A 2Q5EA 2Z1DA 1NMXA 4LDNA 3ZLBA 1K75A 3F47A 3N87A 4QOJA 4B79A 1QQTA 3HDVA 3RVLA 4OO3A 1RPJA 1CF9A 3GVCA 2CXHA 3F7TA 4AJOA 1U8AA 2QRVA 1CR0A 4ZVSA 4EUHA 1N57A 2WJ3A 4GZ3A 1K0UA 1UC9A 2NU7A 3IQWA 3DAAA 4G0UA 2FEOA 2CB9A 3COSA 5J2TA 1GNTA 2RCYA 2RGXA 3D6JA 4JVLA 4MIEA 1GZVA 4X95A 1NQVA 3ESCA 4DQXA 2GS9A 5A9RA 4E3WA 1GTVA 3WGMA 4P0PB 3Q1KA 1VBHA 1KJZA 4AC9A 1EVJA 5JZMA 3WBJA 1RWWA 2ONKA 1A71A 2P9YA 1O4WA 3QVJA 1BD4A 4EYQA 1SIWA 3INTA 2H00A 2HBYA 4XJXA 3V80A 5ILOA 3OSNA 5E6UB 5JAZA 3Q10A 1BKDR 1CB0A 4LVNA 2J9ZB 3NCHA 4Y1RA 2CCJA 2HF8A 4K86A 2ZJBA 2Y3IA 2BGMA 4O7WA 4Q9JA 1X70A 1ULHA 2CXNA 5ERYA 4Y1EA 2WTNA 3OUUA 2DQYA 3OU2A 4RIIA 4UBKA 4TMYA 5INTA 2WMNB 3FJYA 3ZHBA 3OOEA 2GM5A 1G9XA 1Z33A 1HH4A 2RC6A 4PLVA 3ZHXA 5F98A 1KOLA 2DR3A 3FPFA 3T1NA 5ELMA 3NFYA 3RB4A 2JD0A 3HP1A 5U4XA 1Z06A 3KFLA 5L3RA 2ZKIA 2OV4A 3PGLA 5HQTA 1Y1SA 1ZGJA 2JFYA 3H1EA 3N9IA 4MW7A 5EJAA 4UDYX 3QOFA 3U56A 3IVGA 4R01A 3ZX4A 2XX3A 3HJHA 3GLQA 3M6VA 1OW3B 5TB5A 4FGWA 4N5MA 2AOUA 2Q2WA 1IC6A 2Y27A 2VXYA 3ET5A 1TM7E 4X66H 4TYPA 4O81A 1RAEA 2W2LA 4LYEA 5IDVA 1I6WA 3FHTA 3CKKA 4IM7A 4QBIA 5FL7D 4OJTA 2OILA 4QARA 3VR4D 2EWWA 4ARVA 2EG5A 4E1AA 2UUAB 3R3HA 3TSCA 5FD5A 3OO1A 1QQ6A 2ADOA 3AW8A 4P08A 5DN6A 4AY5A 3UYKA 4DMRA 2VRCA 3KAQA 4HDQB 2J0UA 4RK5A 2O8CA 1ABFA 1U0SY 1G21A 3RFUA 1YI8A 1OLOA 3ZV7A 4LJ7A 4BMCA 3DKRA 1ZN7A 2OCKA 3B6MA 2CSUA 3G89A 2X3FA 1N8TA 2QMOA 4OFXA 3NGDA 3C2QA 3C1AA 3U62A 3JVUA 2FZVA 5JVDA 4QXMA 2E6UX 3RSOA 1NFQA 1CP2A 1OC4A 5FI1B 4I1RA 2WM2A 2L19A 4ZICA 1PEYA 4WWHA 1C9YA 3WWEA 2ONJA 2VKQA 4XQ0A 1Y1WA 4MQLA 1VJ1A 4XJTA 4C9BA 6ABPA 4FGKA 1BDMA 1P2VA 3BGVA 4QYMA 1ACJA 3PLRA 3F3YA 1ZSNA 2XEXA 4RYLA 1MO2A 4Q3OA 4X3OA 3T5BA 3OKAA 3DW3X 3WYDA 3A37A 3Q5EA 1X7DA 2BEWB 3MWYW 4ZT5A 4XH9B 4RD3A 1MORA 3O0DA 1G8HA 4OQLA 5IWAH 1TUGA 2ZT7A 3PB3A 2Q27A 3IP5A 3Q8WA 3FXAA 4CC6A 2D1SA 4QQRA 3AHEA 2W2PA 2QPTA 4IXWA 5HOEA 2HM7A 4QG7A 1YFJA 1NJFA 3SI7A 1SCIA 2FSFA 1DFHA 3FLEA 3BDIA 1MR3F 5LOVA 7GPBA 1JDSA 3A7EA 1DQPA 1D2NA 2E21A 3OCYA 2PBZA 1GRNA 4XIYA 3C0FB 4QYXA 3TNYA 1GITA 3P1JA 1E2HA 3BQ2A 1II8B 3KXYT 2ZETA 5F2EA 1MC5A 3IESA 1JGTA 4N01A 1QTNA 2R6JA 2QTLA 1PE0A 3CQZA 3QU4A 3TTUA 3NMUF 2UZ4A 4OHOA 1UM9A 3I5YA 3VOBA 1G8MA 1SWVA 4OPMA 4YJHA 1W5FA 3RD5A 3CJRA 1P61B 3IPAA 3NHFA 3BGOS 4Q3KA 1ONNA 4RPGA 2IYEA 1EWKA 5DBIA 4NG5A 4ZCTA 1EHIA 3PUVA 3F4KA 1HFJA 5F4ZA 4LV6A 3LQQA 1EDEA 4KACA 3SR4A 4LZPA 4JBHA 3WIBA 3A9WA 4YJ2B 2R6GA 1HYBA 6AT1A 1ZVQA 2W98A 3AP3A 1XSEA 2FY8A 1KYXA 4QHTA 3RM3A 4QC2A 3P2KA 3Q8XB 5ER6A 2WTBA 1YZNA 1UBJS 5COBA 1UJBA 1HZJA 1Y8AA 3T3DA 4HWOA 2QUHA 2KSQA 5KNBD 3QEOA 1DWPA 1SK8A 2ZJ8A 5T8KC 3H5VA 3NNDA 3AF2A 3KOOA 2Q5JA 5AKLA 2WVJA 1E8DA 1DO0A 4BMXA 2FUEA 1DIGA 2I2AA 2HMYB 5ITZA 1NQXA 4BEBA 4QDTA 4PHCA 2JLYA 4OHZA 2WTFA 3IP9A 1QH8B 4UTXA 1KQGA 4XQCA 3EOZA 2EX1A 4EVIA 4ALMA 1YR7A 3TVYA 2VHJA 3JQRA 3MSCA 4ZMRA 2Q41A 1E94E 3MPUA 4B3CA 3EIEA 4H0NA 4IR9A 2IWRA 4KDFA 1USIA 3ZGLA 3TS1A 4TTVA 4OX9B 1S4QA 5G1OA 2JLXA 1LU9A 4MROA 2HWYA 4GXTA 3S2GA 2WB1E 2X77A 4A23A 1DQZA 4OP2A 1ZVMA 3FCEA 4QBHA 5BUQA 2WD7B 5AW7A 1WH2A 1YB4A 3VAZA 2B63G 3FPSA 3NVMB 2ASDA 2J67A 4CMHA 4Y6QA 3LIIA 4UXJA 2VWHA 2OCPA 4B33A 5TY0A 3HCRA 2NVBA 3FSGD 3LNCA 2ZRCA 2H2HA 3G2MA 3OZFA 3SEAA 4BE4A 1NBHA 3VGPA 3GTKA 4KO2S 2FLPA 1XHLA 3TPFA 3THWA 2EZ8A 3EVFA 4QXAA 4EJ2A 1LVHA 4EB3A 2CV0A 3RBXA 5HXAA 5HEKA 2WIBA 3C5EA 4BQFA 2XVMA 1X3LA 1ZW1A 4EMTA 1HTTA 1SZPA 1HQYE 5DNDA 1N9GA 4TTRA 4K8OA 4DN6A 