2FBHA

The crystal structure of transcriptional regulator pa3341
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
YFGTLLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARHRDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILANLENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator PA3341
publication title The crystal structure of transcriptional regulator PA3341
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 49
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbhA00
1WQ2A 4WXDA 3WE2A 2O03A 1KQ9A 2NNNA 1Y0UA 4L0ZB 2ZKZA 5EEGA 3FM5A 2MLKA 3MWMA 1A04A 1J75A 3GVAA 3J81Z 5DYMA 3DFGA 3QU6A 1X3UA 3BY6A 5D4SA 3H3UA 1P92A 1RIOH 3BJOA 1AOYA 4HA8A 2VOOA 2FU4A 4LLNA 4ESJA 4UXNA 2E7WA 2P5KA 3I71A 5LHHA 2JTVA 4RGSA 3GFLA 4BQAA 2PLYA 5K1YA 1TNTA 4KIFA 2EA4A 4I0BA 5HVQC 2L4AA 2P6SA 4TV7A 2Z99A 3RKYA 1YLFA 2HQNA 1K78A 1S7AA 4EJUA 4OMYA 5DCMA 4KMFA 5LEKA 5ILVA 3E6BA 4HF2A 3BDDA 4GYGA 4RB0A 5HS8A 2STTA 1PP8F 2L3DA 5CVVA 3GW2A 2EK5A 2JZYA 4LJZF 2G7HA 1ZREA 4A2UA 3HRSA 1FPQA 5IT3A 2XV4S 2LKPA 3HHHA 3HOSA 1BIBA 1B59A 2L54A 4KYWA 2DQRA 5H6RA 2NS0A 1T2KA 5FFXA 4I09A 3TDZC 5DD8A 5CVJA 3J80K 5D8LB 3ZMVA 4LG0B 3TO6A 2WC2A 1MKMA 4Y13A 4IF4A 3LA2A 3RKWA 2E1NA 2CQKA 2XGXA 3ZMSA 4CO8A 1SFEA 1C0WA 2PEXA 2IP2A 2O61A 2XROA 1HKTA 2XAHA 1HKSA 4HX4A 4ENJA 2HKXA 1S7OA 2VN2A 2PQ8A 4H0EA 2A69F 2PFBA 2ESHA 1PDNC 2PN6A 3J7AO 5EEHA 3RPQA 3F8CA 4RS8A 4R79A 5HLGA 4HF1A 1HSTA 4UVBA 1V3FA 4OIRF 1R36A 4I98B 2DPDA 2ZMEA 1XGNA 3DF8A 1E2XA 3K0LA 1HBXG 3I5UA 1MDMA 1IN4A 4GYIA 3COAC 4ZYHA 1REPC 4EJTA 2ZBKA 1TQIA 2MA3A 3BWGA 1J2XA 3D0SA 1IXSB 2KIFA 4A6EA 2HYGD 4HX7A 3L09A 5HDGA 1R22A 2W85A 1ZG1A 2HR3A 4IXAA 5D6EA 1LDJA 3R6SA 5BPDA 2VBZA 4HLYA 1FY7A 3W6KB 3E6MA 5LRRA 4B09A 2RC4A 1T98A 1YO5C 2O3FA 4L5JA 4Z2YA 4LK0F 3KETA 1G4DA 2IA0A 3ABTA 3I54A 2EFNA 1P4XA 1KU2A 4LG0A 3RIRA 1ZG5A 1Z6RA 1FZPB 5FO5A 1GHCA 1O7FA 3MEXA 4KN4X 1BI0A 3EYYA 3OV8A 4RB1A 3GEZA 2FEZA 4A0ZA 1BIAA 3RJPA 3J81K 3T1BA 1DPRA 1XB4A 3IKTA 4IHTA 3K1MA 3L00A 2HTJA 3I4PA 3P7NA 4ENKA 4HBLA 2YR2A 2EV6A 2V6CA 3N4MA 3QPTA 4PZJA 1QO0D 2CYYA 1FLIA 2VC0A 1W7PA 3V4GA 2YPRA 5H20A 4UVCA 1LEAA 3HSRA 4OOIA 3LFKA 5FFZA 4UV8A 1FNNA 1O3SA 5HDNA 2FQ3A 3LSTA 4Y15A 1PP7U 2DT5A 3WTSC 2EFPA 2GA2A 5AIQA 4XSXF 2PJPA 1UHMA 2XAFA 1LNWA 4ESBA 2ZFWA 1XD7A 3DKWA 3DXJF 5E1WA 2IRFG 2G9WA 2A61A 2HWVA 3KLOA 2LNBA 3GWZA 2EA2A 5HS9A 2UXNA 4FT8A 3ECHA 3LWFA 3JTGA 1P4AA 4LFUA 2P8TA 2ZNZA 2P5VA 2DW4A 4P96A 2QLZA 2OU2A 4KT5C 4P5OA 2X4HA 3N97A 1TNSA 3HUGA 4AWXB 2VC1A 2AXLA 2F5EA 3EUHA 3Q5FA 4UVAA 1U8RA 4EMSA 1IAWA 2YX4A 4I0AA 3E5QA 1KYWA 4A6DA 3VODA 4CHUA 2P5LC 5CVUA 2ZNYA 2PBIA 4KA4A 4G9YA 2D1VA 2FNAA 1ZAOA 1BC8C 3FMRA 4G7ZF 3E97A 3T8RA 1U78A 1KYZA 1MGTA 4HOBA 3FWEA 1EH7A 1RNLA 3ML6A 2QQAA 2CW0F 3KP4A 3HRMA 2XUBA 3JAMK 3REOA 1F1ZA 4JBAA 2MC3A 4EQQA 4BXUA 4Q47A 1T38A 2RDPA 3RYPA 3WU1B 3V8JA 2GIVA 1QZYA 5E8GA 3R60A 4U0YA 3KP3A 4XSZF 4YIFA 4HQEA 