2FB9A

Crystal structure of the apo form of d-alanine: d-alanine ligase (ddl) from thermus caldophilus: a basis for the substrate-induced conformational changes
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
322
structure length
322
Chain Sequence
MEFMRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the apo form of D-alanine: D-alanine ligase (Ddl) from Thermus caldophilus: A basis for the substrate-induced conformational changes
pubmed doi rcsb
molecule keywords D-alanine:D-alanine ligase
molecule tags Ligase
source organism Thermus caldophilus
total genus 87
structure length 322
sequence length 322
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fb9A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fb9A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fb9A01
1KJJA 1I7LA 2R85A 2W71A 3ORRA 2W6NA 4O86A 1JDBB 4O2AF 3V4ZA 4ZOLF 3R5HA 3BSSA 4TV8F 3TQTA 4C5BA 3RV4A 5JH7F 3BFPA 2OLSA 3U9TA 1PX2A 4MV4A 5BMVF 4FU0A 3MWEA 4FFMA 2YRWA 1AUXA 4MV6A 1VKZA 5HBRB 1M0TA 3K5IA 1OBDA 4ZHQF 2FPPB 4EG0A 4O7SA 4O7VA 2W6ZA 5LXTF 4MV3A 3U54A 1KC7A 5C1OA 2W6QA 1DV1A 3Q2OA 4FFRA 4ZQIA 2GQSA 1W96A 5CB4F 5JQWA 2YYAA 4L1KA 4O7NA 1CS0A 5CA1F 4IWXA 4EA9A 4FE2A 2NU6B 2R7KA 2NUAB 1DIKA 4MA0A 4FFLA 3DF7A 4O4HF 4FFNA 3MWDA 3GIDA 1A48A 2Z04A 3U9SA 2FPIB 2W6PA 4O84A 2QK4A 4HR7A 1CE8A 5KKNB 2YZMA 3R5XA 4O7YA 3VPBA 1KJ9A 3N8DA 1M0WA 3R9RA 1JKJB 4I4TF 3I12A 4O81A 4J6EA 2QF7A 5LA6F 5C1PA 1KJIA 4E4TA 1BNCA 3RV3A 1VBHA 4RZQA 3V4SA 2PBZA 2GLTA 2W70A 2GQRA 3KREA 1EYZA 2PN1A 4YAJB 4XYMB 1B6SA 4O83A 5J2TF 4MAMA 2YL2A 4M9CA 2R7MA 1KJQA 4C5AA 2R84A 5EZYF 1A9XA 2FB9A 3JRXA 3TIGA 4XYLB 5CA0F 4HNVA 3BG5A 3BSWA 4IIJF 2FPGB 3KALA 3MJFA 3WO0A 1CQIB 4EGQA 3QFFA 4DIMA 5C8YF 2W6MA 1T36A 3JRWA 4YB8B 5LYJF 2WYOA 3R23A 2CNQA 3VMMA 1IOWA 2XCLA 5JVDF 3K5HA 2V5AA 1SCUB 1C3OA 1BXRA 2I87A 3HBLA 4TUYF 4O7TA 2HGSA 3HO8A 1Z2NX 4WD3A 2DZDA 3VPCA 5JVLA 2I80A 3UFXB 1B6RA 4FGRA 4O7ZA 4EA7A 4O4LF 1ULZA 2YS7A 3NUAA 3BSYA 3ORQA 4M9UA 5LP6F 1JDEA 1OBGA 3OUUA 2CNUA 2CZGA 3SE7A 2NU7B 4O7RA 2SCUB 4C5CA 3U55A 1KJ8A 2DWCA 3ETJA 1AUVA 3KAKA 4O2BF 4EABA 4O4JF 3TW6A 2DIKA 1KUTA 3TINA 4M99A 1VBGA 2YRXA 4MV1A 2YZNA 1CQJB 1EHIA 1GSAA 4MV7A 3AW8A 2YWVA 2VQDA 4FFOA 3JZIA 1EUDB 2DLNA 5CAEB 4MV8A 1IOVA 5K2MA 3ETHA 3WNZA 4MA5A 2VHEA 3K3PA 2R6FA 3R5FA 5GONF 4YAKB 3WO1A 1KBLA 2I8CA 2W6OA 2VPQA 2ZDGA 2NU8B 3LWBA 3RUPA 2R86A 4O82A 1EUCB 4MV9A 1JLLB 2V59A 2C00A 2IP4A 4IZOA 4ZI7F 2XD4A 3E5NA 5LOVF 4ME6A 1EZ1A 3LP8A 5H80A 3G8DA 5J2UF 4YJ3F 1M6VA 4EGJA 2VR1A 4QSHA 2YZLA 5DMXA 1GGOA 3OUZA 3RFCA 2GPSA 3VPDA 2ZDHA 1E4EA 3KAJA 2Z02A 1WR2A 2R7NA 3VOTA 5IYZF 2V58A 4Y8VB 4IHJF 1PK8A 2P0AA 1E4EB 3AX6A 1Z2PX 4GGMX 1DV2A 4I50F 4O4IF 4HNTA 2FP4B 3JZFA 1KEEA 5BPFA 1GSHA 2GPWA 4XZ3B 4DLKA 1C30A 5BPHA 5I47A 2CQYA 3GLKA 4FFPA 3G8CA 4EAAA 2PVPA 1W93A 1GSOA 4WBNF 3Q1KA 2YS6A 4O7LA 1I7NA 3VA7A 1Z2OX 2R87A 1GLVA 1UC9A 2YW2A 2HJWA 2YZGA 4XX0B 4HNUA 4EA8A 2R7LA 2NU9B 2ZDQA 3TIIA 2NPOA 2R82A 5HV6A 2J9GA 4O7WA 1UC8A 4I55F 4YJ2F 3N6RA 4NYEA 4HQ6A 4IWYA 5JQGF 4YBZB 2X0SA 5KX5F 3HB9A 5FNVF 2CNVA 5D8DA 4TV9F 4M98A
chains in the Genus database with same CATH superfamily
1DEKA 1EGHA 1JQJC 1S2OA 1UWKA 3VZCA 1JT9A 5P8WA 1ZGHA 3V4ZA 1DOAA 1GZDA 4WZBE 5K0EA 2VP3A 3PGJA 1CKMA 4GVPA 5JPCA 3KBBA 4FFMA 2IC5A 1OXVA 4R8VA 5HBRB 1Z0UA 3HVHA 2HSDA 1FX0B 3UBMA 3VSBA 1JA1A 4CT4B 5T3UA 1AZWA 4B4DA 3SXPA 4GRAA 3OY2A 4WXMA 1F17A 2GFQA 1X1EA 4FM9A 5JPDA 3LT2A 2NU6B 2N75A 3CEBA 2W9BA 3DMTC 4F4IA 4DR4B 5B7GA 1NN1A 5D01A 4KSYA 5IXSA 1EK5A 4DDKA 1PKEA 4ZXFA 4YQYA 1IXKA 4HATA 1PZFA 1RXWA 5AK6A 1PWXA 3SICE 4ESVA 1R4MA 5JFGA 5EP4A 1M1ZA 4GM1A 4AN0A 5GV8A 1JXAA 2F90A 4A8TA 1HK7A 3QSGA 2AW5A 4JUFA 4NU6A 4RS4A 5KZMB 4QVIA 4UNRA 2OZLB 2EWVA 3C2QA 4D0RA 1Z2EA 3MSXA 3T5KA 3SS8A 4NZNA 4BQNA 1DTEA 4F9TA 2QZJA 3ZUPA 2GJ4A 2BFCB 3WOHA 3KQLA 5AICA 3V4SA 3HLKA 4G1VA 4BB5A 2JW5A 4MLDA 3A6GA 2Y1EA 5K3EA 1RVV1 4MAMA 4L08A 3RVRA 3EFEA 3UT5A 1UDRA 1Y37A 1YVDA 1WSBA 1WCWA 2OFXA 1I2BA 1PIWA 4XGQA 4B84A 4MDFA 4LRQA 4D3DA 3V4FA 4B2LA 4BRZA 4Q4JB 1ZAUA 4W7IA 3WAJA 4CLOA 1CXZA 2VSFA 5MFPA 1UJNA 1VL6A 1S2GA 1QLHA 3HXTA 1ACMA 1RYEA 3QE4A 1XZIA 1IXZA 2B4YA 2JLUA 2QYOA 2BEWB 1Z4KA 1R8JA 3D6JA 4FHZA 1T43A 3DEJA 3QMPA 4X3CA 1T1IA 3L82B 2HWXA 4MUEA 1EJ0A 3WLOA 2AWNA 4KJZA 4X84A 5KYUA 1L5VA 4JOSA 4EGAA 1KZYC 3ACDA 3HYLA 1QP4A 2Q2NA 1B6GA 3BD8A 2FGJA 1NQ5A 1ZA1A 1WCXA 4NBVA 4ER7A 1SRRA 5COQA 2FSFA 3LCVB 3PC6A 3S5UA 1VL0A 1SD2A 4XYBA 3ETHA 1XCJA 2G70A 1W48A 2R6FA 4DLWA 4WKOA 2R00A 4ZEVA 3TVTA 4E1AA 2RHWA 3BMXA 1QYIA 3VR1A 4GBED 2QMUA 3IE1A 3HVRA 1KPHA 4RM3A 3I3SR 4HZIA 4JELA 4AG3A 3GK3A 3F7OA 4CTKA 2V9CA 4IDOA 1TZKA 4S2EA 4NECA 1FNNA 2ZJ5A 3F6CA 1XRLA 4EYKA 2V58A 2R1UA 5A9SB 3ZPXA 5JYEA 1XU7A 3D2BA 2OV3A 1UMBB 3HSKA 1CETA 1AGXA 3SEAA 2GPWA 4YWHA 5DKFA 3B5JA 1U3VA 1ZCAA 4ISCA 3GCWA 4HUTA 2OT3B 1U8AA 3EXHB 3F6YA 4AQ7A 3LL4A 3LAWA 1THGA 4GYWA 1RRKA 1S2IA 4E5MA 4E32A 3OM0A 3H6HA 2P6NA 2BGKA 2XIQA 3PRYA 2I03A 3L8EA 3H83A 2JD1A 3R7DA 3A4MA 1GPLA 4RA9A 3GTLA 2H1IA 5D3KA 3VOSA 3RJ0A 4YCMA 4QT4A 2BHRA 1XSEA 4R6XA 4A2CA 