4MR7B 4C4TA 4DF3A 4H1VA 4QGSA 3OPQA 3NI2A 2OV3A 3L92A 3W9SA 4BY9E 1FA9A 2GEBA 4OXRA 1OLSB 4ER6A 3CKMA 3OJ0A 3OJXA 1NMSA 2PSJA 5IS2A 2GBPA 3ZDBA 5ITVA 4XVHA 4BO3A 3EIFA 1IN4A 2XCLA 1G4AE 2QA5A 2IOHA 2Z09A 2JKYA 3OQBA 2YQ5A 2VJDA 4PZEA 3MUEA 3C8HA 1HZZC 4JB8A 1ABEA 4JU9A 4BNGA 3WIVA 5TPWA 2QOEA 2C4KA 2ABWA 1ZW6A 3AV0B 4XB1A 5SZIA 4QFMA 1NMEA 3GH1A 6PFKA 3N2KB 5CXQA 2X1LA 3D7SA 2IPXA 3OZIA 3NDRA 4UM9B 3DZJA 3M6LA 3GIPA 3OE7A 1TZBA 3B5EA 1E2QA 4I4TF 3D2LA 5AM1A 2HFJA 4HDNB 4NI5A 4J0EA 4BLPA 3RQSA 5BSWA 3QYAA 1THZA 1D2CA 3RSCA 2HDWA 2EERA 5C8YF 3NTXA 4L5BA 4AULA 1BZYA 3GBPA 3M9WA 1GDHA 2ZEJA 5JFOA 1OJLA 2YZKA 5FPRA 2OORC 5GV8A 4C2UA 1NW6A 1JPJA 3W79A 3KQPA 2Y76A 4LZOA 4CJXA 4MA4A 2RJOA 5JI2E 3U26A 2IHBA 2DU8A 3VNAA 5HKBA 3CLSC 3PT9A 3ZWYA 5KSPA 4YT2A 3VA7A 5JXIA 1QFMA 3GARA 5BV1A 5IJAA 4JI5B 3EW7A 3AZPA 2O7QA 4FJ1A 5I7WA 4B2LA 1FFDA 1PJCA 1C1HA 4PGMA 4IIFA 1AZSC 1ZK0A 4INOA 2QAJA 4RBNA 4GR4A 4NPHA 4ZQCB 3SBDA 4HEJA 1SXJC 1F0PA 4PHTA 5ED0A 3FDIA 4LOHA 4RQUA 4QD3A 1QX4A 1EAYA 2B7LA 2WT4A 1BQEA 1SAYA 2RCNA 1AXGA 2CLDX 3K9GA 1EVQA 5L4NA 2VK2A 2Z2KA 1LSUA 1YIOA 2E37A 3A4IA 4W7IA 4RAQA 2UUCB 4FC7A 4NXMB 2XQGA 2EFCB 2A4MA 4DLPA 1R50A 2EZ4A 2R5WA 1M8PA 1RJPA 1N2IA 3VNBA 3TZHA 1S01A 1NY6A 1J21A 2YNMD 3R7LA 2EIXA 1R9GA 2R87A 2XTJA 1T4GA 1GU1A 4DUPA 2PUBA 4RK6A 3AEYA 3NTLA 1IVYA 1XXHA 3DUFA 2O4CA 4RV5A 4ARUA 2VF7A 2VI5A 3CCFA 3K7EA 1S68A 3OBBA 3GYGA 2PZBA 4B3TB 4CTJA 5E6SB 5ALUA 4UHHA 3RJZA 5I5WA 2QNRA 4BN4A 1E1RA 2IYNA 2NTYC 3F4LA 2R2GA 4QYWA 2EFYA 1C0IA 2C1EA 4G1BA 3OEWA 4M86A 1IEVA 2EKQA 2OHGA 2ZRHA 1X1RA 4K81B 4WN9A 2PPVA 1HKUA 2B4TO 4HAYA 3U9TA 4YJ3A 5K8JB 5KTKA 2C42A 5KT6A 2FZKA 5E25A 4JBLA 4PFQA 2FG7C 3GN2A 2W2MA 3AR3A 3MHTA 4FR5A 2NO7A 1WOMA 1Q0SA 1SKBA 2VRNA 3L1HA 4UHFA 2VCYA 3FE2A 4UM7A 1XAIA 4NFHA 3HNPA 4ACAA 3I0NA 1L8OA 4LYDA 1LI7A 2J41A 1TTTA 1HT2E 1VPVA 3VYSB 5DLGA 3D8UA 5F23A 3A8TA 4IJVA 1YJXA 1YD7A 2BT4A 4KMOA 3SICE 4G5GA 2EJUA 2UYHA 2YVQA 3IIJA 1EFHA 1R9TA 4LDPA 4ZVNA 4EDHA 1K1QA 5TDHA 1A8IA 3N2EA 1RPAA 3VO9A 2F8TA 1P6XA 2O0JA 3JD0A 2H1WA 3DL7A 2WOJA 4UHDA 3LF1A 5CURA 1Q3HA 2B69A 1N6PA 4CQJA 4K6OA 4DV0H 2PXAA 4QLAA 1SBTA 4BBRG 4Y8VB 5J4YA 1SGWA 3PEEA 1NBMD 3VR3A 4KIFA 3VBEA 4BX2A 1V11B 3SBXA 1VYVA 4JMLA 4PZ9A 5BQXA 4JYAH 5LU8A 4LC1A 4C4YA 4HSEA 3QP9A 3B89A 1HDRA 3PWTA 4ECEA 3TRHA 4G0OA 2VDMB 5CBPB 4FR0A 1TRHA 2E82A 5AUQA 2QYSA 3PQ3A 2RGNC 2X1HA 4IDCA 4XUGB 1WG8A 1RC0A 3QU5A 3G8YA 4KREA 2X22A 1ESEA 3JQBC 4Q4AA 1NM5A 4R84A 3TQSA 5JCJA 3RWMB 2ZWVA 3GGSA 2VHCA 5C1PA 5CHEA 3KT3A 2EKZA 2R1TB 1UKAA 1JVSA 4FEYA 4YIKA 3A7DA 4KGXA 1TDJA 3C98A 1EK6A 1JR2A 4WKPA 3T3GA 3QYFA 2EX0A 2XRMA 1T5OA 3PUYA 1EDBA 1NAIA 4NU6A 1W4CA 4W5HA 5EHGA 2AHOA 2J09A 3CWCA 2W58A 3S55A 5JQWA 4U4AA 5ITWA 2VQ6A 4J76A 3W2IA 4LFCH 1EA5A 3RGXA 5BSEA 3DLCA 2JVIA 1KARA 3DGFC 1GRVA 4CF3A 3PCRB 1YJQA 3LX4A 1D03A 2GZMA 3HKBA 4DLNA 1HA3A 3O4VA 4R1UA 3UK7A 3EA5A 3R7SA 2Z6QA 3TEJA 4COKA 3E5HA 3GLKA 3SZOA 3MWDA 4XFDA 1I3OA 1IBMB 4JOSA 3NQ41 3UHOA 3WL6A 3TH5A 4F21A 5ECGC 2F90A 1R4NA 3JSXA 1K4YA 2E9SA 4CIXA 1NVKA 1SXIA 3WNVA 3EG9B 3VR1A 4DSTA 3UKOA 4CLOB 3VSDA 3T9EA 5HJEA 2Q4TA 5JAMA 1RQPA 5LPNA 4G86A 4RHTA 3SIRA 4ATNA 1DUIA 4MPDA 3U54A 4YYEA 1U0BB 5IC4A 4IX9A 2C7RA 3T1YB 4H7DA 2VH5R 2WBLC 2C1ZA 5JO9A 3ZDAA 3C3KA 1IONA 5JSZB 5CIWA 3DZFA 1JI3A 1CT9A 4PAQA 3MELA 3E7WA 1JJAA 3VHXB 1TADA 2Q5FA 1C81A 1KH3A 4XUEA 3MLEA 5AQEA 1M74A 2YVAA 2IRWA 4FIZA 1K3TA 4WAUA 3QG5A 2JVKA 