2FBHA 2KKOA 2XIGA 2A6EF 5A2QK 4KIBA 2Q0OA 1YIOA 2F5CA 4ZH4F 2MH9A 2PI0A 2STWA 3JW4A 3L2CA 3HTSB 4RGXA 3QP5A 3ZMDA 5JHUA 1FSEA 3QPHA 3HTUA 3QRFF 4FX0A 3K1NA 4KIGA 3NRVA 5L3BA 3FZVA 3ELKA 2ZO4A 1XMAA 1LQ1A 1FBQA 1ZHFA 2RQPA 3FXUA 3PQJA 2H6CA 5LHGA 3R0AA 1ZRFA 5LBQA 3C3WA 2FBKA 3KEOA 2XRNA 5H6QA 2EJRA 4HV5A 4G8XA 1EH8A 3SXYA 4CYDA 4LK1F 5HDKA 1FWZA 4F7ZA 2IW5A 4M9XA 5DV5A 3WGHA 4HW0A 1S3JA 1OYIA 3F8BA 3SQNA 3BPVA 4RB2C 4U7BA 4HQMA 4OIPF 1H9GA 3QU3A 2RGVA 1T39A 3C7JA 3LQQA 2WV0A 4FHTA 4PDKA 4BH9A 3ERED 2QENA 1Z9CA 1D8KA 3DPTA 3KFWX 1DUXC 6PAXA 3TGNA 1P2FA 4IRGA 1J7KA 3CLOA 3EETA 5L3CA 3F8FA 1SMYF 5F1RA 4CDGA 1MZBA 4XLNF 2Z9OA 2L02A 3ROUA 1ZARA 1KU9A 4U0VA 2FE3A 5K5RA 2OBPA 2J5OA 1MJAA 4HLXA 2KJBA 2JT1A 1IUYA 3M7GA 2Q8KA 1BI3A 1QGPA 4MTDA 1YS7A 2RNJA 1EV7A 5ILSA 2MH2A 2P6TA 4WF2A 1B9MA 2QQBA 1OKRA 1ZN2A 5KK1A 4O3MA 1V4RA 2O0YA 3GFJA 1BC7C 2L01A 3U2RA 2HTSA 3E6CC 1WWXA 1BN5A 2QWWA 2V1DA 2E7XA 4IHSA 1WRJA 3MZYA 5ICEA 3M1EA 4MTEA 4WK8F 1QZZA 4U0WA 2BE5F 3VB2A 1YW8A 3LQRA 2A6HF 2ZMEB 1J59A 1ZLJA 1T0FA 5D5UB 1MDMB 3V8KA 1CF7A 2B0LA 1ON1A 4L5IA 4RGUA 1YS6A 3SFZA 2UXXA 5ICFA 4P9FA 1R7JA 1FOKA 4YIIA 4BHBA 5FGMA 3LAJA 4IRHA 1O3RA 4OIQF 3ZMZA 1ULYA 1ONVA 2NRAC 1UCRA 2XVCA 2GXBA 3GFMA 2XKOA 3JTHA 1I5ZA 3IKVA 3TO7A 4HF0A 1HSJA 4ETSA 2Z3YA 2VE9A 3T8TA 2LSOA 2KIUA 1R1TA 2KJCA 4L18B 1UHWA 3G73A 1P4WA 3GFIA 3DV8A 3WG9A 5DUIA 2K4JA 1ZLKA 2W57A 3L9FA 4EGZA 3H92A 1Z6TA 2QBYB 1P6RA 2F5DA 5F6FA 1HQCA 1U2WA 3CUOA 2FMLA 1W7PB 5HOOA 1G3TA 2E1CA 4ENMA 1OYYA 1YW9A 2ADUA 3ZMUA 1RI7A 1BI1A 2H94A 2DLLA 1KGSA 5LLQA 1U5TA 3QAHA 4EJVA 4L9NA 5JVTA 1MD0A 1TW2A 1JXSA 2EB7A 5KVRA 1J0RA 1RZ4A 2FBIA 3E5XA 3WTZA 2XAQA 3TQNA 4RB3C 1RUOA 1BBYA 3P9KA 4HV6A 2GWRA 2M87A 4WCGA 2F5FA 2OA4A 3EDPA 5CVIA 2K4BA 3ISPA 2M5WA 3MCZA 1LEBA 5E17F 3E5UA 2DPUA 3R4KA 4ZZDA 2FRHA 3M9AA 4EM1A 2QYOA 5AIPA 1OYWA 3I64A 1IN6A 2DQLA 4HYEA 3RPUA 2JPBA 5IT9Z 1FX7A 3LA7A 1W7PD 1IN5A 1Q1HA 1G3WA 1J5YA 4YG2F 1FYLA 2A07F 2P7CB 1LDDA 2QBYA 4HZFA 3CJNA 3ZMTA 1JE8A 1F9NA 4R1HA 4UV9A 1QQIA 1R5HA 2YX7A 4UNOA 4ZYGA 3FXQA 3F3XA 2ISYA 1BM9A 4KN7X 5J8FA 2VXZA 2CFXA 3O3KA 2NYXA 3D5LA 1GXQA 4CXFA 4WX9A 1VTNC 4Q4ZF 2Y75A 3IWZA 2VT3A 3KZZA 2HQRA 3K9TA 4WXCA 2XASA 2BEOA 2VOPA 2Z33A 1UB9A 4IJAA 2FNPA 5CJ9A 2PG4A 3MZHA 5E1ZB 3TOAA 3R61A 4KDPA 4AD9A 1IRGA 3KP7A 2EFWA 4Y17A 1B4AA 3F8NA 1SD4A 1HXDA 2KRFA 1ZG3A 2EFQA 4EV0A 2JRTA 3GO5A 4MNUA 1XGSA 3F22A 3SZTA 4KICA 2DTRA 1IXRC 3RI4A 1KA8A 1D5VA 5DUKA 4BHPA 4LD5A 1K7AA 2RVCA 3CUQC 2DAOA 2LDUA 4MHGA 3JSOA 1STZA 2HFHA 4UHTA 1TTYA 4N0BA 4HX8A 2EFOA 2QQ9A 3NQOA 1TQMA 2GZWA 3GZ6A 2ZXJA 4RAYA 4S04A 4M6XA 1U3EM 1XSXA 4MQVA 1R5GA 4IRIA 2EV0A 1TBXA 2BYVE 2CO5A 2D2WA 2QUFA 5DEQA 2HDCA 4OMZA 3I53A 2XKPA 1TLHB 1S6LA 2P7VB 1Z91A 4P55A 5J6XA 1Z1DA 3K1PA 4G94A 3TOBA 1S8NA 1FSHA 2C6YA 2MD5A 5LHIA 2G7UA 5TRDA 3QP6A 1XDSA 2ZCWA 3G3ZA 5L3EA 4JK1X 3P9CA 1YYVA 1FBSA 2COMA 3KEQA 4BYYA 3ZN1A 3VOEA 3M8EA 3WTVC 