2FBHA

The crystal structure of transcriptional regulator pa3341
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
YFGTLLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARHRDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILANLENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of transcriptional regulator PA3341
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
molecule keywords transcriptional regulator PA3341
total genus 49
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbhA00
1J75A 2H94A 2DAOA 2A3SA 2RN7A 3KLOA 2KIUA 3Q5FA 3V7SA 3KP4A 2LKPA 3T0YA 4UVAA 3RTRA 2E7WA 3GZ5A 3P9KA 4YIFA 1P6RA 2O03A 4RAZA 1Z1DA 1ZGAA 2HTSA 2XUBA 3KFWX 4P55A 4I0BA 3GFJA 3JSPA 5E17F 2FBHA 2V6CA 2M87A 4N9HA 1U5TB 3ZPLA 4HF0A 5CYVA 3LAPA 1V4RA 3WTSC 3L7WA 1BBYA 1TNSA 1MDMB 1P4XA 4HLYA 2MLKA 3CDHA 3GEZA 1HSJA 3K1NA 3IWFA 4DQ2A 3VB2A 2E1CA 2XIGA 5LEJA 2L4AA 2MD5A 1BC8C 2IA2A 3BPXA 4R1HA 2CGPA 1JXSA 4P96A 5FFZA 4HX7A 2ZJ2A 2EFWA 2PEXA 4WK8F 4XSZF 3BROA 4LK1F 3R60A 1R00A 3QPHA 1FWZA 2OAZA 4ZYGA 2Z99A 1TQIA 2JSCA 4EV0A 2DW4A 1HKTA 2QM3A 1O3RA 4S04A 2EV0A 2Y48A 4CHUA 3WG9A 3HHGA 2D1VA 3H3ZA 2D2WA 5CJ9A 2O6GE 2Y75A 4CO8A 1EH8A 5FD5A 2YR2A 2PMUA 2UWMA 1F1ZA 2XAGA 3CTAA 3G73A 1BIAA 3HOTA 2ZFWA 4O3MA 5K5OA 3F8MA 2LNBA 2VBXA 2MH9A 3E6DA 1R7JA 1U8RA 3WTWC 4UVCA 1YYVA 2O61A 4RGSA 1XD7A 1KU3A 2VBWA 4HQEA 4LJZF 1VTNC 3QRFF 3GF2A 4GCVA 5HOOA 3G3ZA 3GLXA 5FLXK 3HYIA 1SFXA 4MTEA 4NB5A 1SD4A 3HUGA 3KP7A 4BQAA 1HW5A 2PLYA 1TW2A 5BPIA 2UZKA 4EJTA 3F3XA 3OV8A 2CQKA 1E17A 2GA1A 4OMYA 3EQLF 3TOBA 1W7PB 2GXBA 4IXAA 4AWXB 2UXXA 3WGIA 2L4MA 2IJLA 1OMIA 2F5CA 2A69F 5A2QZ 3F22A 1MKMA 2PJPA 4HYEA 1KU7A 3T5XA 5DCFA 3HTUA 1G4DA 2HDCA 2R3SA 4RGRA 3LA7A 2FBIA 1FBSA 3MAJA 4RB3C 4RB1A 4BHCA 4D0PA 1YW9A 3F21A 3FWEA 4HBLA 2JT1A 3ZQ7A 4HX4A 1USSA 1ZARA 1JHFA 3GXOA 2DTRA 4MQVA 4RGXA 4A5NA 4BHBA 2IA1A 5FO5A 1FLIA 2QQBA 2JPCA 1T38A 1PP8F 3TDZC 2OA4A 4G7HF 4ZZLA 2K27A 4H0EA 4WWCA 1AOYA 2RQPA 3F6VA 2VBYA 4JBAA 2FU4A 1TQMA 1PDNC 3O3KA 2DPUA 2MC3A 1WWXA 2HQNA 1WI9A 1YTYA 1O57A 2MLGA 2XAHA 4HV6A 2DO7A 4MGRA 1LDDA 3MZHA 4ZYDA 2HKXA 2FRHA 1Y0UA 2Y0MA 1MGTA 2PN6A 3HSEA 3RJPA 2V1UA 3MEXA 3TDUC 4MNUA 1USTA 4G8XA 3ZMSA 1XDSA 5L3CA 2W85A 3R6SA 4ENNA 3HSRA 3WTVC 3VODA 2D45A 1LEAA 2STWA 1HSTA 1SFUA 1UFMA 1BI2A 2NNNA 1FSEA 4XRFA 2IA0A 4M6XA 1KU9A 1ZRFA 2MA3A 2YSRA 2H09A 2WC2A 3HRMA 1P92A 2A68F 5LGNA 3WE3A 1G3YA 1DPUA 1D8JA 2HGCA 1FSHA 2ZKZA 1IN5A 1PUEE 2YX7A 5BMZA 3NEUA 1FOKA 4P9FA 1P4WA 1OYWA 4LMYA 2Z3YA 1IN7A 3M1EA 1O7FA 4E70A 2L54A 2XVCA 1IZ1A 2P5LC 3DPLC 1UHWA 1L3LA 2V9VA 1MJ9A 5LRRA 1XMAA 3SFZA 3C3WA 4LLNA 1LNWA 1K6OA 2J5PA 5DCMA 3CJNA 3GFLA 2FNAA 5DUKA 3HOSA 1REPC 3WE2A 4L18B 1Z9CA 3C7JA 1ODDA 1R23A 5LHIA 2FBKA 5ILSA 4M71A 3GUDA 3JW4A 3C18A 1OKRA 2CYYA 2YPRA 1TQPA 2VOPA 3H92A 4L0YB 5HDNA 1J2XA 2QENA 3WGGA 4AIHA 1R1TA 2O3FA 3RKYA 1R5GA 3K2ZA 1B1BA 2GXGA 2G9WA 5EEGA 2D1HA 1MDMA 3KP5A 3SXYA 4P9UA 3P9IA 4I01A 3K9TA 1ZHFA 2QQAA 3BDDA 1W7PA 4HA8A 3WTUC 4GGGA 2IVMA 3KEQA 5F6FA 1KQ8A 4TV7A 5DD8A 1RIOH 1LEBA 5TJJA 3J7AO 1DUXC 4G9YA 1RUOA 3BP8A 4EGYA 2KIMA 3I71A 4M74A 4O6JA 1T6SA 1IXRC 2QZ8A 3I54A 5CLSA 1MZBA 4IHTA 4IJAA 1B9MA 1BIBA 2P4WA 2E1NA 5D6FA 4B09A 1WKMA 2MBFA 4UUVA 4ZYHA 1UCRA 1U2WA 5FGMA 2DI3A 3RI4A 4Q4ZF 4LB6B 2K86A 3HRSA 2BV6A 2IW5A 3V7CA 3ZMVA 4IVNA 3WU1B 4U0WA 1ZN2A 3J80Z 3KP3A 4WF2A 4IRGA 1HQCA 3ECOA 4O5VA 2P6TA 1YFHA 2P6SA 2TDXA 4WX9A 1XGNA 1YG2A 3HRTA 2LSOA 3E6CC 5L3EA 1QBJA 4G7OF 1F5TA 3LSTA 4I09A 4LGWA 2DBBA 1C0WA 2WTEA 5F64A 2M30A 5D5WB 1S29A 1BM9A 1K78B 1SMTA 1HW2A 1Z91A 2ZNYA 4UXNA 2G7HA 2CWEA 3M8EA 5LHHA 4K2EA 3BZ6A 3CUQC 1FC3A 2KKOA 4LK0F 3ZN1A 3E5UA 3FF5A 3WU0A 1KYZA 2L02A 2QQ9A 1G3SA 5ICCA 3I59A 2W24A 3T8RA 1GHCA 1QNTA 1IW7F 1HKQA 2COMA 4Y15A 2QLZA 2XV4S 3KZYA 1D8KA 2VT3A 3MWMA 4M9XA 4ZYEA 4L5IA 4KICA 5ICGA 4KUMA 5IT3A 1YO5C 2LF7A 5J6XA 4KNYA 4NQWA 4EJUA 1B4AA 3GWZA 2K4BA 1G3TA 4HLXA 5BPDA 1TBXA 2NNYA 3ML6A 3V8JA 1ZLKA 3WTTC 1XGOA 2F2EA 4EM2A 3J80K 3F8FA 1QZZA 1XN7A 3K69A 1SMYF 1GVJA 1ZAOA 3KE2A 4HF2A 1KGSA 1QQIA 3DV8A 3IKTA 2DQLA 5CVUA 2O8XA 3LQQA 1RUNA 1QGPA 1FYLA 4FT8A 4BXUA 1DP7P 1S7OA 4AD9A 5D5XB 2FEZA 3BOQA 2ISZA 5K5QA 2HQRA 5CVRA 2K4JA 4L9VA 3T8TA 1XSXA 1H9TA 2R7DA 3VEPA 2OQRA 4G6DA 1V3FA 3QU6A 1T39A 1R5HA 1W5SA 1UB9A 3LFKA 1JE8A 5FD6A 4MQ9F 5L3FA 1MJAA 1LVAA 5JFRA 4G6QA 2M5WA 4EJWA 2P7CB 2VN2A 3SHFA 5LRSA 2HWVA 3IRQA 1X3UA 4NHJA 5D5UB 2HYFA 4OMZA 3BWGA 1YW8A 2RVCA 3GZ6A 1QPMA 4WXCA 2X4HA 4BH9A 2Q8KA 3FZVA 2JZYA 1XCBA 1W5TA 1SD7A 1L0OC 4IF4A 4RB2C 1W4MA 1R1VA 1SAXA 5HDKA 2F5FA 3JAMZ 1KQ0A 3M8FA 1BI3A 5IT9K 4I7HA 1FP2A 3H3UA 3RPUA 2BGCA 1BI0A 3D5LA 2IPQX 3L09A 4R8HA 1S3JA 1CF7B 1ZH5A 1T98A 1S8NA 3BJ6A 3KZZA 2ISYA 5IT9Z 2DFIA 5DCMB 5D4SA 2ESHA 4OIQF 1FPQA 3LAJA 1FBQA 3JAMK 2HR3A 3CO7C 3GVAA 2HEOA 5E18F 3CUQB 4GYGA 3QP6A 4FX4A 4UVBA 1U78A 3BJOA 1Z05A 4ESJA 4HX8A 3FMSA 5K5RA 4YFKF 2XRNA 2P5KA 3FMRA 2Q0OA 2EV5A 1F4KA 5HVQC 2BBYA 3N4MA 3SQNA 4RB0A 2O0YA 1R58A 2EWNA 4WXHA 5AONA 5J8FA 2RKHA 3K1MA 5HLHA 3DXJF 1O3SA 1IXSB 2RV8A 2OZUA 4AIJA 4GO1A 5DV5A 4PDKA 5ERIA 4M6YA 1EH7A 5ILUA 5A2QK 3KP6A 4U0VA 1CF7A 5E1ZB 3C1DA 3MCZA 4U7DA 3E97A 1BC7C 3ZMTA 4L9NA 4HOBA 3E5QA 5KVRA 2VXZA 3U1DA 1XGMA 3PQJA 3I0TA 3MQ0A 5FB2A 2VBZA 2XKOA 1FBUA 2F5EA 2XGXA 3RYPA 1R22A 4EJVA 4UHTA 1OYIA 2JRTA 3TGNA 4XLNF 5FLXZ 4U7BA 1P2FA 1ZG5A 1YS6A 4HV5A 1O7LA 1FY7A 5D8KB 2XROA 2IP2A 3I53A 3LA2A 3IWZA 3IC7A 3N97A 3KP2A 1T2KA 1BI1A 3E6MA 3SZPA 1KQ9A 3HHHA 5CVJA 5LGTA 4LD5A 2EK5A 3F8BA 1SD5A 2H27A 3EYYA 5F1RA 1R1UA 3BJAA 4Y17A 1WSUA 2M45A 3IKVA 3CUQA 2EJRA 2XAFA 4YIIA 3HIFA 1ZG1A 4JK1X 2A5YB 6PAXA 4KA4A 3FXRA 3L2CA 4XBFA 1K79A 2W57A 2FSWA 3EDPA 2QYOA 5HLGA 2GAUA 2ZMEA 1LDKB 2LF8A 2YU3A 1A04A 2H6BA 2RNJA 1IXCA 3F23A 2NRAC 4LLGF 4I0AA 5E8GA 3RKWA 4ENJA 2ZO4A 3NRVA 2FE3A 4I98B 4CZZA 5L3GA 3Q9VA 1XGSA 2EA2A 4ENKA 1H0MA 2DPDA 3SZTA 3T1BA 1G3WA 1FP1D 1KU2A 2STTA 1T0FA 2GA2A 2ZXJA 2DT5A 3F8NA 3MZYA 3IRRA 4I02A 5EEHA 4OIRF 3U9GA 1RI7A 2ELHA 2ETHA 2PG4A 2OZ6A 2P7VB 3DFGA 4B8XA 3FM5A 4DNCA 2HS5A 1EH6A 3GFIA 3TO7A 2QBYB 4KN4X 1K7AA 5D6EA 1ON2A 1TNTA 2VC1A 4MTDA 4GYIA 2OQGA 5ED4A 1HKSA 1RZ4A 1I1GA 1GXQA 4FX0A 5LLQA 4BYYA 4PCQA 2AS5F 4KIBA 2Z33A 4IHSA 4L0ZB 5ILVA 3RIRA 3O6BB 2M1BA 2VE9A 3QPTA 3V8LA 1J5YA 1I6XA 5K1YA 1PP7U 3F6OA 5JHUA 3ZMZA 3I4PA 1CGPA 2VE8A 3LWFA 3L00A 4EJOA 1XSDA 4F7ZA 1IN6A 4HDVA 3GX4X 3TKYA 1YQAA 2HZTA 3FHZA 4Q48A 1JHHA 1XMKA 5HS8A 2QBYA 2P5VA 2XHKA 2EB7A 1HXDA 4PGHA 2HTJA 1LJ9A 3DP7A 3LA3A 5ICFA 3JTGA 3P9CA 1BJAA 4M9SA 4BHPA 4CXFA 4ASNA 4RS8A 1B9NA 5HDGA 3TOAA 2EFQA 2B0LA 5LHGA 3JTHA 1XDUA 5BQTA 3BPVA 3W6JB 3K0LA 4KFCA 2VOOA 4AVPA 4LLLA 5E8IA 1QO0D 5LEKA 2CG4A 4HF1A 2BE5F 2PBIA 4ESFA 2DLLA 1YLFA 3DEUA 5DEQA 1GXPA 3U2RA 1KA8A 3EYIA 1XB4A 1J9IA 2VODA 1LQ1A 1HW1A 3EETA 3QU3A 2A6HF 2Z5UA 5KK1A 3R0JA 4EMSA 1K78A 1I1SA 2A61A 1OR7A 3KETA 1Z6RA 5H20A 4HW0A 1Z6TA 2PQ8A 4ZH4F 3V7RA 4HDUA 2A07F 2LDUA 2ZMEB 4WXDA 3I59B 4A2UA 2BEOA 1IN8A 1ONVA 1OPCA 2KJBA 3GFMA 1ZRCA 2VT2A 1SFEA 2ZCWA 3RKXA 2FMLA 4QWQA 4KMFA 4YFNF 5J8CA 2XAQA 1IF1A 1B59A 5FFXA 4LG0A 1XCVA 2JTVA 4OOIA 2EFPA 1FYKA 1TLHB 4KYWA 4ENMA 1H9GA 1U3EM 4IPAA 1ZG3A 4PZJA 5L3DA 2XASA 2K7LA 4QLCU 4ESBA 4HZFA 2WV0A 5TRDA 3ECHA 4HQMA 2FQ3A 3KLNA 2FA5A 2ZNZA 4EM0B 1DDNA 4R79A 2X0LA 2EV6A 2EFNA 4N0BA 4A6DA 3OOPA 3WTYC 4Y13A 2RDPA 2L3DA 3IHUA 1IN4A 4A0XA 5DYMA 3FXUA 2GQQA 3B02A 1KYWA 1MJBA 3I58A 5E1XA 2QVOA 2CW0F 4YFXF 3TO6A 5ICEA 1YW7A 1U5TC 2QWWA 2J5OA 2ESNA 1Z7UA 5H6QA 1ON1A 5L3BA 4MEXF 4A5MA 3R61A 2IRFG 4GXOA 1LB2A 5JVTA 2NYXA 4KN7X 5DD4A 3QP5A 1U5TA 1ZREA 1Q1HA 5DUIA 2H6CA 1NHAA 5AIPA 3RDIA 1E2XA 2ADUA 2K02A 3WODF 2RGVA 5HS7A 3DKWA 5D4RA 3CO6C 3E5XA 2M8EA 2DU9A 2V79A 1J0RA 4S05A 4FHTA 4L9JA 4CGZA 2KRFA 1I27A 2RC4A 2V1XA 2JPBA 1EV7A 1AWCA 3TQNA 4OIOF 3PQKA 1D3YA 2GWRA 5AIQA 2FOKA 4AIKA 4YG2F 3ZMUA 4A0ZA 4ETSA 2HFHA 3WGHA 3F8CA 3ELKA 4CDGA 4OU0A 1ULYA 2GZWA 3TO9A 3KCCA 4KDPA 1ZYRF 2Z9OA 5CVIA 4CICA 1S7AA 1TTYA 3W6KB 4M73A 3GYHX 3QAHA 4KIFA 5D5VB 4U88A 3B73A 1WRJA 3QOPA 4P5OA 4Q47A 4CYDA 1MD0A 5LGUA 4ON0A 4MHGA 5H6RA 4ZZDA 3ZN0A 2BYVE 3FM3A 5DDGA 3P7NA 2EFOA 4A0YA 4N9IA 1J7KA 4JQFA 3Q9SA 3RPQA 1DPRA 4UV9A 5BOXA 5D8LB 1B6AA 3GO5A 4M9ZA 3ROUA 3S2WA 1OYYA 3HRUA 2NAZA 4G94A 5BS6A 2PFBA 2E7XA 1ZRDA 3V8KA 3M9AA 3COAC 3ABTA 4KIGA 1R36A 2DQRA 2CO5A 3ZP5A 2HYGD 2Q2EA 2OD5A 1F9NA 4G7ZF 2IT0A 2XKPA 1FYMA 1IAWA 4EM1A 1JGSA 2OBPA 1LDJA 3F72A 4EQQA 3L9FA 4UNOA 4A12A 3VFZA 3DPTA 2FNPA 2ACJA 4XSXF 2KJCA 3E3VA 2EA4A 4RAYA 2WWYA 4WCGA 1TW3A 4LG0B 3K1PA 2ZBKA 2L01A 1WQ2A 2QUFA 1FNNA 3REOA 3WTZA 3WTXC 3VOEA 2HKOA 1ZGJA 2F5DA 3KEOA 1UHMA 1FX7A 2CFXA 2W25A 3AAFA 4OINF 5CVVA 2P8TA 3NQOA 4MEYF 1O3TA 1U6GA 2DK8A 4I2OA 5LBQA 4A6EA 1QZYA 3HTSB 4BNCA 2R7FA 4M72A 4XLPF 2KIFA 1FZPB 1IRGA 1D5VA 1BOAA 2OU2A 2FXAA 3V4GA 2FF4A 3ERED 3D0SA 2FMYA 3ULQB 2GIVA 2VC0A 1XSVA 4UV8A 1IRFA 2XAJA 4L5JA 3I64A 2AXLA 2PI0A 2C6YA 1O3QA 2MH2A 1P4AA 4L9TA 4PGGA 3O2PE 4RGUA 3FXQA 3PFIA 1SD6A 1YIOA 3CLOA 1HBXG 2NS0A 1S6LA 2A6EF 2G7UA 5E1WA 3M7GA 3CUOA 3RYRA 3BY6A 4KT5C 3GW2A 2CSOA 4U0YA 1G6NA 2HOEA 4EVIA 2PMHA 4BAYA 3J81Z 3ISPA 4OIPF 3JSOA 2UXNA 3R4KA 1RNLA 3HSFA 4IRHA 5HS9A 5JI6A 2W84A 4LFUA 4KMUX 4IRIA 1BN5A 2V1DA 3I5UA 1J59A 5JR3A 1STZA 1ZLJA 4LB5A 3E6BA 5HLIA 3ZMDA 3J81K 1IUYA 3DF8A 3EUHA 3R0AA 4HAMA 3DQVC 4Z2YA 2YX4A 4Q5SF 1FT9A 1I5ZA 1YS7A 3IL2A 4EGZA 3MFKA 2DK5A 5E20A 1W7PD 3ABUA 2VONA 3FX3A 3FMQA 3LQRA
chains in the Genus database with same CATH superfamily
1J75A 2H94A 1K4TA 2DAOA 3CF2A 2A3SA 4NNJA 2RN7A 3KLOA 2KIUA 5GPAA 3Q5FA 3V7SA 1JKRC 3KP4A 2LKPA 2A5WA 3T0YA 1OCZH 2CRGA 4UVAA 3RTRA 3JRDA 2E7WA 3FXMA 3GZ5A 3P9KA 4DYQA 1H89C 4YIFA 3Q0WA 2XSJC 3SFIA 4A3GJ 1P6RA 5J4VA 2O03A 1I50J 4RAZA 5GPCA 2DDAA 1Z1DA 3Q3SA 1ZGAA 2HTSA 2XUBA 1U9OA 3KFWX 1Y8QB 4P55A 4I0BA 3DU5A 2NS8A 4IL6C 3GFJA 3JSPA 5E17F 2FBHA 3SEQA 3IH3A 1WHUA 1IDYA 2V6CA 3LSRA 3LSMA 2M87A 2ZSHB 4N9HA 1VQPI 4PJNA 1U5TB 3BR3A 1D1AA 3ZPLA 4HF0A 2DXIA 1WI3A 5CYVA 1V4RA 4XKBA 3LAPA 9ANTA 3WTSC 1ACIA 3L7WA 3GMEA 2QCOA 3H3VK 3OIOA 1BBYA 4BJTA 1TNSA 1MDMB 1P4XA 4C3IJ 4I99C 2M0CA 2MLKA 4HLYA 3CDHA 3GEZA 1HSJA 3PNTA 1WH7A 4BXXJ 3K1NA 2E1MC 3IWFA 4DQ2A 2WB1N 3VB2A 2LK2A 2E1CA 2K3FA 1UZCA 2XIGA 5LEJA 1X1DA 2L4AA 4F52A 1R6RA 2MD5A 2IS2A 2IS4A 1BC8C 1X2MA 2IA2A 3HZJA 3BPXA 1YJNI 4R1HA 2CGPA 1JXSA 4P96A 3G1OA 5FFZA 4AVZA 3DEEA 4HX7A 3J7YJ 2ZJ2A 3ZQFA 3QODA 4YELA 2KT0A 2EFWA 4ITVA 1NTCA 2PEXA 3TEDA 4WK8F 3K70D 4XSZF 4XN3A 1NG6A 3BROA 4LK1F 3JRFA 3CCJI 3R60A 1R00A 3QPHA 1FWZA 2OAZA 1NH3A 1H8AC 2VASA 3LMMA 4ZYGA 2Z99A 3IH4A 1UHSA 3L2WA 3GZNB 1K6YA 3CCSI 1LFUP 3AL0B 4PJLA 1TQIA 2JSCA 4EV0A 2DW4A 1HKTA 1JTXA 4MIMA 2PMZN 2QM3A 1O3RA 2ECBA 3PUBA 4S04A 2KMUA 1TWHJ 2EV0A 3RPUD 4CCLA 2Y48A 3S32A 4CHUA 3WG9A 3HHGA 2D1VA 3CJQB 1V54H 3H9QA 3QPSA 2L9VA 3H3ZA 2D2WA 5CJ9A 4DGWB 2O6GE 3BG9A 3LL7A 1OCOH 2Y75A 5IYDJ 2LRDA 4A3FJ 4CO8A 1EH8A 5H2FC 2VXDA 4HNTA 1G2HA 2IXSA 5FD5A 2MG4A 2R5YB 3CJTB 2YR2A 1D0ZA 3H1CA 1MBJA 2PMUA 5IYCJ 2UWMA 1F1ZA 2XAGA 3CTAA 3G73A 1BIAA 3L2VA 4B43A 3HOTA 2ZFWA 3OYBA 5HNHA 4O3MA 5K5OA 3F8MA 3K7AJ 2LNBA 1YOVB 2VBXA 3TBIA 2HOAA 2BW3A 1N25A 5EYRA 2MH9A 3S1MJ 3E6DA 1R7JA 2W1OA 1A31A 3JCUC 4XOPA 2M0MA 2XPWA 2NVQJ 1U8RA 4UY8I 2AQEA 3ABKH 3WTWC 4UVCA 1YYVA 2EBIA 1A35A 4YIRX 2O61A 4RGSA 4N4NB 1XD7A 3D5SC 1KU3A 2VBWA 4HQEA 1P9QC 1N78A 2LFBA 4LJZF 1VTNC 3QRFF 4X1EA 1TP4A 2HNHA 5FKKA 3GF2A 4GCVA 5HOOA 3G3ZA 3GLXA 5FLXK 3HYIA 5F04A 2NVUB 1SFXA 1ZK8A 2HXOA 4MTEA 4BS9A 4NB5A 3GTQJ 1SD4A 1OFCX 1R49A 2VQGA 3TW7A 3HUGA 3KP7A 3ZQCA 1PUFA 1HW5A 2R5ZA 1W36C 2PLYA 4BQAA 4IHXA 1TW2A 5BPIA 2UZKA 4EJTA 1QU3A 2JSPA 3F3XA 