3PPIA 2RHOA 3QWUA 3G79A 4P53A 5AM1A 2MSKA 5J4VA 3OOEA 1RJRA 1T9BA 1W9MA 4AS1A 2J5KA 3MIZA 4N0QA 4PF1A 4UVEA 1E7WA 1E4GT 1TZBA 2HMSA 2O6LA 5JZBA 3FPCA 3N2KA 1XO1A 1QCZA 3FB1A 4OAOA 1EQUA 3TCXB 1OGYA 1NSYA 3R3VA 1UINA 3L1VA 4NK5A 2XI4A 1N57A 1CIVA 1RLMA 3DC2A 3GMSA 1V9PA 3UB4A 1C4WA 4TX1A 4UUAA 3IE0A 1MB3A 1OWLA 2BI4A 1BA3A 2YFKA 2YVAA 3GFPA 1ORIA 1VYHA 2HXYA 2OPBA 3K1AB 4WLOA 1O0CA 5K3WA 5KFQA 1G6HA 4JI0B 1GG9A 1U7XA 3KFVA 3DF7A 4TWRA 3LPCA 2VA2A 4G84A 8ABPA 1H94A 4LS3A 2PT5A 1WXEA 1Z0FA 1NW5A 4JI3H 2XDYA 3G82C 3GBSA 2UYCA 2QK4A 4Y2SA 1S97A 4M6WB 3RNLA 3NUQA 4BV8A 3A6KA 1ID1A 4Z9BA 5ALXA 1K7EB 3ZTYA 3CE9A 3JVIA 4E15A 3KYDA 4FYKA 2PUEA 2XQGA 2IEIA 2DKOA 4MW9A 1FRZA 1TYCA 1Q44A 3LVBA 3VH3A 5K3SA 5I8WA 1Y1PA 1JQ5A 4MGHA 3MLAA 3UXYA 2OFWA 1M1NB 1NFQA 1J1IA 1W8DA 2YIVX 2Q5CA 5C4MA 1E79D 7REQA 4DV4B 2OLKA 4TVSA 3MK31 1EA5A 5DCWA 3SSMA 3UXHA 2FWJA 3KXKA 2QTVA 4KWHA 2NTVA 4DGSA 2Y3IA 2HU7A 4GP7A 2HIVA 4EX7A 1D2EA 4NTZA 3NM4A 2ZIZA 2Q2OA 4EGSA 3OOHA 1R6AA 3OM9A 1HNXB 1MNQA 1SUBA 5BUZA 4B3RH 2X9QA 4Y9DA 3KVNA 1VPVA 4Q39A 4M8IA 4DCCA 1GQRA 5DRTA 1YI0A 4JNKA 2H2FA 5AK0A 4EL0A 5KVSA 1X1TA 2R5FA 4R3WA 1TZ2A 4CYMA 4DLSA 1G8PA 4KDRA 3H40A 4RVDA 3UV6A 5SZKB 4JDPA 1W46A 4F6CA 1AQLA 2XNDD 4XEUA 3ZXUB 3FOAA 4L7QA 5KTSA 1P5FA 1PSZA 1TMYA 2WV9A 1PJ3A 1ZONA 2XGPA 1N8KA 1VBGA 1BGXT 4Z4EA 2D5LA 3Q8RB 1DQYA 2WWTA 3JQQA 3BGWA 4M55A 4PFSA 5CGZA 4GI5A 3RYHB 5KMGA 4JBXA 5AW2A 3W6UA 5ITSA 3CH6A 4DV7H 4WOPA 1B93A 3GLHA 2RH4A 2IYTA 1SQ6A 1PDVA 1PL0A 4W8HA 4BO4A 2QD3A 4YROA 2WHRA 2PRKA 4RL6A 2O5VA 4RVUA 1HDYA 3NV9A 2DKFA 1LTKA 3T7AA 5EJ8A 3PR5B 3WLSA 1B8VA 3RS5A 1EINA 1H4TA 2WJYA 3CR8A 2ZKIA 2VSYA 2HA2A 3DULA 1X86B 2PY6A 1XKQA 1M5RA 1ORHA 3EPIA 4DC9A 1CHNA 3H0CA 4F91B 2W7TA 1VPEA 2D62A 4MP6A 3G2NA 1OT3A 1T6ZA 1Z82A 4U2KA 4ENQA 3Q11A 3NDBB 1H22A 3FPBA 1VE5A 3BWDD 4I81A 2V7VA 5DQHA 5IDQA 3EPKA 1S8AA 1LSJA 4C0BA 4FP9A 2VC2B 4OHVA 2H06A 3QRWA 3DSRA 1BU5A 3UJCA 1KVUA 2CNNA 4P3OA 2GSWA 2QZSA 1YJXA 1UKYA 3DZGA 5L4LA 4HBZA 5HIJA 1FNMA 3TIIA 1KPIA 1E6CA 5KFGA 2CK3D 2J0VA 4O63O 5DHRA 5JCJD 1Y9EA 5LIPA 3KSBC 2FN9A 3ZCTA 1EDZA 2O3RA 1QHYA 4P6VF 2R85A 1I7DA 4HGQA 2R92A 3DF9A 1X3LA 1ETHA 2I3ZA 3FM9A 1WUYA 3R7FA 3EGDB 4IFEA 4KWCA 1B43A 1T5SA 2B2NA 4B4OA 2XB6A 2VZ9A 4K8OA 2X4GA 2NZ8A 3ESAA 2JFQA 2CF6A 2XVAA 4CNQA 5AR1A 1NX6A 5KHLB 3R7WA 3HCFA 3RVNA 3VH4A 3HWSA 4OPMA 2MINA 2CVHA 1KQFA 5DGCA 4G8CA 5CVEA 1E7YA 4AMYA 1XQXA 4XZ3A 4IVQA 3X1WA 1T3LA 1OV6A 1LDNA 4HEQA 2ZYWX 4UD2A 1BCRB 3V33A 4JD5A 5A2QA 1G8FA 4HS4A 4UM7A 3DV2A 4ED0A 4BQFA 1NRWA 1Z15A 1JHPA 2PD3A 2QU7A 3L2PA 4R2WA 1XZJA 4PLGA 3RARA 1HDRA 1E2DA 5JS7A 4BIMA 4M60A 1TYAE 5EIFA 2R6CA 1QU3A 4IM7A 3UQ8A 1RDFA 4U02A 3HGTA 2AOVA 1UXJA 4I4TF 1UDBA 2FSGA 3DXFA 3DFKA 3NDIA 4J1SA 5H9WA 3DMDA 5ESWA 2OQVA 4ZFNA 3KVOA 1I2ZA 2Z30A 3L0OA 3HYNA 4F2GA 4FBGA 4CMEA 2MSNA 4O1MA 4L5IA 2JBAB 3K8YA 4R7ZA 3IPAA 1TW3A 3G89A 1M8PA 5EKXA 3OPVA 5TY0A 1O9HA 3PNOA 2WYWA 2W6JD 2I2DA 1QB7A 3T4XA 3TXAA 2RIPA 3HGQA 4QXOA 2GF0A 3CXUA 1ZZEA 2ZJ0A 1IJFA 4XVHA 2CXQA 1SG6A 3O92A 4QWEA 1EFPA 1SVSA 4Q45A 3S99A 3DE2X 5E2BA 5GADl 4FD2A 4E6NA 1C3OB 5IVDA 2IEZA 4Z0HO 4L9SA 2WSIA 2ZBVA 4HGPA 2ZKLA 4LECA 2CV1A 4JA0A 2ZSFA 3HTXA 1U99A 2HNBA 3V80A 2RHGB 4D6XA 3T4UA 2JZCA 4PO3X 4FJ0A 1ZM2A 3PF8A 1KP9A 2QM7A 1EVJA 2JLWA 5SZIA 3B13B 3BTSA 2PUDA 3KLBA 4MS3A 3H5WA 3E6AA 3MXTA 1L1RA 2KWIA 3CC8A 2XADA 1NI4A 3SOZA 1J20A 5B3JC 5TXGA 4DR6B 4G26A 3TOZA 5F9MA 3NBZB 2UZ4A 4DL5A 1AXRA 3FSRA 5FO1A 1LUAA 3AIKA 1Z3CA 1RHQA 2CYBA 3SYLA 2V0NA 3QQMA 3IN5A 5AI4A 2O2GA 4F50A 2Q0SA 2PYIA 4MPDA 4URHA 4IYJA 4MAAA 1QHGA 1NVGA 1A0OA 3TTXA 2OBLA 3G13A 2WUEA 5I9MA 4QVKA 4CIVA 4GDFA 5FBLB 1QQ6A 2IEDA 3M4XA 1G2WA 5JNSA 1B7GO 4M88A 3PQ6A 1D1PA 1II8A 3H3JA 4G36A 2FHPA 3H75A 3ZKWB 1D2GA 3U4MA 3H6GA 4OLHA 5LD2B 3BCHA 2J4FA 2REQB 2CVOA 4CDNA 1HY3A 4Y9TA 3C3DA 4CM1A 1F2UA 1ODFA 3GEIA 2WIFA 1DHRA 1KORA 2C77A 3RS0A 2C92A 3D8SA 5THXA 1PZGA 2ANBA 2YOFA 3GRRA 3U16A 1KJNA 1LSOA 5JSZB 1M73E 1ZX1A 3VAYA 3FZQA 3ZDXB 2WMYA 3H5RA 2OD2A 3NWJA 3E7XA 3L7OA 1Y89A 3LBAA 4ED9A 4YMTA 3RQIA 1S89A 4EHJA 1JAIA 5C7OO 2GAFA 2UXDH 3OD5A 4IIJB 3TUIC 3NS7A 3H19A 3IDAA 1V35A 3GIWA 2MCFA 3NBFA 4C4YA 3M81A 4N0EA 2XIJA 3INGA 4ND3A 4DDWA 3PW4A 2ECPA 2IA5A 3B5IA 2AVNA 2C9DA 3R9WA 2AOTA 1X8XA 4HDRB 1ZU5A 5DBFA 1E3WA 3KWLA 1Y1WA 5TMDA 4YR0A 3BXFA 1ZMTA 5BYKA 3CNEA 3K6KA 4CUJA 3RSHA 1QO7A 3QVJA 1G5HA 3VISA 2CJYA 2DHQA 2CMKA 1V8FA 4DR7H 1E3DA 3CF6R 3EIQA 3QMWA 4DIDA 2A86A 4J0QA 2JRLA 3IP5A 2JFNA 3F1LA 4C20A 5KFHA 3S2FA 3KG2A 5IWAB 2WTBA 3IP9A 3LX8A 4M76B 2QAJA 2V4ZA 1Q7GA 1VDZA 3VHQA 1GSIA 1CE8B 3R6TA 3MT0A 4YAOA 4DG5A 3WLRA 1ZM4A 2CXRA 1NBOA 2ERCA 2Q46A 3X44A 1J0XO 5K6AA 3TNDA 2EL7A 1J5EB 3NDJA 1TOAA 1UXKA 1DAPA 3I6YA 4TZKA 5H5JA 3WRWA 2W9XA 5GZ3A 4WZZA 5A05A 5DZSA 1N32B 2J0UA 3K6RA 3LX4A 3EAFA 2REOA 5L3VA 1GZSA 3QELA 2OOSA 3VGPA 3DUFB 3FMIA 3IXMA 3KPYA 4KR3A 4BAGA 2Z2JA 4PZYA 3VTZA 2JJYA 3NJ8A 5ALTA 2LE0A 5T41A 5B7NA 5E4TA 2YXPX 1M34B 1ICEA 4FGLA 4E2WA 1RWNA 3QEMB 1SCUB 3I32A 4NZMA 2VZ8A 3WLLA 4D3FA 3RLIA 2PV0A 3IHKA 4JBHA 3TE6A 2XDQA 4QDZA 3S0JA 4XWKA 3WC4A 1HE1C 