3O2PE 2K27A 1T6SA 2DO7A 4JQFA 1WSUA 2VT2A 5LEJA 4M9SA 3QOPA 3FXRA 1U5TC 5LGUA 2OAZA 3IHUA 1SMTA 5DDGA 1FP1D 2EV5A 4LLLA 3I0TA 1L3LA 4O5VA 4N9IA 1KU7A 4KFCA 2QZ8A 4KMUX 4U7DA 1JHHA 2VBXA 3GX4X 5FLXZ 5D5VB 4OINF 1JGSA 1NHAA 4AIHA 1HW5A 3HYIA 2WTEA 5DCFA 4AVPA 3FMSA 4CICA 3BP8A 1FYKA 2HOEA 4E70A 1R00A 2PMUA 3KP6A 2FF4A 2W24A 5LGTA 3E3VA 2OD5A 3CO6C 3WE3A 3IRRA 2IJLA 3VFZA 1SFXA 4A0XA 2VODA 3FF5A 1YQAA 3MAJA 4ENNA 3DP7A 2ACJA 1ZGAA 3O6BB 1CF7B 4A5MA 1ZGJA 4Q48A 2BV6A 2MLGA 1F5TA 1JHFA 1RUNA 5D4RA 4HAMA 3B02A 3BJAA 1I6XA 5FB2A 4AIKA 1OR7A 2Z5UA 1XSDA 1AWCA 1O3TA 3WGGA 3WGIA 1S29A 3V7RA 4DNCA 3MQ0A 3T5XA 3ZP5A 2CSOA 2CG4A 3IRQA 2V1UA 3U9GA 4PGGA 3HHGA 1TQPA 2MBFA 3VEPA 2DI3A 2Q2EA 3GXOA 3I59A 5HLHA 4EJOA 1K6OA 2W84A 4L9VA 5E20A 3RTRA 1USSA 1K79A 4M74A 2H6BA 4ZYEA 2JSCA 1BOAA 3PFIA 2UWMA 4NHJA 1D3YA 1I27A 1IW7F 1TW3A 1HW2A 5D5WB 1KU3A 3BPXA 4A12A 1YFHA 2IPQX 1I1GA 4NQWA 4EVIA 4G6QA 5HS7A 1HW1A 3C18A 2OZ6A 2XHKA 4LGWA 3PQKA 4P9UA 1U5TB 1XDUA 3K69A 1U6GA 2RV8A 1G3SA 1G3YA 3Q9VA 4KUMA 5L3DA 2O6GE 1H9TA 1IXCA 4EM0B 2V79A 2M8EA 1I1SA 1W5TA 4MGRA 4RGRA 2CWEA 3GLXA 4ZZLA 3BJ6A 3CUQA 4I01A 5E18F 3F23A 2ELHA 2XAGA 5DD4A 1SD7A 2M45A 3HSFA 2HEOA 2JPCA 4K2EA 2HS5A 3HSEA 1LVAA 5L3GA 3OOPA 5BMZA 3ZQ7A 3BROA 4M71A 4XLPF 1KQ0A 2A68F 5FLXK 3ZN0A 2D45A 5BPIA 3HRUA 4EJWA 5HLIA 2QVOA 5JFRA 3RKXA 1IN8A 1GVJA 5LGNA 2DK5A 1LDKB 1YW7A 1FP2A 2HGCA 3ULQB 2ZJ2A 4I2OA 3KE2A 1FC3A 3F72A 1W5SA 1OPCA 3WTWC 2UZKA 2LF8A 4UUVA 5D8KB 1EH6A 3WTYC 1E17A 2NAZA 4ZYDA 2V9VA 4HDVA 1KQ8A 4A5NA 3HRTA 1DDNA 3CTAA 3JSPA 1XCVA 2TDXA 3ABUA 2YSRA 3S2WA 3FX3A 5CVRA 3KZYA 1CGPA 3JAMZ 2GA1A 2X0LA 3F6OA 2WWYA 5ERIA 2IT0A 1R23A 5ED4A 3IL2A 3L7WA 1QPMA 4MEXF 2K02A 3V7CA 2A5YB 3IWFA 2QM3A 2R3SA 2M1BA 4G7HF 1MJ9A 3CO7C 5ICCA 4EGYA 4ASNA 2R7DA 4YFXF 5BQTA 3R0JA 3P9IA 1ON2A 4MQ9F 5JI6A 5A2QZ 1Z05A 4I02A 2Y0MA 3NEUA 1XGOA 2F2EA 1YTYA 1FYMA 4U88A 2IA2A 3F6VA 2OZUA 1H0MA 5K5QA 5JR3A 1PUEE 4QWQA 2IVMA 3SHFA 4CGZA 2FOKA 1MJBA 1GXPA 2BBYA 1ZRDA 5F64A 2ESNA 2DU9A 1IN7A 1FBUA 5CLSA 3V7SA 4BAYA 1B9NA 2FA5A 2HYFA 3ECOA 1LB2A 3KCCA 5ICGA 1O3QA 3LAPA 2HKOA 1WKMA 3TKYA 4XRFA 3FMQA 4M72A 4IPAA 4QLCU 2EWNA 1WI9A 4MEYF 3CDHA 4WWCA 2AS5F 4CZZA 5FD6A 4L9JA 4OU0A 3K2ZA 3KP5A 3BZ6A 5J8CA 4KNYA 2K7LA 1W4MA 4GGGA 1XMKA 4OIOF 1XSVA 2VONA 4D0PA 5LRSA 2KIMA 5K5OA 4DQ2A 2P4WA 2W25A 5L3FA 1QBJA 4LB5A 1USTA 1R58A 1FT9A 5TJJA 3WU0A 3V8LA 4IVNA 3WTTC 4WXHA 4GCVA 2J5PA 2ETHA 3KLNA 1HKQA 4G6DA 3HIFA 2M30A 1Z7UA 5ILUA 4PGHA 3SZPA 4XBFA 1XN7A 1J9IA 2YU3A 3W6JB 5BOXA 2ISZA 3IC7A 3TDUC 1O7LA 3EQLF 4L0YB 4M6YA 2H09A 2GXGA 3F8MA 2VE8A 2VBYA 3TO9A 1DPUA 1QNTA 2CGPA 4L9TA 4HDUA 1R1UA 1BI2A 2PMHA 2V1XA 3WTUC 5BS6A 1SD6A 1SFUA 4GXOA 1B1BA 4R8HA 2VBWA 3H3ZA 4LLGF 3AAFA 4BHCA 1SAXA 2Y48A 1F4KA 2A3SA 3WTXC 4GO1A 1DP7P 2GAUA 2DBBA 1XGMA 4N9HA 1IRFA 1SD5A 4FX4A 4Q5SF 4O6JA 5D5XB 2DK8A 3BOQA 2DFIA 1UFMA 3FM3A 2FXAA 4EM2A 4A0YA 1L0OC 2LF7A 3I59B 2O8XA 