4JSYA 3UUGA 5FWYA 4UQPA 1RQGA 4G63A 2VPZA 4BVEA 1EUCA 1XWIA 1YJBA 1QAOA 1NQTA 5LD2B 1Y1VA 2Z8ZA 1A9SA 1ES9A 1T6YA 1PFVA 4M8IA 4XZ3A 2XUJA 4I2VA 4MGYR 2I6SA 3H1TA 2C2GA 3KAKA 3NBXX 3WMEA 3JZIA 2JJMA 4NJEA 3QXJA 4OAOA 4TWJA 5IMSA 2I2FA 3WBFA 1PR3A 4DNQA 1E4GT 3HCCA 4O4HB 5KT3A 1MZBA 3HB4X 1Z4KA 5EIBD 5ALHA 1QVWA 5EJGA 1MOPA 5C32A 4XXHA 2A7XA 4CLHA 1T25A 2NGRA 1DRVA 3MCVA 4Q9HA 4C6TB 1RRMA 1TVEA 4LXHA 3QGMA 1CUYA 1GSAA 1DKRA 4M83A 4C08A 2UZ1B 4Z3OA 3H11B 1P7YA 5EQTA 1B76A 5TVKA 5LBIA 5J4KA 4O3QA 1EJBA 2YCLA 4O29A 3VR6A 2XCRB 5CH3A 1B7GO 1PNQA 4YJFA 2UXDB 1BXGA 5BR7A 3RO7A 2ZI7A 1LBSA 2FUG1 4WOBA 2QVYX 1FQOA 4MWZA 3K5IA 4D1YA 4ITUA 2VNHA 1WUIS 4Y1GA 3U13A 1Z0AA 1RKQA 1U9IC 1TT5A 1JWBB 2XNKA 2G6BA 1ZU5A 5K20A 4B6FA 3H9UA 2YQZA 1PQ4A 1B73A 2Q0QA 1BGXT 3C3BA 4AJ1A 2C29D 1RP7A 4AAYA 2W4MA 5IFKA 3S2UA 3RVRA 1MDBA 5FXMA 4YCJA 1VMEA 4INAA 3UBMA 3GDGA 3KLMX 1C7QA 3AR8A 3U5TA 2WUDA 2A5YB 5FX2A 5B3LA 4GUAA 4DNPA 2AGOA 4IIXA 3CTPA 4JAVC 2X5JO 1U02A 4HYTA 2BGWA 5DNUA 2YRFA 1FXWA 1EK0A 4OHRA 4RTMA 3I5MA 4RSMA 521PA 3OX4A 2UZIR 3P26A 4IDQA 3UIEA 5K4HA 1MU0A 4MYRA 5EHIA 2P4HX 1CNFA 4OGKA 4AN4A 2Q5OA 3GHHA 2OGSA 1RHMA 3EFOA 2QTGA 1JX6A 4YUAA 3FTQA 2GPJA 3QWFA 3TLMA 3S29A 1WCIB 2VDQB 4L4RA 1NZDA 2R7NA 3ZC3A 2DETA 2ZI9A 2YIJA 3HA3A 3GV5B 1F51E 1H2YA 5E6RA 1YR1A 2R4UA 3MWKA 3LPMA 2V4MA 3QI2A 5MFZA 1U9CA 4YMLA 4R5MA 3KTMA 4CEHB 4J75A 1G66A 4IXMA 3F6CA 1UFKA 1BJTA 3EVAA 7YASA 3WWYA 5AIBA 4MUAA 2O8BA 4C3ZA 2QD4A 1B8OA 3BICA 3N75A 1ZSVA 1X8XA 4LFAB 2ZUEA 5LNK6 1KO1A 4KO8A 1VBKA 4LRSB 1XMJA 3VSCA 1CK4A 4G0VA 3GAZA 5AVKA 3WGKA 5B58C 1OXSC 4YA6A 3L6BA 1BA2A 1PX0A 3DKKA 1EKXA 1XZCA 1RIIA 3L8YA 1AQUA 2VL7A 2VJPA 1OLXA 1EK1A 2Q5HA 3RUDA 5BN5A 1DCFA 2Q2QA 4JQOA 4CV2A 1N36B 2QVXX 4BNVA 4CG2A 1VMIA 4DCMA 2XRYA 4ARZB 3QZ8A 1T6NA 1UXIA 1USWA 5GGXA 2DHRA 3L6CA 3OE5A 4XKJA 2JGKA 5TXGA 3BGDA 4P5EA 3ZCTA 4O82A 2QRUA 3CBGA 2FP4A 3DE4X 5FUBA 1VL8A 1QFZA 3ZS8A 3IALA 2M9MA 3COZA 5DLEA 1BS9A 2C0QA 4XGIA 5EJ2A 3X1KA 5CBKA 3DMRA 3KXKA 4EL5A 2ID4A 3VTFA 3WIOA 1NLMA 2YOFA 5JC1A 3I34X 1QWOA 3SE7A 2XCSB 1ZJWA 4JCOA 2WV7A 1V4BA 1CUEA 1S96A 5BVGB 3W04A 1ST2A 2QORA 3C6XA 3I3SR 4BAUA 3U4CA 1H5QA 3QJYA 2CVFA 5FBHA 4Q9KA 5AI5A 4DARA 5K0JA 3PX7A 5KYUB 5LP6B 3KEFA 1X7WB 2LCIA 1E0AA 4REOA 3JYOA 2WG1A 5GWXA 1QIHA 2IXTA 1P4AA 4C7VA 1PUJA 1GO2A 3GNQA 2HWUA 1P5RA 2QL7A 4LK3A 3E2MA 4RS4A 2A0WA 5IJ0B 4EJSA 4IIVA 3A11A 3JYNA 3K0EA 3AINA 5FOQA 5JVLA 3F9CA 3B6EA 2KWIA 4K46A 2GFQA 3C1UA 3R76A 4F4XA 1E2GA 1V8FA 2BHNA 1JXQA 4M7RA 5EUMA 3FUWA 2XH8A 4DG8A 2EF1A 1FTWA 2P67A 2XCQA 5DISB 1GL7A 4XE5A 3BA1A 3KZNA 2JHPA 1YA8A 3FETA 3EE6A 4YB8A 3IPLA 1U7DA 4P83A 4TMFA 1ZRNA 1L4BA 1TEVA 4D0NA 1M0WA 2FN9A 2L82A 1SVKA 5CD9A 1EVEA 3FFWA 2FA9A 3C5VA 4HQNA 3GFQA 2CZGA 3E3NA 1BG6A 1JJIA 3GJRA 4ZAXA 2WIDA 3K9HA 1XK5A 3UBTA 1NOJA 2BM0A 3V6JA 4BFXA 2GCGA 2MCTA 5JNVA 3DWFA 3LXRA 4O7VA 1J0EA 2OD9A 5B53A 3ND5A 3GAMA 4ZOLA 1JAZA 1JT9A 4HEA1 2X2OA 4OGLA 2PLNA 3TBFA 4X8OA 1UKBA 3PN1A 2AN9A 4LDRA 1LRJA 3DT9A 2XXJA 1K27A 1U04A 4UHEA 4XR4A 4AKHA 2IA6A 1DJOA 4P5PA 3QWIA 3ET4A 5GJWC 3HEMA 5L45A 4ZYZA 1GCAA 5D87A 4N5NA 1E1YA 3HY6A 4HGNA 4DL5A 1GGOA 3E5NA 3ZCSA 1LPOA 4UW9A 3VPAA 1W36D 4X6LA 4RVUA 5C7YA 3OHPA 5ECDA 1YGPA 1EFPA 1IK4A 1TA0A 1P4GA 1YCGA 2FE4A 4Y9UA 3GLFA 2BEJA 3E3OA 4WN3A 1K06A 4BO5A 2WYWA 3F7NA 3O2NA 1JUDA 3P9XA 1AB6A 1EUQA 4H15A 4W6QA 4AB1A 4JJIA 3WFIA 4MP6A 3O6VA 2WMOB 1DZIA 4KODA 4P80A 2NP7A 1VHQA 5CT4A 