4B8WA 4RNMA 1Y63A 3OX2A 5BYAA 1HDEA 1QK3A 3QBTA 3OO1A 1N2XA 3OFJA 5KFTA 4NYJQ 3BN3A 3RYIA 4B0PA 3ZR4B 1KUTA 1RU3A 1VA4A 4DCNA 4OQEA 1FS4A 4EUNA 2JNWA 2D54A 2F1RA 1X0VA 4I4TB 5FF9A 4KWIA 4S1WA 5TS3A 4ACAA 1YJAA 2BYTA 2FJPA 3DW3X 2PKWA 1BMFD 5EYPA 1IOVA 1LVGA 2O0HA 4TT3D 1K06A 3OJWA 3DTNA 3GDOA 1R0LA 1SUPA 1X9NA 2ZAGA 3UHOA 5GY7A 4MQFA 2H8GA 1WCV1 5FNZA 4E6PA 4FMPA 4UHKA 1V45E 3ETEA 1QANA 1Y4SA 4M0DA 5EE0A 2X40A 4ZALA 3Q5GA 3QEJA 2MWMA 3PX2A 3LP8A 1MAHA 1EHYA 3ZE7A 3O2QB 4NH4A 3BL6A 5I9BA 5KS8A 4ON9A 1MB4A 4AZ0B 3DE1X 2R4TA 1R6UA 1SVOA 2C3YA 5AUNB 3ISTA 4OB8A 4TM5A 5HK8A 3TSAA 5FOSA 2FW9A 3GJTA 1II0A 2FZEA 3AIIA 4R7RA 1K2VN 4P32A 1U4OA 1XMIA 4B3TH 3FYHA 4HY3A 1E60A 1IM8A 3BXHA 4IDNA 1DHTA 4CQNA 2C2RA 2OYCA 3H2SA 4HF7A 3HZHA 1M2OA 1JIHA 4JEMA 2FGKA 1SBCA 3D8UA 2GSDA 1C9NA 3IP7A 4LNAA 4YR2A 1XQ9A 4HGRA 5K8LA 4LW8A 4MX8A 2BUBA 1VB5A 5YASA 5I01A 2BSQA 2J7KA 2VRCA 1ZQ7A 2QQGA 1M0EA 3OCCA 3G8YA 1WXQA 3GGGA 5DXAA 2R00C 4LSZA 3OQNA 5J1TB 4B7ZA 2D4AA 2J8ZA 3IOEA 4GYKA 3HPQA 5IC5A 3NGLA 2WWWA 1OH6A 2WBLC 1PX2A 5FD8A 3NYWA 1WKCA 3HEAA 3QKSA 2OCIA 2H1VA 1F8GA 4BNWA 3ZQJA 4X61A 4GE3A 3MCAA 4REOA 4L5CA 2EWMA 3L92A 4R40A 5ESRA 5CH8A 3RVKA 2A30A 3FJ1A 2QTMA 1UMDA 3NCTA 4A2PA 2VCYA 1JIKA 4CMFA 3K1TA 2HV8A 3HP7A 5DQIA 1D07A 1YU6A 3UMJA 1RT9A 1K9VF 4HMQA 2ZI3A 3MAJA 4O4HF 4E03A 1NLZA 5KSPA 4D9BA 1LNSA 2CNDA 3D2LA 1L4LA 1CEEA 5C32A 5ENVA 1OA1A 1P2TA 3ROKA 4LZLA 1QS0B 1XTKA 5B4UA 2JEYA 2JGIA 5HRCA 2O8BA 3VPBA 4YPFA 2P6RA 1JYFA 9ATCA 1O6CA 3SYKA 2E48A 3TD9A 4TL8A 4KWEA 1H2WA 1TD9A 3AEQA 3WQBA 2IBSA 4NNPA 3Q0EA 3ESXA 5J4LA 3H1AA 5AW4A 4W7SA 2K5UA 2NYUA 1FUUA 1GOTA 2JIBA 1XMQB 1OZAA 3PN1A 2JFPA 1XBTA 3KTDA 1NVVQ 2DXIA 1WZEA 4EEYA 3BFKA 2CZQA 5D1OB 4KYIB 4V0MA 2YJZA 3PFBA 4HYQA 1V1JA 4I1RA 2Q6VA 3QYPA 2H2HA 4M7OA 4PSVA 2Y0CA 3WNVA 2AH5A 3GH1A 4D6YA 3M70A 2EFGA 3WGQA 3K5HA 2JC3A 2V7EA 3HVIA 1KE2A 3MOSA 1ZVVA 4BHTA 3MGAA 1J21A 3B12A 5AVKA 3NZEA 1DRJA 3WL8A 1TEZA 3DDSA 2EQBA 4B7AA 2PCLA 3HNRA 2UZAA 1H2YA 3SC2A 2B3DA 2BGGA 4AG6A 1GDDA 1RMYA 1XCLA 2R6HA 3UMGA 5FPHA 4Q16A 2BISA 3GAZA 4WKNA 5DLEA 2YZNA 3MWKA 3N42B 3BB4A 1NNLA 4HTFA 2YWVA 3HO6A 2ZM6B 5JRDS 4RJJA 3SQMA 2CF5A 5HQJA 2PGIA 2CBZA 1ZBQA 5EY5B 4M1OA 2PWYA 2VBFA 1X7DA 4DV1H 4CEHA 3UGTA 3ZYCA 1HQYE 2IJGX 4RD1A 5CA0A 3G2QA 2P5YA 2ZYDA 3O2JA 1U9IA 3I2IA 1JTEA 3RR2A 4A8JC 4G5YA 1Y6QA 3ZVRA 2O2IA 3H9QA 3JQPA 1TL7C 3FZYA 421PA 1HYHA 3ER8A 1QV9A 5KFNA 3IVCA 3VZQA 2CDAA 5AVSA 1UXOA 2EJWA 4I9FA 1MRSA 5EWLB 1L4NA 1OUMA 1JDSA 1E4EA 4F4ZA 2I67A 1DEOA 2VHQA 1GZUA 4UOQA 3F4BA 5IKOA 4LI0A 4PNZA 4KFUA 2AGPA 1DWUA 1SCNE 4ZARA 2BTQA 4QDTA 5L4NA 1GP2A 3T1HH 3W5UA 3EK2A 1UJ2A 4BPBA 2C78A 3MR6A 4CCYA 2HF2A 4LWPA 3QVGA 2GM4A 1B0PA 4WBNF 1DAHA 2DQZA 3PCRB 5T6MA 1UZLA 4LDJA 3BQ0A 2QOEA 4JSYA 4Y18A 5IAEA 3E7DA 4JT4A 5AOCA 3TLZA 2G7ZA 3VR6A 2I1QA 2DBRA 3INRA 3B3JA 3UJPA 3RSLA 2ZSJA 3KELA 3N3AC 3AETA 3KR2A 2O0LA 1Q2XA 1X7YB 2P5TB 3AI7A 1SURA 3SMVA 2UVQA 3HCWA 1E4FT 1JFFA 2X22A 5JYCA 3I4NG 1ZWKA 3B7PA 3RFFA 3SZMA 3CB2A 4NBWA 1PV2A 1KMMA 2IYPA 2JFHA 2W2KA 5BNZA 1O94D 3GIJA 5BSKA 1KI4A 3L6BA 1UM9B 3K5IA 5J5AA 4UQLA 5JTUA 3FDJA 2Y1XA 3G2JA 1GXSA 5C8DA 4CXMA 4QOJA 4DMRA 1UZNA 4MI6A 3FWKA 4JB0A 3TSWA 3LY9A 5DYYA 3DAGA 2NUAA 3EMDA 2HLHA 4LHEA 4RUKA 1H1TA 2A92A 2VXBA 2CY0A 5KFMA 3W6PA 1PJAA 3K15A 3IMEA 4ZV4A 3VR4A 4N0PA 4GR9A 1PYDA 3JQAD 1KXJA 3OBIA 1HTBA 4YV1A 1ZGAA 4JKOA 4J3JA 1KYWA 5AI5A 1YAHA 1Z6QA 1V5FA 1L5HA 4PO8A 1M7JA 1K1QA 5ILOA 4NATA 5CX4A 3AMVA 2G4LA 5JNRA 1FCJA 2GHRA 3VO1A 4IHAA 3KPVA 3KQHA 5C1PA 1WXGA 1FDWA 5HZMA 1F4VA 4B3IA 3GHYA 2GEUA 3U3RA 3WGOA 4AM8A 3F8SA 4RK7A 1D7OA 3UKOA 2I0FA 3EZ6A 4PWZA 1B42A 2QSZA 4QOFA 3BK7A 2BP7A 3PG5A 3E9NA 2F1KA 2V7QA 4BMVA 5B3KA 2HJGA 3W78A 2VNJA 2FFAA 4YJHA 2JCGA 4Q9LA 3QI7A 1CQIB 3GNLA 1YH3A 3RIMA 1I50A 4EVIA 3EYWA 2YWJA 3UJ3X 2Y9PB 3QY0A 5ALYA 2IGBA 2IEBA 1M1YE 3BE6A 3W1WA 2HMVA 1P39A 3BH7A 2ZI9A 1MDFA 3NC0C 3EMKA 4NMMA 4PHTA 2L82A 4X1YB 5BQ3A 3QOYA 1X7GA 1JMVA 1XTJA 2VSNA 5FBQB 3HB7A 1Q7CA 3RAQA 2PKQO 5B30A 1RS0A 3HUDA 4JVOA 4O4HB 2GBPA 1UEXC 4LMRA 2VYND 2JIDA 1UNNC 2H5LA 4Q7QA 3HBFA 3HMKA 1OFUX 4ND8A 3WKCA 1NXQA 2II6A 3OU6A 4G24A 2O1SA 4M86A 1H9CA 4BU0A 3MLBA 2ZJBA 4GMFA 3PFNA 3DMHA 1LX6A 2JL1A 4MCJA 2R1ZA 2LVBA 4AN1A 1PT5A 3BRSA 4MUAA 1DRVA 5C7LO 2X2FA 3K3PA 3K92A 2H85A 1OHHD 1YJCA 4TQ9A 2ID9A 2X0DA 1R0WA 2WC1A 1VGRA 4FFBA 3WK6A 3HZRA 2IIPA 1GDTA 4BFCA 3VNNA 4IXWA 2QLJA 2I34A 2VXOA 3BWVA 1BXZA 4L75A 5BMVB 3WSTA 1VRWA 4E3ZA 4R9RA 2IYZA 2VNIA 4DL3A 4B6PA 3GA0A 2HTEA 4MLZA 4TSFD 1XRPA 2AR7A 2Q5EA 2P2SA 2XUJA 1JMYA 3PQ2A 3FKIA 1RBMA 4A8PA 1C0IA 3E58A 4EY8A 3NUGA 4CQJA 3O3MB 4U3JA 2OWOA 2C3PA 2A4MA 5GIPE 5B12A 2QP3A 4F45A 4INJA 3G2OA 1GGNA 1KQ3A 4Q48A 1WR2A 1POXA 3EUFA 3WA6A 5A4AA 3UT0A 4UEQA 4RKEA 3HB5X 4W5NA 1PUIA 3BM5A 2A9KA 3EQ7A 1YUNA 4K6FA 4UTZA 5L1KA 1DO2A 2Q3HA 2ZVPX 2JJMA 4OQYA 1C8VB 4DYDA 1DPGA 1DKQA 1C4XA 2D1SA 4H6XA 1SD5A 3AL3A 4PHGA 4NLGA 1N92A 3WSWA 3HLYA 4E31A 3BE8A 5HWSA 1V2GA 1AQIA 2QYTA 3HU1A 2P4SA 5KNDH 2NM0A 5EKSA 4NENB 1UC8A 3WP0A 5I5XA 4ND4A 1DJNA 5DCUA 2XWJI 3HB9A 3HWX1 3QBVA 2NP6A 4TV9F 4KZKA 