3J80Z 1ZRCA 2R7FA 2IA1A 1G6NA 2OQRA 2FSWA 4I7HA 1IF1A 3ZPLA 3DQVC 4S05A 2D1HA 3Q9SA 4ESFA 5D6FA 4B8XA 5IT9K 1D8JA 4NB5A 4BNCA 3GYHX 1OMIA 4AIJA 3RDIA 4LB6B 3EYIA 4ON0A 3WODF 5E1XA 3E6DA 4RAZA 2L4MA 4YFNF 3B73A 3MFKA 3GUDA 3KP2A 1R1VA 2RKHA 1LJ9A 4M73A 1ODDA 5AONA 1K78B 5DCMB 3DPLC 2BGCA 3HOTA 5E8IA 2NNYA 2GQQA 3F21A 4PCQA 4G7OF 3I58A 3RYRA 4YFKF 3GF2A 1IZ1A 1B6AA 2HZTA 2OQGA 2K86A 5FD5A 3C1DA 3T0YA 2RN7A 3M8FA 4M9ZA 3CUQB 1YG2A 2XAJA 3LA3A 1ZYRF 2H27A 1BJAA 5CYVA 3DEUA 3GZ5A 1O57A 2FMYA 1XCBA 3U1DA 3FHZA 1ZH5A 4LMYA
chains in the Genus database with same CATH superfamily
3HKZN 3K10A 1WQ2A 4WXDA 3WE2A 4X0GA 2O03A 1KQ9A 2CRGA 3S2HJ 4ANJA 2NNNA 1LKXA 2IAIA 2CMPA 3WHCA 1Y0UA 4XONA 4L0ZB 5JLXA 2ZKZA 5EEGA 3J7YJ 3OYJA 1YRNA 2IXSA 3FM5A 2MLKA 3MWMA 1A04A 1QZEA 2HZDA 5M5XJ 1J75A 3GVAA 3J81Z 4MFEA 5DYMA 2VUMJ 3DFGA 3QU6A 4M6VA 1X3UA 1MNDA 3NWTA 1FJLA 4Y7NJ 2E5ZA 3BY6A 5D4SA 3H3UA 1UAAA 3VPRA 1P92A 1GT0C 5GTIC 1RIOH 3BJOA 1AOYA 4HA8A 2VOOA 2JRMA 2W00A 1WJ5A 2FU4A 4LLNA 1A5JA 3CF2A 4ESJA 4UXNA 2E7WA 2M8GX 2P5KA 3I71A 3VDXA 2XRLA 4I6ZA 1V5EA 5LHHA 2JTVA 4RGSA 3GFLA 3G71I 4BQAA 2B7EA 2PLYA 2IS6A 1R5ID 3U21A 5K1YA 1TNTA 4KIFA 1I3QJ 1YE9A 2EA4A 1Z3XA 4I0BA 4PUSA 5J3LA 4E7SA 5HVQC 3L2QA 1EF4A 2L4AA 4DYQA 2P6SA 4TV7A 2Z99A 3RKYA 1NTCA 1YLFA 2HQNA 1K78A 1S7AA 3VYUB 4EJUA 4G6TB 5DCMA 4OMYA 4KMFA 5LEKA 4M3BA 2BHZA 5ILVA 3EUHC 1ETVA 3E6BA 4F92B 3S14J 4HF2A 3BDDA 4B47A 4DGWB 3PO2J 3BQYA 4GYGA 4RB0A 4UUSA 5E3LA 1AKHA 5HS8A 2OTJI 2ELJA 2R7TA 4KT6A 4E7IA 4ZTJA 2STTA 3OYAA 2JUGA 1PP8F 2E1MB 2L3DA 5CVVA 5M5YJ 3K7AJ 3C2BA 3GW2A 2EK5A 2ZSHB 2JZYA 3CMMA 4LJZF 2G7HA 3ZOBA 1ZREA 2MC4A 4A2UA 3HRSA 1FPQA 3QQAA 5IT3A 3SYTA 3H3VK 3S1RJ 4E6KG 1JT0A 2XV4S 2LKPA 3HHHA 3HOSA 2NS8A 1JT6A 4RAGA 1BIBA 1B59A 2L54A 2KIQA 3Q0VA 4M3GA 4KYWA 4FQGA 2DQRA 2XPUA 3SEQA 5FKMA 3LSMA 5H6RA 2NS0A 3UKGA 1T2KA 2O7OA 5FFXA 3DTIA 4I09A 3TDZC 1VI0A 5DD8A 1A6QA 5CVJA 1U9NA 2HI3A 1FTTA 3OR2C 2M2EA 3J80K 5D8LB 3W2AA 1G2HA 3ASNH 3DEEA 3ZMVA 4LG0B 1W0TA 1X2MA 1KZHA 3TO6A 2WC2A 1MKMA 4Y13A 4IF4A 1WZ2A 3LA2A 4Y3OA 3RKWA 2E1NA 1JI8A 2EIJH 5CKTA 2CQKA 2XGXA 3ZMSA 3BTIA 4CO8A 1SFEA 1OCCH 5FKKA 1C0WA 2PEXA 1RESA 2IP2A 2O61A 4ZYAA 1JKRC 2XROA 1HKTA 2CJJA 2X6XA 4XN0A 2XAHA 1HKSA 2LKXA 4HX4A 2EINH 4ENJA 2HKXA 2WY8Q 3HJEA 1S7OA 2JA7J 2VN2A 4X1EA 2BXYA 3GCMA 2L9VA 2PQ8A 2HPIA 4H0EA 2HQAA 2COBA 5F04A 2A69F 3A0BC 2PFBA 2ESHA 1PDNC 2PN6A 3J7AO 2JVGA 5EZGA 2HVQA 2EZKA 4N4OB 1X3WB 5EEHA 3RPQA 2XF6A 3CZ6A 3F8CA 4RS8A 4DBQA 4CUGA 4R79A 3FXKA 1NK2P 5HLGA 3D5SC 4HF1A 2DOAA 3O8GA 1HSTA 4UVBA 1V3FA 4OIRF 1R36A 1DU0A 4I98B 2DPDA 2D5VA 3EPZA 2ZMEA 1XGNA 4XICA 2NVTJ 3DF8A 1E2XA 1TWAJ 2I5UA 2L7KA 1R4MB 2E1OA 3K0LA 5E3MA 1HF0A 1NG7A 1HBXG 3I5UA 3A01B 1IN4A 2KZGA 1MDMA 4RLFA 4GYIA 3COAC 3H35A 2RNGA 2XDVA 3HM5A 2BY3A 3CCYA 2ID6A 4ZYHA 1REPC 4EJTA 2ZBKA 1TQIA 2XGEA 2MA3A 3BWGA 1J2XA 3D0SA 4L5EA 2KP6A 3H9GA 1IXSB 3K70C 2KIFA 4A6EA 3KIOA 