1QE5A 4IBOA 2JASA 1EG2A 2BQRA 2Q2TA 3Q7QA 1QQAA 5HF9A 3DJYA 3V8EA 3IAXA 5KQGA 3F3MA 3BMNA 1E59A 3H1AA 1N3LA 1S7GA 2MJLA 3LP5A 5K6RA 1Q0UA 3LPAA 3OSPA 4QFCA 2CE2X 1FFXA 3LHSA 4DR4B 3EIQA 5D1OB 4CKEA 2HV8A 1UANA 3I2FA 1Y8ZA 1G0OA 1SCQA 5F9HA 3UV7A 3E82A 3PTZA 2GYUA 2I7XA 4L75A 3BTSA 4J2OA 1FFGA 5EYPB 4AJNA 5FFNA 2VYCA 3FFXA 3B6ZA 1A0OA 5A4MS 2PCLA 3OIGA 4JLVA 5CGQB 2XXAB 1WY5A 1Q91A 5DXJA 1UBCA 5B7GA 5C5JA 1T94A 1J07A 5IARA 5KVSA 1A8SA 1RTTA 4XAQA 3W77A 3QZ7A 2O59A 3BDVA 4YAIA 3ZDDA 5IEBA 4YT5A 3P2JA 5ENZA 1P33A 4XGKA 2V8BA 3NAMA 3N5KA 4TYQA 2XMGA 1U90A 1TTQB 2YW9A 4Q1AA 3W2TA 2YV1A 5F1YA 1TYDE 2J0SA 2R8YA 4J1SA 2IXGA 3O1LA 5BYJA 5CG1A 3CH4B 3KPVA 4A4DA 1XKXA 4QT0A 4I1UA 2W6IA 4M0FA 2IUUA 1QIEA 3OZTA 2PLWA 1YZVA 1KHHA 4R2IA 1NUPA 2P65A 2YWVA 1IHOA 2IYOA 4HDAA 4B6SA 2KLBA 1WSCA 3M9OB 1NOKA 3TQIA 3B2EA 2FK3A 3AFIA 2ISCA 3UA4A 4NXNH 4DR5H 2OHHA 1T5HX 3NHWA 1WB4A 2JIBA 4CYMA 1JKMA 4WW0A 5CX4A 3CH6A 4P3XA 4V0MA 5E2BA 4AG6A 5L40A 5K0ZA 4EYIB 3DMFA 3HYRA 3ONWA 1YB6A 5JHHB 1TVKB 4HV4A 3HJRA 3AOEC 4EGAA 1QDLB 2JH9A 3BN3A 3RKUA 2FPXA 3C87A 2OD2A 2XB8A 3G2PA 5TQVA 4NE7A 2ZSEA 3UXMA 3AKEA 4Z4IA 1HGXA 4EPRA 5CVDA 4ARBA 3EIOA 2QX9A 4CEJB 5JJLA 2AJLI 3CLVA 1TFRA 3D8TA 1GPJA 1CZNA 1TD1A 1KMIY 4FBUA 4MQ4A 1Z62A 4KH1A 1TVMA 1GGEA 1HY3A 3GN1A 3ZV3A 3KR0A 1ZMXA 1Z68A 1JEJA 4ZI7B 5E6UA 4PZLA 1Q95A 4CQLA 1C1XB 1RE1A 3R7WA 3PFCA 4TRNA 3AFGA 2IUTA 2D00A 3NOQA 3TX6A 4JSTA 3KWMA 4C3UA 3GL9A 1ZK1A 4XYLB 4MR9B 3FSRA 4WZBE 1IQPA 1NVWQ 3EULA 2JGRA 3CMMA 2AG0A 4DJDC 1NWCA 4GOOD 4C87A 1XHFA 1Q15A 3Q98A 5AKEA 3MMSA 2VWQA 2YMQA 1WVMA 3LVRE 1VJRA 3VNRA 1FS4A 2WHXA 1NN0A 2XUFA 4H3KB 1MX3A 1JKFA 1O94A 4FMCF 3S44A 2BW0A 2JIRA 5ER9A 1LDYA 3R3ZA 3ZNQA 1B3BA 4QOFA 5H83A 2ZIXB 5BWMA 5FLMG 4MHOA 1B23P 2IHZA 2EEZA 3HXPA 3O74A 3WZMA 3IOMA 3GEIA 4DE5A 1ZISA 1KY4A 1XU4A 1RZRD 2PWPA 2PCJA 1TJPB 5F9LA 1JDBC 1CR6A 2PJDA 1N2EA 4KX5A 3BRSA 3NWPA 4XDGA 4YHBA 1P1JA 4LYFA 4MS1A 3EFHA 4BN5A 1FBTA 2JJYA 3UXYA 1A9XB 2ATVA 1KZ6A 4P31A 4QZVA 1NZJA 3R4VA 3P9QA 3RVPA 4B2YA 3EHDA 4GNKA 3KKQA 2FETA 4WVFA 4JLOA 1FU8A 2DC1A 1U98A 1NXSA 5ERGB 1UK9A 1T5SA 1T9GS 3AP1A 1V16B 1AJEA 3RAQA 5FPSA 1O97D 2W6JA 2J08A 3GT4A 1C9MA 3A1EA 3WKCA 1KQFA 3O73A 1S9HA 1PL7A 5F12A 2P1ZA 2CGEA 2QSJA 1WP9A 2ES4A 5AIAA 1V9LA 4F3RA 4ZGBA 3EYWA 3ECCA 3V32A 3NYRA 2CVPA 3QBVA 1DTWB 3A05A 4YCDA 2RI1A 3CEMA 4ME6A 1J1IA 3JYPA 4OA8A 1H6BA 5J63A 5ESDA 2P9EA 5DYGA 4KUHA 4EY5A 3EDQA 3C6ZA 1XU9A 2VYNA 4KAAA 2PT9A 3JAKB 3GLGB 2BF7A 2B4QA 1V39A 5C8ZA 1FMFA 4H7EA 1OA0A 3GVHA 3TOVA 3CQ9A 1NAHA 3OOSA 3TGLA 4TV8B 2XB6A 4OXYA 2OGTA 1C3EA 3ZXIA 1CY8A 8ATCA 2PWAA 3GQCA 1G1MA 1NI4B 1QHHA 4APMA 2VTDA 3KQOA 5C7IO 2X6RA 3MTBA 3SNHA 3IAHA 2XGQA 2LWIA 4IVQA 1KAMA 1IB0A 1KC7A 2QGFA 4KDRA 1UDCA 4OQDA 1WRBA 1C9NA 4HDCA 2NSDA 4ZYTA 3RK0A 4L5IA 3A6FA 2IZ6A 4G0QA 3NC0C 3OP1A 2NOAA 1CZUA 1TCCA 4TV9F 5DGHA 4MKRA 1AVTA 3GGOA 2YV5A 5K6TA 4GC6A 5KSYA 1QKIA 3VNVA 3TK1A 2IHTA 4QTUB 4EABA 2QENA 4IHQA 1JHYA 1KWKA 3BT7A 3R0ZA 2FJZA 1YJ5A 4QATA 2BIFA 1CYDA 1VCMA 1X8JA 1XO1A 2BUCA 3HUFA 1L2ZA 1Y34E 2FW7A 4U7CA 2SECE 4G23A 3BFPA 3LZCA 1H2FA 1KI3A 4BXOB 4BO6A 1EYZA 5LQMA 1MTZA 3TWOA 1CIVA 2GCEA 3SGLA 5K01A 3Q88A 1R88A 5G0VA 2IEGA 4PQFA 1MA0A 3BH7A 3AC0A 2MYUA 4RPKA 3SYLA 4TYWA 4FDLA 4TWBA 4N7JA 1U28A 4EA7A 2ZJ3A 1C9EA 1K6JA 4Z4HA 1UMBA 3T12A 4ZD6A 2VJAA 1KEEA 4BX8A 3ZVKA 3RYIB 3A1WA 5A1JA 3FLAA 4FGSA 1JFFA 1XTZA 2ECKA 2PVCA 7REQB 4CZ2A 2FCRA 1WDLA 4QUKA 2VP6A 