1WJEA 2LY1A 2R7OA 3OV8A 1R71A 2CQKA 2DMUA 5M3FJ 1E17A 3FKIJ 2GA1A 4M3GA 3DWLE 4OMYA 2FOWA 3EQLF 3TOBA 1W7PB 2GXBA 4IXAA 1UMQA 4AWXB 4J19A 2E35A 2UXXA 1HCRA 2OPTA 1VQLI 3AL0C 3WGIA 1ETQA 2B7EA 4XLFA 2L4MA 1SFOJ 2IJLA 4XR6A 1OMIA 1Y6IA 4B3AA 5LFAA 2F5CA 2A69F 3Q0UA 5A2QZ 3I4MJ 3S3NA 1JKOC 3F22A 1IRXA 2Z1DA 2DODA 1MKMA 2M4KA 2PJPA 4HYEA 1KU7A 3CP8A 1ZQ3P 3HKZN 3T5XA 1I3AA 5J47A 5DCFA 1HC8A 1Y8RB 3HTUA 1SFKA 1G4DA 2HDCA 3MKZA 2KDZA 2Y0SN 2R3SA 1N77A 4RGRA 1SVLA 5FKNA 3KPHA 3HOVJ 2DYRH 4IQ4A 4DIQA 1MMGA 3LA7A 2FBIA 4DW6A 1FBSA 1ZR4A 3MAJA 4RB3C 4RB1A 2IGMA 4BHCA 4D0PA 3C2BA 5M5YJ 2TCTA 4XKWA 1YW9A 3DBRB 3F21A 3FWEA 2LYCA 3FISA 1I6HJ 4HBLA 2JT1A 3CMEI 2BY3A 3ZQ7A 5F08A 4HX4A 1USSA 4X0GA 1ZARA 3A0BC 4XMYA 1JHFA 2VB6A 1S7EA 4IOAF 1RETA 3HEFA 4BY7J 3GXOA 2DTRA 3HDDA 4C9YA 4CUGA 2NXNB 2Y30A 4MQVA 4RGXA 4A5NA 3AFHA 2DN0A 2CS3A 4BHBA 2IA1A 1HLVA 5FO5A 5J1RA 4IX7A 2HU9A 5IY5H 1FLIA 2QQBA 2P81A 4ZDPA 3A2KA 2JPCA 1T38A 3PM1A 2VJ5A 2K9NA 3DCFA 4II3A 1PP8F 3TDZC 3QYEA 2OA4A 2JQ7A 2LTPA 3K70C 4G7HF 4ZZLA 1VQ7I 3IH2A 5GTHC 2K27A 3L2QA 4H0EA 3VDXA 4WWCA 4F91B 1AOYA 3I56I 3HGGA 2H1LA 3DU6A 3M1CA 2RQPA 1V5EA 2VBYA 3F6VA 3QPLA 1IGNA 1D1BA 4JBAA 5IP9J 2FU4A 1TQMA 2Q2EB 2K40A 1PDNC 2CV2A 1NK2P 1X4OA 3O3KA 2DPUA 2MC3A 1PYVA 3A03A 1WWXA 2HQNA 1WI9A 1YTYA 2E19A 1O57A 3QYBA 2MLGA 2GOMA 3A01B 2IGNA 1X58A 1V55H 2XAHA 1EJ9A 4HV6A 2DO7A 4MGRA 1LDDA 3MZHA 4ZYDA 2HKXA 2FRHA 1Y0UA 2Y0MA 1EA3A 1MGTA 2PN6A 2H8RA 2KDOA 2NVXJ 1TC3C 5GAHJ 3HSEA 3RJPA 3OYEA 3MEXA 2V1UA 3TDUC 3HM5A 5B3SH 4MNUA 3DTEA 1USTA 4G8XA 3ZMSA 1RESA 1XDSA 5L3CA 1RC9A 2W85A 3R6SA 2K85A 3CQZJ 3BTLA 4ENNA 2CJJA 4ZJZA 3Q0VA 2X51A 3HSRA 3WTVC 3QOEA 2VJIA 3W2WA 3VODA 3SDBA 2D45A 1LEAA 4M3FA 2STWA 3S8PA 1HSTA 3OSGA 2JUCA 2JA7J 1IO2A 1SFUA 1UFMA 3AG3H 4Y3OA 3CCUI 4IEJA 1BI2A 1MMSA 2NNNA 2G0EA 4HNVA 1YRNB 1VQ5I 2EZHA 1FSEA 4XRFA 2IA0A 1X3WB 4M6XA 1KU9A 1R4MB 1ZRFA 1Y1WJ 2MA3A 2GXAA 2CUFA 3CDLA 4NDLA 2YSRA 2H09A 4XIDA 1BW6A 2WC2A 3OYAA 3HRMA 1P92A 2A68F 5LGNA 1IRZA 4XRMA 1G3YA 3WE3A 2BW3B 2MGQA 1DPUA 4BDZA 1D8JA 2HGCA 2VQHA 1FSHA 2ZKZA 5EG0A 1IN5A 3JRGA 1PUEE 2YX7A 5BMZA 3NEUA 1FOKA 2NVTJ 3PL8A 4P9FA 1P4WA 2IBDA 4DJAA 3TMOA 1OYWA 4A3JJ 2R5YA 2KRHA 4LMYA 3S14J 2Z3YA 1IN7A 2XGEA 4A3IJ 3M1EA 2BOLA 1O7FA 3WG7H 3CF5F 4E70A 2XVCA 1WGXA 2L54A 1IZ1A 2P5LC 2JN6A 1T0FC 2BY2A 2KFDA 3QYFA 4D1QA 3DPLC 1UHWA 1L3LA 2V9VA 1MJ9A 5LRRA 3LSJA 3LSGA 1XMAA 3SFZA 3C3WA 2HPMA 4LLNA 1LNWA 1Q1VA 1K6OA 1D5YA 2J5PA 5DCMA 3CJNA 3GFLA 2FNAA 2VJJA 3HXLA 5DUKA 3HOSA 2F4MB 1REPC 3V42A 3WE2A 2KIQA 4L18B 1Z9CA 3MKWB 2WY7Q 3C7JA 1ODDA 1R23A 5LHIA 2LKSA 4RA2A 2FBKA 1RRJA 2JA6J 5ILSA 4NC6A 2RQQA 2FUG2 1ETVA 4M71A 5B1BH 2ZB9A 3ZCOA 3GUDA 3JW4A 3OIPA 1WZ2A 4BU2A 2R92J 3C18A 4RM3A 1OKRA 2HXIA 2CYYA 4XKVA 4XLEA 1XS9A 2YPRA 1TQPA 2R5ZB 3OSFA 2VOPA 3H92A 3CP2A 4L0YB 5HDNA 5C44J 3S3MA 2DMTA 2XGCA 1J2XA 2QENA 3WGGA 2HQ5A 4AIHA 1BA5A 1R1TA 2M8GX 2O3FA 3RKYA 1R5GA 3K2ZA 1B1BA 1QZEA 3OL3A 3WHBA 1RPWA 2GXGA 4F92B 2G9WA 4JX5A 5EEGA 2D1HA 1MDMA 3FK6A 3KP5A 1TL8A 3NARA 4PK4A 3SXYA 1YE9A 2X6YA 4P9UA 2WB1A 2F4IA 4UB6C 2QKMB 3P9IA 4I01A 2AHQA 5JHFA 3BG5A 3K9TA 1ZHFA 2JA2A 2QQAA 5IP6A 3BDDA 2OCCH 1W7PA 4HA8A 3WTUC 5IOZA 1B8IA 4GGGA 4D9JA 2IVMA 2M9HA 4ZC3A 2BHZA 1MBKA 2F4OB 2KZGA 3ESWB 3KEQA 5F6FA 4X6AJ 1KQ8A 2UUZA 4TV7A 5E3OA 2K9LA 2R4GA 4E7ZA 2CW7A 3KYLA 2Q1ZB 4FE7A 2L5QA 3G2BA 2L9RA 4CA0A 2CV0A 3FDYA 5DD8A 2HI3A 1RIOH 3O8HA 2IS6A 1LEBA 4LIVA 4JP0A 5TJJA 2LY9A 3J7AO 1DUXC 2WA0A 2DFFA 4G9YA 4IHVA 3OS0A 3B6CA 1RUOA 1LE8A 3BP8A 4EGYA 2KIMA 3I71A 2LREA 4M74A 4O6JA 3PUFA 1T6SA 1IXRC 2QZ8A 1BL0A 3I54A 4KT6A 2CQXA 2RNGA 3DLLF 5CLSA 1MZBA 4IHTA 4IJAA 1B9MA 4JX6A 4BJ5C 1J09A 1BIBA 2P4WA 1TT5B 2XSDC 2E1NA 1R9TJ 4A3BJ 3A0HC 5D6FA 4B09A 1WKMA 3DTIA 3CCQI 2ZJQF 5FLMJ 1MMDA 2MBFA 4UUVA 4ZYHA 2AXTC 1UCRA 3KYCB 1X1PA 1U2WA 3IV5A 1JUMA 4XRSG 1RR8C 5FGMA 1YHQI 3GCMA 1MSFC 2DI3A 3RI4A 4BQQA 1M1EB 4Q4ZF 1ZELA 4LB6B 4B44A 4G6TB 4BEHA 2K86A 3HRSA 2BV6A 2IW5A 1AU7A 4HRIA 3V7CA 1T56A 2XRLA 2CW8A 3ZMVA 4XQFA 4BACA 1ETOA 4IVNA 3WU1B 2HVQA 4U0WA 1ZN2A 3J80Z 3KP3A 2BXZA 4P1WA 4WF2A 1UELB 4IRGA 4AIDA 1HQCA 2CQQA 3ECOA 4O5VA 2E2IJ 2P6TA 1YFHA 2P6SA 2TDXA 3WU2C 4WX9A 1XGNA 2JVGA 2OJED 3NAUA 1YG2A 2ME6A 3HRTA 2WADA 4DZPA 2LSOA 3E6CC 5L3EA 1QBJA 3PO2J 4BE0A 1AA7A 2E5NA 2QF7A 4PJJA 1MW7A 4G7OF 5GADJ 2IGKA 1LE8B 1F5TA 3LSTA 3N05A 3EUKL 2XPVA 4I09A 4LGWA 4CZCA 2DBBA 1C0WA 1OR7C 1MNMC 4S0HB 2WTEA 4W97A 5F64A 2EILH 2M30A 5D5WB 4ZYAA 1FIPA 1UAAA 1D0XA 1N75A 2QGUA 1S29A 1BM9A 3J7AY 5FKOA 3ZGKA 2NS7A 2EPFA 3H35A 3IAM2 1K78B 1SMTA 2R0QC 1Z91A 2KRCA 1HW2A 4XM3A 2ZNYA 4UXNA 1I39A 1MBEA 2G7HA 5IYBJ 2VPLA 5J1YA 1A6IA 2CWEA 3M8EA 5LHHA 1G59A 4K2EA 1YITI 3BZ6A 2WY8Q 1FC3A 2KKOA 2X85A 3CUQC 4LK0F 3ZN1A 5C4XJ 1HA8A 5EZGA 3E5UA 3FF5A 3WU0A 4BQOA 1KYZA 3C2HA 2L02A 2QQ9A 2L0KA 1IJWC 1G3SA 2M7AA 2QEXI 2TRTA 5ICCA 2X48A 5GP9A 3AG2H 1OCPA 3I59A 3J7ZI 1YX5A 2W24A 3T8RA 1GHCA 3BLYA 1QNTA 1IW7F 1HKQA 2COMA 3KYDB 4Y15A 2QLZA 2XV4S 3DKYA 3ZQQA 5K7HA 3KZYA 2Y9ZA 1D8KA 3D1NI 2VT3A 3MWMA 1JUSA 4DBQA 1ZTRA 5J4YA 1YJWI 2B63J 4M9XA 2ID3A 5KAIC 4ZYEA 1SVOA 3OMYA 4KICA 4L5IA 4IO9F 3K4LA 5ICGA 2X1DA 2W48A 2LMDA 4KUMA 4XKCA 5IT3A 1E3OC 2L7KA 1YO5C 2EH3A 3M8JA 1JT6A 3K6GA 2LF7A 2X6WA 5J6XA 3G71I 3LSPA 4KNYA 2VIXA 4NQWA 4EJUA 1B4AA 3GWZA 2K4BA 3SYTA 2GBYA 1G3TA 4HLXA 5BPDA 4B48A 4YRVA 1TBXA 2NNYA 1BOBA 3ML6A 3V8JA 1A5JA 3KIOA 1ZLKA 3WTTC 1XGOA 4C30A 2BVMA 2F2EA 3P5JA 3QWLA 4EM2A 3J80K 3TP3A 3F8FA 1QZZA 1XN7A 3K69A 1EKEA 3GTPJ 3BTJA 3TP0A 1SMYF 1GVJA 1ZAOA 2Z2SB 3KE2A 3DV8A 1KGSA 1PJRA 1QQIA 4HF2A 1HDDC 4CCOA 3IKTA 2DQLA 3VYUB 5CVUA 3L1PA 5KAFC 3BR0A 2O8XA 3LQQA 1JI8A 1RUNA 1QGPA 1FYLA 4FT8A 3OYJA 4BXUA 1DP7P 4UUSA 2EIKH 4RM2A 3RZDJ 1S7OA 3HG9A 5F0CA 2HDDA 4PUSA 4A3DJ 4AD9A 2R7VA 1P7JA 1PUFB 3HUGB 4M3EA 2FX0A 5D5XB 4XLAA 3H5NA 1APLC 5IP7J 1SAUA 2FEZA 3BOQA 1SVMA 2ISZA 5K5QA 3JRIA 1ZR2A 3H0DA 2ZC2A 2L7ZA 2HQRA 1B72B 5CVRA 3BQYA 5J1UA 1H88C 2K4JA 4L9VA 3T8TA 4AUXA 1XSXA 3E0JB 1H9TA 2R7DA 3JR9A 3VEPA 2OQRA 1RKTA 5DTDA 4D5CA 5GAGJ 3HGYA 4G6DA 1V3FA 3QU6A 4MFEA 1T39A 1R5HA 2R7QA 3S2HJ 1W5SA 1UB9A 3LFKA 1JE8A 5FD6A 2ZXIA 4AYBA 2L2OA 3BC8A 2JA8J 4MQ9F 5JLWA 5L3FA 3CD6I 1MJAA 1LVAA 5JFRA 4G6QA 3SZGA 2M5WA 1ORKA 4EJWA 2R7ZJ 1OJLA 2VJ4A 3UR3C 2P7CB 2R7UA 2VN2A 3SHFA 5LRSA 2EQRA 2HWVA 1VI0A 5TISC 3IRQA 1OLTA 2WAQN 2R7SA 1X3UA 1UJ8A 2KQRA 3HBLA 5D5UB 4NHJA 1Z7LA 1DGRM 2HYFA 1U8BA 4OMZA 5FRMA 3BWGA 4KITB 3W2VA 2Y69H 1YW8A 2RVCA 3GZ6A 1LPQA 1QPMA 4RMNA 4WXCA 3S1RJ 3LFUA 3JRAA 2X4HA 1OISA 4BH9A 2Q8KA 3FZVA 4C3JJ 2JZYA 4J00A 1XCBA 3BCAA 5CQEA 1W5TA 2WAEA 2KISA 3A01A 3S93A 1WJ5A 1SD7A 2GLOA 1ZKGA 3BR1A 2DYSH 5HLTA 2E1OA 1XTAA 1MIJA 1MNDA 1L0OC 4IF4A 1WJDA 2FD5A 4RB2C 1MSEC 4BDYA 1W4MA 2CFOA 3S17J 1R1VA 1SAXA 5HDKA 2LVSA 2RREA 3FXJA 2F5FA 2DMQA 1WH5A 3JAMZ 1NK3P 2VUMJ 2I8DA 1KQ0A 1K83J 2DOFA 3M8FA 1Z3YA 3F9KA 3OYCA 1BI3A 5IT9K 4I7HA 1FP2A 3GTJJ 3H3UA 3K4KA 3RPUA 2BGCA 3JRCA 3HC7A 3D5LA 1BI0A 1QRYA 2IPQX 3L09A 1I3QJ 4R8HA 3CESA 2JA5J 1S3JA 2YUSA 2YS9A 1CF7B 1ZH5A 3L2RA 1Z77A 1T98A 1WPKA 1S8NA 3BJ6A 3KZZA 2ISYA 4PSXA 3CCRI 5IT9Z 2DFIA 2DOEA 5DCMB 5D4SA 2ESHA 4OIQF 3DPUA 3ZRGA 1FPQA 1T08B 3LAJA 1FBQA 4ANJA 3JAMK 2HR3A 3PSIA 3I9V2 3CO7C 3GVAA 3GTMJ 2HEOA 3UNGC 1KZHA 1DU6A 2L7FP 5E18F 4LG3A 2LOOA 3CUQB 5JLXA 3VSKA 4GYGA 3ZQIA 1HF0A 3QP6A 4FX4A 2HZDA 3M4OJ 3K4JA 3PSFA 3KX2A 4UVBA 1VQOI 1U78A 3BJOA 1Z05A 3CCLI 3OYDA 4ESJA 4HX8A 5DS9A 3FMSA 5K5RA 4YFKF 2XRNA 3OYHA 2DFEA 1MH3A 3GBGA 2YU9J 2P5KA 2FQ4A 3FMRA 2Q0OA 2EV5A 1A36A 1F4KA 1UG0A 4B4CA 5HVQC 4XONA 1Z0XA 2BBYA 3N4MA 3L2UA 1SC7A 3SQNA 4RB0A 2O0YA 1R58A 5FJ8J 2EWNA 1XX5A 4WXHA 5AONA 4A93J 5J8FA 2RKHA 2PJRB 3K1MA 2BZTA 3MN2A 3TL4X 1FOYA 2CQ7A 3BZCA 4CCMA 5HLHA 3DXJF 3K2AA 1DQUA 1IXSB 2RV8A 1O3SA 2OZUA 4AIJA 1FEXA 1VQNI 4HPQA 2HDWA 4GO1A 5DV5A 2KHMA 3RCOA 4PDKA 5ERIA 4BBRJ 2HVRA 4M6YA 1EH7A 2GOXB 3HL2A 5ILUA 4IZZA 4JX4A 5A2QK 3KP6A 3PIPF 4U0VA 4C3HJ 4E4HA 5E3MA 1CF7A 5E1ZB 3C1DA 3MCZA 3CMAI 4U7DA 3E97A 1BC7C 2BY0A 3ZMTA 4CCJA 2LLKA 2MC4A 4L9NA 4HOBA 3E5QA 4AU7A 5KVRA 3BG7A 2VXZA 3U1DA 1XGMA 3PQJA 3I0TA 1SANA 4ZTJA 3MQ0A 5FB2A 2VBZA 2XKOA 2VPRA 1FBUA 3MZ8A 3IP4B 2F5EA 2XB5A 4E7KA 2V7FA 4XLCA 2XGXA 3RYPA 2VKEA 1E3PA 4XORA 3EPZA 1XC5A 2JRMA 1R22A 3ZXSA 2BHYA 4EJVA 4E7LA 4UHTA 3JREA 4XL9A 2VKVA 1OYIA 2JRTA 3GLLA 1TWCJ 2LH9A 4ZTFA 3TGNA 4XLNF 5FLXZ 4U7BA 1P2FA 1ZG5A 2BXYA 1YS6A 1OQYA 1W5CC 2QSGX 3CCVI 3G6EI 3ERMA 4HV5A 2UV1A 3AG1H 3I4NJ 1O7LA 1WFXA 1B72A 2V1NA 3O8GA 3W6VA 1FY7A 2R93J 5D8KB 1WJBA 3U1KA 2XROA 2IP2A 3I53A 4CCKA 1GT0C 2LP0A 4JOMA 3LA2A 2ZJRF 1IV8A 1EF4A 3IWZA 4QPOA 5FRNA 5EF6A 2AO9A 3SEZA 3IC7A 3DKXA 2DA5A 4II2A 3N97A 3KP2A 1T2KA 1BI1A 3E6MA 3SZPA 1KQ9A 1WVRA 1FJLA 4BE1A 2ELKA 1BR4A 3HHHA 5CVJA 1MMNA 5F1JA 5LGTA 4LD5A 5K7ZA 2EK5A 1VZ0A 3F8BA 1VQ4I 1SD5A 3G4SI 3CC4I 2H27A 2M4GA 3EYYA 5F1RA 1R1UA 2OV7A 2BVLA 3BJAA 4Y17A 3MKYB 1WSUA 2M45A 3IKVA 3CUQA 2EJRA 2XAFA 1FOWA 4YIIA 3HIFA 4RLFA 1S5LC 1ZG1A 4JK1X 2A5YB 2DA4A 3H0GJ 4KA4A 3FXRA 6PAXA 3CMYA 2DA1A 3B6AA 5TGTA 4XBFA 4OAYA 3L2CA 1K79A 2W57A 2FSWA 3EDPA 2QYOA 1R5ID 5HLGA 2GAUA 2ZMEA 2DJNA 1LDKB 2LF8A 1WJFA 1A04A 2YU3A 5B5EC 2H6BA 2RNJA 1IXCA 3F23A 2NRAC 4LLGF 4I0AA 5E8GA 3RKWA 2PX9A 2LY2A 4ENJA 2ZO4A 4EEFG 4XN0A 2VKDA 2KZVA 3NRVA 2FE3A 4I98B 4CZZA 5L3GA 3Q9VA 1XGSA 4OWRB 2M34A 2EA2A 4BQNA 4ENKA 2Z16A 1H0MA 2DPDA 3SZTA 3T1BA 1G3WA 3OYFA 4A3CJ 1FP1D 1Z3XA 1KU2A 2STTA 2KP6A 4RAGA 3HOZJ 5E3NA 1GLNA 1T0FA 2GA2A 2P0WA 2ZXJA 3ZOBA 2DT5A 3F8NA 2OF7A 3D5RC 3FBNB 3S1NJ 3MZYA 2PMZA 4XLHA 3IRRA 4I02A 1ITYA 5EEHA 1X3ZB 4OIRF 3U9GA 1VQMI 1RI7A 2ELHA 4RLQA 3OY9A 2ETHA 2QKLB 2PG4A 2OZ6A 2P7VB 2QSHX 3DFGA 1QVTA 2H1KA 2LBFA 3ASNH 4B8XA 3FM5A 4DNCA 2HS5A 1EH6A 4BE2A 2M7BA 3GFIA 1WJAA 1NG7A 3TO7A 2Y2ZA 2QBYB 2W7NA 2EZIA 4KN4X 1K7AA 1E0EA 3I3LA 5D6EA 1ON2A 1IDZA 1TNTA 4CYCB 3PO3J 2VC1A 4MTDA 1VNDA 1WJCA 2K9MA 3OR1C 3X2QH 4BJ6C 1R4NB 4GYIA 4E7HA 2OQGA 1JJ8C 5ED4A 1HKSA 2O7OA 3VYSB 1RZ4A 3FXKA 4Z6YA 1I1GA 3OYKA 1GXQA 4FX0A 5LLQA 4BYYA 4PCQA 2O8KA 2AS5F 4KIBA 2XF6A 2Z33A 4IHSA 3BZKA 5ILVA 4L0ZB 3BCBA 3RIRA 3O6BB 1ETWA 2M1BA 2VE9A 4F93B 3LSKA 2MW8A 4MFDA 1XMXA 3QPTA 3ZQGA 4BUPA 4QSHA 2IAIA 4BBSJ 5C4JJ 5M5XJ 3V8LA 1YRNA 1J5YA 1ETYA 1I6XA 2CU7A 3OR2C 4QIWN 5K1YA 1PP7U 2DCEA 2OTLI 2M3AA 2CMPA 3F6OA 4BEHB 5JHUA 5E3LA 3ZMZA 3I4PA 1CGPA 4XOTA 4BY1J 2VE8A 5GTIC 3CJRB 3F0CA 3LWFA 1JTYA 2CUZA 3L00A 4EJOA 2VLAA 1XSDA 4F7ZA 1IN6A 4HDVA 3SDGA 3GX4X 3WHCA 1U0JA 3TKYA 1YQAA 2HZTA 3S2DJ 1DP3A 4I6ZA 3FHZA 5CPRB 4Q48A 1JHHA 1XMKA 2DA6A 5HS8A 2QBYA 2LG4A 2P5VA 5J40A 2XHKA 3H36A 4ZDLA 1XPXA 1FMWA 2EB7A 2DT7B 1HXDA 4PGHA 1ZGWA 2HTJA 1LJ9A 2ZMEC 2KL4A 4UUTA 4C2TA 4IHWA 3DBHB 3K10A 3DP7A 4A3MJ 2IS1A 3LA3A 3SJMA 5ICFA 3JTGA 3P9CA 1BJAA 5EEAA 4G12A 1YJ9I 1IV6A 4PFPA 2DFHA 3CCYA 2DT6A 4M9SA 1FTZA 4BHPA 4CXFA 5M5WJ 4ASNA 2DA2A 2K9SA 4RS8A 2EZKA 3UKGA 2WAQA 3H9JA 3BR6A 1B9NA 5HDGA 3TOAA 1VQKI 2EFQA 2KPMA 2VKHA 2B0LA 5LHGA 3JTHA 3CZ6A 1VF9A 3LSHA 1JUPA 4DZJA 1TZLA 1D1CA 1XDUA 2LD5A 2XF5A 5BQTA 1S72I 3BPVA 3W6JB 2R7RA 4AM3A 3OYGA 3K0LA 4KFCA 4D7MA 2VOOA 1ERDA 4AVPA 4LLLA 5E8IA 1QO0D 2ZXHA 4AYBN 2CG4A 5LEKA 4HF1A 2GIZA 2BE5F 2PBIA 2E5ZA 4LOCA 4ESFA 2DLLA 1YLFA 3DTKA 1Z67A 1MH4A 4L5EA 3DEUA 4M3BA 4V2GA 5DEQA 2VI6A 1GXPA 3U2RA 1KA8A 5EGOA 1QA6A 2IEKA 2L9NA 3MMYB 5FKLA 4RDUA 3EYIA 3GTOJ 2K9QA 1XB4A 1J9IA 2EINH 3HOUJ 5EGOB 2VODA 1LQ1A 1HW1A 4Y7NJ 3EETA 3MVPA 3HJEA 3QU3A 2A6HF 2Z5UA 4IQJA 5FROA 5KK1A 3CC7I 1U9NA 3R0JA 5IPAA 4EMSA 1K78A 1I1SA 2A61A 1OR7A 3RZOJ 4IOCF 1VFCA 3KETA 1AKHA 1MNEA 1IUFA 2FJ1A 2X1CA 1Z6RA 5H20A 4HW0A 1IG7A 1Z6TA 2PQ8A 1Y56A 4ZH4F 3VWBA 2JVHA 