1PSWA 1PR3A 1O57A 1NW8A 4ZCQA 3KJZA 3C0KA 4XQ9A 3OTIA 1SBQA 1G63A 3GAAA 2HHFA 5J58A 5J2UA 3WB2A 2XUDA 4KMSA 4MW4A 1YBVA 4H08A 5T5QA 3L6OO 1A7UA 4MUNA 4IOLA 3KXPA 4XRGA 1BVHA 1V1RA 1A98A 2DAPA 4MEBA 4MV3A 1J2YA 4L5YA 2NQTA 3HV2A 4DZTA 3SX4A 1J33A 1YGPA 3KOOA 1WXFA 3GD7A 5K51A 1GR0A 5I8ZA 1ZVMA 1NVDA 3UH0A 2JZOA 3TX2A 1GAJA 3DB1A 3SIPA 2HBQA 4X8OA 2YINC 1WV0A 3QLUA 4KGXA 1M5UA 2ZJ3A 1OROA 4LRXA 4TLBA 1USGA 3FUWA 4RVCA 4GI1A 2GD2A 4GF5A 1EZZA 1UR5A 3HKBB 4C4ZA 5KKNB 3VDNB 3I8SA 1K08A 3DNMA 1IXYA 1DKUA 4LK3A 2OA0A 2ILTA 3ZCRA 4OM8A 1KGDA 3ZE1B 3IQIX 1WBDA 2E21A 5BSWA 1WVGA 3JAMA 3C48A 2GLTA 1D6SA 1XG5A 3JQ9A 4NJMA 3KREA 4PZAA 1CD5A 2I2XB 3EXFB 4EMUA 3QF4A 3DC7A 1MC5A 3QNMA 3S1LA 2E49A 2FK8A 4GX0A 4IRXA 3RIZA 1JQDA 5DGXA 1AH2A 3AJAA 4QW8A 3JCZA 4QFDA 2FPGB 2BUCA 4JGGA 3R5JA 5D5HA 4Q1AA 2CLHB 5IPFA 1VP9A 4KRXA 3R9XA 3UYKA 3HXKA 2J08A 1QRUA 3TKLA 2VHJA 4URYR 1KZ9A 1O97C 4C89A 1N6PA 2DZDA 2B1IA 1J2TA 1YZQA 2OHOA 2XSZD 2HKIA 4QTYA 1NN3A 4RZRA 1GCUA 4LF7H 1R0BA 3EUAA 1JDEA 3NAQA 4EGFA 5BWXA 4NICA 3KEQA 4GC5A 4C5CA 3KB1A 2O8DB 2GR9A 5BVGB 4YRCA 1L7RA 1KJ8A 1JQAA 2XV1A 4F4WA 4N4AA 3URMA 3ULKA 1WKVA 3BILA 3I45A 3QJ5A 3KJIA 4NESA 2DIKA 2JI7A 3X3HA 4UU8A 1YDEA 2ORED 3HB1A 3ZWYA 1CQJB 5KX5A 4UJ5A 3EX7C 4JBIA 9LDBA 4P92A 3I01A 5L3QA 4Q1DA 3BJMA 5K6AC 5IMBA 4B85A 1V3TA 1NU8A 1QWSA 4BMSA 3ITKA 3T9BA 2AXEA 2OGTA 1YGYA 1NHWA 3PGA1 2QYSA 4XDGA 4F86A 1NF3A 1XIVA 1D9ZA 8ADHA 5CHEA 4KUGA 4DL6A 4LXYA 3V4PB 4F3CA 2XMGA 4FYWA 1N7HA 2GPSA 2PKCA 4QUEA 2ZRHA 3KHKA 1EFHA 4IUDS 4ENSA 2BMEA 4KXFB 4ECZA 4J0HA 2OAP1 3AILA 3ZS8A 2X8JA 1Z6ZA 3DFZA 3OOWA 5KNCH 3WLIA 3VI3B 5HCIA 3ZJ5A 5EE9A 3AHHA 4QLAA 4RDXA 2CL7X 3S44A 2VOEA 5KFCA 3KTAA 1IN7A 1KU0A 1G20E 4P54A 4ESHA 3IBYA 1BEEA 5KTTA 5T8KA 1RM0A 2W37A 3D4BA 2EIXA 1N1MA 3QJGA 1CERA 2X0JA 3U44A 2Z1MA 4RWZA 1HURA 2E3JA 1JSCA 3BPSA 1Q11A 2BI8A 1R8QA 2CFOA 3RJTA 5EZQA 2AG0A 2QRHA 1C7JA 2A7XA 5EMNA 1PJRA 4QJIA 1TI7A 2Q5IA 3O47A 4AUKA 1F5NA 4FW9A 1E6WA 3LT1A 1LJUA 4GSLA 3CIFA 4OYHA 3UEOA 2QVZX 4CL3A 4NWIA 1QB8A 1F8YA 1E5XA 1XWFA 4ZXPA 2Z09A 3KKOA 2J0QA 4MIEA 4L4YA 2ACVA 3T06B 1KWKA 1F3LA 5AK3A 1KC1A 4F04A 3FUUA 2VYQA 3PTZA 1TUGA 1LNZA 1FC0A 2G4CA 3ICPA 5KYYA 1WV1A 4C07A 2PFGA 5AJVB 4IMPA 3OQIA 3GRCA 5JMWA 1PR9A 1X9HA 4BNDA 3W8NA 2R0QC 3QJYA 5KT6A 2QTWB 4OJKA 4RSGA 3ZVLA 1VDMA 3AZOA 1NBMD 4LSXA 1KY5A 3KJGA 2CJPA 2O8CA 2IU0A 2Z8YA 1EI9A 4I66A 2LZ0A 1RYRA 2J48A 2VF8A 3R5SA 4PZZA 4W1RA 2NV6A 1OIVA 1HZZA 2WAOA 2ZBGA 3IHWA 1E2EA 5CNMA 1E79A 2J3MA 4LF9H 3ADKA 3HG7A 3E0XA 3B2NA 2Q4DA 1SVLA 5T57A 1Y1TA 3MTDA 4TV9B 4H3SA 1B4DA 5IBPA 3LYHA 4DLRA 3KZMA 4CEJB 4AQYH 1HORA 5C53B 3S7ZA 3LS2A 4OB6A 4YP1A 1GYRA 1WXWA 3BQMB 4HNVA 4YB8A 2F3UA 4ERXA 4H1VA 5HS6A 2CDCA 2YN4A 1AF4A 1EXNA 1NXOA 4B0OA 1UIMA 2DPIA 2FSSA 5DISB 5DNCA 2XNDA 1L5MA 4JBWA 1J70A 2PQMA 4TTJA 3OLXA 1K1EA 3IYLW 3DLPX 3GEHA 3B1JA 2C7RA 3PJRA 3EXEB 4B32A 2X86A 1IN6A 4MQBA 4YCBA 5ADUS 1EHCA 5K4GA 3ORQA 4CMHA 2CNWD 2CHVA 3G5TA 1DIRA 5HF8A 2WTAA 1K27A 2IXDA 1WETA 4GI7A 4LDQA 2G82A 4K81B 4X54A 1SCJA 3L7CA 3AEKA 1OI3A 2ATIA 4RJIA 1PLKA 2H7VA 3OQOA 2JASA 3AHFA 5C8VA 4HX2A 3QKRB 4Q4HA 4HQRA 5DBEX 5L53A 4FILA 3EQ9A 1FF9A 5JUWA 3D6HA 5KFIA 4ZTZB 2ZIEA 4PRYA 2JRCA 1S3IA 4WZBA 4PYMA 4MMYB 5C4IA 4RE6A 4EO4A 4CL0A 1Z38A 1E3JA 3HFRA 1FS5A 1ECFA 1QMGA 1NF9A 2AHOA 2R9VA 4E7PA 2J6SA 1Z7BA 1KQGA 3RUDA 4EGJA 3CCCA 4RESA 4E09A 1YV9A 2IOFA 3W0LB 5HJ7A 1HXHA 5E4FA 2BFWA 4LC9A 2VG8A 1OC2A 1I13A 3GVCA 4YR9A 1DEAA 2SKDA 1QHSA 2HXGA 3A25A 4MQ5A 4MR8A 4IZ6A 4A4DA 1O4WA 2OHGA 5HR5A 5LQSA 3WHPA 4AZTA 4BC0A 3GWZA 1HT3A 4KIUA 2YHAA 5DGDA 2NN3C 3F1KA 3DVAB 5EA2A 5CM8B 4DVJA 5JCJA 5K8TA 1JDUA 2DCMA 3FLEA 4FIZA 5C5EA 3ILVA 3IVMA 3NOOA 1UBEA 5H68A 5J2TA 1ODSA 1IUKA 4PC6A 3KDAA 3T12A 5EJ6A 1LF5A 1Q14A 5EJFA 4P0PB 3AUSA 3ETDA 3IB6A 1BO6A 2O2HA 3JWGA 4RQTA 2J32A 2J9XB 4DT1B 2X0IA 4X95A 5GTDA 2WB2A 3VUFA 4A7PA 3LWZA 4RY2A 1U9IC 1VHWA 3OT5A 3A6PC 4Q12A 5LQCA 4G65A 2MYNA 3D4PA 4WXHA 3NETA 2I78A 3OEYA 2HADA 4UPVA 5EDWA 3KKPA 1LLUA 4DLAA 4MW1A 4G4SP 2CNLA 3CCFA 1C1DA 3PGMA 4I5FA 4MO9A 2BC9A 1E9FA 4OJTA 1ZC4A 4IRCA 5KT4A 3ZEIA 4OQMA 4II3A 2VDOB 1YRWA 1GQYA 2HXSA 1FZTA 3WNBA 2W9BB 4WZ6A 3KXLA 1U81A 2XGJA 3KEMA 4JP1A 3E8MA 3FXAA 2O3SA 3ZU2A 3TWOA 1SBZA 3DMFA 1BZYA 4JVSB 1KETA 1FFDA 4Z9AA 1PS0A 4ABTA 1PEYA 4R1PA 3FDFA 1UQRA 3G7UA 2BHNA 4X44A 4J9KA 1T8SA 2GTPA 3AV3A 1KR2A 2TECE 4Q93A 1QV7A 3FCCA 1PEDA 4H0FA 4UCRA 3EZGA 1TNDA 5BRNA 1EYZA 5LKRA 1RI5A 5AW1A 2HSJA 4ZO4A 1HEIA 4V0KA 2R84A 4OQXA 4YJ3A 1GPMA 3KTOA 5LNK6 3ZE2B 3IELA 3IPXA 4ESOA 2CLCX 8LDHA 4IIJF 4IG4A 1Z18A 5F5NA 1GL6A 2WHQA 3RGZA 2Q8QA 1SNYA 2GZAA 1MVOA 2VQEH 4FZJA 1VOTA 5TC4A 3FZGA 2QNRA 3EE6A 2C2MA 1ENPA 3JASB 4EG7A 5C35A 2FG6C 2VPZA 3B9RA 5T4FA 1I5RA 2V7PA 4B3DA 3ENWA 4YLGA 3ZVKA 2WM2A 2QXYA 4DAAA 4CN9A 1SGWA 4TWJA 2SCUB 2NZUG 2E87A 1J56A 4LDZA 1DC7A 3VKHA 3BK1A 3GJXC 5KC8A 5BXYA 2YY7A 3ZH2A 3M4YA 3A7DA 1AUQA 2VF7A 3C6QA 3FSEA 3WQSB 2QORA 3DAFA 3R7BA 1Z0IA 1Y1VA 1GCGA 4EA6A 5H4HA 3H86A 4QJBA 3R75A 5K7SA 3OURA 4XYMA 1UBTS 1JHUA 3DXXA 4KAJA 4HOYA 4GWGA 1VECA 2JBHA 5KJ1A 5FA5A 2NTJA 2UU9H 