4CZCA 2HYGD 2AO9A 3S16J 2R7ZJ 2R7VA 4HX7A 1I50J 3L09A 5HDGA 1R22A 2XAUA 4U87A 3VSKA 3JRFA 1T33A 2RAEA 2W85A 1ZG1A 2HR3A 2LR8A 1SEUA 4IXAA 2JK3A 5D6EA 1SVLA 1VQ6I 1LDJA 1EKEA 1W0UA 3R6SA 5BPDA 2VBZA 1Y6IA 2QF7A 4HLYA 4UB6C 1FY7A 3W6KB 3A4CA 4Y4RA 3E6MA 3HZJA 5LRRA 4FE7A 4B09A 5E79C 2RC4A 4Z6YA 1T98A 1YO5C 2O3FA 4L5JA 4JX4A 3HOWJ 1QPIA 4Z2YA 3ASOH 4LK0F 4DZPA 3KETA 1G4DA 2IA0A 3ABTA 3F0CA 3I54A 2EFNA 1P4XA 1X1BA 3ONQA 1KU2A 1ITYA 4LG0A 3RIRA 1ZG5A 1Z6RA 3K4LA 3JRGA 1MNMC 1FZPB 5FO5A 1GHCA 4EEFG 1O7FA 3MEXA 1WI3A 4KN4X 1BI0A 2K5CA 3EYYA 3OV8A 4AVZA 3FDYA 1RRJA 1F36A 4FCYA 4RB1A 3GEZA 2FEZA 4A0ZA 1BIAA 3S32A 3RJPA 1IO2A 3J81K 3DLLF 3CMEI 1U8BA 3T1BA 1DPRA 1XB4A 1ZGWA 3IKTA 4IHTA 3K1MA 3DKYA 3L00A 5M3MJ 2HTJA 3MN2A 3I4PA 3X2QH 4DJAA 5F1JA 1QA6A 3P7NA 4ENKA 4OWRB 1Y1VJ 4HBLA 5BNGA 2YR2A 3FXMA 3JCUC 4D7NA 2EV6A 4BE0A 2V6CA 2VQLA 3N4MA 4HSRA 3IP4B 3QPTA 4PZJA 4DIQA 3KYLA 1QO0D 2CYYA 5GP9A 2QKLB 3U1KA 1FLIA 2VC0A 1W7PA 5C4JJ 5IY5H 2EZHA 3HOYJ 3V4GA 2YPRA 2R7RA 5H20A 4UVCA 1LEAA 3HSRA 4OOIA 3LFKA 3VSLA 5FFZA 4UV8A 1FNNA 5IYCJ 1AA7A 1O3SA 2CU7A 5HDNA 3FKIJ 2DA2A 2FQ3A 3LSTA 4Y15A 1U0JA 4BDZA 3A2KA 2ZFUA 1PP7U 2DT5A 3WTSC 2HXOA 2EFPA 3H1CA 3RQIA 2IEKA 2GA2A 5AIQA 4V2GA 4XSXF 2PJPA 1BL0A 1UHMA 2XAFA 3W2VA 5HODA 1LNWA 1IV8A 4ESBA 3BR5A 1XS9A 2ZFWA 1XD7A 5FRNA 3DKWA 3DXJF 5E1WA 2IRFG 1IRXA 5M3FJ 2G9WA 4Y33A 2A61A 2HWVA 3PSIA 1T0FC 2VKVA 1OCRH 3KLOA 1X58A 3V42A 1X1DA 2LNBA 1TL8A 3IH3A 4A3KJ 3BR6A 2H8WA 2EA2A 2QSFX 3GWZA 3QYFA 5B5EC 5HS9A 1AU7A 3BTLA 2UXNA 4FT8A 2V6EA 3ECHA 3LWFA 3LNQA 3JTGA 1P4AA 2AQEA 4LFUA 3HB9A 3CJQB 2P8TA 2ZNZA 2P5VA 2DW4A 5KCMA 2KZVA 4P96A 2QLZA 4PJJA 2OU2A 4KT5C 4P5OA 1X3ZB 3ERMA 2XSJC 1V5FA 2X4HA 3N97A 4AM3A 2ME6A 1TNSA 3ZXSA 4XLHA 2UV1A 2X1CA 4XOTA 3HUGA 3P5JA 4AWXB 3W2WA 3MKZA 2WADA 3FXJA 2VC1A 3PNTA 2AXLA 2F5EA 3EUHA 4W1UA 3Q5FA 1HDDC 3PFYA 4UVAA 1JUMA 4M3EA 3AL0C 4DZJA 1U8RA 4D1QA 4EMSA 1IAWA 3HOVJ 2YX4A 4I0AA 5C44J 3E5QA 2OCEA 1SFOJ 1VQPI 1ZKGA 2DFFA 2R5YA 2O9LA 3B6AA 2Q1ZB 1KYWA 3TBIA 1IGNA 1RETA 3W6VA 2QSGX 4A6DA 3VODA 4CHUA 4MIMA 2P5LC 5CVUA 2ZNYA 2PBIA 4KA4A 4G9YA 4BGDA 2D1VA 2FNAA 1ZAOA 1FOXA 1BC8C 3FMRA 3E97A 4HPQA 4G7ZF 1ZR2A 1X4PA 3T8RA 1U78A 1KYZA 1MGTA 1N75A 4HOBA 3FWEA 1EH7A 2LYCA 1NH3A 4HEA2 2QSHX 1RNLA 2H1LA 3ML6A 2QQAA 2CW0F 4RMNA 4PJNA 3KP4A 3HRMA 2XUBA 5JVGF 3JAMK 3REOA 1F1ZA 5LFAA 2NVYJ 2BOLA 1P9QC 4JBAA 2GLOA 2MC3A 4EQQA 3LMMA 4BXUA 3L2RA 2PMZN 4Q47A 3LSJA 1X4OA 1P7JA 1T38A 2RDPA 3RYPA 3WU1B 1JUSA 3V8JA 2GIVA 1VFCA 1KONA 1QZYA 3AG4H 5E8GA 3R60A 5FKOA 2Y30A 4U0YA 3KP3A 3ZRGA 4B43A 4XSZF 4YIFA 5IP6A 4HQEA 2FBHA 2KKOA 2XIGA 4BQNA 2A6EF 2AXTC 3J7ZI 4QPOA 3DU6A 5HNFA 4KIBA 5A2QK 3JRIA 2Q0OA 3E7LA 1RC9A 3Q3SA 4F52A 1YIOA 2F5CA 4ZH4F 3AG1H 2MH9A 1Y8QB 4NUBA 3UNGC 2PI0A 1S72I 3M8JA 5EGOA 2STWA 2EPFA 3BG7A 3LSGA 2X9DA 3JW4A 2LBFA 2BVMA 3L2CA 3HTSB 4NNJA 4RGXA 3QP5A 3ZMDA 5JHUA 5EG0B 3CESA 3D1NI 1YRNB 1MMNA 1FSEA 1JKQC 3QPHA 