3V7RA 1Y39A 4HDUA 2EIMH 1Y0NA 4DOZA 2A07F 2CH0A 3H9GA 2E2JJ 4XRSA 2IGOA 2LDUA 1VQ6I 2MFZA 4IHYA 4E7JA 2I10A 2ZMEB 4WXDA 1TWFJ 3GTLJ 3I59B 4A2UA 2BEOA 3K4CA 1IN8A 1ONVA 1OPCA 2CUEA 3G1LA 2KJBA 3GFMA 1HDPA 1SEUA 1ZRCA 2VT2A 5J3LA 2I5UA 2X9DA 1SFEA 2OUMA 2ZCWA 3OL4A 3RKXA 3A4CA 3W3CA 2FMLA 4QWQA 2EZLA 2XC7A 3HKZA 4YFNF 5J8CA 4KMFA 2XAQA 1IF1A 1B59A 5FFXA 4LG0A 2DMPA 1XCVA 3FXLA 2JTVA 2W4SA 4OOIA 3BTCA 2EFPA 1PVEA 1FYKA 5F0FA 1Z21A 2AQFA 1TLHB 4KYWA 4ENMA 1H9GA 2HPIA 4CH7A 1U3EM 4IPAA 3CDIA 1ZG3A 5KNLA 4IKFA 2E36A 4PFOA 1GDTA 2ELJA 4PZJA 3OS1A 4FETA 5L3DA 2WBMA 3FHNA 4M3DA 3A02A 2XASA 2K7LA 2X6OA 4ESBA 4QLCU 5CQGA 4HZFA 2WV0A 1BJZA 3NWTA 3ECHA 5TRDA 4B1RA 4HQMA 2FQ3A 5M3MJ 2ECCA 1W0UA 5B1AH 3KLNA 1D0YA 3ABMH 2XAUA 2FA5A 2ZNZA 2COBA 3S16J 4EM0B 4QTRA 2Y31A 1ENHA 4A3KJ 1DDNA 2LBFB 2MD0A 4R79A 2X0LA 2R7TA 2EV6A 2EFNA 4N0BA 4A6DA 3OOPA 3G1MA 2V9KA 2XGDA 3WTYC 4Y13A 2RDPA 2L3DA 1BW5A 3U21A 1RR7A 3IHUA 1IN4A 2N8GA 4CCNA 4A0XA 5DYMA 1DU0A 1LUJB 3CCMI 3FXUA 2GQQA 2OC6A 3B02A 1KYWA 2E34A 1MJBA 3I58A 5E1XA 2QVOA 5EG0B 2V6EA 2CW0F 2MSYA 3PNYA 4YFXF 2JK3A 2DA3A 2HOTA 3BTIA 3TO6A 5ICEA 2M2EA 4CYCA 1YW7A 1U5TC 2QWWA 2J5OA 2ESNA 3OOUA 4C2MJ 1TWAJ 1FIAA 1MBFA 3VYTB 1S9HA 4N4OB 5GAEJ 5KHDA 1Z7UA 5H6QA 1ON1A 5L3BA 1K4SA 4MEXF 4A5MA 4XICA 1O4XA 3R61A 3RQ4A 1K61A 2IRFG 1JKQC 4V2FA 1BR1A 3RQIA 3S15J 3RSNA 4GXOA 4ZDOA 2NOJB 4BL0B 1LB2A 1FOXA 5JVTA 2NYXA 4LIUA 4CSWA 4KN7X 5DD4A 3QP5A 4MO7A 2ZJPF 3OYMA 1U5TA 3VPRA 2OTJI 1ZREA 1Q1HA 3OS2A 5DUIA 2H6CA 1NHAA 2ZSIB 4Y52J 2HVSA 5AIPA 3RDIA 1E2XA 2K5CA 2ADUA 2K02A 1T33A 3WODF 3KZIC 1QPIA 2RGVA 5HS7A 3OYNA 3DKWA 5D4RA 3CO6C 4DBRA 3E5XA 2M8EA 2DU9A 2V79A 3OIQA 4D7NA 3E7LA 1J0RA 1JGGA 1UG2A 4S05A 4FHTA 4L9JA 3NWSA 4CGZA 2KRFA 1I27A 2RC4A 2V1XA 2CQNA 5JVGF 2JPBA 1EV7A 1AWCA 3TQNA 4OIOF 3GTGJ 2V9PA 1OCRH 3PQKA 2Y0SA 5B66C 1D3YA 2A6TA 2DDBA 2GWRA 5AIQA 4AC0A 2QSFX 2FOKA 4YG2F 4AIKA 3ZMUA 4V19K 2CUJA 1LVKA 2ZFUA 3QQAA 4A0ZA 4ETSA 4GDFA 5F27A 2HFHA 1DGWY 3WGHA 3F8CA 5CKTA 1TWGJ 3ELKA 3BG3A 4ABZA 4CDGA 4OU0A 1ULYA 3JRHA 2GZWA 3TO9A 3KCCA 4KDPA 1AKHB 2LR8A 1ZYRF 2Z9OA 4A69C 5CVIA 1V5FA 4CICA 3BQZA 1S7AA 2W82A 1TTYA 3W6KB 2ID6A 2V4JC 4M73A 4C2UA 2LC2A 3GYHX 3QAHA 3FKJA 4KIFA 1X19A 4OAZA 4U88A 5BNGA 5D5VB 3B73A 1WRJA 3QOPA 4A3LJ 1QHGA 4P5OA 4Q47A 1JJ6C 1F43A 4CYDA 1MD0A 1POGA 1MMAA 2F48A 3MD2A 5LGUA 4ON0A 3HOXJ 1YI2I 3DEWA 4MHGA 5HODA 2V26A 5DM6F 5H6RA 3ONQA 2E60A 4FASD 4ZZDA 3PFYA 2ICWG 3ZN0A 2XPUA 2BYVE 3FM3A 3EUAA 3P7NA 2EFOA 4A0YA 5DDGA 4N9IA 1J7KA 2XF7A 3RKQA 4J01A 1W0TA 4JQFA 3Q9SA 3HPHA 3RPQA 2HOSA 1DPRA 4UV9A 5BOXA 3FK7A 5D8LB 1B6AA 2NVYJ 3GO5A 3ABLH 4M9ZA 3ROUA 1VQ8I 1KONA 3FBIB 3KEYA 1IC8A 4B3XA 2X6XA 3OYLA 3S2WA 4EATA 3M3YJ 4KISA 3W2AA 1OYYA 1VQ9I 3HRUA 2QA4I 1X2NA 2NAZA 4G94A 2HYJA 1E3HA 5BS6A 2PFBA 2E7XA 2ME0A 5LD2C 5C3EJ 1ZRDA 3V8KA 2R7XA 4UB8C 1YX3A 3AG4H 4FE4A 1X1CA 2F6CA 3ASOH 3M9AA 3PIOF 4KJZA 3COAC 3ABTA 1W36D 2XDVA 2A05A 4KIGA 1R36A 2DQRA 3BT9A 2DMNA 5HNFA 2CO5A 4QPQA 3CCEI 3A1YA 5F0HA 2HYGD 2Q2EA 3ZP5A 2OD5A 4NUBA 4NC8A 2VQLA 1F9NA 4E6KG 3LNQA 2NOGA 4G7ZF 4NC7A 2IT0A 1V5GA 4NQWB 2XKPA 1T95A 1FYMA 1IAWA 4EM1A 2B9SA 1JGSA 2OBPA 4YEJA 3LOCA 1LDJA 1JT0A 3F72A 2L9SA 4EQQA 2K3PA 3L9FA 2R7WA 4UNOA 2LKXA 4A12A 2KLOA 3VFZA 3HOYJ 3DPTA 2CV1A 1FTTA 2FNPA 4PJ0C 2JMWA 5K7FA 1X4PA 3H5AA 2WV1A 2ACJA 2DJIA 4XSXF 2KJCA 3E3VA 2EA4A 4Y33A 4RAYA 3VYRB 1OCCH 4WCGA 2WWYA 1TW3A 4LG0B 3K1PA 2ZBKA 1W1WE 1ETXA 2QUFA 1WQ2A 2L01A 1FNNA 3REOA 4HEA2 4RAFA 3WTZA 3WTXC 2DA7A 3VOEA 3OYIA 2HKOA 1ZGJA 2F5DA 3KEOA 4W1UA 1AHDP 1UHMA 3AKZA 1FX7A 2CFXA 2WAFA 2W25A 3AAFA 5EDNA 2GM4A 4MLOA 4OINF 3VSLA 5CVVA 1YIJI 1MBGA 4F55A 2P8TA 4LITA 3S1QJ 4DYCA 3NQOA 1GV5A 4MEYF 3PNVA 1HOMA 1O3TA 3I55I 1U6GA 2DK8A 4I2OA 5LBQA 4A6EA 4FCYA 4RBOA 1GVDA 1QZYA 3HTSB 4B47A 4BNCA 2R7FA 4M72A 4XLPF 2KIFA 1FZPB 1IRGA 1D5VA 1BOAA 2OU2A 4HNUA 4E7IA 3CC2I 2FXAA 1QVUA 3V4GA 2FF4A 3ERED 2OCEA 3D0SA 1T8IA 2FMYA 3ULQB 2GIVA 3JRBA 1P7IA 2VC0A 3FXOA 3PJRA 4BKXA 4F3QA 1XSVA 4GFBA 4UV8A 1IRFA 3ZQLA 2XAJA 4L5JA 4A3EJ 3I64A 2AXLA 2PI0A 3CLQA 2C6YA 1ETKA 4NBQA 1O3QA 4PSWA 2MH2A 2MYSA 1P4AA 4L9TA 4PGGA 2XB0X 3O2PE 4RGUA 2H8WA 3FXQA 3PFIA 4HSTA 2X1EA 1SD6A 5FKMA 1YIOA 4U87A 1X1BA 3CLOA 3ZQHA 4DYRA 2MABA 4XK4A 2W00A 1HBXG 2NS0A 1S6LA 3FIWA 2DOAA 3E1SA 2A6EF 2EIJH 3IAS2 1GV2A 2G7UA 5E1WA 3M7GA 1CQTA 3CUOA 3RYRA 3BY6A 2ZXWH 2VL8A 4KT5C 4HSRA 2O9LA 3GW2A 2CSOA 4U0YA 3TW6A 1G6NA 1GUUA 2HOEA 4EVIA 3HOWJ 2PMHA 4BAYA 5KCMA 4UUSB 2JWTA 3K4MA 1A6QA 3J81Z 3ISPA 5E79C 4OIPF 4Y4RA 4PJMA 2O5RA 4D5FA 4I76A 3JSOA 1TT0A 2UXNA 4FTHA 4FQGA 2RAEA 3R4KA 4M6VA 3H5RA 3OWTA 5EJCA 4BXFA 1RNLA 3HSFA 4IRHA 5HS9A 3BR5A 3C2GA 3DLAA 2D5VA 5JI6A 2W84A 3GTKJ 1G8XA 2E1MB 4LFUA 1QHHD 4KMUX 4IRIA 1BN5A 3MKLA 2QQ8A 2V1DA 1LKXA 3I5UA 2JJ7A 3HB9A 1J59A 5JR3A 2E71A 3LSIA 1STZA 1ZLJA 3K4NA 4LB5A 4GRIA 3IUOA 3E6BA 3DBLB 5HLIA 3ZMDA 1JKPC 5FLVA 3J81K 4BGDA 3BG6A 2HQAA 3K4BA 3ZR8X 1IUYA 1WCMJ 3M07A 3DF8A 4XNFA 3EUHA 4JYKA 3EUHC 1B8IB 3R0AA 2JUGA 2DTZA 1RKWA 2F5VA 4HAMA 1F36A 5EZHA 3DQVC 2VQCA 1BR2A 4H4KC 4Z2YA 5IOYA 3S3OA 2E2HJ 2L7MP 3CMMA 5DM7F 4HG2A 1OCTC 2YX4A 3BR2A 1X1AA 4Q5SF 1LFBA 4E7SA 1FT9A 1I5ZA 4FISA 2Y9YA 1YS7A 3IL2A 4EGZA 1Y1VJ 3MFKA 2DK5A 5E20A 1W7PD 3HPGA 1LFPA 1MBHA 2PJRA 1XG1A 2BY1A 3ABUA 2VONA 3FX3A 1FMVA 3FMQA 3LQRA
chains in the Genus database with same CATH topology
1J75A 2H94A 2DAOA 2A3SA 2RN7A 3KLOA 2KIUA 3Q5FA 3V7SA 3KP4A 2LKPA 3T0YA 4UVAA 3RTRA 2E7WA 3GZ5A 3P9KA 4YIFA 1P6RA 2O03A 4RAZA 1Z1DA 1ZGAA 2HTSA 2XUBA 3KFWX 4P55A 4I0BA 3GFJA 3JSPA 5E17F 2FBHA 2V6CA 2M87A 4N9HA 1U5TB 3ZPLA 4HF0A 5CYVA 3LAPA 1V4RA 3WTSC 3L7WA 1BBYA 1TNSA 1MDMB 1P4XA 4HLYA 2MLKA 3CDHA 3GEZA 1HSJA 3K1NA 3IWFA 4DQ2A 3VB2A 2E1CA 2XIGA 5LEJA 2L4AA 2MD5A 1BC8C 2IA2A 3BPXA 4R1HA 2CGPA 1JXSA 4P96A 5FFZA 4HX7A 2ZJ2A 2EFWA 2PEXA 4WK8F 4XSZF 3BROA 4LK1F 3R60A 1R00A 3QPHA 1FWZA 2OAZA 4ZYGA 2Z99A 1TQIA 2JSCA 4EV0A 2DW4A 1HKTA 2QM3A 1O3RA 4S04A 2EV0A 2Y48A 4CHUA 3WG9A 3HHGA 2D1VA 3H3ZA 2D2WA 5CJ9A 2O6GE 2Y75A 4CO8A 1EH8A 5FD5A 2YR2A 2PMUA 2UWMA 1F1ZA 2XAGA 3CTAA 3G73A 1BIAA 3HOTA 2ZFWA 4O3MA 5K5OA 3F8MA 2LNBA 2VBXA 2MH9A 3E6DA 1R7JA 1U8RA 3WTWC 4UVCA 1YYVA 2O61A 4RGSA 1XD7A 1KU3A 2VBWA 4HQEA 4LJZF 1VTNC 3QRFF 3GF2A 4GCVA 5HOOA 3G3ZA 3GLXA 5FLXK 3HYIA 1SFXA 4MTEA 4NB5A 1SD4A 3HUGA 3KP7A 4BQAA 1HW5A 2PLYA 1TW2A 5BPIA 2UZKA 4EJTA 3F3XA 3OV8A 2CQKA 1E17A 2GA1A 4OMYA 3EQLF 3TOBA 1W7PB 2GXBA 4IXAA 4AWXB 2UXXA 3WGIA 2L4MA 2IJLA 1OMIA 2F5CA 2A69F 5A2QZ 3F22A 1MKMA 2PJPA 4HYEA 1KU7A 3T5XA 5DCFA 3HTUA 1G4DA 2HDCA 2R3SA 4RGRA 3LA7A 2FBIA 1FBSA 3MAJA 4RB3C 4RB1A 4BHCA 4D0PA 1YW9A 3F21A 3FWEA 4HBLA 2JT1A 3ZQ7A 4HX4A 1USSA 1ZARA 1JHFA 3GXOA 2DTRA 4MQVA 4RGXA 4A5NA 4BHBA 2IA1A 5FO5A 1FLIA 2QQBA 2JPCA 1T38A 1PP8F 3TDZC 2OA4A 4G7HF 4ZZLA 2K27A 4H0EA 4WWCA 1AOYA 2RQPA 3F6VA 2VBYA 4JBAA 2FU4A 1TQMA 1PDNC 3O3KA 2DPUA 2MC3A 1WWXA 2HQNA 1WI9A 1YTYA 1O57A 2MLGA 2XAHA 4HV6A 2DO7A 4MGRA 1LDDA 3MZHA 4ZYDA 2HKXA 2FRHA 1Y0UA 2Y0MA 1MGTA 2PN6A 3HSEA 3RJPA 2V1UA 3MEXA 3TDUC 4MNUA 1USTA 4G8XA 3ZMSA 1XDSA 5L3CA 2W85A 3R6SA 4ENNA 3HSRA 3WTVC 3VODA 2D45A 1LEAA 2STWA 1HSTA 1SFUA 1UFMA 1BI2A 2NNNA 1FSEA 4XRFA 2IA0A 4M6XA 1KU9A 1ZRFA 2MA3A 2YSRA 2H09A 2WC2A 3HRMA 1P92A 2A68F 5LGNA 3WE3A 1G3YA 1DPUA 1D8JA 2HGCA 1FSHA 2ZKZA 1IN5A 1PUEE 2YX7A 5BMZA 3NEUA 1FOKA 4P9FA 1P4WA 1OYWA 4LMYA 2Z3YA 1IN7A 3M1EA 1O7FA 4E70A 2L54A 2XVCA 1IZ1A 2P5LC 3DPLC 1UHWA 1L3LA 2V9VA 1MJ9A 5LRRA 1XMAA 3SFZA 3C3WA 4LLNA 1LNWA 1K6OA 2J5PA 5DCMA 3CJNA 3GFLA 2FNAA 5DUKA 3HOSA 1REPC 3WE2A 4L18B 1Z9CA 3C7JA 1ODDA 1R23A 5LHIA 2FBKA 5ILSA 4M71A 3GUDA 3JW4A 3C18A 1OKRA 2CYYA 2YPRA 1TQPA 2VOPA 3H92A 4L0YB 5HDNA 1J2XA 2QENA 3WGGA 4AIHA 1R1TA 2O3FA 3RKYA 1R5GA 3K2ZA 1B1BA 2GXGA 2G9WA 5EEGA 2D1HA 1MDMA 3KP5A 3SXYA 4P9UA 3P9IA 4I01A 3K9TA 1ZHFA 2QQAA 3BDDA 1W7PA 4HA8A 3WTUC 4GGGA 2IVMA 3KEQA 5F6FA 1KQ8A 4TV7A 5DD8A 1RIOH 1LEBA 5TJJA 3J7AO 1DUXC 4G9YA 1RUOA 3BP8A 4EGYA 2KIMA 3I71A 4M74A 4O6JA 1T6SA 1IXRC 2QZ8A 3I54A 5CLSA 1MZBA 4IHTA 4IJAA 1B9MA 1BIBA 2P4WA 2E1NA 5D6FA 4B09A 1WKMA 2MBFA 4UUVA 4ZYHA 1UCRA 1U2WA 5FGMA 2DI3A 3RI4A 4Q4ZF 4LB6B 2K86A 3HRSA 2BV6A 2IW5A 3V7CA 3ZMVA 4IVNA 3WU1B 4U0WA 1ZN2A 3J80Z 3KP3A 4WF2A 4IRGA 1HQCA 3ECOA 4O5VA 2P6TA 1YFHA 2P6SA 2TDXA 4WX9A 1XGNA 1YG2A 3HRTA 2LSOA 3E6CC 5L3EA 1QBJA 4G7OF 1F5TA 3LSTA 4I09A 4LGWA 2DBBA 1C0WA 2WTEA 5F64A 2M30A 5D5WB 1S29A 1BM9A 1K78B 1SMTA 1HW2A 1Z91A 2ZNYA 4UXNA 2G7HA 2CWEA 3M8EA 5LHHA 4K2EA 3BZ6A 3CUQC 1FC3A 2KKOA 4LK0F 3ZN1A 3E5UA 3FF5A 3WU0A 1KYZA 2L02A 2QQ9A 1G3SA 5ICCA 3I59A 2W24A 3T8RA 1GHCA 1QNTA 1IW7F 1HKQA 2COMA 4Y15A 2QLZA 2XV4S 3KZYA 1D8KA 2VT3A 3MWMA 4M9XA 4ZYEA 4L5IA 4KICA 5ICGA 4KUMA 5IT3A 1YO5C 2LF7A 5J6XA 4KNYA 4NQWA 4EJUA 1B4AA 3GWZA 2K4BA 1G3TA 4HLXA 5BPDA 1TBXA 2NNYA 3ML6A 3V8JA 1ZLKA 3WTTC 1XGOA 2F2EA 4EM2A 3J80K 3F8FA 1QZZA 1XN7A 3K69A 1SMYF 1GVJA 1ZAOA 3KE2A 4HF2A 1KGSA 1QQIA 3DV8A 3IKTA 2DQLA 5CVUA 2O8XA 3LQQA 1RUNA 1QGPA 1FYLA 4FT8A 4BXUA 1DP7P 1S7OA 4AD9A 5D5XB 2FEZA 3BOQA 2ISZA 5K5QA 2HQRA 5CVRA 2K4JA 4L9VA 3T8TA 1XSXA 1H9TA 2R7DA 3VEPA 2OQRA 4G6DA 1V3FA 3QU6A 1T39A 1R5HA 1W5SA 1UB9A 3LFKA 1JE8A 5FD6A 4MQ9F 5L3FA 1MJAA 1LVAA 5JFRA 4G6QA 2M5WA 4EJWA 2P7CB 2VN2A 3SHFA 5LRSA 2HWVA 3IRQA 1X3UA 4NHJA 5D5UB 2HYFA 4OMZA 3BWGA 1YW8A 2RVCA 3GZ6A 1QPMA 4WXCA 2X4HA 4BH9A 2Q8KA 3FZVA 2JZYA 1XCBA 1W5TA 1SD7A 1L0OC 4IF4A 4RB2C 1W4MA 1R1VA 1SAXA 5HDKA 2F5FA 3JAMZ 1KQ0A 3M8FA 1BI3A 5IT9K 4I7HA 1FP2A 3H3UA 3RPUA 2BGCA 1BI0A 3D5LA 2IPQX 3L09A 4R8HA 1S3JA 1CF7B 1ZH5A 1T98A 1S8NA 3BJ6A 3KZZA 2ISYA 5IT9Z 2DFIA 5DCMB 5D4SA 2ESHA 4OIQF 1FPQA 3LAJA 1FBQA 3JAMK 2HR3A 3CO7C 3GVAA 2HEOA 5E18F 3CUQB 4GYGA 3QP6A 4FX4A 4UVBA 1U78A 3BJOA 1Z05A 4ESJA 4HX8A 3FMSA 5K5RA 4YFKF 2XRNA 2P5KA 3FMRA 2Q0OA 2EV5A 1F4KA 5HVQC 2BBYA 3N4MA 3SQNA 4RB0A 2O0YA 1R58A 2EWNA 4WXHA 5AONA 5J8FA 2RKHA 3K1MA 5HLHA 3DXJF 1O3SA 1IXSB 2RV8A 2OZUA 4AIJA 4GO1A 5DV5A 4PDKA 5ERIA 4M6YA 1EH7A 5ILUA 5A2QK 3KP6A 4U0VA 1CF7A 5E1ZB 3C1DA 3MCZA 4U7DA 3E97A 1BC7C 3ZMTA 4L9NA 4HOBA 3E5QA 5KVRA 2VXZA 3U1DA 1XGMA 3PQJA 3I0TA 3MQ0A 5FB2A 2VBZA 2XKOA 1FBUA 2F5EA 2XGXA 3RYPA 1R22A 4EJVA 4UHTA 1OYIA 2JRTA 3TGNA 4XLNF 5FLXZ 4U7BA 1P2FA 1ZG5A 1YS6A 4HV5A 1O7LA 1FY7A 5D8KB 2XROA 2IP2A 3I53A 3LA2A 3IWZA 3IC7A 3N97A 3KP2A 1T2KA 1BI1A 3E6MA 3SZPA 1KQ9A 3HHHA 5CVJA 5LGTA 4LD5A 2EK5A 3F8BA 1SD5A 2H27A 3EYYA 5F1RA 1R1UA 3BJAA 4Y17A 1WSUA 2M45A 3IKVA 3CUQA 2EJRA 2XAFA 4YIIA 3HIFA 1ZG1A 4JK1X 2A5YB 6PAXA 4KA4A 3FXRA 3L2CA 4XBFA 1K79A 2W57A 2FSWA 3EDPA 2QYOA 5HLGA 2GAUA 2ZMEA 1LDKB 2LF8A 2YU3A 1A04A 2H6BA 2RNJA 1IXCA 3F23A 2NRAC 4LLGF 4I0AA 5E8GA 3RKWA 4ENJA 2ZO4A 3NRVA 2FE3A 4I98B 4CZZA 5L3GA 3Q9VA 1XGSA 2EA2A 4ENKA 1H0MA 2DPDA 3SZTA 3T1BA 1G3WA 1FP1D 1KU2A 2STTA 1T0FA 2GA2A 2ZXJA 2DT5A 3F8NA 3MZYA 3IRRA 4I02A 5EEHA 4OIRF 3U9GA 1RI7A 2ELHA 2ETHA 2PG4A 2OZ6A 2P7VB 3DFGA 4B8XA 3FM5A 4DNCA 2HS5A 1EH6A 3GFIA 3TO7A 2QBYB 4KN4X 1K7AA 5D6EA 1ON2A 1TNTA 2VC1A 4MTDA 4GYIA 2OQGA 5ED4A 1HKSA 1RZ4A 1I1GA 1GXQA 4FX0A 5LLQA 4BYYA 4PCQA 2AS5F 4KIBA 2Z33A 4IHSA 4L0ZB 5ILVA 3RIRA 3O6BB 2M1BA 2VE9A 3QPTA 3V8LA 1J5YA 1I6XA 5K1YA 1PP7U 3F6OA 5JHUA 3ZMZA 3I4PA 1CGPA 2VE8A 3LWFA 3L00A 4EJOA 1XSDA 4F7ZA 1IN6A 4HDVA 3GX4X 3TKYA 1YQAA 2HZTA 3FHZA 4Q48A 1JHHA 1XMKA 5HS8A 2QBYA 2P5VA 2XHKA 2EB7A 1HXDA 4PGHA 2HTJA 1LJ9A 3DP7A 3LA3A 5ICFA 3JTGA 3P9CA 1BJAA 4M9SA 4BHPA 4CXFA 4ASNA 4RS8A 1B9NA 5HDGA 3TOAA 2EFQA 2B0LA 5LHGA 3JTHA 1XDUA 5BQTA 3BPVA 3W6JB 3K0LA 4KFCA 2VOOA 4AVPA 4LLLA 5E8IA 1QO0D 5LEKA 2CG4A 4HF1A 2BE5F 2PBIA 4ESFA 2DLLA 1YLFA 3DEUA 5DEQA 1GXPA 3U2RA 1KA8A 3EYIA 1XB4A 1J9IA 2VODA 1LQ1A 1HW1A 