1JEQA 3HKZE 5EHNA 1H6DA 1O0SA 3LH5A 2J6UA 4O3FA 1UK7A 3U3XA 2ZBEA 1ATZA 3CURA 2A67A 1U5CA 3SD7A 1KI6B 1R5BA 3JU3A 3EWIA 4R2XA 2OORA 3IQDB 1CJUC 3TGWA 2TMDA 3WNQA 4DG9A 4NZOA 2FZWA 2PWZA 2H0RA 3RC7A 4LH6A 3MJHA 2V74B 3U7QA 2B83A 2KHZA 5JISA 1IMOA 4CM6A 4PG4A 4FYPA 2D1RA 3U3JA 4BWSC 1E89A 4KXVA 1V16A 3TAXA 4QOSA 3JZFA 4AJJA 5FAXA 1GY8A 3NONA 4D46A 3K2QA 3VR2D 2ZEJA 5KYXA 1OB5A 2WE7A 3ZNQA 1AD2A 4IS3A 2V7WA 1FNSA 4ESEA 2O07A 3LDHA 1W87A 4N3CA 1F9AA 5AKKA 3OJLA 3KVYA 3AF0A 2QL9A 4K9MA 4CU5A 3KJFA 4Q1FA 4Z1OA 4NI5A 1JBQA 4M37A 3IA7A 2QMEA 1HT2E 4GYYA 4B2PA 5ICFA 4GRIA 4BAUA 3GL9A 2PUCA 3JYOA 5LU8A 2NO9A 4LWOA 3NFYA 1GTG1 4IIUA 4LCJA 3ZQUA 4KLAA 5C8YA 2AE1A 4G67A 3VJKA 1QGZA 4ECQA 4ES6A 2WNHA 4ZREA 2GDZA 1XTBA 2PX5A 3HPRA 1HETA 3B51X 1XVLA 2P62A 4CKEB 2POCA 1D4FA 2B63G 3B85A 3MMXA 3Q12A 2ZATA 2FQ1A 5A5EA 4ZVSA 4D0GA 4DIFA 2V0CA 2FEWB 4ZV7A 2HJSA 2WD9A 1VG0B 1PNOA 2H1LA 2FSUA 4I1YA 3PEVA 4UTPA 1PNQA 3JSLA 5JC1A 4J9LA 3TBKA 4IDAA 1P2FA 3SSOA 3ZDRA 1SB8A 4PSAA 5JNWA 3T5JA 3TRIA 5JDCA 5EWFA 2WB1E 3CX8A 2VNHA 1NVUQ 4LQ4A 2I33A 1ADJA 1I1LA 5GP1A 2WIBA 1NR5A 1FRFS 4FB4A 2JHGA 5HTOA 4O7YA 2WF9A 2HA6A 2HRCA 3QU4A 3N2IA 3AZPA 4IP0A 1F12A 3KYDB 5AQEA 4I9UA 4D41A 4ZP1A 3ADCA 2IXEA 4JLKA 3WMRA 4I4IA 3CA8A 2CDNA 2VDRB 1E1DA 1IHXA 1CYEA 2E4XA 4EOGA 4AJ4A 1Y6RA 1ZGGA 4UXJA 1ZCFA 1IBMH 2AZXA 4EFKA 2VHWA 4R81A 2ZJ1A 3C39A 4LJ5A 4KSCA 1IIRA 3O4IA 5IKEA 1K8QA 4D0LB 1NXPA 2Y71A 4A8JB 1IUPA 2QTVB 2WB4A 4MVXA 3UGKA 4XOUA 5A7HA 1Q74A 4YQFA 5IK2A 4NZYA 4GLJA 1CDDA 1C8LA 5FV4A 4N9WA 1ZHOA 1ZRSA 3U7FB 4OJYA 1ZLYA 4LZPA 4B2YA 4IBOA 1BRMA 5LB2A 3OKAA 4BMNA 2DM6A 2PX8A 2V1UA 1EUQA 1OPXA 1UFQA 5F9FA 2IW1A 3IKLA 1SVMA 4WNAA 2PUJA 3QVTA 3QHQA 4XA8A 3L7DA 3QLUC 3ETJA 4F38A 1OCEA 2IE8A 1BE0A 1BEZA 1W6UA 4PLWA 1DINA 1QAOA 4O3PA 1LWNA 3MAGA 5HIMA 4IGAA 1VSVA 4S3MA 2HBYA 4MV7A 3AW8A 1ADYA 3ZW9A 3L49A 2QTNA 3HKZA 1LJLA 3L8ZA 1Q22A 1BH2A 4I6GA 5ICGA 3ZOZA 3ZWBA 1KBOA 2DR0A 1EXWA 1WUHS 5CK5A 1WJGA 4UASA 2QRKA 4Q4LA 2HSZA 3IIIA 3GLHB 3OZCA 3CFYA 3VUEA 1LB1B 1GLGA 1SUAA 3FCAA 5KFAA 1RI4A 3PUKA 3U3OA 1S7CA 4HB0A 3N53A 2O14A 1FS6A 2I2BA 1LFDB 1FY2A 3BABA 3UICA 4C1NA 5IVIA 1L7AA 3BF7A 1CR4A 1AQUA 2YWRA 1PT8A 2A14A 4YUVA 4F7WA 5IVPA 2GRAA 1YZGA 2AMFA 3SZUA 3M4JA 1EMDA 2G77B 4R98A 4RFVA 2R93A 3T94A 3I83A 3PC3A 2PQ2A 4MVJH 3GLFE 1K5PA 2QZPA 1RVDA 1QIDA 3AF1A 4TXNA 1GUDA 4QD3A 3KKQA 2CW5A 5IKPA 1OFHA 3RF7A 5BOVA 2VDNB 1T3HA 2IRWA 3A1EA 4MQEB 3AFMA 1JHDA 4KAAA 5DASA 4Y1RB 2XODA 4BGUA 3BA6A 3VPAA 1CJMA 1L5QA 2ZS9A 3HLTA 5K05A 4A73A 1TFUA 5FOUA 2MSCB 1Z35A 2XMBA 5D87A 4BN0A 2HQBA 1QE5A 2V6GA 1IMJA 3RJ9A 2IK8A 1PR4A 3FNHA 1AX9A 3P97A 2SNIE 2XTAA 3S40A 4WASA 2W0MA 1QR6A 3GV8B 3R7WB 2UVPA 3NC0B 1T6NA 1CJKC 1N78A 3MJCA 3I1FA 4N12A 3PQDA 5AKYA 3FUXA 1RI3A 2WB1A 1N0WA 4NYMR 4BMPB 3H4TA 1D5WA 4JI2H 2LGJA 4O2BA 2JGLA 4FFLA 5CCXA 2CKZB 2AZMA 2HLDD 4UXHA 1WVMA 1FMTA 5KG7A 1U7DA 5FORA 3LDFA 1NXXA 4KITB 1U8ZA 4ZDIA 2XXAB 4F9EA 1CUZA 1HFWA 3A9TA 4YRDA 1M8FA 3THWB 4Y6RA 1H5NA 4A16A 2OBNA 4K0KH 3IIKA 3DWFA 1XAJA 4U6QA 1ST3A 1PUJA 4M1MA 3I9LA 1IWPB 3CUSA 3CISA 4B48A 3FN4A 1P45A 1O7JA 5GJCA 5LQNA 1GTL1 1GD1O 4J43A 3NXSA 5CFRA 1JXMA 4BZZA 1GAEO 1X7ZA 2EX1A 2G09A 3LKZA 1RJGA 2FEXA 4O83A 2FPXA 4LGYA 2PU5A 1ZDMA 1JWAB 3JQ7B 2JD2A 4GPEA 2B92A 2BE9A 4R84A 4RE5A 1CRQA 2QUKA 3W7VA 3Q7RA 4MXDA 1BMTA 1OZFA 3I34X 4CJXA 4TXMA 2ZRIA 2IHZA 5KTOA 1FZQA 2B8WA 3PUZA 3LTNC 2IA6A 4U7PB 3CF0A 4WE3A 3EZ9A 1DNPA 1GRQA 4MVJG 3VR3A 1EFPB 2QTCA 1RXVA 5BSVA 1DBWA 3QX3A 1SA0A 2OBXA 5TT0A 4LSWA 1BWSA 1IY0A 2F9FA 2OO7A 1UBFA 2Q1XA 4RM2A 1MOPA 4ZVQA 4JLWA 3B6ZA 4L50A 3V8BA 1YVUA 2YC4C 4BQSA 4I3FA 4ZQCB 2L17A 4KLNA 3RREA 4M99A 4MRVA 3CN7A 4RSMA 4I55A 4JBGA 2G9UA 1IN5A 3PLAE 4MS3B 3RADC 5L45A 2MSDB 3CLVA 3RVBA 3ANMA 4M4SA 1HZZC 5FUMA 1U7PA 3WNZA 3P71T 3BGVA 3SC4A 1NV8A 4YUZA 3ZC3A 1TRKA 4R9UC 4H4CA 4RV4A 1QJCA 1Z7WA 1EJ6A 5HRAA 4DJ5X 3RNOA 3X1DA 2V59A 1KMNA 3Q88A 5KNDD 3PHJA 4QNMA 5J3JA 4DIBA 4RC9A 4UMDA 4BQQA 1KYYA 2YH2A 4X8MA 2BQRA 3DDHA 4N39A 4J16A 5CYFA 3VFDA 1ZIDA 1AKEA 1QVZA 3RR5A 3U3DA 1EVIA 3W9SA 3VNRA 2J6CA 5FLYA 3ZCUA 1X1BA 2NXCA 3GLFA 3CEMA 4YJFB 2PZFA 2E4YA 3AHJA 1XNQH 4L28A 4BX8A 2EFHB 2X77A 5A5FA 4ZVPA 2V8OA 1II8B 1I6LA 3CF4G 4EL5A 2XKKA 5BSMA 4PC3A 1MN6A 1W85A 3LUJA 2IY7A 4UFOA 4ZT6A 2QTFA 3RPEA 4L16A 3RUFA 1P6QA 2ZZKA 3VU1A 3RFTA 3R5KA 4RNOA 1PVVA 3BX1A 3SXJA 3PHIA 1PTKA 1OJLA 1OH7A 3VH1A 1BHO1 4BYGA 3TD6A 1EBBA 1EVYA 2FSVA 3V8EA 1MHTA 3LF1A 4R8UA 4KK4A 3DOIA 3OZXA 4HDQB 2WA2A 3WVNA 3RROA 3FIUA 3LBHA 2YKGA 1C0PA 5AM5A 1JIIA 5ALPA 3D64A 4PZ0A 2PIAA 4M9SA 5CDSA 2IW3A 2MYUA 5AK5A 2V0GA 1CR1A 3LP5A 5BMVF 3DTFA 5A4DA 5FQOA 3JARA 5JROA 3BRWD 2P8SA 1JVNA 2Y05A 4MGIR 2QLMA 4XCQA 2A8YA 1PYGA 5AOBA 5EMKA 1ZFNA 3V4LA 1P72A 3F71A 3PFCA 3FRIA 1OTYA 3L9XA 2PX3A 3KWFA 4X85A 2P9CA 1T2AA 2DUJA 1I4LD 2OCDA 4JT8A 3PW7A 1RJ9A 1LTQA 4TRRA 4D8XA 1JH8A 8AT1A 4IAJA 1LLQA 3ZK8A 3REGA 2EP8A 3AFGA 4FEGA 1P75A 3ZCVA 4EVQA 5AJUA 1LF0A 1S2MA 4QTTB 5D5QA 3PVCA 3D8TA 4JYAB 4P22A 3C5EA 2GK3A 3OTOH 1VJRA 1Z2AA 2P2GA 3AYXB 2VNAA 3S68A 3WYBA 3R9RA 2BMDA 2VA9A 3F96A 2KI5A 1CUGA 