2I87A 4LCJA 1E1QA 2OFWA 1YQUA 5IJZA 5AK0A 4ZGGA 4TQGA 4L15A 1T1JA 2VJNA 5AM2A 2CXRA 2YBEA 4EHKA 1Z6ZA 1TLFA 3RSHA 1T0PA 2ZUBA 2AC4A 2CLLB 1UQRA 4AURA 1Y80A 5LMUB 3R75A 4IEEA 4BO7A 4NJOA 3W8NA 1ZG3A 5DI3A 2UYCA 3T3EA 3HKEB 4X65B 1FSPA 2DJ5A 4WASA 2GGSA 4Y18A 3RJ0A 3D81A 1JSZA 2Y77A 2ZJ5A 2XNSA 3BMOA 2OLSA 3GNTA 2PR7A 3D4LA 3KELA 3JQPA 1XLWA 1K7SN 1VBMA 4MUHA 3K2EA 4IIUA 1XVLA 3JV7A 4IZOA 3PWKA 3TBKA 3C7KA 2FK2A 1USKA 1RJ9A 4YV2A 2GF9A 5LA6B 5LDHA 3G7UA 3HXQA 2N1MA 4YRGA 4TYYA 2BD0A 4AKTA 4MRPA 4PO3X 4ECVA 3OLZA 4MR7A 5TARA 1EE9A 1ZMOA 3NKLA 1DARA 1JEYA 1JTVA 3LLMA 2JK0A 5IJ9A 1UF9A 3KM0A 2EC5A 1OLSA 3LW7A 4PSDA 2M6LA 4HEHA 2R66A 3L9WA 4P8RA 2GBLA 3K4QA 5KAMA 5B7QA 3FFBA 4XX0B 1JV2B 1HETA 3TCKA 3H2SA 3ODPA 1XCJA 3REQB 1XPOA 4KLZA 1JLSA 4OG2A 2Z4TA 3KYBA 1WNTA 4RGYA 4DV2H 3PQ4A 1XPUA 3R0XA 1FKAH 1L7OA 1TA9A 5REQB 2B6NA 3JS5A 3ZE8A 4G5RA 4GGPA 2A9JA 2PU7A 4YTEA 3CPSA 1T1IA 2R8IA 1I2CA 1Q92A 5JISA 1G17A 3HMQA 4B0OA 4YHHH 3ZY4A 4F8EA 5B1SA 4DL4A 4FBLA 3EYAA 4GLWA 2VATA 1PRYA 1Y33E 4HOYA 1UJNA 5E1BA 1KMQA 2YHIA 5ESWA 3OT4A 5K3OA 4RVHA 3BULA 3R3JA 1ZGCA 4HDNA 3GJXC 3ABZA 4XFKA 2GBCA 5KSZA 2R8OA 3FMAA 2XA2A 1CEQA 3GFGA 4UEJA 2ODEA 3MWFA 4GECA 1V26A 3ER9A 1HDXA 4W8GA 1P0CA 4P33A 1H8EA 4Z53A 2O8DB 3VKFA 3DXXA 3ZD6A 3R5SA 1DEXA 1TF2A 1F8YA 4C4RA 3CUVA 3E7FA 1TTHA 1XQ9A 4NZPA 1SQFA 5AJYA 2XNDD 3MCZA 4IDNA 3N86A 4DKJA 121PA 1VE5A 4CNQA 2Z56A 3U9LA 5KNDH 3DTFA 3ZU5A 4N5HX 4K40A 2UU9B 3FYHA 4WUTA 2HUNA 4AJHA 1V9SA 3AMVA 2DECA 1XJWA 1AUXA 2QW1A 1A8PA 3X1ZA 3JQ9A 1JLKA 1BE1A 4A73A 1AV6A 5JDIA 4H0CA 3W8DA 4MW6A 1MD9A 2UUOA 3T5DA 2P8JA 2OBFA 4LGCA 4FD3A 1BFUA 1C8LA 1TK2A 2PZKA 4UC0A 4RUCA 3UATA 1UWVA 1NBWB 4A2QA 1HUQA 2CLOB 5JSQA 4DM3A 2PV7A 3RI3A 4JA2A 3EXEA 5ENVA 1JX4A 4IUDS 4GSYA 1DEHA 2X7XA 4E4RA 1FRFS 3T1HH 5DEOA 5LLTA 3MM4A 3ODGA 4B3JA 1S0MA 3TY8A 2EYUA 3GUVA 1F6DA 1B0ZA 1E61A 3HJCA 1T24A 1G2QA 1K7EB 3DZIA 5JCOA 1OAOA 3HJFA 3CHYA 1MIOB 5FO1A 4AIRA 4HAUA 3O8BA 4M0PA 4I6JA 1EGQA 2JZCA 2FEWB 4NV1A 5CK4A 1T1GA 4F04A 3MMPA 3M9LA 1U8EA 1KMNA 1X15A 2DRIA 4CRWB 3UJHA 4YV7A 3A14A 2CL7X 4E03A 4MRNA 2WUGA 1H66A 4ND8A 1RLUA 3EGOA 4F0JA 5IRCD 2NQ2C 1OH6A 2W7OA 5JW6A 4QQNA 2FPGB 1DAMA 3P9IA 3HL4A 2JZOA 4U7DA 3ZE9A 3V00A 4TL8A 1JRLA 3KZKA 2IYXA 1JL3A 1RXWA 4G81A 2FFHA 1I5EA 5E7MA 1ZHFA 2WJIA 3RVMA 3WIDA 1YR3A 1CKMA 4Q4HB 1STOA 1TUBA 3R1IA 3K8YA 2HG8A 4OQQA 4ZZIA 4LTDA 1L7EA 4I36A 4X1KA 1ZBDA 2N42A 4KK4A 1CUFA 2RGVA 4C7OA 1I32A 1WXGA 4BN0A 4X0EA 5AOAA 4PYJA 3A6DA 4FCWA 3RSLA 4NOJA 8OHMA 1XGKA 1DQRA 2ZRFA 5D2CA 4O2BF 4E7OA 1OIVA 3KZOA 1CJMA 2PPLA 3NOXA 1PF7E 1RXUA 2DKOA 4MAAA 1RYHA 1O1YA 2B25A 4HBGA 4HN9A 1YB1A 3VOAA 4RULA 1OZGA 1SEVA 4DQDA 3S70A 4AKEA 2FYTA 2QSUA 5CBPA 1IG0A 2CHGA 1J70A 1KAHA 4DYHA 4M6WB 5FPQA 2C4NA 1MW8X 1IY0A 4NBKA 3IIIA 3ZHSA 2P5UA 3OU7A 3OF3A 5IHPA 3RYCB 2VK1A 3DBLA 5KOJB 4B3BA 1ZEMA 4DC1A 4EZBA 2HIMA 3MUFA 4WCDA 1CQIA 1A1VA 6REQB 4FS3A 5EMLA 4D4KA 1XJCA 2P9JA 3RB3A 4U6PA 3M5DA 2Y1FA 2V4RA 3GEEA 4EMUA 1N2SA 1Y7PA 3O83A 1FVOA 1DBVO 1S9FA 1H6AA 1Z6GA 1HMPA 4MLDA 2GTPA 1JJ7A 1IAVA 1T6BY 2GA8A 2Z2IA 2ZLBA 3HA5A 2FQYA 3JQAD 2C1XA 5SY4A 1ZCJA 3KZVA 1HNZH 4K2HA 5AOBA 5KFGA 2B4KA 2WYHA 4PLZA 2V6MA 1YUNA 3PENA 4N65A 3JWEA 4EBBA 4K6NA 3QX8A 1FDRA 4KQ6A 1SH7A 3RRXA 4LSXA 5EWFA 1Y4DE 1IZZA 1RBMA 3U39A 3KPJA 2GPYA 4G9EA 4JQZA 4W9RA 5CDFE 3WKAA 2GPWA 1TMKA 4IJ5A 1BHO1 1N1MA 3ETNA 5L3QB 4X1IA 3PD1A 2CKMA 3ACCA 1SPBS 1D1TA 1J7JA 4PLCA 1M83A 