3EETA 3QU3A 2A6HF 2Z5UA 5KK1A 3R0JA 4EMSA 1K78A 1I1SA 2A61A 1OR7A 3KETA 1Z6RA 5H20A 4HW0A 1Z6TA 2PQ8A 4ZH4F 3V7RA 4HDUA 2A07F 2LDUA 2ZMEB 4WXDA 3I59B 4A2UA 2BEOA 1IN8A 1ONVA 1OPCA 2KJBA 3GFMA 1ZRCA 2VT2A 1SFEA 2ZCWA 3RKXA 2FMLA 4QWQA 4KMFA 4YFNF 5J8CA 2XAQA 1IF1A 1B59A 5FFXA 4LG0A 1XCVA 2JTVA 4OOIA 2EFPA 1FYKA 1TLHB 4KYWA 4ENMA 1H9GA 1U3EM 4IPAA 1ZG3A 4PZJA 5L3DA 2XASA 2K7LA 4QLCU 4ESBA 4HZFA 2WV0A 5TRDA 3ECHA 4HQMA 2FQ3A 3KLNA 2FA5A 2ZNZA 4EM0B 1DDNA 4R79A 2X0LA 2EV6A 2EFNA 4N0BA 4A6DA 3OOPA 3WTYC 4Y13A 2RDPA 2L3DA 3IHUA 1IN4A 4A0XA 5DYMA 3FXUA 2GQQA 3B02A 1KYWA 1MJBA 3I58A 5E1XA 2QVOA 2CW0F 4YFXF 3TO6A 5ICEA 1YW7A 1U5TC 2QWWA 2J5OA 2ESNA 1Z7UA 5H6QA 1ON1A 5L3BA 4MEXF 4A5MA 3R61A 2IRFG 4GXOA 1LB2A 5JVTA 2NYXA 4KN7X 5DD4A 3QP5A 1U5TA 1ZREA 1Q1HA 5DUIA 2H6CA 1NHAA 5AIPA 3RDIA 1E2XA 2ADUA 2K02A 3WODF 2RGVA 5HS7A 3DKWA 5D4RA 3CO6C 3E5XA 2M8EA 2DU9A 2V79A 1J0RA 4S05A 4FHTA 4L9JA 4CGZA 2KRFA 1I27A 2RC4A 2V1XA 2JPBA 1EV7A 1AWCA 3TQNA 4OIOF 3PQKA 1D3YA 2GWRA 5AIQA 2FOKA 4AIKA 4YG2F 3ZMUA 4A0ZA 4ETSA 2HFHA 3WGHA 3F8CA 3ELKA 4CDGA 4OU0A 1ULYA 2GZWA 3TO9A 3KCCA 4KDPA 1ZYRF 2Z9OA 5CVIA 4CICA 1S7AA 1TTYA 3W6KB 4M73A 3GYHX 3QAHA 4KIFA 5D5VB 4U88A 3B73A 1WRJA 3QOPA 4P5OA 4Q47A 4CYDA 1MD0A 5LGUA 4ON0A 4MHGA 5H6RA 4ZZDA 3ZN0A 2BYVE 3FM3A 5DDGA 3P7NA 2EFOA 4A0YA 4N9IA 1J7KA 4JQFA 3Q9SA 3RPQA 1DPRA 4UV9A 5BOXA 5D8LB 1B6AA 3GO5A 4M9ZA 3ROUA 3S2WA 1OYYA 3HRUA 2NAZA 4G94A 5BS6A 2PFBA 2E7XA 1ZRDA 3V8KA 3M9AA 3COAC 3ABTA 4KIGA 1R36A 2DQRA 2CO5A 3ZP5A 2HYGD 2Q2EA 2OD5A 1F9NA 4G7ZF 2IT0A 2XKPA 1FYMA 1IAWA 4EM1A 1JGSA 2OBPA 1LDJA 3F72A 4EQQA 3L9FA 4UNOA 4A12A 3VFZA 3DPTA 2FNPA 2ACJA 4XSXF 2KJCA 3E3VA 2EA4A 4RAYA 2WWYA 4WCGA 1TW3A 4LG0B 3K1PA 2ZBKA 2L01A 1WQ2A 2QUFA 1FNNA 3REOA 3WTZA 3WTXC 3VOEA 2HKOA 1ZGJA 2F5DA 3KEOA 1UHMA 1FX7A 2CFXA 2W25A 3AAFA 4OINF 5CVVA 2P8TA 3NQOA 4MEYF 1O3TA 1U6GA 2DK8A 4I2OA 5LBQA 4A6EA 1QZYA 3HTSB 4BNCA 2R7FA 4M72A 4XLPF 2KIFA 1FZPB 1IRGA 1D5VA 1BOAA 2OU2A 2FXAA 3V4GA 2FF4A 3ERED 3D0SA 2FMYA 3ULQB 2GIVA 2VC0A 1XSVA 4UV8A 1IRFA 2XAJA 4L5JA 3I64A 2AXLA 2PI0A 2C6YA 1O3QA 2MH2A 1P4AA 4L9TA 4PGGA 3O2PE 4RGUA 3FXQA 3PFIA 1SD6A 1YIOA 3CLOA 1HBXG 2NS0A 1S6LA 2A6EF 2G7UA 5E1WA 3M7GA 3CUOA 3RYRA 3BY6A 4KT5C 3GW2A 2CSOA 4U0YA 1G6NA 2HOEA 4EVIA 2PMHA 4BAYA 3J81Z 3ISPA 4OIPF 3JSOA 2UXNA 3R4KA 1RNLA 3HSFA 4IRHA 5HS9A 5JI6A 2W84A 4LFUA 4KMUX 4IRIA 1BN5A 2V1DA 3I5UA 1J59A 5JR3A 1STZA 1ZLJA 4LB5A 3E6BA 5HLIA 3ZMDA 3J81K 1IUYA 3DF8A 3EUHA 3R0AA 4HAMA 3DQVC 4Z2YA 2YX4A 4Q5SF 1FT9A 1I5ZA 1YS7A 3IL2A 4EGZA 3MFKA 2DK5A 5E20A 1W7PD 3ABUA 2VONA 3FX3A 3FMQA 3LQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J75 A;  2H94 A;  2DAO A;  2A3S A;  2RN7 A;  3KLO A;  2KIU A;  3Q5F A;  3V7S A;  3KP4 A;  2LKP A;  3T0Y A;  4UVA A;  3RTR A;  2E7W A;  3GZ5 A;  3P9K A;  4YIF A;  1P6R A;  2O03 A;  4RAZ A;  1Z1D A;  1ZGA A;  2HTS A;  2XUB A;  3KFW X;  4P55 A;  4I0B A;  3GFJ A;  3JSP A;  5E17 F;  2FBH A;  2V6C A;  2M87 A;  4N9H A;  1U5T B;  3ZPL A;  4HF0 A;  5CYV A;  3LAP A;  1V4R A;  3WTS C;  3L7W A;  1BBY A;  1TNS A;  1MDM B;  1P4X A;  4HLY A;  2MLK A;  3CDH A;  3GEZ A;  1HSJ A;  3K1N A;  3IWF A;  4DQ2 A;  3VB2 A;  2E1C A;  2XIG A;  5LEJ A;  2L4A A;  2MD5 A;  1BC8 C;  2IA2 A;  3BPX A;  4R1H A;  2CGP A;  1JXS A;  4P96 A;  5FFZ A;  4HX7 A;  2ZJ2 A;  2EFW A;  2PEX A;  4WK8 F;  4XSZ F;  3BRO A;  4LK1 F;  3R60 A;  1R00 A;  3QPH A;  1FWZ A;  2OAZ A;  4ZYG A;  2Z99 A;  1TQI A;  2JSC A;  4EV0 A;  2DW4 A;  1HKT A;  2QM3 A;  1O3R A;  4S04 A;  2EV0 A;  2Y48 A;  4CHU A;  3WG9 A;  3HHG A;  2D1V A;  3H3Z A;  2D2W A;  5CJ9 A;  2O6G E;  2Y75 A;  4CO8 A;  1EH8 A;  5FD5 A;  2YR2 A;  2PMU A;  2UWM A;  1F1Z A;  2XAG A;  3CTA A;  3G73 A;  1BIA A;  3HOT A;  2ZFW A;  4O3M A;  5K5O A;  3F8M A;  2LNB A;  2VBX A;  2MH9 A;  3E6D A;  1R7J A;  1U8R A;  3WTW C;  4UVC A;  1YYV A;  2O61 A;  4RGS A;  1XD7 A;  1KU3 A;  2VBW A;  4HQE A;  4LJZ F;  1VTN C;  3QRF F;  3GF2 A;  4GCV A;  5HOO A;  3G3Z A;  3GLX A;  5FLX K;  3HYI A;  1SFX A;  4MTE A;  4NB5 A;  1SD4 A;  3HUG A;  3KP7 A;  4BQA A;  1HW5 A;  2PLY A;  1TW2 A;  5BPI A;  2UZK A;  4EJT A;  3F3X A;  3OV8 A;  2CQK A;  1E17 A;  2GA1 A;  4OMY A;  3EQL F;  3TOB A;  1W7P B;  2GXB A;  4IXA A;  4AWX B;  2UXX A;  3WGI A;  2L4M A;  2IJL A;  1OMI A;  2F5C A;  2A69 F;  5A2Q Z;  3F22 A;  1MKM A;  2PJP A;  4HYE A;  1KU7 A;  3T5X A;  5DCF A;  3HTU A;  1G4D A;  2HDC A;  2R3S A;  4RGR A;  3LA7 A;  2FBI A;  1FBS A;  3MAJ A;  4RB3 C;  4RB1 A;  4BHC A;  4D0P A;  1YW9 A;  3F21 A;  3FWE A;  4HBL A;  2JT1 A;  3ZQ7 A;  4HX4 A;  1USS A;  1ZAR A;  1JHF A;  3GXO A;  2DTR A;  4MQV A;  4RGX A;  4A5N A;  4BHB A;  2IA1 A;  5FO5 A;  1FLI A;  2QQB A;  2JPC A;  1T38 A;  1PP8 F;  3TDZ C;  2OA4 A;  4G7H F;  4ZZL A;  2K27 A;  4H0E A;  4WWC A;  1AOY A;  2RQP A;  3F6V A;  2VBY A;  4JBA A;  2FU4 A;  1TQM A;  1PDN C;  3O3K A;  2DPU A;  2MC3 A;  1WWX A;  2HQN A;  1WI9 A;  1YTY A;  1O57 A;  2MLG A;  2XAH A;  4HV6 A;  2DO7 A;  4MGR A;  1LDD A;  3MZH A;  4ZYD A;  2HKX A;  2FRH A;  1Y0U A;  2Y0M A;  1MGT A;  2PN6 A;  3HSE A;  3RJP A;  2V1U A;  3MEX A;  3TDU C;  4MNU A;  1UST A;  4G8X A;  3ZMS A;  1XDS A;  5L3C A;  2W85 A;  3R6S A;  4ENN A;  3HSR A;  3WTV C;  3VOD A;  2D45 A;  1LEA A;  2STW A;  1HST A;  1SFU A;  1UFM A;  1BI2 A;  2NNN A;  1FSE A;  4XRF A;  2IA0 A;  4M6X A;  1KU9 A;  1ZRF A;  2MA3 A;  2YSR A;  2H09 A;  2WC2 A;  3HRM A;  1P92 A;  2A68 F;  5LGN A;  3WE3 A;  1G3Y A;  1DPU A;  1D8J A;  2HGC A;  1FSH A;  2ZKZ A;  1IN5 A;  1PUE E;  2YX7 A;  5BMZ A;  3NEU A;  1FOK A;  4P9F A;  1P4W A;  1OYW A;  4LMY A;  2Z3Y A;  1IN7 A;  3M1E A;  1O7F A;  4E70 A;  2L54 A;  2XVC A;  1IZ1 A;  2P5L C;  3DPL C;  1UHW A;  1L3L A;  2V9V A;  1MJ9 A;  5LRR A;  1XMA A;  3SFZ A;  3C3W A;  4LLN A;  1LNW A;  1K6O A;  2J5P A;  5DCM A;  3CJN A;  3GFL A;  2FNA A;  5DUK A;  3HOS A;  1REP C;  3WE2 A;  4L18 B;  1Z9C A;  3C7J A;  1ODD A;  1R23 A;  5LHI A;  2FBK A;  5ILS A;  4M71 A;  3GUD A;  3JW4 A;  3C18 A;  1OKR A;  2CYY A;  2YPR A;  1TQP A;  2VOP A;  3H92 A;  4L0Y B;  5HDN A;  1J2X A;  2QEN A;  3WGG A;  4AIH A;  1R1T A;  2O3F A;  3RKY A;  1R5G A;  3K2Z A;  1B1B A;  2GXG A;  2G9W A;  5EEG A;  2D1H A;  1MDM A;  3KP5 A;  3SXY A;  4P9U A;  3P9I A;  4I01 A;  3K9T A;  1ZHF A;  2QQA A;  3BDD A;  1W7P A;  4HA8 A;  3WTU C;  4GGG A;  2IVM A;  3KEQ A;  5F6F A;  1KQ8 A;  4TV7 A;  5DD8 A;  1RIO H;  1LEB A;  5TJJ A;  3J7A O;  1DUX C;  4G9Y A;  1RUO A;  3BP8 A;  4EGY A;  2KIM A;  3I71 A;  4M74 A;  4O6J A;  1T6S A;  1IXR C;  2QZ8 A;  3I54 A;  5CLS A;  1MZB A;  4IHT A;  4IJA A;  1B9M A;  1BIB A;  2P4W A;  2E1N A;  5D6F A;  4B09 A;  1WKM A;  2MBF A;  4UUV A;  4ZYH A;  1UCR A;  1U2W A;  5FGM A;  2DI3 A;  3RI4 A;  4Q4Z F;  4LB6 B;  2K86 A;  3HRS A;  2BV6 A;  2IW5 A;  3V7C A;  3ZMV A;  4IVN A;  3WU1 B;  4U0W A;  1ZN2 A;  3J80 Z;  3KP3 A;  4WF2 A;  4IRG A;  1HQC A;  3ECO A;  4O5V A;  2P6T A;  1YFH A;  2P6S A;  2TDX A;  4WX9 A;  1XGN A;  1YG2 A;  3HRT A;  2LSO A;  3E6C C;  5L3E A;  1QBJ A;  4G7O F;  1F5T A;  3LST A;  4I09 A;  4LGW A;  2DBB A;  1C0W A;  2WTE A;  5F64 A;  2M30 A;  5D5W B;  1S29 A;  1BM9 A;  1K78 B;  1SMT A;  1HW2 A;  1Z91 A;  2ZNY A;  4UXN A;  2G7H A;  2CWE A;  3M8E A;  5LHH A;  4K2E A;  3BZ6 A;  3CUQ C;  1FC3 A;  2KKO A;  4LK0 F;  3ZN1 A;  3E5U A;  3FF5 A;  3WU0 A;  1KYZ A;  2L02 A;  2QQ9 A;  1G3S A;  5ICC A;  3I59 A;  2W24 A;  3T8R A;  1GHC A;  1QNT A;  1IW7 F;  1HKQ A;  2COM A;  4Y15 A;  2QLZ A;  2XV4 S;  3KZY A;  1D8K A;  2VT3 A;  3MWM A;  4M9X A;  4ZYE A;  4L5I A;  4KIC A;  5ICG A;  4KUM A;  5IT3 A;  1YO5 C;  2LF7 A;  5J6X A;  4KNY A;  4NQW A;  4EJU A;  1B4A A;  3GWZ A;  2K4B A;  1G3T A;  4HLX A;  5BPD A;  1TBX A;  2NNY A;  3ML6 A;  3V8J A;  1ZLK A;  3WTT C;  1XGO A;  2F2E A;  4EM2 A;  3J80 K;  3F8F A;  1QZZ A;  1XN7 A;  3K69 A;  1SMY F;  1GVJ A;  1ZAO A;  3KE2 A;  4HF2 A;  1KGS A;  1QQI A;  3DV8 A;  3IKT A;  2DQL A;  5CVU A;  2O8X A;  3LQQ A;  1RUN A;  1QGP A;  1FYL A;  4FT8 A;  4BXU A;  1DP7 P;  1S7O A;  4AD9 A;  5D5X B;  2FEZ A;  3BOQ A;  2ISZ A;  5K5Q A;  2HQR A;  5CVR A;  2K4J A;  4L9V A;  3T8T A;  1XSX A;  1H9T A;  2R7D A;  3VEP A;  2OQR A;  4G6D A;  1V3F A;  3QU6 A;  1T39 A;  1R5H A;  1W5S A;  1UB9 A;  3LFK A;  1JE8 A;  5FD6 A;  4MQ9 F;  5L3F A;  1MJA A;  1LVA A;  5JFR A;  4G6Q A;  2M5W A;  4EJW A;  2P7C B;  2VN2 A;  3SHF A;  5LRS A;  2HWV A;  3IRQ A;  1X3U A;  4NHJ A;  5D5U B;  2HYF A;  4OMZ A;  3BWG A;  1YW8 A;  2RVC A;  3GZ6 A;  1QPM A;  4WXC A;  2X4H A;  4BH9 A;  2Q8K A;  3FZV A;  2JZY A;  1XCB A;  1W5T A;  1SD7 A;  1L0O C;  4IF4 A;  4RB2 C;  1W4M A;  1R1V A;  1SAX A;  5HDK A;  2F5F A;  3JAM Z;  1KQ0 A;  3M8F A;  1BI3 A;  5IT9 K;  4I7H A;  1FP2 A;  3H3U A;  3RPU A;  2BGC A;  1BI0 A;  3D5L A;  2IPQ X;  3L09 A;  4R8H A;  1S3J A;  1CF7 B;  1ZH5 A;  1T98 A;  1S8N A;  3BJ6 A;  3KZZ A;  2ISY A;  5IT9 Z;  2DFI A;  5DCM B;  5D4S A;  2ESH A;  4OIQ F;  1FPQ A;  3LAJ A;  1FBQ A;  3JAM K;  2HR3 A;  3CO7 C;  3GVA A;  2HEO A;  5E18 F;  3CUQ B;  4GYG A;  3QP6 A;  4FX4 A;  4UVB A;  1U78 A;  3BJO A;  1Z05 A;  4ESJ A;  4HX8 A;  3FMS A;  5K5R A;  4YFK F;  2XRN A;  2P5K A;  3FMR A;  2Q0O A;  2EV5 A;  1F4K A;  5HVQ C;  2BBY A;  3N4M A;  3SQN A;  4RB0 A;  2O0Y A;  1R58 A;  2EWN A;  4WXH A;  5AON A;  5J8F A;  2RKH A;  3K1M A;  5HLH A;  3DXJ F;  1O3S A;  1IXS B;  2RV8 A;  2OZU A;  4AIJ A;  4GO1 A;  5DV5 A;  4PDK A;  5ERI A;  4M6Y A;  1EH7 A;  5ILU A;  5A2Q K;  3KP6 A;  4U0V A;  1CF7 A;  5E1Z B;  3C1D A;  3MCZ A;  4U7D A;  3E97 A;  1BC7 C;  3ZMT A;  4L9N A;  4HOB A;  3E5Q A;  5KVR A;  2VXZ A;  3U1D A;  1XGM A;  3PQJ A;  3I0T A;  3MQ0 A;  5FB2 A;  2VBZ A;  2XKO A;  1FBU A;  2F5E A;  2XGX A;  3RYP A;  1R22 A;  4EJV A;  4UHT A;  1OYI A;  2JRT A;  3TGN A;  4XLN F;  5FLX Z;  4U7B A;  1P2F A;  1ZG5 A;  1YS6 A;  4HV5 A;  1O7L A;  1FY7 A;  5D8K B;  2XRO A;  2IP2 A;  3I53 A;  3LA2 A;  3IWZ A;  3IC7 A;  3N97 A;  3KP2 A;  1T2K A;  1BI1 A;  3E6M A;  3SZP A;  1KQ9 A;  3HHH A;  5CVJ A;  5LGT A;  4LD5 A;  2EK5 A;  3F8B A;  1SD5 A;  2H27 A;  3EYY A;  5F1R A;  1R1U A;  3BJA A;  4Y17 A;  1WSU A;  2M45 A;  3IKV A;  3CUQ A;  2EJR A;  2XAF A;  4YII A;  3HIF A;  1ZG1 A;  4JK1 X;  2A5Y B;  6PAX A;  4KA4 A;  3FXR A;  3L2C A;  4XBF A;  1K79 A;  2W57 A;  2FSW A;  3EDP A;  2QYO A;  5HLG A;  2GAU A;  2ZME A;  1LDK B;  2LF8 A;  2YU3 A;  1A04 A;  2H6B A;  2RNJ A;  1IXC A;  3F23 A;  2NRA C;  4LLG F;  4I0A A;  5E8G A;  3RKW A;  4ENJ A;  2ZO4 A;  3NRV A;  2FE3 A;  4I98 B;  4CZZ A;  5L3G A;  3Q9V A;  1XGS A;  2EA2 A;  4ENK A;  1H0M A;  2DPD A;  3SZT A;  3T1B A;  1G3W A;  1FP1 D;  1KU2 A;  2STT A;  1T0F A;  2GA2 A;  2ZXJ A;  2DT5 A;  3F8N A;  3MZY A;  3IRR A;  4I02 A;  5EEH A;  4OIR F;  3U9G A;  1RI7 A;  2ELH A;  2ETH A;  2PG4 A;  2OZ6 A;  2P7V B;  3DFG A;  4B8X A;  3FM5 A;  4DNC A;  2HS5 A;  1EH6 A;  3GFI A;  3TO7 A;  2QBY B;  4KN4 X;  1K7A A;  5D6E A;  1ON2 A;  1TNT A;  2VC1 A;  4MTD A;  4GYI A;  2OQG A;  5ED4 A;  1HKS A;  1RZ4 A;  1I1G A;  1GXQ A;  4FX0 A;  5LLQ A;  4BYY A;  4PCQ A;  2AS5 F;  4KIB A;  2Z33 A;  4IHS A;  4L0Z B;  5ILV A;  3RIR A;  3O6B B;  2M1B A;  2VE9 A;  3QPT A;  3V8L A;  1J5Y A;  1I6X A;  5K1Y A;  1PP7 U;  3F6O A;  5JHU A;  3ZMZ A;  3I4P A;  1CGP A;  2VE8 A;  3LWF A;  3L00 A;  4EJO A;  1XSD A;  4F7Z A;  1IN6 A;  4HDV A;  3GX4 X;  3TKY A;  1YQA A;  2HZT A;  3FHZ A;  4Q48 A;  1JHH A;  1XMK A;  5HS8 A;  2QBY A;  2P5V A;  2XHK A;  2EB7 A;  1HXD A;  4PGH A;  2HTJ A;  1LJ9 A;  3DP7 A;  3LA3 A;  5ICF