2PR7A 2BGLA 1KY4A 5AH0A 2QSYA 4MR9A 3NHFA 4UTOA 1ZJWA 1R9JA 1MEEA 2LKDA 5IT0A 3DKIA 3LKBA 2H17A 4XVQA 3EVFA 3HABA 4JLOA 1ULBA 5CA0F 3OICA 4A3LG 5AVUA 1IN4A 4IVRA 4A3IG 1K66A 3QELB 3TDNA 4Y0VA 1I14A 3AR7A 1EVLA 1P0QA 3BMQB 3UGJA 3LFUA 3C4VA 4B35A 3TRFA 1VMDA 4EK9A 4X65H 4CF7A 2VYNA 3VRHA 1N2SA 4AUEA 3D7RA 4BN5A 1MP0A 1FTYA 2XB9A 4AI6A 3IPCA 4IGIA 2BGNA 5IBCA 3N5CA 3KQTA 1HLFA 4F84A 1SPBS 4GLWA 2XDQB 1M33A 1NDHA 3BIWA 4WZAE 3K5PA 1IY9A 5C7YA 4FLFA 4JLAA 4NXMB 3C3CA 1RJWA 1BKSB 4P35A 1T2DA 2RB5A 4HJRA 1K5DA 4RFLA 3RYIB 5FQNA 4UBKA 1O75A 4ZAGA 2PKEA 5I7HA 5C5IA 1HYEA 3PTAA 4FDAA 3GYBA 2YNMA 3M3PA 1C0KA 4DV3B 5KNCD 2A5JA 3PQFA 4EHIA 2AFIE 3AWDA 5DYIA 1FVOA 1IJEA 4ER3A 3EIXA 4IJMA 1E77A 4U5XA 2JAHA 4NSNA 2ALZA 3OIYA 3I73A 821PA 1YQEA 1NXVA 1V26A 3CZMA 4BVLA 3EVDA 3QKUA 1K7XB 1VBFA 2FFJA 2RHBA 1Z7EA 2LP4Y 4PLZA 4D4IA 4QPNA 4DQ0A 2GN1A 1A3CA 4LXGA 1NLYA 3EIWA 1VZ3A 1XPOA 4NAVA 4H7DA 4GSKA 4RD6A 6ADHA 3DCYA 3W77A 3PT5A 1EM8B 4B31A 2IIVA 5JAOA 1L5SA 1ODKA 4UFPA 1G7SA 2XCOA 5THKA 3BGIA 3KL4A 1QQTA 1KHHA 2W5UA 5ADVA 4C2BA 4IDCA 5E38A 4CWAA 1Q1GA 5K0BA 2RH8A 1HLGA 3D7LA 4QOIA 3VPSA 2BQ3A 10MHA 4IJWA 3THRA 3C6XA 1MGPA 3NATA 2CSUA 1W88A 1MMFB 4RS3A 4BVBA 1CK4A 3GFBA 2HRQA 2W6CX 2EGHA 1H85A 2VHUA 2XUAA 4I3HA 5AVRA 4M0JA 1P1CA 1J9ZA 7AT1A 4TKMA 1JPUA 5D8DA 1CY0A 2IP1A 3VR0A 1H66A 5JE8A 3T5BA 1QFSA 3BMOA 1ODJA 4S1PA 3V8MA 3DMRA 1BYUA 1U3UA 3OESA 4C5BA 5HGJA 2R4QA 5CR5A 2BWJA 2VDLB 3VHRA 2FZCA 2AMJA 4LVNA 2VDPB 3L5OA 2VBCA 5LMUB 4F8JA 4GSYA 2VT6A 2X2OA 2GYWA 1G66A 4D43A 5TPZA 4OK3A 4R8KA 1CR6A 1L5OA 2OWDA 5IG2A 2JFUA 4TKUA 2FPSA 3NYIA 2B9EA 4GOJA 4BFYA 2WKPA 3T1YH 2N47A 1NBME 2OH2A 3P96A 1QHFA 2GBLA 1N48A 2PZ8A 1HGXA 3IIMA 1X1DA 4K9DA 2B8EA 2WJJA 3HKCA 1IEXA 3COWA 1A9PA 4RIHA 1N36B 2XQFA 4B3SH 5DNWA 2RC6A 5CVTA 2I22A 1ENOA 5G3ZA 3MW8A 1VPTA 2GPYA 3I12A 4RHTA 2PPLA 5I60A 2WDTA 2V54A 3BSFA 4N5IX 4CDMA 4V0OA 1SEIA 5B1EA 1JSZA 1VM6A 5DCLA 3ROEA 2AUMA 1S3SA 2Y4OA 4PR3A 4YRGA 4A5SA 4W5HA 2EW2A 1TGVA 2HCFA 4UUGA 1FVIA 1Q15A 3QV1A 2R7AA 4CMEC 1GG2A 1QP0A 4CW7A 1QORA 2HUNA 2V7UA 3HXLA 1OILA 3PICA 3N2LA 2HSWA 2VJDA 1MA0A 1E1KA 3FFAA 4HK4A 4LE2A 1ZL0A 3BHNA 2A9VA 1BAPA 3TCKA 5E6UB 4ROSA 5K0TA 1TTHA 1H0KA 1CQZA 2B4KA 3LG2A 4RUAA 4PIVA 1WZ2A 1C0LA 2NUBA 2PLAA 4FQ5A 3TF5A 3JZMA 4AF6A 3NYRA 3SC2B 2I7VA 4G3IA 2B9VA 2GNPA 1T4MA 2HPVA 5EXEA 4FPXA 2B30A 1U0OC 4F4UA 5D7BA 2AFRA 1QQAA 3RUHA 4ZMSA 4P08A 4X20A 1FL9A 1W25A 3V00A 1OBFO 4IDBA 5KVVA 3SGIA 1F3OA 1NP3A 4P7JA 5EQDA 3ZU3A 1N33B 4DMCA 2PYZA 4L6AA 5BUCA 1CUXA 2OECA 4C6TB 3K9WA 2H5IA 4G01B 2A58A 5DYGA 2ZS7A 1RZ3A 1ZAYA 4LGCA 2P2LA 4ALMA 4KQJA 4OP3A 1Z0JA 3UC5A 3CQZA 3QHAA 5B1IA 1TFRA 1XT6A 2VK4A 3WBFA 2DFLA 1U5BA 1L4KA 2W7OA 4IZOA 4ED2A 5CA0B 3IOBA 4FC7A 3LY8A 2VZLA 1DI0A 1GUYA 3CG4A 4YYZA 2HWUA 5J2UF 2HDNB 3CMCO 3N0WA 3D3QA 4M8NE 4M8KA 4D74A 2DJIA 2WKSA 2QN9A 2WD7B 3RS7A 5KOHA 1P16A 2ZXEA 4AJEA 2I6UA 3EG9B 4WLUA 3ZWWA 2XOKD 1VPLA 4IJ6A 4W1QA 1E4EB 4A6PA 5KJ6A 1AXEA 4NLLA 3WIOA 2WM9B 1FYEA 2J5QA 2OKCA 2D0PB 2PVSA 2EL9A 4I1IA 4OJQA 5A6SA 5M04A 4FNGA 3EEQA 2XYRA 3OTWA 3PZBA 2F3PA 3UMFA 4ZGBA 3QIVA 1S1CA 3AJ9A 1JBKA 1DIGA 2OHJA 3WP1B 3VU0A 3LSTA 3DZ8A 5C1DA 3MYYA 4P7FA 3QVGB 3OUTA 1EXMA 1DBRA 5KKCA 3IB3A 4DAEA 2E4UA 2C2BA 4XWGA 3V46A 4EYGA 3K8ZA 5J4KA 4BO3A 3V34A 2PZMA 5BYBA 4ZYUA 1UAAA 3A28A 2Y0PA 3RJ5A 4ZYZA 5KQRA 1HEYA 2I66A 5SY9A 2YMQA 4E5KA 2W2XA 4HDMA 3TFQA 3HBMA 2X4DA 3L7NA 1JFFB 5ALEA 1VI5A 3RSSA 2JAXA 3TNYA 3FDZB 2EJBA 4LHYA 2W98A 1L8XA 2Q5OA 1M1YA 5JV5A 4GMGA 5AYVA 3OZUA 3GEGA 4JP3A 1XHEA 4O7SA 1FTWA 3UMRA 3AY0A 4RV5A 3SQNA 1E58A 1TJ5A 3LI2A 3KE9A 4BMXA 1GXSB 4Z4GA 1RKXA 3ZD8A 4LFBH 4IJKA 4ZZ0A 4A3BG 2F8LA 2XUPA 3RASA 2NUAB 1G2QA 4CTJA 5C9ZA 3F49S 1PD1A 3ZWAA 4IGEA 1X0XA 5CH5A 3L7BA 4JUIA 2V5VA 3U26A 2LDXA 3C7AA 1H23A 1I1KA 3VC1A 3NEAA 1M2WA 4KO1S 3ZXIA 3ZGVA 1MT3A 2NVYA 1YU9A 1KJ9A 5KFVA 5CLIA 3MFIA 2PK3A 5ULLA 3ERCA 2A35A 1Z25A 2WFMA 4QT0A 1SBIA 1WEKA 3LXRA 4WOCA 2JF0A 5BN1A 621PA 4DIKA 3KUDA 1GO2A 2QT1A 3GEBA 4D4LA 4AMBA 3UMBA 1NL3A 1N3YA 2BBOA 4PCLA 4YJHB 2YMLA 4C21A 4ZZ1A 5CT9A 4XASA 1J8YF 1JG6A 5CFLA 2UYQA 1JJIA 1L7XA 3RFXA 2E1RA 4JBNA 4Q9NA 1P5JA 4JI1B 4Q4CA 1T15A 2D7JA 4NDNE 4XW2A 1M8GA 5JR3A 2IE0A 2CNUA 2J5XA 3K0EA 2IWHA 1VJTA 2AZDA 4UOZA 3OOJA 1NQXA 3G6YA 3OZVA 2JI9A 4FBMA 3N7AA 5LP1A 1KEEB 4EABA 2BVNA 3TXYA 3WHLA 1QHIA 1K9SA 2IZZA 3UZOA 2J3LA 2H63A 3T3DA 4A0SA 2MSEB 2Q0XA 5KDOA 4DKXA 2XZOA 5KVQA 3REOA 1DBQA 1NSFA 4D4HA 4YRZA 2ID4A 1WH2A 4E13A 1YNOA 4KSBA 1Y9ZA 3VYTB 3QV2A 2IP2A 2XUHA 4MCAA 2ZIUB 4UE6A 3PBKA 1TEVA 1U6KA 2B2XA 1H4VB 1JSXA 3L0DA 4INZA 4Z3KA 4PFQA 5A2QW 4FFBB 3Q8XB 4G89A 1G60A 2VRBA 1Y7IA 1KA9H 1W5TA 3E5NA 4AP5A 1RWOA 2OD7A 1FYWA 4E7OA 1OBVA 1YJBA 3C3BA 1Y4AE 1YOBA 2EKBA 2VDWB 4ZVOA 2XRZA 3P45A 3VOBA 2VR1A 1JX6A 4W6ZA 3IDSA 4L7VA 4PCUA 3I39X 4U3JB 1GM5A 3GUZA 1VL8A 1P7VA 3PDIA 2XNKA 3GTJA 4X41A 1IHOA 4NR0A 4J6FA 1TJ3A 1AO3A 3IAUA 1JE0A 3UG6A 5IH3A 1ZBDA 1US8A 2PG3A 4EPVA 3FRHA 2IUSA 2AQKA 1GSHA 5A71A 1ISPA 1RBYA 2NQ8A 2K2WA 3H99A 5HEKA 1IU9A 1SK9A 5CIQA 2P1ZA 2YQ5A 2EZTA 1CKOA 4NJOA 1E7SA 3LT5A 1IVNA 1XMSA 