5J40A 2I8DA 2X6YA 1SVMA 4J01A 2JWTA 3HTUA 4XLEA 3IV5A 3QRFF 1FIAA 4PFPA 4FX0A 3K1NA 4KIGA 3NRVA 5L3BA 2VPRA 3HGGA 3FZVA 3ELKA 4LG3A 2ZO4A 1XMAA 3K70D 2EQRA 4E7LA 1LQ1A 1FBQA 1ZHFA 2RQPA 3FXUA 3PQJA 3SJMA 2H6CA 5FLMJ 5LHGA 1JKOC 3R0AA 1ZRFA 3DCFA 5LBQA 3C3WA 2B9SA 2FBKA 3BR1A 3KEOA 4AIDA 2XRNA 5B3SH 5C4XJ 2BVLA 3H0DA 5H6QA 2EJRA 2WY7Q 3TW7A 4HV5A 4NC7A 4G8XA 3TW6A 4BJTA 1EH8A 1T08B 4HNTA 3SXYA 4CYDA 4LK1F 3FK7A 5HDKA 1FWZA 4QPQA 4F7ZA 2IW5A 4M9XA 5DV5A 2XC7A 3CQZJ 2HOTA 3WGHA 3A03A 4HW0A 2WAQN 1S3JA 1W36C 1OYIA 3F8BA 4AYBN 3H5NA 2DMQA 3GLLA 3SQNA 1RKTA 3BPVA 2VQCA 2QA4I 4PJMA 4DW6A 1VQ8I 4RB2C 4U7BA 2TRTA 2HQ5A 3W3CA 4HQMA 3H5AA 2PJRB 2NXNB 4OIPF 1H9GA 3CCMI 2BHYA 3QU3A 2RGVA 3OWTA 1T39A 3C7JA 3LQQA 1POGA 1VQNI 2WV0A 1DGRM 4FHTA 2LD5A 2HU9A 4PDKA 4BH9A 3ERED 2QENA 3S3OA 1Z9CA 2DDBA 1D8KA 3DPTA 3KFWX 1DUXC 6PAXA 3TGNA 3ZQFA 5F0FA 1MBJA 3S3MA 1H8AC 1P2FA 4IRGA 2QEXI 1J7KA 3CLOA 3EETA 2IS1A 5L3CA 5IPAA 3F8FA 1SMYF 5F1RA 3HKZA 4CDGA 2X51A 1MZBA 4XLNF 2LRDA 1ACIA 2Z9OA 2L02A 3CDIA 3ROUA 2E2HJ 2XSDC 5GAGJ 4OAYA 1ZARA 1KU9A 1V54H 4U0VA 2FE3A 5K5RA 3ZQQA 2OBPA 2IGKA 3FISA 1TWHJ 2J5OA 3GBGA 1NK3P 1WJFA 1MJAA 4HLXA 2KJBA 5EYRA 2JT1A 1XTAA 1IUYA 3M7GA 2Q8KA 1ETWA 4LITA 1BI3A 2GOXB 1QGPA 2XGCA 3L2VA 2R7OA 2Z2SB 2ECBA 4MTDA 1YS7A 2RNJA 5EG0A 4KJZA 1EV7A 5ILSA 1YJNI 1H88C 4IHXA 2MH2A 5GAHJ 1PUFB 2P6TA 3QYEA 4WF2A 4XNFA 1B9MA 2QQBA 1OKRA 2EILH 3QODA 4NC8A 5JLWA 3GTMJ 4D5CA 1ZN2A 4XORA 3I55I 1FMVA 5KK1A 4O3MA 3CCRI 1D1AA 1V4RA 3HXLA 2O0YA 3GFJA 4IKFA 3QPSA 1BC7C 2L01A 3U2RA 1F43A 2HTSA 3A0HC 2V9PA 1AHDP 4FISA 1DU6A 2DT7B 3PM1A 4D7MA 1WWXA 3OIOA 3E6CC 1BN5A 3CDLA 4IHVA 3K4NA 5FROA 1H89C 2QWWA 2NVXJ 1VNDA 2V1DA 4J19A 4ABZA 2E7XA 4IHSA 1WRJA 3MZYA 3I4MJ 5ICEA 3M1EA 4MTEA 5J1RA 2KPMA 1N78A 4WK8F 3M3YJ 1QZZA 2P0WA 4MO7A 4U0WA 4CCNA 1R6RA 3OMYA 2BE5F 3BCBA 3S93A 3VB2A 1YW8A 3LQRA 2A6HF 2ZMEB 2XGDA 1J59A 1GLNA 4ITVA 4C9YA 4D9JA 1ZLJA 1T0FA 1TC3C 3ABMH 5D5UB 3HPHA 3I3LA 1MDMB 3V8KA 3B6CA 3HBLA 3WG7H 2B0LA 1CF7A 4IEJA 1BA5A 2F48A 1ON1A 2PJRA 4L5IA 2TCTA 4RGUA 2L7FP 1WCMJ 2FOWA 1YS6A 3SFZA 2UXXA 3OYKA 5ICFA 3G1MA 4P9FA 4E7HA 1R7JA 1FOKA 2L7MP 2KT0A 3VWBA 4YIIA 4BHBA 2DMTA 2HYJA 5FGMA 4B4CA 3LAJA 2CW8A 3LSPA 1VQ9I 2XB5A 2OUMA 3CCQI 4A3DJ 4AU7A 2KDZA 2KRCA 4IRHA 3DBLB 4J00A 2N8GA 3OYCA 1O3RA 4OIQF 1WHUA 2V9KA 3CC7I 2HXIA 1OQYA 2QCOA 3ZMZA 1ULYA 1ONVA 3MKLA 3BT9A 2NRAC 1GVDA 4ZDPA 1UCRA 2XVCA 2GXBA 2V4JC 1FOWA 3GFMA 4XQFA 2XKOA 3JTHA 4C3HJ 4W97A 9ANTA 4CCMA 1I5ZA 3OOUA 3IKVA 5J4YA 3OS0A 3TO7A 2VI6A 4HF0A 1HSJA 1B72A 2K9MA 4XLAA 4ETSA 1YJ9I 2Z3YA 2VE9A 3PUBA 1PUFA 1B8IA 3CP2A 1MBGA 3OIPA 2MFZA 3T8TA 2LSOA 5EDNA 2KIUA 1O4XA 1R1TA 3BQZA 4PSXA 5F08A 1GDTA 1LE8B 3SZGA 2KJCA 2X6OA 3AFHA 4L18B 1XX5A 1Y39A 1UHWA 3BG9A 1P4WA 3G73A 1MMSA 4HRIA 3GFIA 2XF7A 4GFBA 3DV8A 3WG9A 2BXZA 5DUIA 2K4JA 1ZLKA 2W57A 2K40A 2LY9A 3L9FA 2M3AA 4EGZA 3PIOF 3S2DJ 3H92A 2XPWA 1T56A 4XRMA 2F6CA 1Z6TA 