A;  3JTG A;  3P9C A;  1BJA A;  4M9S A;  4BHP A;  4CXF A;  4ASN A;  4RS8 A;  1B9N A;  5HDG A;  3TOA A;  2EFQ A;  2B0L A;  5LHG A;  3JTH A;  1XDU A;  5BQT A;  3BPV A;  3W6J B;  3K0L A;  4KFC A;  2VOO A;  4AVP A;  4LLL A;  5E8I A;  1QO0 D;  5LEK A;  2CG4 A;  4HF1 A;  2BE5 F;  2PBI A;  4ESF A;  2DLL A;  1YLF A;  3DEU A;  5DEQ A;  1GXP A;  3U2R A;  1KA8 A;  3EYI A;  1XB4 A;  1J9I A;  2VOD A;  1LQ1 A;  1HW1 A;  3EET A;  3QU3 A;  2A6H F;  2Z5U A;  5KK1 A;  3R0J A;  4EMS A;  1K78 A;  1I1S A;  2A61 A;  1OR7 A;  3KET A;  1Z6R A;  5H20 A;  4HW0 A;  1Z6T A;  2PQ8 A;  4ZH4 F;  3V7R A;  4HDU A;  2A07 F;  2LDU A;  2ZME B;  4WXD A;  3I59 B;  4A2U A;  2BEO A;  1IN8 A;  1ONV A;  1OPC A;  2KJB A;  3GFM A;  1ZRC A;  2VT2 A;  1SFE A;  2ZCW A;  3RKX A;  2FML A;  4QWQ A;  4KMF A;  4YFN F;  5J8C A;  2XAQ A;  1IF1 A;  1B59 A;  5FFX A;  4LG0 A;  1XCV A;  2JTV A;  4OOI A;  2EFP A;  1FYK A;  1TLH B;  4KYW A;  4ENM A;  1H9G A;  1U3E M;  4IPA A;  1ZG3 A;  4PZJ A;  5L3D A;  2XAS A;  2K7L A;  4QLC U;  4ESB A;  4HZF A;  2WV0 A;  5TRD A;  3ECH A;  4HQM A;  2FQ3 A;  3KLN A;  2FA5 A;  2ZNZ A;  4EM0 B;  1DDN A;  4R79 A;  2X0L A;  2EV6 A;  2EFN A;  4N0B A;  4A6D A;  3OOP A;  3WTY C;  4Y13 A;  2RDP A;  2L3D A;  3IHU A;  1IN4 A;  4A0X A;  5DYM A;  3FXU A;  2GQQ A;  3B02 A;  1KYW A;  1MJB A;  3I58 A;  5E1X A;  2QVO A;  2CW0 F;  4YFX F;  3TO6 A;  5ICE A;  1YW7 A;  1U5T C;  2QWW A;  2J5O A;  2ESN A;  1Z7U A;  5H6Q A;  1ON1 A;  5L3B A;  4MEX F;  4A5M A;  3R61 A;  2IRF G;  4GXO A;  1LB2 A;  5JVT A;  2NYX A;  4KN7 X;  5DD4 A;  3QP5 A;  1U5T A;  1ZRE A;  1Q1H A;  5DUI A;  2H6C A;  1NHA A;  5AIP A;  3RDI A;  1E2X A;  2ADU A;  2K02 A;  3WOD F;  2RGV A;  5HS7 A;  3DKW A;  5D4R A;  3CO6 C;  3E5X A;  2M8E A;  2DU9 A;  2V79 A;  1J0R A;  4S05 A;  4FHT A;  4L9J A;  4CGZ A;  2KRF A;  1I27 A;  2RC4 A;  2V1X A;  2JPB A;  1EV7 A;  1AWC A;  3TQN A;  4OIO F;  3PQK A;  1D3Y A;  2GWR A;  5AIQ A;  2FOK A;  4AIK A;  4YG2 F;  3ZMU A;  4A0Z A;  4ETS A;  2HFH A;  3WGH A;  3F8C A;  3ELK A;  4CDG A;  4OU0 A;  1ULY A;  2GZW A;  3TO9 A;  3KCC A;  4KDP A;  1ZYR F;  2Z9O A;  5CVI A;  4CIC A;  1S7A A;  1TTY A;  3W6K B;  4M73 A;  3GYH X;  3QAH A;  4KIF A;  5D5V B;  4U88 A;  3B73 A;  1WRJ A;  3QOP A;  4P5O A;  4Q47 A;  4CYD A;  1MD0 A;  5LGU A;  4ON0 A;  4MHG A;  5H6R A;  4ZZD A;  3ZN0 A;  2BYV E;  3FM3 A;  5DDG A;  3P7N A;  2EFO A;  4A0Y A;  4N9I A;  1J7K A;  4JQF A;  3Q9S A;  3RPQ A;  1DPR A;  4UV9 A;  5BOX A;  5D8L B;  1B6A A;  3GO5 A;  4M9Z A;  3ROU A;  3S2W A;  1OYY A;  3HRU A;  2NAZ A;  4G94 A;  5BS6 A;  2PFB A;  2E7X A;  1ZRD A;  3V8K A;  3M9A A;  3COA C;  3ABT A;  4KIG A;  1R36 A;  2DQR A;  2CO5 A;  3ZP5 A;  2HYG D;  2Q2E A;  2OD5 A;  1F9N A;  4G7Z F;  2IT0 A;  2XKP A;  1FYM A;  1IAW A;  4EM1 A;  1JGS A;  2OBP A;  1LDJ A;  3F72 A;  4EQQ A;  3L9F A;  4UNO A;  4A12 A;  3VFZ A;  3DPT A;  2FNP A;  2ACJ A;  4XSX F;  2KJC A;  3E3V A;  2EA4 A;  4RAY A;  2WWY A;  4WCG A;  1TW3 A;  4LG0 B;  3K1P A;  2ZBK A;  2L01 A;  1WQ2 A;  2QUF A;  1FNN A;  3REO A;  3WTZ A;  3WTX C;  3VOE A;  2HKO A;  1ZGJ A;  2F5D A;  3KEO A;  1UHM A;  1FX7 A;  2CFX A;  2W25 A;  3AAF A;  4OIN F;  5CVV A;  2P8T A;  3NQO A;  4MEY F;  1O3T A;  1U6G A;  2DK8 A;  4I2O A;  5LBQ A;  4A6E A;  1QZY A;  3HTS B;  4BNC A;  2R7F A;  4M72 A;  4XLP F;  2KIF A;  1FZP B;  1IRG A;  1D5V A;  1BOA A;  2OU2 A;  2FXA A;  3V4G A;  2FF4 A;  3ERE D;  3D0S A;  2FMY A;  3ULQ B;  2GIV A;  2VC0 A;  1XSV A;  4UV8 A;  1IRF A;  2XAJ A;  4L5J A;  3I64 A;  2AXL A;  2PI0 A;  2C6Y A;  1O3Q A;  2MH2 A;  1P4A A;  4L9T A;  4PGG A;  3O2P E;  4RGU A;  3FXQ A;  3PFI A;  1SD6 A;  1YIO A;  3CLO A;  1HBX G;  2NS0 A;  1S6L A;  2A6E F;  2G7U A;  5E1W A;  3M7G A;  3CUO A;  3RYR A;  3BY6 A;  4KT5 C;  3GW2 A;  2CSO A;  4U0Y A;  1G6N A;  2HOE A;  4EVI A;  2PMH A;  4BAY A;  3J81 Z;  3ISP A;  4OIP F;  3JSO A;  2UXN A;  3R4K A;  1RNL A;  3HSF A;  4IRH A;  5HS9 A;  5JI6 A;  2W84 A;  4LFU A;  4KMU X;  4IRI A;  1BN5 A;  2V1D A;  3I5U A;  1J59 A;  5JR3 A;  1STZ A;  1ZLJ A;  4LB5 A;  3E6B A;  5HLI A;  3ZMD A;  3J81 K;  1IUY A;  3DF8 A;  3EUH A;  3R0A A;  4HAM A;  3DQV C;  4Z2Y A;  2YX4 A;  4Q5S F;  1FT9 A;  1I5Z A;  1YS7 A;  3IL2 A;  4EGZ A;  3MFK A;  2DK5 A;  5E20 A;  1W7P D;  3ABU A;  2VON A;  3FX3 A;  3FMQ A;  3LQR A; 
#chains in the Genus database with same CATH topology
 1J75 A;  2H94 A;  1K4T A;  2DAO A;  3CF2 A;  2A3S A;  4NNJ A;  2RN7 A;  3KLO A;  2KIU A;  5GPA A;  3Q5F A;  3V7S A;  1JKR C;  3KP4 A;  2LKP A;  2A5W A;  3T0Y A;  1OCZ H;  2CRG A;  4UVA A;  3RTR A;  3JRD A;  2E7W A;  3FXM A;  3GZ5 A;  3P9K A;  4DYQ A;  1H89 C;  4YIF A;  3Q0W A;  2XSJ C;  3SFI A;  4A3G J;  1P6R A;  5J4V A;  2O03 A;  1I50 J;  4RAZ A;  5GPC A;  2DDA A;  1Z1D A;  3Q3S A;  1ZGA A;  2HTS A;  2XUB A;  1U9O A;  3KFW X;  1Y8Q B;  4P55 A;  4I0B A;  3DU5 A;  2NS8 A;  4IL6 C;  3GFJ A;  3JSP A;  5E17 F;  2FBH A;  3SEQ A;  3IH3 A;  1WHU A;  1IDY A;  2V6C A;  3LSR A;  3LSM A;  2M87 A;  2ZSH B;  4N9H A;  1VQP I;  4PJN A;  1U5T B;  3BR3 A;  1D1A A;  3ZPL A;  4HF0 A;  2DXI A;  1WI3 A;  5CYV A;  1V4R A;  4XKB A;  3LAP A;  9ANT A;  3WTS C;  1ACI A;  3L7W A;  3GME A;  2QCO A;  3H3V K;  3OIO A;  1BBY A;  4BJT A;  1TNS A;  1MDM B;  1P4X A;  4C3I J;  4I99 C;  2M0C A;  2MLK A;  4HLY A;  3CDH A;  3GEZ A;  1HSJ A;  3PNT A;  1WH7 A;  4BXX J;  3K1N A;  2E1M C;  3IWF A;  4DQ2 A;  2WB1 N;  3VB2 A;  2LK2 A;  2E1C A;  2K3F A;  1UZC A;  2XIG A;  5LEJ A;  1X1D A;  2L4A A;  4F52 A;  1R6R A;  2MD5 A;  2IS2 A;  2IS4 A;  1BC8 C;  1X2M A;  2IA2 A;  3HZJ A;  3BPX A;  1YJN I;  4R1H A;  2CGP A;  1JXS A;  4P96 A;  3G1O A;  5FFZ A;  4AVZ A;  3DEE A;  4HX7 A;  3J7Y J;  2ZJ2 A;  3ZQF A;  3QOD A;  4YEL A;  2KT0 A;  2EFW A;  4ITV A;  1NTC A;  2PEX A;  3TED A;  4WK8 F;  3K70 D;  4XSZ F;  4XN3 A;  1NG6 A;  3BRO A;  4LK1 F;  3JRF A;  3CCJ I;  3R60 A;  1R00 A;  3QPH A;  1FWZ A;  2OAZ A;  1NH3 A;  1H8A C;  2VAS A;  3LMM A;  4ZYG A;  2Z99 A;  3IH4 A;  1UHS A;  3L2W A;  3GZN B;  1K6Y A;  3CCS I;  1LFU P;  3AL0 B;  4PJL A;  1TQI A;  2JSC A;  4EV0 A;  2DW4 A;  1HKT A;  1JTX A;  4MIM A;  2PMZ N;  2QM3 A;  1O3R A;  2ECB A;  3PUB A;  4S04 A;  2KMU A;  1TWH J;  2EV0 A;  3RPU D;  4CCL A;  2Y48 A;  3S32 A;  4CHU A;  3WG9 A;  3HHG A;  2D1V A;  3CJQ B;  1V54 H;  3H9Q A;  3QPS A;  2L9V A;  3H3Z A;  2D2W A;  5CJ9 A;  4DGW B;  2O6G E;  3BG9 A;  3LL7 A;  1OCO H;  2Y75 A;  5IYD J;  2LRD A;  4A3F J;  4CO8 A;  1EH8 A;  5H2F C;  2VXD A;  4HNT A;  1G2H A;  2IXS A;  5FD5 A;  2MG4 A;  2R5Y B;  3CJT B;  2YR2 A;  1D0Z A;  3H1C A;  1MBJ A;  2PMU A;  5IYC J;  2UWM A;  1F1Z A;  2XAG A;  3CTA A;  3G73 A;  1BIA A;  3L2V A;  4B43 A;  3HOT A;  2ZFW A;  3OYB A;  5HNH A;  4O3M A;  5K5O A;  3F8M A;  3K7A J;  2LNB A;  1YOV B;  2VBX A;  3TBI A;  2HOA A;  2BW3 A;  1N25 A;  5EYR A;  2MH9 A;  3S1M J;  3E6D A;  1R7J A;  2W1O A;  1A31 A;  3JCU C;  4XOP A;  2M0M A;  2XPW A;  2NVQ J;  1U8R A;  4UY8 I;  2AQE A;  3ABK H;  3WTW C;  4UVC A;  1YYV A;  2EBI A;  1A35 A;  4YIR X;  2O61 A;  4RGS A;  4N4N B;  1XD7 A;  3D5S C;  1KU3 A;  2VBW A;  4HQE A;  1P9Q C;  1N78 A;  2LFB A;  4LJZ F;  1VTN C;  3QRF F;  4X1E A;  1TP4 A;  2HNH A;  5FKK A;  3GF2 A;  4GCV A;  5HOO A;  3G3Z A;  3GLX A;  5FLX K;  3HYI A;  5F04 A;  2NVU B;  1SFX A;  1ZK8 A;  2HXO A;  4MTE A;  4BS9 A;  4NB5 A;  3GTQ J;  1SD4 A;  1OFC X;  1R49 A;  2VQG A;  3TW7 A;  3HUG A;  3KP7 A;  3ZQC A;  1PUF A;  1HW5 A;  2R5Z A;  1W36 C;  2PLY A;  4BQA A;  4IHX A;  1TW2 A;  5BPI A;  2UZK A;  4EJT A;  1QU3 A;  2JSP A;  3F3X A;  1WJE A;  2LY1 A;  2R7O A;  3OV8 A;  1R71 A;  2CQK A;  2DMU A;  5M3F J;  1E17 A;  3FKI J;  2GA1 A;  4M3G A;  3DWL E;  4OMY A;  2FOW A;  3EQL F;  3TOB A;  1W7P B;  2GXB A;  4IXA A;  1UMQ A;  4AWX B;  4J19 A;  2E35 A;  2UXX A;  1HCR A;  2OPT A;  1VQL I;  3AL0 C;  3WGI A;  1ETQ A;  2B7E A;  4XLF A;  2L4M A;  1SFO J;  2IJL A;  4XR6 A;  1OMI A;  1Y6I A;  4B3A A;  5LFA A;  2F5C A;  2A69 F;  3Q0U A;  5A2Q Z;  3I4M J;  3S3N A;  1JKO C;  3F22 A;  1IRX A;  2Z1D A;  2DOD A;  1MKM A;  2M4K A;  2PJP A;  4HYE A;  1KU7 A;  3CP8 A;  1ZQ3 P;  3HKZ N;  3T5X A;  1I3A A;  5J47 A;  5DCF A;  1HC8 A;  1Y8R B;  3HTU A;  1SFK A;  1G4D A;  2HDC A;  3MKZ A;  2KDZ A;  2Y0S N;  2R3S A;  1N77 A;  4RGR A;  1SVL A;  5FKN A;  3KPH A;  3HOV J;  2DYR H;  4IQ4 A;  4DIQ A;  1MMG A;  3LA7 A;  2FBI A;  4DW6 A;  1FBS A;  1ZR4 A;  3MAJ A;  4RB3 C;  4RB1 A;  2IGM A;  4BHC A;  4D0P A;  3C2B A;  5M5Y J;  2TCT A;  4XKW A;  1YW9 A;  3DBR B;  3F21 A;  3FWE A;  2LYC A;  3FIS A;  1I6H J;  4HBL A;  2JT1 A;  3CME I;  2BY3 A;  3ZQ7 A;  5F08 A;  4HX4 A;  1USS A;  4X0G A;  1ZAR A;  3A0B C;  4XMY A;  1JHF A;  2VB6 A;  1S7E A;  4IOA F;  1RET A;  3HEF A;  4BY7 J;  3GXO A;  2DTR A;  3HDD A;  4C9Y A;  4CUG A;  2NXN B;  2Y30 A;  4MQV A;  4RGX A;  4A5N A;  3AFH A;  2DN0 A;  2CS3 A;  4BHB A;  2IA1 A;  1HLV A;  5FO5 A;  5J1R A;  4IX7 A;  2HU9 A;  5IY5 H;  1FLI A;  2QQB A;  2P81 A;  4ZDP A;  3A2K A;  2JPC A;  1T38 A;  3PM1 A;  2VJ5 A;  2K9N A;  3DCF A;  4II3 A;  1PP8 F;  3TDZ C;  3QYE A;  2OA4 A;  2JQ7 A;  2LTP A;  3K70 C;  4G7H F;  4ZZL A;  1VQ7 I;  3IH2 A;  5GTH C;  2K27 A;  3L2Q A;  4H0E A;  3VDX A;  4WWC A;  4F91 B;  1AOY A;  3I56 I;  3HGG A;  2H1L A;  3DU6 A;  3M1C A;  2RQP A;  1V5E A;  2VBY A;  3F6V A;  3QPL A;  1IGN A;  1D1B A;  4JBA A;  5IP9 J;  2FU4 A;  1TQM A;  2Q2E B;  2K40 A;  1PDN C;  2CV2 A;  1NK2 P;  1X4O A;  3O3K A;  2DPU A;  2MC3 A;  1PYV A;  3A03 A;  1WWX A;  2HQN A;  1WI9 A;  1YTY A;  2E19 A;  1O57 A;  3QYB A;  2MLG A;  2GOM A;  3A01 B;  2IGN A;  1X58 A;  1V55 H;  2XAH A;  1EJ9 A;  4HV6 A;  2DO7 A;  4MGR A;  1LDD A;  3MZH A;  4ZYD A;  2HKX A;  2FRH A;  1Y0U A;  2Y0M A;  1EA3 A;  1MGT A;  2PN6 A;  2H8R A;  2KDO A;  2NVX J;  1TC3 C;  5GAH J;  3HSE A;  3RJP A;  3OYE A;  3MEX A;  2V1U A;  3TDU C;  3HM5 A;  5B3S H;  4MNU A;  3DTE A;  1UST A;  4G8X A;  3ZMS A;  1RES A;  1XDS A;  5L3C A;  1RC9 A;  2W85 A;  3R6S A;  2K85 A;  3CQZ J;  3BTL A;  4ENN A;  2CJJ A;  4ZJZ A;  3Q0V A;  2X51 A;  3HSR A;  3WTV C;  3QOE A;  2VJI A;  3W2W A;  3VOD A;  3SDB A;  2D45 A;  1LEA A;  4M3F A;  2STW A;  3S8P A;  1HST A;  3OSG A;  2JUC A;  2JA7 J;  1IO2 A;  1SFU A;  1UFM A;  3AG3 H;  4Y3O A;  3CCU I;  4IEJ A;  1BI2 A;  1MMS A;  2NNN A;  2G0E A;  4HNV A;  1YRN B;  1VQ5 I;  2EZH A;  1FSE A;  4XRF A;  2IA0 A;  1X3W B;  4M6X A;  1KU9 A;  1R4M B;  1ZRF A;  1Y1W J;  2MA3 A;  2GXA A;  2CUF A;  3CDL A;  4NDL A;  2YSR A;  2H09 A;  4XID A;  1BW6 A;  2WC2 A;  3OYA A;  3HRM A;  1P92 A;  2A68 F;  5LGN A;  1IRZ A;  4XRM A;  1G3Y A;  3WE3 A;  2BW3 B;  2MGQ A;  1DPU A;  4BDZ A;  1D8J A;  2HGC A;  2VQH A;  1FSH A;  2ZKZ A;  5EG0 A;  1IN5 A;  3JRG A;  1PUE E;  2YX7 A;  5BMZ A;  3NEU A;  1FOK A;  2NVT J;  3PL8 A;  4P9F A;  1P4W A;  2IBD A;  4DJA A;  3TMO A;  1OYW A;  4A3J J;  2R5Y A;  2KRH A;  4LMY A;  3S14 J;  2Z3Y A;  1IN7 A;  2XGE A;  4A3I J;  3M1E A;  2BOL A;  1O7F A;  3WG7 H;  3CF5 F;  4E70 A;  2XVC A;  1WGX A;  2L54 A;  1IZ1 A;  2P5L C;  2JN6 A;  1T0F C;  2BY2 A;  2KFD A;  3QYF A;  4D1Q A;  3DPL C;  1UHW A;  1L3L A;  2V9V A;  1MJ9 A;  5LRR A;  3LSJ A;  3LSG A;  1XMA A;  3SFZ A;  3C3W A;  2HPM A;  4LLN A;  1LNW A;  1Q1V A;  1K6O A;  1D5Y A;  2J5P A;  5DCM A;  3CJN A;  3GFL A;  2FNA A;  2VJJ A;  3HXL A;  5DUK A;  3HOS A;  2F4M B;  1REP C;  3V42 A;  3WE2 A;  2KIQ A;  4L18 B;  1Z9C A;  3MKW B;  2WY7 Q;  3C7J A;  1ODD A;  1R23 A;  5LHI A;  2LKS A;  4RA2 A;  2FBK A;  1RRJ A;  2JA6 