3IXLA 3OQJA 4TL6A 3HEMA 4YGYA 4J1QA 2PVCA 3H84A 3OLVA 1P6UA 5AW9A 4U63A 4I46A 2JDID 5CXSA 3WOVA 3DLIA 1Z5VA 2AJLI 5E6SA 4YHBA 4DR2H 2J5RA 4QUDA 3JYHA 1VHDA 3B70A 4BNXA 2FQQA 3RAPR 5FL7D 1KTAA 3GT3A 3ZLBA 1OXMA 3OMXA 1NBWB 1SKMA 1FRNA 1NR7A 4MUIA 4X90A 3TTYA 3BQ9A 4KDEA 4ZJZA 1M2KA 3NT2A 4H7JA 5J2UB 4QGAA 2XX3A 4OMCA 4EHBA 4ZN6A 4XGIA 1ECGA 1PR0A 2P40A 5GINE 3NGDA 3CTMA 3SK0A 1K3UB 1HI9A 4J16C 1CY2A 3SPXA 5FXMA 3ZIUA 3C1OA 1FPQA 1DV1A 1O54A 2H2WA 1EP1B 4MQLA 5FH9A 2BR5A 2BSXA 5AVWA 1B73A 2FN7A 3LGAA 2B4RO 5IYCG 1NF8A 1O89A 3WX0A 2ONKA 5I7WA 3ELWA 1A48A 3SEQA 3DR3A 4B3XA 2NT4A 2RIRA 2XCSB 1XK7A 1RMTA 1Z6GA 3F4LA 4B6SA 3GG9A 3OOSA 1K0FA 3NH6A 4H7IA 3WLKX 4R1LA 2NZJA 1AGNA 1MU0A 2P4HX 3PLNA 3KFLA 4YRQA 2Z3VA 2HWWA 1WS6A 4KEAA 4RZXA 5G4LA 5EPEA 4GNRA 4PINA 2FLPA 3GLIE 3KTMA 4KQ2A 2NO1A 3GGSA 1M2NA 4ZT3A 4JX8A 2FSVC 3LOUA 4E5UA 4DIOA 2R7ZG 4IX9A 4NJMB 4R2KA 3D6AA 4BNMA 3DEZA 5HFAA 3QF4B 4HYEA 2CLMB 3U5TA 1AKVA 1S4MA 3MF4A 4MROA 4LF4H 1JAZA 4GWKA 3AUYA 1GQ2A 1IBRA 2EATA 3T7SA 1GTZA 1R2QA 3RC2A 2VH1A 1VBKA 1YVRA 3ECCA 4BO0A 4ECVA 4C3OB 1TQDA 3ENVA 2M1XA 1E0SA 4PM4A 5BT8A 3R9XB 1OZHA 2VQFB 4FCVA 5C0OE 5K3DA 1Z2NX 1SHLA 4BMZA 4GBMA 1SHTX 2Z2KA 3ZWQA 1T0UA 5G0WA 2OZKA 2EZ9A 3TUJC 1B6RA 1G20A 4S1OA 1ULTA 3SI8A 4D97A 1NQVA 2HW8A 5F23A 4PHCA 3JQ8B 2PMFA 2EFJA 1MFPA 4EG6A 3K3VA 9GPBA 3TW6A 4KAFA 3TINA 4BNFA 2CK3A 4X6UA 3JZ6A 1DIHA 4GUAA 1E9VA 1FX1A 1HUQA 3NALA 4FFOA 2R8YA 1E3MA 1N2EA 1H2BA 3W34A 2X5KO 1N9GA 4MVJD 4CM9D 3AO0B 3QG1A 4EPXA 5AKLA 1RPTA 1J06A 4R9SA 4IL5A 3I1YA 4AIIA 4RV9A 3DT9A 3J80A 4QAJA 2R8KA 3CVVA 1WQ4A 4A3CG 5I9TA 3K4PA 2YUTA 3RSGA 2JFGA 4L27A 4ZK6A 1P18A 2J1LA 1LY1A 3LZ6A 1U0TA 4KE6A 3MM4A 4EUEA 2O3QA 2FSHA 5JAUA 3VR2A 1S6YA 3PGKA 5CB6A 2ODQA 2EBHX 4CR8A 4L9WA 1W4ZA 3VKUA 5JZVA 4JYMA 4P84A 3SF0A 3CVOA 5LWQA 3FF1A 4NU5A 2J9RA 3JWIA 1GZ4A 3QXJA 2DBYA 3WGUA 3ONEA 3MR3A 1TECE 3AKZA 1G3MA 2OZEA 2Q5QA 3OF3A 1R4MB 5DI9A 3A11A 3NRJA 3T3OA 5JJKA 2BMWA 2CJWA 1MO4A 2PX6A 4HXGA 2YJ3A 2ODWA 3LZCA 2YNMC 121PA 3IEXA 3I23A 3IS3A 3A4TA 4LRYA 2D7DA 2DHRA 2UUAH 1B1AA 5KWJA 4G1EB 2JLYA 1S1MA 2W6JA 1W1WA 2ZWAA 5BV8A 3QSYA 2ZCJA 2F62A 3GJYA 1WAMA 4ALKA 4PANA 1X14A 3UT5B 2OP1A 1ONOA 4S35A 3E22A 4D9FA 4AF7A 3PC2A 1GV0A 1BXKA 1LRJA 5AJTA 4ZTBA 3P2KA 1PJ2A 2AQ4A 4CRWB 4R1TA 4G0YA 4G5FA 3A26A 4BO9A 1PJZA 4MDEA 5KYYB 1H9BA 3TG8A 1X1SA 3ROFA 4CLOB 4KXWA 5IVKA 1KK0A 3WNCA 3Q1LA 1EM6A 3OQIB 3F3SA 4ZU1X 4U2FA 1TVEA 1JFRA 2JFFA 4L4ZA 4BNDB 1SUSA 4JR0A 3H20A 3EDCA 1OFGA 4ZCLA 3HA2A 2O8CB 3JPYA 5IASA 1IUOA 4N5MA 1CQPA 3GLIA 3FZEA 5KYUB 5GONA 3I0NA 1OXKB 3ZJ4A 1TF5A 2R6GA 1NTOA 3D43A 3SP1A 2QA5A 4HBGA 2WNIA 1L9KA 1GQFA 1Z16A 3T5CA 4HSEA 3NANA 4E5VA 1J8FA 1QE3A 3OIDA 3E1KA 3E9QA 4B46A 2VJMA 4RTPA 2GVDC 2X2EA 1PWEA 4KLZA 3ABOB 2J6IA 1XZGA 3HUTA 2NAPA 3PDCA 2OD9A 4XWWA 1N25A 4N5LA 2JGAA 2I54A 2DTDA 3FPKA 4BVFA 3CLUD 3RAEC 3E9CA 1W47A 3TLEA 4CKYA 1N75A 4YB8B 3HS3A 5IJAA 2K2QB 3W06A 3N58A 1Z9BA 4L07A 3DZKA 3VBEA 3C7CB 5H3HA 3TIVA 1HDOA 4BWYA 1JVSA 4NOLA 3LDAA 3T52A 2KS6A 3AF4A 2PLRA 1A4UA 4FYJA 1TC2A 1GHTA 2C7OA 4L3OA 1QTNA 4MJ3A 3RVSA 3BE4A 3KSDO 4L9RA 2C5GA 3E48A 3AB8A 4LFAH 4B6OA 2FPMA 2J45A 5CT8A 5BR8H 2AEFA 4O8ZA 4HWKA 4JX9A 1UK6A 1YZTA 3AEKB 3DZDA 1N34B 2Z9DA 1FFEA 1J1ZA 4GOMD 1WXIA 3VPFA 1G9TA 4CE6A 4Q4HB 1DIOB 4F5ZA 1SWWA 1KZ1A 3UN1A 1XZQA 2HDOA 1IYDA 2I2AA 4MUKA 1L5YA 4RA9B 4II2A 2FW7A 3V3TA 1TQ2A 2C5BA 5DTJA 3F5MA 3HZZA 4TV8A 2YJ5A 2VTDA 2YUIA 5B36A 1XVAA 4EJ0A 5JW6A 4MV9A 3U2QA 2F17A 1MOSA 4WZBB 4RNCA 4PPNA 3R20A 5FP0A 3RODA 1DTSA 2B61A 4AN4A 1ZVQA 3JQGA 2XD4A 4ILKA 4DZRA 1D09A 5DV9A 3UCEA 1JLKA 3HDVA 4MTLA 2ZGIA 2OCXA 1XYGA 4M38A 5IH7A 3N2KB 1DDIA 2C29D 4JI5H 5EFOA 3SNOA 2F3QA 1DAFA 2ZBRA 3UFXA 1NLMA 4EKGA 5I7EA 4G1MB 2CSXA 3N0RA 1I8TA 4MW6A 4AZVA 5JWOA 2Z9CA 2OXRA 1ODTC 1UUFA 1S2NA 1HC7A 3ETLA 4MR8B 3WDSA 2JFBA 4IHQA 3KQKA 1OVMA 3DAPA 2JEZA 3PPWA 4JZKA 4MRSA 1SQSA 4QARA 3DOJA 2YTZA 4WBXC 4PS0A 1TYZA 3CWQA 2W4QA 3DWIA 4KPUA 2ZDQA 2NPOA 3CR7A 4P93A 3HL0A 3CZAA 1GGEA 1JIVA 4CV1A 4K86A 3M2TA 4JLDA 4HNQA 3LSYA 1LU9A 3TLMA 2QRUA 2O2JA 3HJAA 3OIVA 1GPDG 4D98A 2L18A 2O9JA 1TPYA 4LGVA 2XT9A 2HDKA 3WIDA 2IHBA 7REQB 2D00A 2IYNA 1EFCA 3UYYA 2PM8A 3VC3A 3J7AK 5ITZA 5LIRA 3A6DA 3P0RA 3WKBA 4A2BA 5AKZA 2NYVA 2ET6A 3NAGA 1C8BA 3ABZA 3FVRA 1GQSA 4I9NA 4NBKA 2HLDA 1KO1A 1HOTA 1W1IA 4JVMA 2Q3MA 1BOOA 1W36D 8ATCA 1UM8A 3AG6A 3U56A 3FETA 1GPKA 4IGKA 2E6KA 4UM5A 1ECPA 1O0BA 4UHDA 5FR1A 2IKSA 5JBQA 4JV5H 3Q87B 3K6SA 1JDJA 2UZ1A 3AKDA 2ZW9A 1WCMA 1SHZA 4YRIA 1GA4A 2C61A 4CG1A 4F0JA 4Y0NA 2IYEA 1BMFA 2DPGA 3AU9A 1VE1A 4TT3A 4E2ZA 1M0WA 4JENA 4UM9B 1EFRD 3RRBA 1Z28A 2QT9A 1QIMA 3TNFA 3W7BA 2HRZA 3L46A 5KMGB 3ZW7A 4ZI7A 3HB4X 3IJ5A 1Z5PA 5NULA 4AD8A 1NUPA 3EVEA 3PFKA 3I42A 3DLBA 1EWTA 3ZXXA 2PKRA 4OBXA 4H3VA 2GFIA 5K01A 2MMCA 3JQ9C 3KOMA 3JV7A 4HGNA 3QE9Y 4JJZA 3UATA 1E2FA 1I4DD 4WN9A 3R2JA 4OY3A 3T4PA 2ZUSA 1HR0H 4TZ6A 2LWIA 4CV3A 4G1BA 1IOWA 1OMOA 3ZNNA 3KQQA 3L4JA 1Y4ZA 3G6KA 4DBLE 4LBWA 4D1YA 3VPCA 1N9KA 2XDWA 1PTJA 4DQNA 3PO3G 1E2QA 2C5SA 4EA7A 2BONA 3O83A 3BSYA 4KKXB 4A36A 1HNWH 1SEVA 4GD3Q 3X1YA 