3VC3A 4ND2A 3JZDA 3NTRA 2EJVA 1DC5A 3LZ6A 3PQFA 4I7EA 4BMSA 4LXQA 4QYTA 2FE3A 1XDUA 3AJEA 1W8IA 4LSZA 1QHFA 5D5HA 4KSYA 1L5VA 4A0SA 1GN9A 1Y4UA 2PXCA 4B82A 3V1TC 3CRZA 3CNEA 3QUSA 5L4LA 1J5EH 2OO5C 1OROA 2QLFA 2WQ7A 4Q1VA 1SCKA 5GIOE 1IN5A 1CVLA 3IBGA 2ZI5A 4DLTA 3FNBA 3RJ9A 4Y2UA 1FSGA 3DMDA 5HNKA 3I6QA 4YROA 3L7KA 1M6NA 3TG8A 2DY0A 4BB0A 1O8BA 3GIIA 3FBGA 4RIHA 1T2NA 1QHEA 1QP7A 1MVLA 3KR9A 4MQEB 2B83A 4NL4H 3LA6A 2JKZA 1ESCA 5I48A 4PTLA 1PW5A 4NOKA 3LTEA 4IJ6A 4Q44A 4A3MG 1UIRA 3MIIA 2PMCA 5EAIA 4C3VA 4H16A 1VMKA 4TLCA 4HTAA 1O5OA 1E9CA 2EP7A 5I7RA 1ZU4A 1A0IA 2W6NA 4RZUA 3HZRA 3D2AA 4NKRA 4GZ5A 3KEGA 2ZS9A 3IQIX 4QTZA 1DHTA 4AF6A 4LWPA 4EW2A 3PPXA 2X4GA 3BZWA 2VZ8A 5KNCA 1FFWA 3IH5A 4Q7JB 5ALNA 1Y8QB 4I19A 1OI3A 4ZK2A 1GM5A 3OFJA 4QBKA 5A71A 3C4QA 3HT5A 4JLUA 5HJ5A 4BEWA 1S3SA 2QJWA 4P81A 1KZ4A 1SKQA 3DLIA 3L8GA 5KJCA 3PNBA 4JL8A 4FFNA 2BUAA 4FMDF 2MWMA 4DANA 3CZRA 2R7KA 2CNNA 2UZ1A 3M4YA 1QHGA 1AQ6A 1KFEB 1W6UA 4KQXA 3TIIA 4RTOA 1HQKA 1ZY2A 3N2LA 1LPAB 3VR2D 3F5DA 1GUFA 3BMQB 3T4UA 4NAHA 1GTG1 3S1AB 3ZTTA 3L0ZA 2UUPA 5C5IA 3EGCA 4B17A 2XKAA 1XRQA 2VDRB 5KVQA 2BGRA 4B2PA 1BMQA 5A2QW 3M8KA 1E5TA 2P6OA 2AD1A 1OT5A 1GARA 3G0IA 3C97A 3LOPA 4R2MA 3EQ7A 4G2NA 5I5GA 2Z43A 3DAGA 3CT6A 2AFHE 1KDOA 4EO7A 1L9KA 5JJ5A 2PX5A 4Q15A 1A96A 3KDPA 3LBFA 1R6UA 4V0KA 3DONA 5DQIA 2VQEH 4UXHA 4R3UC 1B0UA 1H5NA 4KXQA 2VDUE 4L6AA 3T15A 1DQYA 1KYQA 2POCA 4FDMA 2PEYA 2EFEB 4Q18A 3OBIA 4GBMA 4YCLA 1CF4A 3QLVA 3SQWA 2E5LB 1SQGA 3L7DA 2ZUTA 4IVRA 2H07A 1Z0JA 4XGRA 2GHRA 2XADA 1V7CA 2XAUA 2F3PA 4EF5A 3SSNA 1PZHA 2ZULA 1T5BA 4LXXA 2FR8A 4AJLA 5JYBA 3GUCA 3K9QO 4DC0A 4IS3A 1CY4A 2MYTA 1LDGA 5L51A 2CXTA 5JQGB 2JIZA 2MT9A 3I0MA 1OWMA 2PUJA 2VNJA 4QYIB 3VJRA 1N2CB 4YQFA 2DM6A 3H65A 3REFA 3B52X 4Y2XA 1WOYA 3WJAA 4WKCA 5EQFA 4F93B 1ISIA 3BGWA 1JTEA 4PPGA 1CZKA 1YS7A 1YK0A 2EKBA 1UXKA 4L1KA 2VH1A 1ACMA 3IL2A 5H9WA 3ICEA 2HXGA 4JB0A 4JI8H 4ZVLA 1Q14A 2CFIA 1E79A 2G40A 1QK5A 1IOLA 1A48A 1AK2A 3AM3A 2C35B 3ZWQA 3OKPA 3AFOA 4R8UA 4TQSA 2ZRIA 2VSQA 1K08A 1SOAA 4M7PA 3ABOB 1JJFA 5M5BA 3IP6A 5GZ3A 5TLSA 5I51A 2ERYA 2WV9A 5MGNA 1XNGA 2ZVQX 13PKA 3WRXA 1T3SA 3GJ7A 1JXMA 4UTRA 3O9ZA 4LFBB 1N6NA 5E1OA 5FTMA 1BAPA 2C2EA 4XDHA 3WDSA 4X60A 3UH1A 3HO6A 4DCUA 3EC1A 1U2EA 2PE5A 3U5ZB 3AL2A 2ZRGA 1YRAA 5JS7A 5JY6A 4B4OA 1RLJA 4RX1A 5FL3A 2FSUA 5FPKA 5BUCA 4L28A 4PSCA 2OV2A 4JP5A 4L8GA 4GL4A 3C85A 1RHUA 4NOMA 4H31A 1G291 1WDWB 4E22A 3T4PA 2QL9A 4EJSC 1SXPA 4QGHA 4OI1A 5CB4F 4RHUA 1XN1A 1IXSB 1GZ3A 4P34A 3Q0IA 3OTIA 3IQGX 1Y9JA 4R9SA 4RKWA 3KDSE 4EDFA 3HYSA 2R4TA 1XNQB 3OA2A 3IQZA 1C5KA 1ODLA 2HF9A 3ENKA 1TQHA 1A04A 5KMGB 3W5HA 1NONA 4IIDA 1VJCA 5KFLA 5AM3A 1BOOA 2NZ8A 4H4DA 2WHRA 2O54A 4MI6A 3Q3IA 5LKRA 4XQ9A 4HYEA 4LTMA 1J23A 4W1PA 1W8DA 1OZ0A 1T10A 2IITA 3KZCA 1OBHA 4JCCA 2Q0SA 2WT9A 3I2IA 2CZCA 3TW4A 4P36A 3EZFA 4YP3A 1RU3A 1CJKC 3JATA 1ZKMA 1GILA 3ZBPA 1N2JA 1NQWA 2ID9A 3ABQB 5L3SA 2WABA 4KO4S 1L7RA 5H3HA 1E6EA 2PS9A 4LRUA 3X43A 4AECA 4N9WA 4BFLA 2R7AA 1GGHA 2Z4RA 1GR1A 2BMEA 4CMCA 4QASA 3MQ2A 2ZRDA 3W6OA 4H3HB 1R15A 3KOYA 1XK7A 2B92A 3DKVA 3QEJA 3COPA 2AR7A 4A3JG 3G7NA 2A9RA 3PXBA 2IU0A 2GESA 1UH5A 3E9EA 1T3NA 4MUKA 2ZJOA 1RKVA 2HHFB 3K20A 1AUOA 1ZIPA 1FNDA 2H57A 1RQXA 5FD6A 4R7GA 3IMGA 3RF7A 1XL1A 4LJLA 1T9HA 4P38A 3VZCA 3CSUA 3GNLA 2TS1A 3SEFA 3FCUB 4FHEA 4BUCA 2Q99A 1XXLA 5TGDA 4MV9A 3FKSD 2A0KA 4TUYB 1IQUA 3H9GA 1C80A 2ZP1A 3O8CA 4YLGA 2PUAA 1AKEA 1UAAA 5L7TA 