J;  5ILS A;  4NC6 A;  2RQQ A;  2FUG 2;  1ETV A;  4M71 A;  5B1B H;  2ZB9 A;  3ZCO A;  3GUD A;  3JW4 A;  3OIP A;  1WZ2 A;  4BU2 A;  2R92 J;  3C18 A;  4RM3 A;  1OKR A;  2HXI A;  2CYY A;  4XKV A;  4XLE A;  1XS9 A;  2YPR A;  1TQP A;  2R5Z B;  3OSF A;  2VOP A;  3H92 A;  3CP2 A;  4L0Y B;  5HDN A;  5C44 J;  3S3M A;  2DMT A;  2XGC A;  1J2X A;  2QEN A;  3WGG A;  2HQ5 A;  4AIH A;  1BA5 A;  1R1T A;  2M8G X;  2O3F A;  3RKY A;  1R5G A;  3K2Z A;  1B1B A;  1QZE A;  3OL3 A;  3WHB A;  1RPW A;  2GXG A;  4F92 B;  2G9W A;  4JX5 A;  5EEG A;  2D1H A;  1MDM A;  3FK6 A;  3KP5 A;  1TL8 A;  3NAR A;  4PK4 A;  3SXY A;  1YE9 A;  2X6Y A;  4P9U A;  2WB1 A;  2F4I A;  4UB6 C;  2QKM B;  3P9I A;  4I01 A;  2AHQ A;  5JHF A;  3BG5 A;  3K9T A;  1ZHF A;  2JA2 A;  2QQA A;  5IP6 A;  3BDD A;  2OCC H;  1W7P A;  4HA8 A;  3WTU C;  5IOZ A;  1B8I A;  4GGG A;  4D9J A;  2IVM A;  2M9H A;  4ZC3 A;  2BHZ A;  1MBK A;  2F4O B;  2KZG A;  3ESW B;  3KEQ A;  5F6F A;  4X6A J;  1KQ8 A;  2UUZ A;  4TV7 A;  5E3O A;  2K9L A;  2R4G A;  4E7Z A;  2CW7 A;  3KYL A;  2Q1Z B;  4FE7 A;  2L5Q A;  3G2B A;  2L9R A;  4CA0 A;  2CV0 A;  3FDY A;  5DD8 A;  2HI3 A;  1RIO H;  3O8H A;  2IS6 A;  1LEB A;  4LIV A;  4JP0 A;  5TJJ A;  2LY9 A;  3J7A O;  1DUX C;  2WA0 A;  2DFF A;  4G9Y A;  4IHV A;  3OS0 A;  3B6C A;  1RUO A;  1LE8 A;  3BP8 A;  4EGY A;  2KIM A;  3I71 A;  2LRE A;  4M74 A;  4O6J A;  3PUF A;  1T6S A;  1IXR C;  2QZ8 A;  1BL0 A;  3I54 A;  4KT6 A;  2CQX A;  2RNG A;  3DLL F;  5CLS A;  1MZB A;  4IHT A;  4IJA A;  1B9M A;  4JX6 A;  4BJ5 C;  1J09 A;  1BIB A;  2P4W A;  1TT5 B;  2XSD C;  2E1N A;  1R9T J;  4A3B J;  3A0H C;  5D6F A;  4B09 A;  1WKM A;  3DTI A;  3CCQ I;  2ZJQ F;  5FLM J;  1MMD A;  2MBF A;  4UUV A;  4ZYH A;  2AXT C;  1UCR A;  3KYC B;  1X1P A;  1U2W A;  3IV5 A;  1JUM A;  4XRS G;  1RR8 C;  5FGM A;  1YHQ I;  3GCM A;  1MSF C;  2DI3 A;  3RI4 A;  4BQQ A;  1M1E B;  4Q4Z F;  1ZEL A;  4LB6 B;  4B44 A;  4G6T B;  4BEH A;  2K86 A;  3HRS A;  2BV6 A;  2IW5 A;  1AU7 A;  4HRI A;  3V7C A;  1T56 A;  2XRL A;  2CW8 A;  3ZMV A;  4XQF A;  4BAC A;  1ETO A;  4IVN A;  3WU1 B;  2HVQ A;  4U0W A;  1ZN2 A;  3J80 Z;  3KP3 A;  2BXZ A;  4P1W A;  4WF2 A;  1UEL B;  4IRG A;  4AID A;  1HQC A;  2CQQ A;  3ECO A;  4O5V A;  2E2I J;  2P6T A;  1YFH A;  2P6S A;  2TDX A;  3WU2 C;  4WX9 A;  1XGN A;  2JVG A;  2OJE D;  3NAU A;  1YG2 A;  2ME6 A;  3HRT A;  2WAD A;  4DZP A;  2LSO A;  3E6C C;  5L3E A;  1QBJ A;  3PO2 J;  4BE0 A;  1AA7 A;  2E5N A;  2QF7 A;  4PJJ A;  1MW7 A;  4G7O F;  5GAD J;  2IGK A;  1LE8 B;  1F5T A;  3LST A;  3N05 A;  3EUK L;  2XPV A;  4I09 A;  4LGW A;  4CZC A;  2DBB A;  1C0W A;  1OR7 C;  1MNM C;  4S0H B;  2WTE A;  4W97 A;  5F64 A;  2EIL H;  2M30 A;  5D5W B;  4ZYA A;  1FIP A;  1UAA A;  1D0X A;  1N75 A;  2QGU A;  1S29 A;  1BM9 A;  3J7A Y;  5FKO A;  3ZGK A;  2NS7 A;  2EPF A;  3H35 A;  3IAM 2;  1K78 B;  1SMT A;  2R0Q C;  1Z91 A;  2KRC A;  1HW2 A;  4XM3 A;  2ZNY A;  4UXN A;  1I39 A;  1MBE A;  2G7H A;  5IYB J;  2VPL A;  5J1Y A;  1A6I A;  2CWE A;  3M8E A;  5LHH A;  1G59 A;  4K2E A;  1YIT I;  3BZ6 A;  2WY8 Q;  1FC3 A;  2KKO A;  2X85 A;  3CUQ C;  4LK0 F;  3ZN1 A;  5C4X J;  1HA8 A;  5EZG A;  3E5U A;  3FF5 A;  3WU0 A;  4BQO A;  1KYZ A;  3C2H A;  2L02 A;  2QQ9 A;  2L0K A;  1IJW C;  1G3S A;  2M7A A;  2QEX I;  2TRT A;  5ICC A;  2X48 A;  5GP9 A;  3AG2 H;  1OCP A;  3I59 A;  3J7Z I;  1YX5 A;  2W24 A;  3T8R A;  1GHC A;  3BLY A;  1QNT A;  1IW7 F;  1HKQ A;  2COM A;  3KYD B;  4Y15 A;  2QLZ A;  2XV4 S;  3DKY A;  3ZQQ A;  5K7H A;  3KZY A;  2Y9Z A;  1D8K A;  3D1N I;  2VT3 A;  3MWM A;  1JUS A;  4DBQ A;  1ZTR A;  5J4Y A;  1YJW I;  2B63 J;  4M9X A;  2ID3 A;  5KAI C;  4ZYE A;  1SVO A;  3OMY A;  4KIC A;  4L5I A;  4IO9 F;  3K4L A;  5ICG A;  2X1D A;  2W48 A;  2LMD A;  4KUM A;  4XKC A;  5IT3 A;  1E3O C;  2L7K A;  1YO5 C;  2EH3 A;  3M8J A;  1JT6 A;  3K6G A;  2LF7 A;  2X6W A;  5J6X A;  3G71 I;  3LSP A;  4KNY A;  2VIX A;  4NQW A;  4EJU A;  1B4A A;  3GWZ A;  2K4B A;  3SYT A;  2GBY A;  1G3T A;  4HLX A;  5BPD A;  4B48 A;  4YRV A;  1TBX A;  2NNY A;  1BOB A;  3ML6 A;  3V8J A;  1A5J A;  3KIO A;  1ZLK A;  3WTT C;  1XGO A;  4C30 A;  2BVM A;  2F2E A;  3P5J A;  3QWL A;  4EM2 A;  3J80 K;  3TP3 A;  3F8F A;  1QZZ A;  1XN7 A;  3K69 A;  1EKE A;  3GTP J;  3BTJ A;  3TP0 A;  1SMY F;  1GVJ A;  1ZAO A;  2Z2S B;  3KE2 A;  3DV8 A;  1KGS A;  1PJR A;  1QQI A;  4HF2 A;  1HDD C;  4CCO A;  3IKT A;  2DQL A;  3VYU B;  5CVU A;  3L1P A;  5KAF C;  3BR0 A;  2O8X A;  3LQQ A;  1JI8 A;  1RUN A;  1QGP A;  1FYL A;  4FT8 A;  3OYJ A;  4BXU A;  1DP7 P;  4UUS A;  2EIK H;  4RM2 A;  3RZD J;  1S7O A;  3HG9 A;  5F0C A;  2HDD A;  4PUS A;  4A3D J;  4AD9 A;  2R7V A;  1P7J A;  1PUF B;  3HUG B;  4M3E A;  2FX0 A;  5D5X B;  4XLA A;  3H5N A;  1APL C;  5IP7 J;  1SAU A;  2FEZ A;  3BOQ A;  1SVM A;  2ISZ A;  5K5Q A;  3JRI A;  1ZR2 A;  3H0D A;  2ZC2 A;  2L7Z A;  2HQR A;  1B72 B;  5CVR A;  3BQY A;  5J1U A;  1H88 C;  2K4J A;  4L9V A;  3T8T A;  4AUX A;  1XSX A;  3E0J B;  1H9T A;  2R7D A;  3JR9 A;  3VEP A;  2OQR A;  1RKT A;  5DTD A;  4D5C A;  5GAG J;  3HGY A;  4G6D A;  1V3F A;  3QU6 A;  4MFE A;  1T39 A;  1R5H A;  2R7Q A;  3S2H J;  1W5S A;  1UB9 A;  3LFK A;  1JE8 A;  5FD6 A;  2ZXI A;  4AYB A;  2L2O A;  3BC8 A;  2JA8 J;  4MQ9 F;  5JLW A;  5L3F A;  3CD6 I;  1MJA A;  1LVA A;  5JFR A;  4G6Q A;  3SZG A;  2M5W A;  1ORK A;  4EJW A;  2R7Z J;  1OJL A;  2VJ4 A;  3UR3 C;  2P7C B;  2R7U A;  2VN2 A;  3SHF A;  5LRS A;  2EQR A;  2HWV A;  1VI0 A;  5TIS C;  3IRQ A;  1OLT A;  2WAQ N;  2R7S A;  1X3U A;  1UJ8 A;  2KQR A;  3HBL A;  5D5U B;  4NHJ A;  1Z7L A;  1DGR M;  2HYF A;  1U8B A;  4OMZ A;  5FRM A;  3BWG A;  4KIT B;  3W2V A;  2Y69 H;  1YW8 A;  2RVC A;  3GZ6 A;  1LPQ A;  1QPM A;  4RMN A;  4WXC A;  3S1R J;  3LFU A;  3JRA A;  2X4H A;  1OIS A;  4BH9 A;  2Q8K A;  3FZV A;  4C3J J;  2JZY A;  4J00 A;  1XCB A;  3BCA A;  5CQE A;  1W5T A;  2WAE A;  2KIS A;  3A01 A;  3S93 A;  1WJ5 A;  1SD7 A;  2GLO A;  1ZKG A;  3BR1 A;  2DYS H;  5HLT A;  2E1O A;  1XTA A;  1MIJ A;  1MND A;  1L0O C;  4IF4 A;  1WJD A;  2FD5 A;  4RB2 C;  1MSE C;  4BDY A;  1W4M A;  2CFO A;  3S17 J;  1R1V A;  1SAX A;  5HDK A;  2LVS A;  2RRE A;  3FXJ A;  2F5F A;  2DMQ A;  1WH5 A;  3JAM Z;  1NK3 P;  2VUM J;  2I8D A;  1KQ0 A;  1K83 J;  2DOF A;  3M8F A;  1Z3Y A;  3F9K A;  3OYC A;  1BI3 A;  5IT9 K;  4I7H A;  1FP2 A;  3GTJ J;  3H3U A;  3K4K A;  3RPU A;  2BGC A;  3JRC A;  3HC7 A;  3D5L A;  1BI0 A;  1QRY A;  2IPQ X;  3L09 A;  1I3Q J;  4R8H A;  3CES A;  2JA5 J;  1S3J A;  2YUS A;  2YS9 A;  1CF7 B;  1ZH5 A;  3L2R A;  1Z77 A;  1T98 A;  1WPK A;  1S8N A;  3BJ6 A;  3KZZ A;  2ISY A;  4PSX A;  3CCR I;  5IT9 Z;  2DFI A;  2DOE A;  5DCM B;  5D4S A;  2ESH A;  4OIQ F;  3DPU A;  3ZRG A;  1FPQ A;  1T08 B;  3LAJ A;  1FBQ A;  4ANJ A;  3JAM K;  2HR3 A;  3PSI A;  3I9V 2;  3CO7 C;  3GVA A;  3GTM J;  2HEO A;  3UNG C;  1KZH A;  1DU6 A;  2L7F P;  5E18 F;  4LG3 A;  2LOO A;  3CUQ B;  5JLX A;  3VSK A;  4GYG A;  3ZQI A;  1HF0 A;  3QP6 A;  4FX4 A;  2HZD A;  3M4O J;  3K4J A;  3PSF A;  3KX2 A;  4UVB A;  1VQO I;  1U78 A;  3BJO A;  1Z05 A;  3CCL I;  3OYD A;  4ESJ A;  4HX8 A;  5DS9 A;  3FMS A;  5K5R A;  4YFK F;  2XRN A;  3OYH A;  2DFE A;  1MH3 A;  3GBG A;  2YU9 J;  2P5K A;  2FQ4 A;  3FMR A;  2Q0O A;  2EV5 A;  1A36 A;  1F4K A;  1UG0 A;  4B4C A;  5HVQ C;  4XON A;  1Z0X A;  2BBY A;  3N4M A;  3L2U A;  1SC7 A;  3SQN A;  4RB0 A;  2O0Y A;  1R58 A;  5FJ8 J;  2EWN A;  1XX5 A;  4WXH A;  5AON A;  4A93 J;  5J8F A;  2RKH A;  2PJR B;  3K1M A;  2BZT A;  3MN2 A;  3TL4 X;  1FOY A;  2CQ7 A;  3BZC A;  4CCM A;  5HLH A;  3DXJ F;  3K2A A;  1DQU A;  1IXS B;  2RV8 A;  1O3S A;  2OZU A;  4AIJ A;  1FEX A;  1VQN I;  4HPQ A;  2HDW A;  4GO1 A;  5DV5 A;  2KHM A;  3RCO A;  4PDK A;  5ERI A;  4BBR J;  2HVR A;  4M6Y A;  1EH7 A;  2GOX B;  3HL2 A;  5ILU A;  4IZZ A;  4JX4 A;  5A2Q K;  3KP6 A;  3PIP F;  4U0V A;  4C3H J;  4E4H A;  5E3M A;  1CF7 A;  5E1Z B;  3C1D A;  3MCZ A;  3CMA I;  4U7D A;  3E97 A;  1BC7 C;  2BY0 A;  3ZMT A;  4CCJ A;  2LLK A;  2MC4 A;  4L9N A;  4HOB A;  3E5Q A;  4AU7 A;  5KVR A;  3BG7 A;  2VXZ A;  3U1D A;  1XGM A;  3PQJ A;  3I0T A;  1SAN A;  4ZTJ A;  3MQ0 A;  5FB2 A;  2VBZ A;  2XKO A;  2VPR A;  1FBU A;  3MZ8 A;  3IP4 B;  2F5E A;  2XB5 A;  4E7K A;  2V7F A;  4XLC A;  2XGX A;  3RYP A;  2VKE A;  1E3P A;  4XOR A;  3EPZ A;  1XC5 A;  2JRM A;  1R22 A;  3ZXS A;  2BHY A;  4EJV A;  4E7L A;  4UHT A;  3JRE A;  4XL9 A;  2VKV A;  1OYI A;  2JRT A;  3GLL A;  1TWC J;  2LH9 A;  4ZTF A;  3TGN A;  4XLN F;  5FLX Z;  4U7B A;  1P2F A;  1ZG5 A;  2BXY A;  1YS6 A;  1OQY A;  1W5C C;  2QSG X;  3CCV I;  3G6E I;  3ERM A;  4HV5 A;  2UV1 A;  3AG1 H;  3I4N J;  1O7L A;  1WFX A;  1B72 A;  2V1N A;  3O8G A;  3W6V A;  1FY7 A;  2R93 J;  5D8K B;  1WJB A;  3U1K A;  2XRO A;  2IP2 A;  3I53 A;  4CCK A;  1GT0 C;  2LP0 A;  4JOM A;  3LA2 A;  2ZJR F;  1IV8 A;  1EF4 A;  3IWZ A;  4QPO A;  5FRN A;  5EF6 A;  2AO9 A;  3SEZ A;  3IC7 A;  3DKX A;  2DA5 A;  4II2 A;  3N97 A;  3KP2 A;  1T2K A;  1BI1 A;  3E6M A;  3SZP A;  1KQ9 A;  1WVR A;  1FJL A;  4BE1 A;  2ELK A;  1BR4 A;  3HHH A;  5CVJ A;  1MMN A;  5F1J A;  5LGT A;  4LD5 A;  5K7Z A;  2EK5 A;  1VZ0 A;  3F8B A;  1VQ4 I;  1SD5 A;  3G4S I;  3CC4 I;  2H27 A;  2M4G A;  3EYY A;  5F1R A;  1R1U A;  2OV7 A;  2BVL A;  3BJA A;  4Y17 A;  3MKY B;  1WSU A;  2M45 A;  3IKV A;  3CUQ A;  2EJR A;  2XAF A;  1FOW A;  4YII A;  3HIF A;  4RLF A;  1S5L C;  1ZG1 A;  4JK1 X;  2A5Y B;  2DA4 A;  3H0G J;  4KA4 A;  3FXR A;  6PAX A;  3CMY A;  2DA1 A;  3B6A A;  5TGT A;  4XBF A;  4OAY A;  3L2C A;  1K79 A;  2W57 A;  2FSW A;  3EDP A;  2QYO A;  1R5I D;  5HLG A;  2GAU A;  2ZME A;  2DJN A;  1LDK B;  2LF8 A;  1WJF A;  1A04 A;  2YU3 A;  5B5E C;  2H6B A;  2RNJ A;  1IXC A;  3F23 A;  2NRA C;  4LLG F;  4I0A A;  5E8G A;  3RKW A;  2PX9 A;  2LY2 A;  4ENJ A;  2ZO4 A;  4EEF G;  4XN0 A;  2VKD A;  2KZV A;  3NRV A;  2FE3 A;  4I98 B;  4CZZ A;  5L3G A;  3Q9V A;  1XGS A;  4OWR B;  2M34 A;  2EA2 A;  4BQN A;  4ENK A;  2Z16 A;  1H0M A;  2DPD A;  3SZT A;  3T1B A;  1G3W A;  3OYF A;  4A3C J;  1FP1 D;  1Z3X A;  1KU2 A;  2STT A;  2KP6 A;  4RAG A;  3HOZ J;  5E3N A;  1GLN A;  1T0F A;  2GA2 A;  2P0W A;  2ZXJ A;  3ZOB A;  2DT5 A;  3F8N A;  2OF7 A;  3D5R C;  3FBN B;  3S1N J;  3MZY A;  2PMZ A;  4XLH A;  3IRR A;  4I02 A;  1ITY A;  5EEH A;  1X3Z B;  4OIR F;  3U9G A;  1VQM I;  1RI7 A;  2ELH A;  4RLQ A;  3OY9 A;  2ETH A;  2QKL B;  2PG4 A;  2OZ6 A;  2P7V B;  2QSH X;  3DFG A;  1QVT A;  2H1K A;  2LBF A;  3ASN H;  4B8X A;  3FM5 A;  4DNC A;  2HS5 A;  1EH6 A;  4BE2 A;  2M7B A;  3GFI A;  1WJA A;  1NG7 A;  3TO7 A;  2Y2Z A;  2QBY B;  2W7N A;  2EZI A;  4KN4 X;  1K7A A;  1E0E A;  3I3L A;  5D6E A;  1ON2 A;  1IDZ A;  1TNT A;  4CYC B;  3PO3 J;  2VC1 A;  4MTD A;  1VND A;  1WJC A;  2K9M A;  3OR1 C;  3X2Q H;  4BJ6 C;  1R4N B;  4GYI A;  4E7H A;  2OQG A;  1JJ8 C;  5ED4 A;  1HKS A;  2O7O A;  3VYS B;  1RZ4 A;  3FXK A;  4Z6Y A;  1I1G A;  3OYK A;  1GXQ A;  4FX0 A;  5LLQ A;  4BYY A;  4PCQ A;  2O8K A;  2AS5 F;  4KIB A;  2XF6 A;  2Z33 A;  4IHS A;  3BZK A;  5ILV A;  4L0Z B;  3BCB A;  3RIR A;  3O6B B;  1ETW A;  2M1B A;  2VE9 A;  4F93 B;  3LSK A;  2MW8 A;  4MFD A;  1XMX A;  3QPT A;  3ZQG A;  4BUP A;  4QSH A;  2IAI A;  4BBS J;  5C4J J;  5M5X J;  3V8L A;  1YRN A;  1J5Y A;  1ETY A;  1I6X A;  2CU7 A;  3OR2 C;  4QIW N;  5K1Y A;  1PP7 U;  2DCE A;  2OTL I;  2M3A A;  2CMP A;  3F6O A;  4BEH B;  5JHU A;  5E3L A;  3ZMZ A;  3I4P A;  1CGP A;  4XOT A;  4BY1 J;  2VE8 A;  5GTI C;  3CJR B;  3F0C A;  3LWF A;  1JTY A;  2CUZ A;  3L00 A;  4EJO A;  