3TIXB 2ZS8A 3CU5A 2UUPA 2QV0A 3UHAA 5AHXA 4X64H 5CVDA 3I37X 3PNMA 2JA6G 4EO7A 3TTWA 4RK6A 1KZHA 4B09A 4Q5IA 1T13A 3F4KA 2ZT6A 3KVRA 4WESA 2CNKA 4ZHSA 3TEMA 1EESA 4IIEA 1P7YA 2VBGA 4RD2A 1P0PA 4CLHA 2FMFA 4EB0A 4X45A 2MIIA 3GF4A 4TQUS 2HTFA 4IVPA 3GCZA 4Z2AA 3NG1A 4YDRA 4X66B 3QMMA 3HU3A 4R0MA 5CLLA 2VT7A 4QBGB 3BE5A 4MRMA 2GBFA 2PXHA 3EGXA 2WTNA 4G4JA 3LWBA 1XC7A 1L4MA 2BM1A 3C8MA 1XP8A 1A8IA 2X3YA 1YCFA 3KSAC 1JEQB 1WPXA 3VPXA 5AOAA 5KFPA 4R8MA 3L8GA 2HK8A 5ES3A 1OBCA 1STOA 3SGLA 2ASVA 1UKBA 3HXQA 1T9GS 2VJPA 3H5AA 3C98A 3U61B 3MFQA 5H80A 1D1SA 5AIAA 4FCTA 1OQAA 2PEZA 4RJKA 2GD0A 4NDAA 2YZLA 4YRJA 4TYWA 3B1ZA 2JLRA 3BWXA 2YFQA 1JN0A 3NDPA 1OLOA 3M82A 1FXWA 2FCAA 3AGPA 4H0NA 5JPIA 1Q2UA 2MINB 1V7QA 4JYBA 5A9RA 2RHJA 1SB9A 2FG7C 1C5KA 3BCUA 4JXZA 4EAQA 3E1GA 3K30A 3KEOA 2QRPA 4QATA 4XZ3B 3U39A 3GFSA 3HCEA 1POWA 5EE3A 1ZHHA 5KYXB 4LFCB 4C6HA 4ZAZA 1FFBA 3U4AA 2FZKA 1QIGA 3E2MA 5T8KC 1Y3BE 4PU0A 1IHYA 4MB0A 5HIIA 4MUHA 3B5EA 4O7WA 2J09A 5EL0A 3UK1A 2X5OA 2A6PA 3GZTB 4JLMA 1RCFA 3D1JA 1H93A 3FY4A 2X0SA 1F0PA 3MXOA 5BT9A 4Q66C 2CVZA 3SMQA 2ZAMA 3GN2A 5DHQA 2I9KA 5LFAA 4LXIA 2A5LA 5HF9A 5SV2A 1K2WA 3JYPA 2FNAA 4Q24A 5H83A 2WYVA 3BRWA 1FUEA 4EYOA 2PT7A 3CX4A 5C8YB 1W5SA 1S8OA 4FXPA 1ORTA 4LY3A 2XD9A 3BFPA 1JZQA 4DDTA 3QWHA 4OHUA 1S10A 4Q1BA 3PSHA 3SI7A 1L2TA 2Z6VA 2XLBA 4JA2A 2PKYX 1I1NA 5J40A 2PAAA 3PHLA 2IH4A 1Q91A 3JALA 5A4FS 2GESA 4X3PA 2R48A 2C5HA 3EVBA 5LUAA 1ZIXA 4RQBA 1KI9A 4YCAA 4Q8EA 4WJLA 2FK2A 2WIAA 2X5NA 2O7RA 1YRYE 1FW8A 4BBSG 1A27A 4UHHA 2FZ4A 5ICMA 3B6EA 3GZJA 2W0SA 1E8MA 1ZI8A 4J4BA 2ZPAA 3NAMA 1C1YA 3K9CA 3MSCA 4N03A 4GKAA 1NT4A 2ODPA 1C9YA 3UOAB 4D4MA 3PXUA 1ZHSA 4LZWA 3KJNA 1ONBA 3W4KA 1DQNA 2B7CA 1U8FO 3CPEA 2P30A 3A31A 1NI4B 5BV0A 1G6OA 4W5JA 3GUUA 4CLXA 3T5HA 5DM60 1ZESA 4F06A 2HFJA 3LFTA 4JOBA 3L0BA 5F33A 2DF8A 1CZRA 5AXBA 3PR1A 3O8CA 1TMGE 5BN3A 3IAEA 4KIJA 4PGGA 3OU7A 3R23A 4LJ4A 2O19A 4GI2A 4ZTUB 3DO5A 3SYNA 5K4AA 1ZUHA 1R66A 2KPOA 4XD7D 1F9EA 2I80A 1YAJA 2RKOA 3Q10A 1QRAA 1F7UA 3UJNA 4GHWA 4K2HA 1VLVA 2VCHA 1CVLA 1BVRA 1XTZA 1ZCJA 2ZYUX 3VZPA 4K9NA 2IODA 1E62A 4LJRA 4YIKA 5KNCA 2DWQA 5HE9A 4L78A 1F06A 2YRXA 1K1SA 4HNRA 2PR2A 1UT8A 4HX5A 1NXTA 1F2UB 4Y3UA 1ISSA 4Y30A 5I48A 2ACEA 2YWCA 4NNJA 2VKTA 1HL3A 5K03A 2A2ZA 2WKRA 3P9YA 3R8XA 1M83A 4TZ0A 1FMLA 3EGIA 3BYZA 1GL7A 3TL3A 3DAOA 3I5XA 1G4UR 1DC3A 5GQSA 5BNIA 4AS3A 5FI3A 1IEWA 1NGSA 3ENQA 3LRPA 1DIAA 1MB0A 2RK3A 4LVOA 2JCXA 3TZLA 2IX9A 4IUCS 4U2DA 4EUHA 1O94A 3R76A 1V2HE 1ZK2A 3WLHA 3QVLA 4JR2A 4RF3A 4RBNA 4KRYA 1NPDA 1CVIA 4PZ7A 5HX7A 4F3YA 2WABA 2DY0A 1YR7A 1I0IA 4RPGA 2IDZA 4MUGA 3C7DB 4NYIR 4LHXA 5CRIA 2MT9A 3HGMA 1F5SA 5FBHA 5C18A 1IQ0A 3MC1A 2HD4A 1WVIA 2AOTB 2YFHA 1PAUA 1IUNA 2ECFA 2IS1A 3ZWMA 1E3WB 3C70A 2FJZA 3ND5A 3OJFA 3JQAA 2DT5A 3EUWA 4RTQA 1I0LA 3U4HA 3DBLA 1J2UA 1A5ZA 3UMYA 4AJ2A 5B1DA 1GPNA 1G4AE 1QC5A 4P7KA 2QG9A 3IAM6 4PYKA 1QVWA 4K0RA 5EQTA 4C2MA 1CRLA 2P6UA 1E1LA 5KO2A 4Z86A 1F20A 2QDXA 4JAVC 4XB6B 1URPA 2LW7A 4PRZA 1WUJS 5FUYA 1G5PA 3A4VA 1WZIA 1USWA 4ZJYA 4KPEC 2HK7A 4HQ6A 4BCCA 1M6HA 3RHSA 2CKMA 4DLLA 5TMPA 2ZBDA 3LQYA 4D8TA 2CMHA 1NPTO 5IC6A 1MAVA 3PIIA 1YDGA 1ZEMA 4DV2B 5KJEA 4DDUA 1R6XA 3U48A 4EW2A 1PNRA 2J0UB 1DIBA 1J8VA 4FJ1A 2NVWA 3B3GA 4LC0A 2IXFA 4N6NA 1ZM9A 1WKBA 2JLBA 5DNVA 1TCUA 4EB8A 3R3WA 1C3VA 4PTZA 4AUMA 3SNHA 1GQOA 4UW9A 2P2CA 2ALJA 1Y7LA 4QO8A 2TS1A 3B38A 2VATA 4ZOEA 4EJFA 1Y3FE 4BATA 1X7WA 1N8TA 1G8JA 2VYCA 2CB0A 1SUFA 3QX9A 2XEXA 3PE4A 2FQWA 4K9PA 3KXIA 3RTXA 3LW7A 4LN1A 5JDIA 4KBFA 3ZN2A 5HNKA 2MOKA 4DSNA 1ISGA 1IEVA 4QKQA 2O0MA 3QBEA 3CINA 3L40A 3A4LA 1NJ6A 5JBIA 1IY1A 4LE0A 3EGEA 3NJ4A 4ZIRA 2DTEA 3B6JA 3OCWA 1E1MA 1EFAA 4AJIA 4HAUA 5DG8A 2JVIA 3RW9A 5CNKA 2VIIA 1OHHA 3ODGA 2ZBQA 2ZIVB 2NLOA 3GG2A 5FWXA 2H18A 3ZZUA 4DTCA 3QE0A 4G4IA 4J7XA 5K8UA 3RO7A 3LHKA 4FBLA 5EYPB 4MUMA 3EEFA 1X7ZB 4IRDA 1KQPA 4TSFA 1CUVA 3VNAA 2EYQA 4MQFB 4ZCIA 1V25A 4FGUA 4QUHA 2G72A 2G0NA 2GN2A 1RQGA 2IPNA 3K1ZA 2B5VA 3PL1A 3VZDA 1N2IA 2O20A 2VHTA 2VPPA 3WWIA 1ACLA 1GA1A 3O8OA 2NSHA 4KYTA 4Q18A 2FR8A 3CSSA 1G8SA 5EXSA 3R24A 4RJTA 2J4DA 2OCBA 2EVWX 3KZKA 1M6YA 3A32A 3KD2A 3DLHA 4TRJA 3MEQA 1QK5A 4ZT7A 3ZCXA 4LYAA 1T9AA 1GO3E 1ZS9A 2M05A 3UJDA 4LSAA 2H57A 4OHWA 3OA2A 4OKIA 2W2TA 4I55B 1EG2A 4QOEA 4TWZA 3IEMA 1TWCA 3PUIA 4MHTA 3HUUA 1M2OB 2IIBA 5AW0A 3DL2A 3A2MA 4RIGA 2YWFA 1XVIA 4C04A 5CPBA 4YIHA 1XXLA 3O6VA 3TNJA 1O3YA 5AXCA 3CEPB 1RABA 1HL7A 3N7UA 4EZEA 1ZQ9A 3O2SB 2H29A 5C80A 4KQ6A 3IKJA 4L76A 3IALA 3BICA 2FEOA 2M98A 1H8HD 2EQAA 3ED5A 4X24A 2O1WA 3RFCA 2QP4A 5BP7A 1Z45A 1TU4A 3QKSB 2OORC 4K6OA 2G9ZA 2R7NA 4CCSA 3IUMA 5EJMA 1UMDB 5G1OA 3FNGA 4ED3A 4KN9S 2AS0A 1XZBA 2JJ1D 3KKLA 4Z51A 5DDIP 4B4VA 1BRTA 1ABBA 3R3ZA 1I3NA 4ND5A 2CLSA 4ENTA 4DV5H 2ZJYA 2HIGA 3M9MB 2C2HA 1C9MA 4QDKA 4YJDA 1XDZA 4RFSA 4L2IA 4YI5A 3RF6A 2P77A 1GAWA 2Q8NA 3V1YA 4UCTA 1XYVA 5C5CA 4RULA 1ZISA 4QE3A 4YBZA 2O8BB 2O0KA 2Q4BA 1KDPA 3EWSA 5FOXA 4CTNA 1I4OA 3AWIA 4QBKA 1ZGJA 1ZOLA 5CXQA 1GNTA 4PFJA 3J7TA 2QGFA 4WBSA 5CLFA 2CCKA 3BFVA 3AEQB 4R8UB 1TA8A 4HDCA 4DLVA 1Y98A 1XAHA 3TQRA 1PJSA 1D2RA 3DKPA <