1RZVA 4RADA 1Y6RA 5KFHA 5CFMA 1Z0KA 1KYIA 4NDNE 1VRWA 1V5FA 1V3UA 2GVDC 4PVDA 4K0KB 5EMJA 5AVWA 1OBFO 5CW1A 1PUIA 5HS4A 3AHGA 5FWAA 1Z34A 5HRAA 3WNCA 1TYBE 3U37A 2I6TA 1S4MA 2DR2A 4IJMA 1H3EA 3L0IB 2V97A 4R2KA 5KFKA 5ADHA 1G2IA 1G5HA 1U8YA 1FDSA 3FPEA 5ARBA 1FVIA 5K2MA 3IKJA 1O89A 4JS0A 2JLZA 1T3GA 3N0WA 1U6IA 4O1IA 5JD5A 1PLKA 4QTXA 4E33A 1CQPA 3KHRA 4PYNA 4E5YA 2CN1A 4DDMA 1JDVA 3D0QA 2D8MA 2F8SA 2BHLA 1HV8A 2V6GA 4LGVA 4LXUA 4FIDA 4LC9A 4ER0A 4J3FA 5JJKA 4PLWA 5CCEA 2VPPA 2J0QA 1T9DA 2IMWP 4DLZA 4AP5A 5L3ZA 3MUOA 1MHTA 2WJVA 2Z9BA 3WYAA 4QKQA 3MD9A 1JZSA 3KL2A 4FJ2A 4Y9TA 4RK0A 3M34A 2GCOA 3E3AA 4ZQGA 4C01A 2VQDA 5D1OA 3K09A 3CW8X 3R7BA 2Q29A 4EYHB 1MENA 1ADBA 3ISTA 3FMGA 1L4EA 3M1YA 4OMUA 3VJLA 3MG9A 1YQQA 4JENA 4DV4B 2PSSA 1XAHA 3V7YA 5EYPA 3L0DA 5I7EA 3LUCA 3OMWA 3VZQA 1YXMA 5FAXA 1QZ3A 5IVIA 4EUNA 1GPLA 1R27A 3MTIA 3GH3A 1X7XB 4ED2A 3CX6A 1LLDA 5AW4A 1OFIA 2J45A 3VR5H 4A03A 5EHXA 1Q5PA 1BWRA 2E4ZA 5LYJB 1UEJA 5DCYA 5FLYA 2CVOA 1VG0B 1I2LA 3CRVA 1L8QA 1Y5LA 3RRBA 3VDRA 3BWYA 1GZUA 1UPAA 1QIFA 1D09A 2R1VB 2F00A 1NUAA 4TZTA 4HDMB 4LOKA 1AB5A 4QPPA 4LSMA 3T7JA 3L7JA 4RCNA 1G6OA 1N3YA 3UWKA 3TRJA 4MRMB 3F8WA 3BXGA 1R74A 1UOQA 3PPWA 2DKNA 4GXQA 4OYRA 1WXIA 4H60A 4J4BA 1IPEA 1RXVA 2Y1GA 4JGGA 1GTRA 1C0PA 1RLOA 3TNLA 4N5IX 2IHKA 4KIGA 4R98A 2PJRA 2RKOA 2R6HA 4UE3S 4GG1A 4QNRA 3RE1A 5GY7A 1H8HD 3NEPX 4RA9B 1EXDA 4MLZA 1RK6A 2I4MA 4KAJA 3OZSA 3BZUA 4OBWA 1TCVA 4R8LA 1TVKA 3RTAA 4QDKA 2A0FA 4DXHA 2WAXA 2XMSA 2NNLD 2OCDA 3T1VA 1FVXA 4JHLA 2QRHA 3N2NA 2BRUC 3NATA 4RCZA 2REOA 3QOXA 3OOHA 2G63A 2J32A 4PX5A 3LUJA 1SJ9A 3T7RA 4H17A 4R8VA 3UN1A 2H59A 3RB6A 3OQ1A 1DMRA 3EEYA 1GGKA 4TVSA 1TM1E 3RU3A 4KLAA 3KHTA 4CEJA 2HLDD 1C1DB 3L6EA 4I5EA 3AVOA 2QN3A 1E7QA 1Z0IA 2H8KA 1H23A 3TXAA 4ZGWA 2JLBA 2AC2A 2B8EA 5BMOA 3QF7A 2Q0HA 3RC7A 1XVUA 3GRAA 4BVKA 1RHKA 2JA8G 3PYLA 3MLAA 4U8GA 3ZHZA 4MGKR 3ZIUA 2RBEA 2CJWB 2B35A 3H2ZA 1NVUQ 4E2XA 3ZI7A 3I52A 2W0MA 4MOWA 1JDJA 3TIVA 2HVSA 5T4BA 4E5DA 1CP3A 4YAKB 4PSAA 5AVUA 3DE3X 5BN3A 3SKVA 1W1IA 1IUNA 1YS1X 4ND6A 3AF0A 2HJ9A 4I1OA 3C4VA 3QUQA 4MH0R 1Z35A 1VCNA 4MR9A 1EP3B 3B7GA 1DWQA 1G2OA 4CG0A 3ZGZA 3M82A 4BV2A 4RH3A 5LQAA 4CTMA 1NSTA 4B7XA 5AVJA 2NV2B 4NBLA 2EWMA 3EXHA 1DUVG 1MNQA 3FVRA 3I73A 5HIJA 5A7GA 1E89A 4UU7A 2WSSA 1WV1A 1LTQA 4UMVA 3TY9A 5KFVA 1ZH0A 2O2YA 5BN4A 1S0NA 4QJ3A 4ECYA 4W5JA 2VZEA 2IFTA 1MJ5A 3MR5A 4WBNF 1F0YA 2ZIZA 1V7PC 3G9TA 4R9VA 1Z0SA 2BKLA 4XDZA 4HGQA 1NKVA 4K9NA 2JJ2A 1KPIA 1M76A 2QTAA 2HQRA 1QF7A 2B82A 5EJ6A 1ZDMA 3FOEC 1GGVA 4C06A 1FW6A 4FW8A 2DT8A 4MR8B 2WD8A 3AR7A 1JG4A 4YYZA 1FPQA 5H3LA 1I50A 1ZI9A 3U0BA 4DMMA 3RYFB 2UV8A 3GLVA 4J9RA 2A6PA 2IKQA 4S1WA 2YJGA 4CIDA 5G41A 2GEFA 3IGFA 4DIFA 4ERNA 3LKBA 5T64A 3D8SA 3HU1A 1W36B 3FUTA 1KBZA 2JEFA 3WLNA 4HZUA 1K6IA 2D2VA 1FNCA 3CVWA 3RBVA 2Q2NA 4IRXA 2DPMA 4KPYA 2RIPA 5DO9A 3GRCA 1RZUA 3P9RA 3QKSB 4N40A 4RPIA 3KYCA 4BVAA 4PPYA 5KJEA 1G5QA 3DBHA 3EUFA 2WHYA 5GJBA 3BB1A 1WX1A 2QM0A 3CXUA 1YDFA 3C5WP 4CCAA 2C22A 2OD7A 4QYSA 2Q9AA 5TS2A 4ZTZB 4DV7B 5JARA 5EIWA 5AR1A 1DTWA 1AS0A 4D57A 4BNYA 2Z3WA 3H97A 1R18A 1JG1A 2IH5A 3C1TA 4BFWA 1DX4A 3NHYA 3A6ZA 3INYA 621PA 2P0YA 3LF2A 1Y1VG 5LQSA 1CVIA 1SCBA 4EOGA 1QOQB 1SXQA 2Z9CA 4E1BA 1R7RA 3KVVA 3F97A 3NGMA 4ND7A 1HLGA 1ZR2A 1XYYA 3Q72A 2IYPA 1NI4A 2K87A 2KE5A 3GXBA 5LP1A 3AM1A 2AGPA 1NQAO 2COJA 3AZQA 4GQAA 4DV6B 1KI8A 2ID8A 4QEZA 3OH8A 2XCTB 5BW6B 5DTIA 3PQ7A 2A9OA 3C7TA 4BV3A 5C8XA 4HWSA 