2QBYB 1BOBA 2ZJQF 1P6RA 2F5DA 5F6FA 1HQCA 3LSHA 4E7ZA 1U2WA 3N05A 3CUOA 2FMLA 1W7PB 5HOOA 1LFBA 1G3TA 3BZKA 2GBYA 4DBRA 2VXDA 2E1CA 3JRBA 4ENMA 4DOZA 3HDDA 1OYYA 1YW9A 3MMYB 2ADUA 2LREA 3HGYA 3ZMUA 1RI7A 1S9HA 1BI1A 2CUFA 2H94A 2DLLA 1KGSA 5LLQA 1U5TA 3QAHA 4EJVA 4L9NA 3JREA 3OSFA 3PIPF 5JVTA 1IG7A 2EZLA 1MD0A 2LLKA 4E7KA 2O5RA 1TW2A 2WV1A 3DEWA 1JXSA 2EB7A 5KVRA 1J0RA 2Z16A 3BG5A 2M4KA 1RZ4A 2L0KA 2HDDA 4DYRA 3GTPJ 2FBIA 3I4NJ 3E5XA 3VYRB 3WTZA 2XAQA 3G6EI 3G2BA 3TQNA 4RB3C 1RUOA 5GPCA 1BBYA 2ME0A 3OR1C 3P9KA 4HV6A 2GWRA 1BR2A 2EH3A 3KPHA 1A35A 2LY2A 2M87A 2Y0SN 4WCGA 1TZLA 2F5FA 2F4MB 4XKWA 1PJRA 2ID3A 1W36D 3MKWB 1SFKA 2OA4A 3EDPA 2DFEA 5CVIA 4I99C 2K4BA 3ISPA 4GDFA 1ZR4A 5GADJ 2M5WA 3MCZA 3NAUA 1YOVB 1LEBA 5E17F 2VJJA 3E5UA 1Z77A 4XMYA 2DPUA 4JP0A 2DDAA 1V5GA 3R4KA 4ZZDA 1D0XA 2FRHA 2JA8J 3M9AA 2HVSA 2Z1DA 4EM1A 2MG4A 2QYOA 5AIPA 4M3DA 3G1LA 1N77A 1LE8A 1MW7A 1OYWA 3HUGB 4CCKA 3I64A 1IN6A 2DQLA 2BZTA 4FETA 2H8RA 4HYEA 3RPUA 2JPBA 5IT9Z 1FX7A 3LA7A 1W7PD 1J09A 4F91B 1IN5A 1Q1HA 1G3WA 1J5YA 5GAEJ 1MH4A 4YG2F 1FYLA 4B44A 4BE1A 3CCUI 2A07F 4JOMA 2WBMA 2P7CB 3KX2A 2R5YB 3OYLA 1LDDA 2QBYA 3S8PA 4HZFA 4QSHA 3CJNA 3ZMTA 2R7SA 1ETQA 1JE8A 1F9NA 4R1HA 4UV9A 5IOYA 1QQIA 1R5HA 3TEDA 1UJ8A 1UHSA 2YX7A 3RKQA 4ZYGA 4UNOA 3AG3H 3DTKA 3FXQA 3F3XA 4ZDOA 1VF9A 5IYDJ 3FHNA 1A31A 2ISYA 1BM9A 4KN7X 5J8FA 2VXZA 2CFXA 3O3KA 3LSIA 2NYXA 4A69C 3D5LA 3K4JA 1GXQA 4BBRJ 4CXFA 3OYBA 4WX9A 2Y9YA 1VTNC 4V2FA 1E3HA 2DA1A 4FE4A 1VQMI 2LOOA 1OISA 2DMNA 3BG3A 4Q4ZF 2DOEA 2Y75A 3FXOA 2OJED 2DA7A 4C30A 2CQNA 3IWZA 3H36A 2KLOA 2VT3A 3KZZA 2HQRA 3K9TA 4WXCA 5DS9A 2XASA 4BACA 2BEOA 3ZQLA 2VOPA 2Z33A 1UB9A 4IJAA 2FNPA 5CJ9A 2PG4A 3L2WA 3MZHA 4PFOA 5E1ZB 3TOAA 1ETXA 3CCLI 3R61A 3J7AY 1XMXA 4KDPA 4AD9A 1IRGA 3CCEI 1HA8A 3BR3A 3KP7A 4BKXA 2EFWA 4Y17A 1B4AA 3F8NA 1Z67A 1R71A 1SD4A 1HXDA 5EGOB 2KRFA 1ZG3A 4CCJA 3OYDA 2EFQA 2O8KA 2R7WA 4A93J 1T8IA 4EV0A 1ORKA 2JRTA 2LBFB 2Y31A 2M34A 3GO5A 1JJ6C 3BC8A 4MNUA 1XGSA 3F22A 2JMWA 2FJ1A 3SZTA 3PNVA 4KICA 2DTRA 1MMDA 1IXRC 4IX7A 5KAFC 2NOJB 3ABLH 4II3A 2E35A 3RI4A 1ETYA 2R4GA 1KA8A 4A3BJ 1D5VA 1Z0XA 5FKNA 2ZJPF 5DUKA 4RA2A 4BHPA 5HNHA 3OL3A 2B63J 4LD5A 4AUXA 2CUZA 1X1PA 1OJLA 1FIPA 1K7AA 2RVCA 3CUQC 2DAOA 2LDUA 3FK6A 4MHGA 2R7UA 3JSOA 3LSRA 2MYSA 1STZA 2ZXHA 2HFHA 3HG9A 2DN0A 1TTYA 2V1NA 4N0BA 4UHTA 2DTZA 2EFOA 2QQ9A 3LOCA 3NQOA 4HX8A 3MKYB 1TQMA 3SEZA 2DXIA 3HEFA 3HOUJ 2GZWA 3WHBA 1ETKA 2K9SA 3GZ6A 4DYCA 3PO3J 4IOCF 2ZXJA 4RAYA 4S04A 4AC0A 3JRCA 1ZTRA 4H4KC 4A3MJ 4M6XA 1U3EM 1XSXA 2KMUA 1VZ0A 4MQVA 1JUPA 1R5GA 2E19A 4IRIA 2EV0A 1TBXA 2A5WA 1YX5A 3NWSA 2GM4A 2BYVE 2W7NA 2CO5A 2R93J 2D2WA 2QUFA 4BY1J 1PVEA 5DEQA 2HDCA 4OMZA 4A3CJ 3I53A 1JJ8C 3CJRB 2X6WA 1TLHB 2XKPA 1S6LA 2P7VB 2PMZA 3QYBA 1Z91A 4BU2A 4P55A 5J6XA 2LKSA 1DP3A 1IC8A 1Z1DA 3K1PA 4G94A 3TOBA 2PX9A 4F3QA 1JTXA 1MMGA 1S8NA 3A1YA 2EIKH 1OCZH 2IS4A 4C2MJ 1FSHA 2C6YA 4IHYA 2MD5A 5LHIA 