2VLA A;  1XSD A;  4F7Z A;  1IN6 A;  4HDV A;  3SDG A;  3GX4 X;  3WHC A;  1U0J A;  3TKY A;  1YQA A;  2HZT A;  3S2D J;  1DP3 A;  4I6Z A;  3FHZ A;  5CPR B;  4Q48 A;  1JHH A;  1XMK A;  2DA6 A;  5HS8 A;  2QBY A;  2LG4 A;  2P5V A;  5J40 A;  2XHK A;  3H36 A;  4ZDL A;  1XPX A;  1FMW A;  2EB7 A;  2DT7 B;  1HXD A;  4PGH A;  1ZGW A;  2HTJ A;  1LJ9 A;  2ZME C;  2KL4 A;  4UUT A;  4C2T A;  4IHW A;  3DBH B;  3K10 A;  3DP7 A;  4A3M J;  2IS1 A;  3LA3 A;  3SJM A;  5ICF A;  3JTG A;  3P9C A;  1BJA A;  5EEA A;  4G12 A;  1YJ9 I;  1IV6 A;  4PFP A;  2DFH A;  3CCY A;  2DT6 A;  4M9S A;  1FTZ A;  4BHP A;  4CXF A;  5M5W J;  4ASN A;  2DA2 A;  2K9S A;  4RS8 A;  2EZK A;  3UKG A;  2WAQ A;  3H9J A;  3BR6 A;  1B9N A;  5HDG A;  3TOA A;  1VQK I;  2EFQ A;  2KPM A;  2VKH A;  2B0L A;  5LHG A;  3JTH A;  3CZ6 A;  1VF9 A;  3LSH A;  1JUP A;  4DZJ A;  1TZL A;  1D1C A;  1XDU A;  2LD5 A;  2XF5 A;  5BQT A;  1S72 I;  3BPV A;  3W6J B;  2R7R A;  4AM3 A;  3OYG A;  3K0L A;  4KFC A;  4D7M A;  2VOO A;  1ERD A;  4AVP A;  4LLL A;  5E8I A;  1QO0 D;  2ZXH A;  4AYB N;  2CG4 A;  5LEK A;  4HF1 A;  2GIZ A;  2BE5 F;  2PBI A;  2E5Z A;  4LOC A;  4ESF A;  2DLL A;  1YLF A;  3DTK A;  1Z67 A;  1MH4 A;  4L5E A;  3DEU A;  4M3B A;  4V2G A;  5DEQ A;  2VI6 A;  1GXP A;  3U2R A;  1KA8 A;  5EGO A;  1QA6 A;  2IEK A;  2L9N A;  3MMY B;  5FKL A;  4RDU A;  3EYI A;  3GTO J;  2K9Q A;  1XB4 A;  1J9I A;  2EIN H;  3HOU J;  5EGO B;  2VOD A;  1LQ1 A;  1HW1 A;  4Y7N J;  3EET A;  3MVP A;  3HJE A;  3QU3 A;  2A6H F;  2Z5U A;  4IQJ A;  5FRO A;  5KK1 A;  3CC7 I;  1U9N A;  3R0J A;  5IPA A;  4EMS A;  1K78 A;  1I1S A;  2A61 A;  1OR7 A;  3RZO J;  4IOC F;  1VFC A;  3KET A;  1AKH A;  1MNE A;  1IUF A;  2FJ1 A;  2X1C A;  1Z6R A;  5H20 A;  4HW0 A;  1IG7 A;  1Z6T A;  2PQ8 A;  1Y56 A;  4ZH4 F;  3VWB A;  2JVH A;  3V7R A;  1Y39 A;  4HDU A;  2EIM H;  1Y0N A;  4DOZ A;  2A07 F;  2CH0 A;  3H9G A;  2E2J J;  4XRS A;  2IGO A;  2LDU A;  1VQ6 I;  2MFZ A;  4IHY A;  4E7J A;  2I10 A;  2ZME B;  4WXD A;  1TWF J;  3GTL J;  3I59 B;  4A2U A;  2BEO A;  3K4C A;  1IN8 A;  1ONV A;  1OPC A;  2CUE A;  3G1L A;  2KJB A;  3GFM A;  1HDP A;  1SEU A;  1ZRC A;  2VT2 A;  5J3L A;  2I5U A;  2X9D A;  1SFE A;  2OUM A;  2ZCW A;  3OL4 A;  3RKX A;  3A4C A;  3W3C A;  2FML A;  4QWQ A;  2EZL A;  2XC7 A;  3HKZ A;  4YFN F;  5J8C A;  4KMF A;  2XAQ A;  1IF1 A;  1B59 A;  5FFX A;  4LG0 A;  2DMP A;  1XCV A;  3FXL A;  2JTV A;  2W4S A;  4OOI A;  3BTC A;  2EFP A;  1PVE A;  1FYK A;  5F0F A;  1Z21 A;  2AQF A;  1TLH B;  4KYW A;  4ENM A;  1H9G A;  2HPI A;  4CH7 A;  1U3E M;  4IPA A;  3CDI A;  1ZG3 A;  5KNL A;  4IKF A;  2E36 A;  4PFO A;  1GDT A;  2ELJ A;  4PZJ A;  3OS1 A;  4FET A;  5L3D A;  2WBM A;  3FHN A;  4M3D A;  3A02 A;  2XAS A;  2K7L A;  2X6O A;  4ESB A;  4QLC U;  5CQG A;  4HZF A;  2WV0 A;  1BJZ A;  3NWT A;  3ECH A;  5TRD A;  4B1R A;  4HQM A;  2FQ3 A;  5M3M J;  2ECC A;  1W0U A;  5B1A H;  3KLN A;  1D0Y A;  3ABM H;  2XAU A;  2FA5 A;  2ZNZ A;  2COB A;  3S16 J;  4EM0 B;  4QTR A;  2Y31 A;  1ENH A;  4A3K J;  1DDN A;  2LBF B;  2MD0 A;  4R79 A;  2X0L A;  2R7T A;  2EV6 A;  2EFN A;  4N0B A;  4A6D A;  3OOP A;  3G1M A;  2V9K A;  2XGD A;  3WTY C;  4Y13 A;  2RDP A;  2L3D A;  1BW5 A;  3U21 A;  1RR7 A;  3IHU A;  1IN4 A;  2N8G A;  4CCN A;  4A0X A;  5DYM A;  1DU0 A;  1LUJ B;  3CCM I;  3FXU A;  2GQQ A;  2OC6 A;  3B02 A;  1KYW A;  2E34 A;  1MJB A;  3I58 A;  5E1X A;  2QVO A;  5EG0 B;  2V6E A;  2CW0 F;  2MSY A;  3PNY A;  4YFX F;  2JK3 A;  2DA3 A;  2HOT A;  3BTI A;  3TO6 A;  5ICE A;  2M2E A;  4CYC A;  1YW7 A;  1U5T C;  2QWW A;  2J5O A;  2ESN A;  3OOU A;  4C2M J;  1TWA J;  1FIA A;  1MBF A;  3VYT B;  1S9H A;  4N4O B;  5GAE J;  5KHD A;  1Z7U A;  5H6Q A;  1ON1 A;  5L3B A;  1K4S A;  4MEX F;  4A5M A;  4XIC A;  1O4X A;  3R61 A;  3RQ4 A;  1K61 A;  2IRF G;  1JKQ C;  4V2F A;  1BR1 A;  3RQI A;  3S15 J;  3RSN A;  4GXO A;  4ZDO A;  2NOJ B;  4BL0 B;  1LB2 A;  1FOX A;  5JVT A;  2NYX A;  4LIU A;  4CSW A;  4KN7 X;  5DD4 A;  3QP5 A;  4MO7 A;  2ZJP F;  3OYM A;  1U5T A;  3VPR A;  2OTJ I;  1ZRE A;  1Q1H A;  3OS2 A;  5DUI A;  2H6C A;  1NHA A;  2ZSI B;  4Y52 J;  2HVS A;  5AIP A;  3RDI A;  1E2X A;  2K5C A;  2ADU A;  2K02 A;  1T33 A;  3WOD F;  3KZI C;  1QPI A;  2RGV A;  5HS7 A;  3OYN A;  3DKW A;  5D4R A;  3CO6 C;  4DBR A;  3E5X A;  2M8E A;  2DU9 A;  2V79 A;  3OIQ A;  4D7N A;  3E7L A;  1J0R A;  1JGG A;  1UG2 A;  4S05 A;  4FHT A;  4L9J A;  3NWS A;  4CGZ A;  2KRF A;  1I27 A;  2RC4 A;  2V1X A;  2CQN A;  5JVG F;  2JPB A;  1EV7 A;  1AWC A;  3TQN A;  4OIO F;  3GTG J;  2V9P A;  1OCR H;  3PQK A;  2Y0S A;  5B66 C;  1D3Y A;  2A6T A;  2DDB A;  2GWR A;  5AIQ A;  4AC0 A;  2QSF X;  2FOK A;  4YG2 F;  4AIK A;  3ZMU A;  4V19 K;  2CUJ A;  1LVK A;  2ZFU A;  3QQA A;  4A0Z A;  4ETS A;  4GDF A;  5F27 A;  2HFH A;  1DGW Y;  3WGH A;  3F8C A;  5CKT A;  1TWG J;  3ELK A;  3BG3 A;  4ABZ A;  4CDG A;  4OU0 A;  1ULY A;  3JRH A;  2GZW A;  3TO9 A;  3KCC A;  4KDP A;  1AKH B;  2LR8 A;  1ZYR F;  2Z9O A;  4A69 C;  5CVI A;  1V5F A;  4CIC A;  3BQZ A;  1S7A A;  2W82 A;  1TTY A;  3W6K B;  2ID6 A;  2V4J C;  4M73 A;  4C2U A;  2LC2 A;  3GYH X;  3QAH A;  3FKJ A;  4KIF A;  1X19 A;  4OAZ A;  4U88 A;  5BNG A;  5D5V B;  3B73 A;  1WRJ A;  3QOP A;  4A3L J;  1QHG A;  4P5O A;  4Q47 A;  1JJ6 C;  1F43 A;  4CYD A;  1MD0 A;  1POG A;  1MMA A;  2F48 A;  3MD2 A;  5LGU A;  4ON0 A;  3HOX J;  1YI2 I;  3DEW A;  4MHG A;  5HOD A;  2V26 A;  5DM6 F;  5H6R A;  3ONQ A;  2E60 A;  4FAS D;  4ZZD A;  3PFY A;  2ICW G;  3ZN0 A;  2XPU A;  2BYV E;  3FM3 A;  3EUA A;  3P7N A;  2EFO A;  4A0Y A;  5DDG A;  4N9I A;  1J7K A;  2XF7 A;  3RKQ A;  4J01 A;  1W0T A;  4JQF A;  3Q9S A;  3HPH A;  3RPQ A;  2HOS A;  1DPR A;  4UV9 A;  5BOX A;  3FK7 A;  5D8L B;  1B6A A;  2NVY J;  3GO5 A;  3ABL H;  4M9Z A;  3ROU A;  1VQ8 I;  1KON A;  3FBI B;  3KEY A;  1IC8 A;  4B3X A;  2X6X A;  3OYL A;  3S2W A;  4EAT A;  3M3Y J;  4KIS A;  3W2A A;  1OYY A;  1VQ9 I;  3HRU A;  2QA4 I;  1X2N A;  2NAZ A;  4G94 A;  2HYJ A;  1E3H A;  5BS6 A;  2PFB A;  2E7X A;  2ME0 A;  5LD2 C;  5C3E J;  1ZRD A;  3V8K A;  2R7X A;  4UB8 C;  1YX3 A;  3AG4 H;  4FE4 A;  1X1C A;  2F6C A;  3ASO H;  3M9A A;  3PIO F;  4KJZ A;  3COA C;  3ABT A;  1W36 D;  2XDV A;  2A05 A;  4KIG A;  1R36 A;  2DQR A;  3BT9 A;  2DMN A;  5HNF A;  2CO5 A;  4QPQ A;  3CCE I;  3A1Y A;  5F0H A;  2HYG D;  2Q2E A;  3ZP5 A;  2OD5 A;  4NUB A;  4NC8 A;  2VQL A;  1F9N A;  4E6K G;  3LNQ A;  2NOG A;  4G7Z F;  4NC7 A;  2IT0 A;  1V5G A;  4NQW B;  2XKP A;  1T95 A;  1FYM A;  1IAW A;  4EM1 A;  2B9S A;  1JGS A;  2OBP A;  4YEJ A;  3LOC A;  1LDJ A;  1JT0 A;  3F72 A;  2L9S A;  4EQQ A;  2K3P A;  3L9F A;  2R7W A;  4UNO A;  2LKX A;  4A12 A;  2KLO A;  3VFZ A;  3HOY J;  3DPT A;  2CV1 A;  1FTT A;  2FNP A;  4PJ0 C;  2JMW A;  5K7F A;  1X4P A;  3H5A A;  2WV1 A;  2ACJ A;  2DJI A;  4XSX F;  2KJC A;  3E3V A;  2EA4 A;  4Y33 A;  4RAY A;  3VYR B;  1OCC H;  4WCG A;  2WWY A;  1TW3 A;  4LG0 B;  3K1P A;  2ZBK A;  1W1W E;  1ETX A;  2QUF A;  1WQ2 A;  2L01 A;  1FNN A;  3REO A;  4HEA 2;  4RAF A;  3WTZ A;  3WTX C;  2DA7 A;  3VOE A;  3OYI A;  2HKO A;  1ZGJ A;  2F5D A;  3KEO A;  4W1U A;  1AHD P;  1UHM A;  3AKZ A;  1FX7 A;  2CFX A;  2WAF A;  2W25 A;  3AAF A;  5EDN A;  2GM4 A;  4MLO A;  4OIN F;  3VSL A;  5CVV A;  1YIJ I;  1MBG A;  4F55 A;  2P8T A;  4LIT A;  3S1Q J;  4DYC A;  3NQO A;  1GV5 A;  4MEY F;  3PNV A;  1HOM A;  1O3T A;  3I55 I;  1U6G A;  2DK8 A;  4I2O A;  5LBQ A;  4A6E A;  4FCY A;  4RBO A;  1GVD A;  1QZY A;  3HTS B;  4B47 A;  4BNC A;  2R7F A;  4M72 A;  4XLP F;  2KIF A;  1FZP B;  1IRG A;  1D5V A;  1BOA A;  2OU2 A;  4HNU A;  4E7I A;  3CC2 I;  2FXA A;  1QVU A;  3V4G A;  2FF4 A;  3ERE D;  2OCE A;  3D0S A;  1T8I A;  2FMY A;  3ULQ B;  2GIV A;  3JRB A;  1P7I A;  2VC0 A;  3FXO A;  3PJR A;  4BKX A;  4F3Q A;  1XSV A;  4GFB A;  4UV8 A;  1IRF A;  3ZQL A;  2XAJ A;  4L5J A;  4A3E J;  3I64 A;  2AXL A;  2PI0 A;  3CLQ A;  2C6Y A;  1ETK A;  4NBQ A;  1O3Q A;  4PSW A;  2MH2 A;  2MYS A;  1P4A A;  4L9T A;  4PGG A;  2XB0 X;  3O2P E;  4RGU A;  2H8W A;  3FXQ A;  3PFI A;  4HST A;  2X1E A;  1SD6 A;  5FKM A;  1YIO A;  4U87 A;  1X1B A;  3CLO A;  3ZQH A;  4DYR A;  2MAB A;  4XK4 A;  2W00 A;  1HBX G;  2NS0 A;  1S6L A;  3FIW A;  2DOA A;  3E1S A;  2A6E F;  2EIJ H;  3IAS 2;  1GV2 A;  2G7U A;  5E1W A;  3M7G A;  1CQT A;  3CUO A;  3RYR A;  3BY6 A;  2ZXW H;  2VL8 A;  4KT5 C;  4HSR A;  2O9L A;  3GW2 A;  2CSO A;  4U0Y A;  3TW6 A;  1G6N A;  1GUU A;  2HOE A;  4EVI A;  3HOW J;  2PMH A;  4BAY A;  5KCM A;  4UUS B;  2JWT A;  3K4M A;  1A6Q A;  3J81 Z;  3ISP A;  5E79 C;  4OIP F;  4Y4R A;  4PJM A;  2O5R A;  4D5F A;  4I76 A;  3JSO A;  1TT0 A;  2UXN A;  4FTH A;  4FQG A;  2RAE A;  3R4K A;  4M6V A;  3H5R A;  3OWT A;  5EJC A;  4BXF A;  1RNL A;  3HSF A;  4IRH A;  5HS9 A;  3BR5 A;  3C2G A;  3DLA A;  2D5V A;  5JI6 A;  2W84 A;  3GTK J;  1G8X A;  2E1M B;  4LFU A;  1QHH D;  4KMU X;  4IRI A;  1BN5 A;  3MKL A;  2QQ8 A;  2V1D A;  1LKX A;  3I5U A;  2JJ7 A;  3HB9 A;  1J59 A;  5JR3 A;  2E71 A;  3LSI A;  1STZ A;  1ZLJ A;  3K4N A;  4LB5 A;  4GRI A;  3IUO A;  3E6B A;  3DBL B;  5HLI A;  3ZMD A;  1JKP C;  5FLV A;  3J81 K;  4BGD A;  3BG6 A;  2HQA A;  3K4B A;  3ZR8 X;  1IUY A;  1WCM J;  3M07 A;  3DF8 A;  4XNF A;  3EUH A;  4JYK A;  3EUH C;  1B8I B;  3R0A A;  2JUG A;  2DTZ A;  1RKW A;  2F5V A;  4HAM A;  1F36 A;  5EZH A;  3DQV C;  2VQC A;  1BR2 A;  4H4K C;  4Z2Y A;  5IOY A;  3S3O A;  2E2H J;  2L7M P;  3CMM A;  5DM7 F;  4HG2 A;  1OCT C;  2YX4 A;  3BR2 A;  1X1A A;  4Q5S F;  1LFB A;  4E7S A;  1FT9 A;  1I5Z A;  4FIS A;  2Y9Y A;  1YS7 A;  3IL2 A;  4EGZ A;  1Y1V J;  3MFK A;  2DK5 A;  5E20 A;  1W7P D;  3HPG A;  1LFP A;  1MBH A;  2PJR A;  1XG1 A;  2BY1 A;  3ABU A;  2VON A;  3FX3 A;  1FMV A;  3FMQ A;  3LQR A; 
#chains in the Genus database with same CATH homology
 1J75 A;  2H94 A;  2DAO A;  2A3S A;  2RN7 A;  3KLO A;  2KIU A;  3Q5F A;  3V7S A;  3KP4 A;  2LKP A;  3T0Y A;  4UVA A;  3RTR A;  2E7W A;  3GZ5 A;  3P9K A;  4YIF A;  1P6R A;  2O03 A;  4RAZ A;  1Z1D A;  1ZGA A;  2HTS A;  2XUB A;  3KFW X;  4P55 A;  4I0B A;  3GFJ A;  3JSP A;  5E17 F;  2FBH A;  2V6C A;  2M87 A;  4N9H A;  1U5T B;  3ZPL A;  4HF0 A;  5CYV A;  3LAP A;  1V4R A;  3WTS C;  3L7W A;  1BBY A;  1TNS A;  1MDM B;  1P4X A;  4HLY A;  2MLK A;  3CDH A;  3GEZ A;  1HSJ A;  3K1N A;  3IWF A;  4DQ2 A;  3VB2 A;  2E1C A;  2XIG A;  5LEJ A;  2L4A A;  2MD5 A;  1BC8 C;  2IA2 A;  3BPX A;  4R1H A;  2CGP A;  1JXS A;  4P96 A;  5FFZ A;  4HX7 A;  2ZJ2 A;  2EFW A;  2PEX A;  4WK8 F;  4XSZ F;  3BRO A;  4LK1 F;  3R60 A;  1R00 A;  3QPH A;  1FWZ A;  2OAZ A;  4ZYG A;  2Z99 A;  1TQI A;  2JSC A;  4EV0 A;  2DW4 A;  1HKT A;  2QM3 A;  1O3R A;  4S04 A;  2EV0 A;  2Y48 A;  4CHU A;  3WG9 A;  3HHG A;  2D1V A;  3H3Z A;  2D2W A;  5CJ9 A;  2O6G E;  2Y75 A;  4CO8 A;  1EH8 A;  5FD5 A;  2YR2 A;  2PMU A;  2UWM A;  1F1Z A;  2XAG A;  3CTA A;  3G73 A;  1BIA A;  3HOT A;  2ZFW A;  4O3M A;  5K5O A;  3F8M A;  2LNB A;  2VBX A;  2MH9 A;  3E6D A;  1R7J A;  1U8R A;  3WTW C;  4UVC A;  1YYV A;  2O61 A;  4RGS A;  1XD7 A;  1KU3 A;  2VBW A;  4HQE A;  4LJZ F;  1VTN C;  3QRF F;  3GF2 A;  4GCV A;  5HOO A;  3G3Z A;  3GLX A;  5FLX K;  3HYI A;  1SFX A;  4MTE A;  4NB5 A;  1SD4 A;  3HUG A;  3KP7 A;  4BQA A;  1HW5 A;  2PLY A;  1TW2 A;  5BPI A;  2UZK A;  4EJT A;  3F3X A;  3OV8 A;  2CQK A;  1E17 A;  2GA1 A;  4OMY A;  3EQL F;  3TOB A;  1W7P B;  2GXB A;  4IXA A;  4AWX B;  2UXX A;  3WGI A;  2L4M A;  2IJL A;  1OMI A;  2F5C A;  2A69 F;  5A2Q Z;  3F22 A;  1MKM A;  2PJP A;  4HYE A;  1KU7 A;  3T5X A;  