4DB4A 1Z4MA 1J06A 5I9NA 4KQIA 4DIEA 3FMVA 4LWQA 4E08A 2A59A 4DG9A 3V4RA 2SCUB 3TD9A 1TWAA 1ZRSA 3QFRA 4EJ6A 1CS4C 4CM1A 1Q22A 5DU2A 3D9QX 3QFTA 1SC9A 4YRRA 4GQBA 1U28C 3PFNA 4YP6A 3AB7A 2PL5A 4S05A 4URUR 1Y0BA 2OM6A 3NALA 4PWZA 3D4PA 1A88A 4MRVA 4DLLA 4YDHB 1IMOA 1QV6A 1RJRA 1TO6A 2A3NA 3KU1A 1F48A 3HB9A 4ZCMA 2FHSA 3FF1A 5U9CA 2D1FA 3G5AA 1Y6FA 3UJNA 3AF3A 3G2HA 1EWRA 3U3OA 1WZNA 1B41A 721PA 4J03A 3HGMA 5DM2A 3NIDB 2RHJA 3AJAA 3TRIA 3RR2A 3PVSA 2IPOA 3WGIA 2C2HA 2H1OA 2O57A 3MAAC 1A2BA 3IXMA 3T7DA 4R5HA 3WRYA 4A6DA 3WJ7A 2X14A 3STWA 1KOJA 1P74A 3TYXA 4CM9A 2X9LA 2PJZA 3EEQA 1WMFA 3FNRA 3BE4A 5BQOA 3RCBA 1N34B 3AO0B 3ANLA 1EGMB 4XTCS 3P9PA 3QPBA 1VG8A 5DG7A 4RZXA 3V5NA 4N49A 5AI8A 1L7VC 3BVPA 5IP5A 4JLAA 2ZANA 5DSTA 2PD4A 3BHIA 4X6XA 5FB3A 4Q7EA 2CLHB 2WWIA 4QG3A 2ZQ5A 2Q5CA 1MJFA 4YASA 3UC9A 1ULTA 2XE7A 2ZREA 2ZITA 4LRQA 1RC1A 4X93A 1FSFA 4KE9A 4B3HA 4Q9NA 1TQ4A 3WI7A 5D8DA 1BVRA 1JIJA 2EQAA 5C1IA 3LLUA 4Z9FA 3UHFA 1QO0A 5LCXA 2JGMA 1Z8FA 3BIFA 5AJWA 1U7UA 3ROGA 3B78A 2GBLC 4D4LA 4I1VA 3FTCA 1AK1A 3RRZA 4MWCA 2V7GA 1PI3A 4HLNA 2XQVA 1DELA 2XUAA 1XRSB 4ZDWA 3A4LA 1KR5A 1GG2A 4K88A 4EG8A 4HSGA 3F6YA 4FWBA 3CT4A 4QRIA 4ZREA 3LYAA 3AY3A 1VHJA 1ZOLA 2XAAA 1ENYA 4I46A 2NO9A 4TX1A 1PT6A 5JSKA 4F2WA 1KK3A 3WGLA 2GH1A 2ANBA 3KG2A 2BHSA 4A3CG 3TOZA 5CT6A 2HWKA 3H8VA 3C8UA 3ADDA 4DLXA 3F5QA 2N9UA 3DDCA 1K5HA 4J9NA 3ECSA 1XZGA 3CX3A 2DT5A 1P3DA 2P6UA 2Q8NA 3KQKA 4C2TA 3VR4A 1DFIA 2YFQA 4XX0A 1PQPA 4ZAZA 2XA1A 2QJFA 1OYVA 5EWGA 1XEFA 4Z0PA 3REQA 5C44G 5EJ7A 3W5JA 5E4JA 1TO1E 5AVSA 2B1JA 5JEDA 2OYRA 2YKGA 1ORVA 3SOPA 3E05A 1XQVA 1ZUD1 4NZMA 4YBZB 1DEOA 3MBIA 2R84A 5U4QA 4YR9A 4F4UA 3PDHA 1PBTA 3H05A 5F2KA 5CCDA 3TO5A 2GXSA 1GQQA 1AHPA 1J2UA 1QF6A 5JFTA 4FDUA 5E1DA 3NBYB 1KO4A 2QIOA 1HBJA 1EXWA 3CF4G 4YAEA 4ZC8A 2GPBA 2FF5A 3B9BA 2DHDA 1YA4A 1W30A 2Q46A 3M6UA 2C9DA 5E8JA 2LP4Y 1J8DA 1IUKA 4KSCA 4C0KA 2X9GA 1OYWA 3WQRA 2BFOA 3PGA1 1Z8NA 4WE3A 2BEWA 3EK2A 5F9FA 2JBAB 4Z4FA 3EXAA 4NJMB 1XMSA 5FNVF 4MVJA 1KAOA 4PY2A 3WLFA 2O8DA 3EGIA 2GT1A 1U6KA 3R5TA 5F52A 1V45E 4JI1H 2X86A 2UXBB 1TE2A 4CU2A 4R68A 2MMGA 3D3KA 2X76A 4PX9A 1PS0A 1UBHS 1H4SA 4N0QA 4Y2RA 4PNEA 3OM1A 5EJMA 3NJ8A 2R11A 2CNQA 3QEKA 4LHXA 4AMGA 1OAOC 2WUVA 1II8A 1BEEA 4PRKA 1FJHA 4R3NA 2QIPA 4EBEA 2M1XA 3D8BA 5U1PA 4ZI2A 5J4HA 1VM6A 1Y3IA 1M73E 3A36A 3EMDA 3EQ6A 1A8UA 4JI6H 1X9HA 1W49A 1QG0A 4E0BA 5IG2A 2MSCB 1I4DD 2C9YA 4EJFA 2VSFA 3U49A 4O7ZA 4D43A 1SYXB 4C0LA 4RCVA 3SXUB 1TYZA 4B8ZA 3ADCA 3SHFA 1VIVA 3T1QA 1FP6A 4O4IF 1ZOPA 3LC2O 3GJYA 2ETXA 1XNJA 1XALA 1RW4A 5F1OA 3GP3A 1NBEA 4YJ2A 1C9JA 3N2ZB 2X8LA 5FCDA 1P8JA 1XROA 2FZEA 5TF4A 3ORQA 1JFTA 4WJLA 2FV8A 2JGAA 4ZVUA 2HJRA 3MCTA 2VJLA 3PRYA 1V47A 4R71A 3FHOA 4C4XA 1R9NA 1CY2A 3HSYA 3OX3A 4BMVA 4AF7A 3K3PA 5IM4F 2WNIA 5BXQC 3WAKA 1IM5A 3ZUPA 5JAQA 4TSFA 3H9JA 4JV2A 1QH8A 3CLUC 3IQEA 1EDOA 4M0LA 3R9KA 1I3QA 5CG2A 3JYHA 2AUNA 4ZT6A 1OH5A 2ETVA 5C4MA 2V59A 1S6YA 1P0QA 4RHYA 3FOZA 3TSWA 4HP8A 2IIBA 2EDCA 3LQ1A 5DTJA 1N2HA 1O77A 1ISFA 1O6CA 4J9SA 3AB8A 3IDAA 1DIBA 1Z25A 2JRCA 5FTNA 4HNTA 3LULA 1MW9X 2D74A 1NW7A 4UPEA 5DTQA 5FUVA 5B1DA 3TSAA 2WF9A 2GNAA 2WD7A 1MT0A 3ZVNA 5I4KA 4Q4HA 4C6SA 1P4RA 2MSDB 1BHQ1 3AU8A 4MVJI 5KSWB 5E4TA 1HEYA 4MP8A 3GA7A 1EINA 1QXSA 1GKLA 1M34B 3ENVA 2Q7XA 3OFSA 1WF3A 1CVRA 4IJWA 5B3AA 1BXKA 3THOA 4O7YA 1V51A 3AB3A 2REXB 1BX1A 4B73A 1WBJB 5IT4A 4QFDA 3HWRA 3O94A 3ZY6A 3HTXA 3CH5A 3IEPA 5KCZA 2GZ3A 2VPYA