5DCF A;  3HTU A;  1G4D A;  2HDC A;  2R3S A;  4RGR A;  3LA7 A;  2FBI A;  1FBS A;  3MAJ A;  4RB3 C;  4RB1 A;  4BHC A;  4D0P A;  1YW9 A;  3F21 A;  3FWE A;  4HBL A;  2JT1 A;  3ZQ7 A;  4HX4 A;  1USS A;  1ZAR A;  1JHF A;  3GXO A;  2DTR A;  4MQV A;  4RGX A;  4A5N A;  4BHB A;  2IA1 A;  5FO5 A;  1FLI A;  2QQB A;  2JPC A;  1T38 A;  1PP8 F;  3TDZ C;  2OA4 A;  4G7H F;  4ZZL A;  2K27 A;  4H0E A;  4WWC A;  1AOY A;  2RQP A;  3F6V A;  2VBY A;  4JBA A;  2FU4 A;  1TQM A;  1PDN C;  3O3K A;  2DPU A;  2MC3 A;  1WWX A;  2HQN A;  1WI9 A;  1YTY A;  1O57 A;  2MLG A;  2XAH A;  4HV6 A;  2DO7 A;  4MGR A;  1LDD A;  3MZH A;  4ZYD A;  2HKX A;  2FRH A;  1Y0U A;  2Y0M A;  1MGT A;  2PN6 A;  3HSE A;  3RJP A;  2V1U A;  3MEX A;  3TDU C;  4MNU A;  1UST A;  4G8X A;  3ZMS A;  1XDS A;  5L3C A;  2W85 A;  3R6S A;  4ENN A;  3HSR A;  3WTV C;  3VOD A;  2D45 A;  1LEA A;  2STW A;  1HST A;  1SFU A;  1UFM A;  1BI2 A;  2NNN A;  1FSE A;  4XRF A;  2IA0 A;  4M6X A;  1KU9 A;  1ZRF A;  2MA3 A;  2YSR A;  2H09 A;  2WC2 A;  3HRM A;  1P92 A;  2A68 F;  5LGN A;  3WE3 A;  1G3Y A;  1DPU A;  1D8J A;  2HGC A;  1FSH A;  2ZKZ A;  1IN5 A;  1PUE E;  2YX7 A;  5BMZ A;  3NEU A;  1FOK A;  4P9F A;  1P4W A;  1OYW A;  4LMY A;  2Z3Y A;  1IN7 A;  3M1E A;  1O7F A;  4E70 A;  2L54 A;  2XVC A;  1IZ1 A;  2P5L C;  3DPL C;  1UHW A;  1L3L A;  2V9V A;  1MJ9 A;  5LRR A;  1XMA A;  3SFZ A;  3C3W A;  4LLN A;  1LNW A;  1K6O A;  2J5P A;  5DCM A;  3CJN A;  3GFL A;  2FNA A;  5DUK A;  3HOS A;  1REP C;  3WE2 A;  4L18 B;  1Z9C A;  3C7J A;  1ODD A;  1R23 A;  5LHI A;  2FBK A;  5ILS A;  4M71 A;  3GUD A;  3JW4 A;  3C18 A;  1OKR A;  2CYY A;  2YPR A;  1TQP A;  2VOP A;  3H92 A;  4L0Y B;  5HDN A;  1J2X A;  2QEN A;  3WGG A;  4AIH A;  1R1T A;  2O3F A;  3RKY A;  1R5G A;  3K2Z A;  1B1B A;  2GXG A;  2G9W A;  5EEG A;  2D1H A;  1MDM A;  3KP5 A;  3SXY A;  4P9U A;  3P9I A;  4I01 A;  3K9T A;  1ZHF A;  2QQA A;  3BDD A;  1W7P A;  4HA8 A;  3WTU C;  4GGG A;  2IVM A;  3KEQ A;  5F6F A;  1KQ8 A;  4TV7 A;  5DD8 A;  1RIO H;  1LEB A;  5TJJ A;  3J7A O;  1DUX C;  4G9Y A;  1RUO A;  3BP8 A;  4EGY A;  2KIM A;  3I71 A;  4M74 A;  4O6J A;  1T6S A;  1IXR C;  2QZ8 A;  3I54 A;  5CLS A;  1MZB A;  4IHT A;  4IJA A;  1B9M A;  1BIB A;  2P4W A;  2E1N A;  5D6F A;  4B09 A;  1WKM A;  2MBF A;  4UUV A;  4ZYH A;  1UCR A;  1U2W A;  5FGM A;  2DI3 A;  3RI4 A;  4Q4Z F;  4LB6 B;  2K86 A;  3HRS A;  2BV6 A;  2IW5 A;  3V7C A;  3ZMV A;  4IVN A;  3WU1 B;  4U0W A;  1ZN2 A;  3J80 Z;  3KP3 A;  4WF2 A;  4IRG A;  1HQC A;  3ECO A;  4O5V A;  2P6T A;  1YFH A;  2P6S A;  2TDX A;  4WX9 A;  1XGN A;  1YG2 A;  3HRT A;  2LSO A;  3E6C C;  5L3E A;  1QBJ A;  4G7O F;  1F5T A;  3LST A;  4I09 A;  4LGW A;  2DBB A;  1C0W A;  2WTE A;  5F64 A;  2M30 A;  5D5W B;  1S29 A;  1BM9 A;  1K78 B;  1SMT A;  1HW2 A;  1Z91 A;  2ZNY A;  4UXN A;  2G7H A;  2CWE A;  3M8E A;  5LHH A;  4K2E A;  3BZ6 A;  3CUQ C;  1FC3 A;  2KKO A;  4LK0 F;  3ZN1 A;  3E5U A;  3FF5 A;  3WU0 A;  1KYZ A;  2L02 A;  2QQ9 A;  1G3S A;  5ICC A;  3I59 A;  2W24 A;  3T8R A;  1GHC A;  1QNT A;  1IW7 F;  1HKQ A;  2COM A;  4Y15 A;  2QLZ A;  2XV4 S;  3KZY A;  1D8K A;  2VT3 A;  3MWM A;  4M9X A;  4ZYE A;  4L5I A;  4KIC A;  5ICG A;  4KUM A;  5IT3 A;  1YO5 C;  2LF7 A;  5J6X A;  4KNY A;  4NQW A;  4EJU A;  1B4A A;  3GWZ A;  2K4B A;  1G3T A;  4HLX A;  5BPD A;  1TBX A;  2NNY A;  3ML6 A;  3V8J A;  1ZLK A;  3WTT C;  1XGO A;  2F2E A;  4EM2 A;  3J80 K;  3F8F A;  1QZZ A;  1XN7 A;  3K69 A;  1SMY F;  1GVJ A;  1ZAO A;  3KE2 A;  4HF2 A;  1KGS A;  1QQI A;  3DV8 A;  3IKT A;  2DQL A;  5CVU A;  2O8X A;  3LQQ A;  1RUN A;  1QGP A;  1FYL A;  4FT8 A;  4BXU A;  1DP7 P;  1S7O A;  4AD9 A;  5D5X B;  2FEZ A;  3BOQ A;  2ISZ A;  5K5Q A;  2HQR A;  5CVR A;  2K4J A;  4L9V A;  3T8T A;  1XSX A;  1H9T A;  2R7D A;  3VEP A;  2OQR A;  4G6D A;  1V3F A;  3QU6 A;  1T39 A;  1R5H A;  1W5S A;  1UB9 A;  3LFK A;  1JE8 A;  5FD6 A;  4MQ9 F;  5L3F A;  1MJA A;  1LVA A;  5JFR A;  4G6Q A;  2M5W A;  4EJW A;  2P7C B;  2VN2 A;  3SHF A;  5LRS A;  2HWV A;  3IRQ A;  1X3U A;  4NHJ A;  5D5U B;  2HYF A;  4OMZ A;  3BWG A;  1YW8 A;  2RVC A;  3GZ6 A;  1QPM A;  4WXC A;  2X4H A;  4BH9 A;  2Q8K A;  3FZV A;  2JZY A;  1XCB A;  1W5T A;  1SD7 A;  1L0O C;  4IF4 A;  4RB2 C;  1W4M A;  1R1V A;  1SAX A;  5HDK A;  2F5F A;  3JAM Z;  1KQ0 A;  3M8F A;  1BI3 A;  5IT9 K;  4I7H A;  1FP2 A;  3H3U A;  3RPU A;  2BGC A;  1BI0 A;  3D5L A;  2IPQ X;  3L09 A;  4R8H A;  1S3J A;  1CF7 B;  1ZH5 A;  1T98 A;  1S8N A;  3BJ6 A;  3KZZ A;  2ISY A;  5IT9 Z;  2DFI A;  5DCM B;  5D4S A;  2ESH A;  4OIQ F;  1FPQ A;  3LAJ A;  1FBQ A;  3JAM K;  2HR3 A;  3CO7 C;  3GVA A;  2HEO A;  5E18 F;  3CUQ B;  4GYG A;  3QP6 A;  4FX4 A;  4UVB A;  1U78 A;  3BJO A;  1Z05 A;  4ESJ A;  4HX8 A;  3FMS A;  5K5R A;  4YFK F;  2XRN A;  2P5K A;  3FMR A;  2Q0O A;  2EV5 A;  1F4K A;  5HVQ C;  2BBY A;  3N4M A;  3SQN A;  4RB0 A;  2O0Y A;  1R58 A;  2EWN A;  4WXH A;  5AON A;  5J8F A;  2RKH A;  3K1M A;  5HLH A;  3DXJ F;  1O3S A;  1IXS B;  2RV8 A;  2OZU A;  4AIJ A;  4GO1 A;  5DV5 A;  4PDK A;  5ERI A;  4M6Y A;  1EH7 A;  5ILU A;  5A2Q K;  3KP6 A;  4U0V A;  1CF7 A;  5E1Z B;  3C1D A;  3MCZ A;  4U7D A;  3E97 A;  1BC7 C;  3ZMT A;  4L9N A;  4HOB A;  3E5Q A;  5KVR A;  2VXZ A;  3U1D A;  1XGM A;  3PQJ A;  3I0T A;  3MQ0 A;  5FB2 A;  2VBZ A;  2XKO A;  1FBU A;  2F5E A;  2XGX A;  3RYP A;  1R22 A;  4EJV A;  4UHT A;  1OYI A;  2JRT A;  3TGN A;  4XLN F;  5FLX Z;  4U7B A;  1P2F A;  1ZG5 A;  1YS6 A;  4HV5 A;  1O7L A;  1FY7 A;  5D8K B;  2XRO A;  2IP2 A;  3I53 A;  3LA2 A;  3IWZ A;  3IC7 A;  3N97 A;  3KP2 A;  1T2K A;  1BI1 A;  3E6M A;  3SZP A;  1KQ9 A;  3HHH A;  5CVJ A;  5LGT A;  4LD5 A;  2EK5 A;  3F8B A;  1SD5 A;  2H27 A;  3EYY A;  5F1R A;  1R1U A;  3BJA A;  4Y17 A;  1WSU A;  2M45 A;  3IKV A;  3CUQ A;  2EJR A;  2XAF A;  4YII A;  3HIF A;  1ZG1 A;  4JK1 X;  2A5Y B;  6PAX A;  4KA4 A;  3FXR A;  3L2C A;  4XBF A;  1K79 A;  2W57 A;  2FSW A;  3EDP A;  2QYO A;  5HLG A;  2GAU A;  2ZME A;  1LDK B;  2LF8 A;  2YU3 A;  1A04 A;  2H6B A;  2RNJ A;  1IXC A;  3F23 A;  2NRA C;  4LLG F;  4I0A A;  5E8G A;  3RKW A;  4ENJ A;  2ZO4 A;  3NRV A;  2FE3 A;  4I98 B;  4CZZ A;  5L3G A;  3Q9V A;  1XGS A;  2EA2 A;  4ENK A;  1H0M A;  2DPD A;  3SZT A;  3T1B A;  1G3W A;  1FP1 D;  1KU2 A;  2STT A;  1T0F A;  2GA2 A;  2ZXJ A;  2DT5 A;  3F8N A;  3MZY A;  3IRR A;  4I02 A;  5EEH A;  4OIR F;  3U9G A;  1RI7 A;  2ELH A;  2ETH A;  2PG4 A;  2OZ6 A;  2P7V B;  3DFG A;  4B8X A;  3FM5 A;  4DNC A;  2HS5 A;  1EH6 A;  3GFI A;  3TO7 A;  2QBY B;  4KN4 X;  1K7A A;  5D6E A;  1ON2 A;  1TNT A;  2VC1 A;  4MTD A;  4GYI A;  2OQG A;  5ED4 A;  1HKS A;  1RZ4 A;  1I1G A;  1GXQ A;  4FX0 A;  5LLQ A;  4BYY A;  4PCQ A;  2AS5 F;  4KIB A;  2Z33 A;  4IHS A;  4L0Z B;  5ILV A;  3RIR A;  3O6B B;  2M1B A;  2VE9 A;  3QPT A;  3V8L A;  1J5Y A;  1I6X A;  5K1Y A;  1PP7 U;  3F6O A;  5JHU A;  3ZMZ A;  3I4P A;  1CGP A;  2VE8 A;  3LWF A;  3L00 A;  4EJO A;  1XSD A;  4F7Z A;  1IN6 A;  4HDV A;  3GX4 X;  3TKY A;  1YQA A;  2HZT A;  3FHZ A;  4Q48 A;  1JHH A;  1XMK A;  5HS8 A;  2QBY A;  2P5V A;  2XHK A;  2EB7 A;  1HXD A;  4PGH A;  2HTJ A;  1LJ9 A;  3DP7 A;  3LA3 A;  5ICF A;  3JTG A;  3P9C A;  1BJA A;  4M9S A;  4BHP A;  4CXF A;  4ASN A;  4RS8 A;  1B9N A;  5HDG A;  3TOA A;  2EFQ A;  2B0L A;  5LHG A;  3JTH A;  1XDU A;  5BQT A;  3BPV A;  3W6J B;  3K0L A;  4KFC A;  2VOO A;  4AVP A;  4LLL A;  5E8I A;  1QO0 D;  5LEK A;  2CG4 A;  4HF1 A;  2BE5 F;  2PBI A;  4ESF A;  2DLL A;  1YLF A;  3DEU A;  5DEQ A;  1GXP A;  3U2R A;  1KA8 A;  3EYI A;  1XB4 A;  1J9I A;  2VOD A;  1LQ1 A;  1HW1 A;  3EET A;  3QU3 A;  2A6H F;  2Z5U A;  5KK1 A;  3R0J A;  4EMS A;  1K78 A;  1I1S A;  2A61 A;  1OR7 A;  3KET A;  1Z6R A;  5H20 A;  4HW0 A;  1Z6T A;  2PQ8 A;  4ZH4 F;  3V7R A;  4HDU A;  2A07 F;  2LDU A;  2ZME B;  4WXD A;  3I59 B;  4A2U A;  2BEO A;  1IN8 A;  1ONV A;  1OPC A;  2KJB A;  3GFM A;  1ZRC A;  2VT2 A;  1SFE A;  2ZCW A;  3RKX A;  2FML A;  4QWQ A;  4KMF A;  4YFN F;  5J8C A;  2XAQ A;  1IF1 A;  1B59 A;  5FFX A;  4LG0 A;  1XCV A;  2JTV A;  4OOI A;  2EFP A;  1FYK A;  1TLH B;  4KYW A;  4ENM A;  1H9G A;  1U3E M;  4IPA A;  1ZG3 A;  4PZJ A;  5L3D A;  2XAS A;  2K7L A;  4QLC U;  4ESB A;  4HZF A;  2WV0 A;  5TRD A;  3ECH A;  4HQM A;  2FQ3 A;  3KLN A;  2FA5 A;  2ZNZ A;  4EM0 B;  1DDN A;  4R79 A;  2X0L A;  2EV6 A;  2EFN A;  4N0B A;  4A6D A;  3OOP A;  3WTY C;  4Y13 A;  2RDP A;  2L3D A;  3IHU A;  1IN4 A;  4A0X A;  5DYM A;  3FXU A;  2GQQ A;  3B02 A;  1KYW A;  1MJB A;  3I58 A;  5E1X A;  2QVO A;  2CW0 F;  4YFX F;  3TO6 A;  5ICE A;  1YW7 A;  1U5T C;  2QWW A;  2J5O A;  2ESN A;  1Z7U A;  5H6Q A;  1ON1 A;  5L3B A;  4MEX F;  4A5M A;  3R61 A;  2IRF G;  4GXO A;  1LB2 A;  5JVT A;  2NYX A;  4KN7 X;  5DD4 A;  3QP5 A;  1U5T A;  1ZRE A;  1Q1H A;  5DUI A;  2H6C A;  1NHA A;  5AIP A;  3RDI A;  1E2X A;  2ADU A;  2K02 A;  3WOD F;  2RGV A;  5HS7 A;  3DKW A;  5D4R A;  3CO6 C;  3E5X A;  2M8E A;  2DU9 A;  2V79 A;  1J0R A;  4S05 A;  4FHT A;  4L9J A;  4CGZ A;  2KRF A;  1I27 A;  2RC4 A;  2V1X A;  2JPB A;  1EV7 A;  1AWC A;  3TQN A;  4OIO F;  3PQK A;  1D3Y A;  2GWR A;  5AIQ A;  2FOK A;  4AIK A;  4YG2 F;  3ZMU A;  4A0Z A;  4ETS A;  2HFH A;  3WGH A;  3F8C A;  3ELK A;  4CDG A;  4OU0 A;  1ULY A;  2GZW A;  3TO9 A;  3KCC A;  4KDP A;  1ZYR F;  2Z9O A;  5CVI A;  4CIC A;  1S7A A;  1TTY A;  3W6K B;  4M73 A;  3GYH X;  3QAH A;  4KIF A;  5D5V B;  4U88 A;  3B73 A;  1WRJ A;  3QOP A;  4P5O A;  4Q47 A;  4CYD A;  1MD0 A;  5LGU A;  4ON0 A;  4MHG A;  5H6R A;  4ZZD A;  3ZN0 A;  2BYV E;  3FM3 A;  5DDG A;  3P7N A;  2EFO A;  4A0Y A;  4N9I A;  1J7K A;  4JQF A;  3Q9S A;  3RPQ A;  1DPR A;  4UV9 A;  5BOX A;  5D8L B;  1B6A A;  3GO5 A;  4M9Z A;  3ROU A;  3S2W A;  1OYY A;  3HRU A;  2NAZ A;  4G94 A;  5BS6 A;  2PFB A;  2E7X A;  1ZRD A;  3V8K A;  3M9A A;  3COA C;  3ABT A;  4KIG A;  1R36 A;  2DQR A;  2CO5 A;  3ZP5 A;  2HYG D;  2Q2E A;  2OD5 A;  1F9N A;  4G7Z F;  2IT0 A;  2XKP A;  1FYM A;  1IAW A;  4EM1 A;  1JGS A;  2OBP A;  1LDJ A;  3F72 A;  4EQQ A;  3L9F A;  4UNO A;  4A12 A;  3VFZ A;  3DPT A;  2FNP A;  2ACJ A;  4XSX F;  2KJC A;  3E3V A;  2EA4 A;  4RAY A;  2WWY A;  4WCG A;  1TW3 A;  4LG0 B;  3K1P A;  2ZBK A;  2L01 A;  1WQ2 A;  2QUF A;  1FNN A;  3REO A;  3WTZ A;  3WTX C;  3VOE A;  2HKO A;  1ZGJ A;  2F5D A;  3KEO A;  1UHM A;  1FX7 A;  2CFX A;  2W25 A;  3AAF A;  4OIN F;  5CVV A;  2P8T A;  3NQO A;  4MEY F;  1O3T A;  1U6G A;  2DK8 A;  4I2O A;  5LBQ A;  4A6E A;  1QZY A;  3HTS B;  4BNC A;  2R7F A;  4M72 A;  4XLP F;  2KIF A;  1FZP B;  1IRG A;  1D5V A;  1BOA A;  2OU2 A;  2FXA A;  3V4G A;  2FF4 A;  3ERE D;  3D0S A;  2FMY A;  3ULQ B;  2GIV A;  2VC0 A;  1XSV A;  4UV8 A;  1IRF A;  2XAJ A;  4L5J A;  3I64 A;  2AXL A;  2PI0 A;  2C6Y A;  1O3Q A;  2MH2 A;  1P4A A;  4L9T A;  4PGG A;  3O2P E;  4RGU A;  3FXQ A;  3PFI A;  1SD6 A;  1YIO A;  3CLO A;  1HBX G;  2NS0 A;  1S6L A;  2A6E F;  2G7U A;  5E1W A;  3M7G A;  3CUO A;  3RYR A;  3BY6 A;  4KT5 C;  3GW2 A;  2CSO A;  4U0Y A;  1G6N A;  2HOE A;  4EVI A;  2PMH A;  4BAY A;  3J81 Z;  3ISP A;  4OIP F;  3JSO A;  2UXN A;  3R4K A;  1RNL A;  3HSF A;  4IRH A;  5HS9 A;  5JI6 A;  2W84 A;  4LFU A;  4KMU X;  4IRI A;  1BN5 A;  2V1D A;  3I5U A;  1J59 A;  5JR3 A;  1STZ A;  1ZLJ A;  4LB5 A;  3E6B A;  5HLI A;  3ZMD A;  3J81 K;  1IUY A;  3DF8 A;  3EUH A;  3R0A A;  4HAM A;  3DQV C;  4Z2Y A;  2YX4 A;  4Q5S F;  1FT9 A;  1I5Z A;  1YS7 A;  3IL2 A;  4EGZ A;  3MFK A;  2DK5 A;  5E20 A;  1W7P D;  3ABU A;  2VON A;  3FX3 A;  3FMQ A;  3LQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...