2G7UA 2VL8A 5TRDA 3QP6A 1XDSA 2XF5A 2VKEA 2ZCWA 1Y56A 5J1YA 2ZJRF 2GXAA 3G3ZA 2P81A 4N4NB 1E3PA 4JK1X 3P9CA 5L3EA 4BBSJ 1YYVA 2JA6J 1FBSA 5CPRB 2F5VA 3LFUA 2COMA 3GTLJ 3KEQA 4BYYA 3A02A 3ZN1A 2ZXIA 3FBIB 5B1BH 1U9OA 3DPUA 3VOEA 3M8EA 3WTVC 3O2PE 2K27A 4G12A 1T6SA 2DO7A 4JQFA 3CCSI 1WSUA 2K3PA 2VT2A 3H9JA 5LEJA 4M9SA 4JX6A 3JRDA 3BZCA 3QOPA 2GIZA 3FXRA 1U5TC 4XLFA 1D0ZA 5LGUA 4B1RA 1VQLI 1XG1A 2OAZA 3IHUA 1SMTA 5DDGA 1LPQA 3CC2I 1FP1D 2EV5A 4IQ4A 2EIMH 3I0TA 4LLLA 1L3LA 1YITI 2FX0A 3MZ8A 4O5VA 4N9IA 3HPGA 1KU7A 2CUJA 4KFCA 2QKMB 3JR9A 4JX5A 3CCVI 1WJEA 3VYSB 1WPKA 4XKVA 2QZ8A 4KMUX 4U7DA 1JHHA 2VBXA 3GX4X 2F4IA 5FLXZ 2VKDA 5D5VB 2AQFA 3C2HA 3K4KA 4OINF 1JGSA 1NHAA 2CQ7A 2CQQA 4AIHA 4CCLA 1HW5A 1WFXA 2WTEA 3HYIA 3K4BA 5DCFA 3TMOA 4AVPA 3FMSA 4CICA 2E1MC 3BP8A 2DA3A 4GRIA 1FYKA 2HOEA 3ZQIA 4E70A 1R00A 2HOAA 3E0JB 2PMUA 3DWLE 3KP6A 2FF4A 2WAQA 2W24A 4AYBA 1MH3A 5IP7J 5LGTA 2ECCA 3E3VA 2YS9A 1APLC 2BY0A 2OD5A 3CO6C 4F55A 3WE3A 3IRRA 2IJLA 3H5RA 3VFZA 3MD2A 1SFXA 3L1PA 4A0XA 2NVUB 2LMDA 3WU2C 2VODA 2M0MA 3FF5A 2OCCH 2LTPA 1YQAA 5FKLA 3MAJA 3FBNB 4ENNA 3DKXA 3DP7A 3CC4I 2CQXA 3OYHA 2ACJA 1JGGA 1ZGAA 1ZELA 3IH2A 3O6BB 1CF7B 2E60A 2VKHA 3FXLA 2DJNA 3ESWB 1TWCJ 4A5MA 1P7IA 1ZGJA 4Q48A 2BV6A 2MLGA 1F5TA 2ZSIB 1MSEC 1JHFA 2VASA 1RUNA 5D4RA 4HAMA 3QWLA 3B02A 3BJAA 4ZC3A 1I6XA 5IOZA 5FB2A 4AIKA 1OR7A 2Z5UA 1XSDA 3JRAA 1DQUA 1AWCA 3ABKH 1O3TA 3WGGA 2RREA 1CQTA 2CV1A 3WGIA 1S29A 2MSYA 2JQ7A 1X2NA 2R7QA 4NBQA 3V7RA 1QVUA 4IHWA 4DNCA 3MQ0A 3T5XA 2IGMA 1W1WE 3ZP5A 2I10A 4HNUA 4CCOA 2CSOA 3ZCOA 1XC5A 2CG4A 3IRQA 2V1UA 3IUOA 4XKBA 3U9GA 3AL0B 1TT0A 4E4HA 2V7FA 3Q0UA 2M0CA 4PGGA 2E2IJ 1UZCA 2LVSA 3HHGA 2W82A 5CQEA 5FJ8J 1TQPA 2MBFA 4V19K 3KYDB 5B66C 4UY8I 2R92J 3BTJA 3VEPA 1SC7A 1B72B 2DI3A 3MVPA 2Q2EA 3OYMA 1TT5B 2M9HA 3GXOA 2JJ7A 3I59A 4XN3A 4EJOA 5HLHA 3BR2A 2R5ZB 2W84A 1K6OA 2VB6A 1B8IB 4L9VA 5E20A 3RTRA 1USSA 1K79A 4M74A 1OCPA 2H6BA 2QGUA 3KEYA 1Y1WJ 4NC6A 5KNLA 4C3IJ 3Q0WA 2L9NA 4ZYEA 2KHMA 5KAIC 2JSCA 1BOAA 3PFIA 2UWMA 4C2UA 4C3JJ 2CV0A 3FIWA 2VJ4A 4NHJA 3S1QJ 4BE2A 3OYGA 2VQGA 1D3YA 2BY2A 2X1EA 1I27A 1IW7F 2L7ZA 1TW3A 3GTJJ 3M4OJ 2KDOA 1HW2A 1ETOA 4BEHB 1KU3A 3BPXA 5D5WB 4A12A 1YFHA 1X1AA 1VQ7I 2IPQX 3OY9A 1I1GA 4MFDA 4NQWA 3GTKJ 2G0EA 4EVIA 4G6QA 4PSWA 3RQ4A 3I9V2 5HS7A 1HW1A 3C18A 2FD5A 3DBRB 2OZ6A 2QQ8A 3GMEA 2XHKA 2OPTA 3PNYA 4LGWA 3PQKA 4XRSG 4P9UA 1U5TB 1XDUA 3K69A 1U6GA 2FQ4A 2RV8A 1G3SA 1G3YA 2IGOA 5J4VA 3Q9VA 4KUMA 5L3DA 3NARA 2O6GE 1H9TA 3BTCA 2A6TA 1WH7A 1IXCA 4EM0B 1RR7A 1R9TJ 2V79A 1IDYA 2M8EA 3RZOJ 1I1SA 1PYVA 1Y8RB 5EEAA 1W5TA 1ZK8A 3OSGA 2DMUA 1FEXA 4MGRA 4RGRA 5IP9J 5KHDA 2FUG2 5EF6A 2CWEA 1LVKA 2KL4A 3GLXA 4ZZLA 1UELB 5H2FC 4HG2A 2V26A 2E5NA 2R7XA 3K6GA 3GTQJ 1BJZA 3BJ6A 1IUFA 2A05A 3CUQA 4I01A 5E18F 3F23A 4RBOA 1R4NB 3K2AA 2ELHA 1D5YA 2XAGA 5DD4A 3RSNA 1OFCX 1SD7A 1E3OC 2M45A 3RZDJ 2NS7A 2IGNA 1TWGJ 1BW6A 3HSFA 1UMQA 2HEOA 2JPCA 4K2EA 3TL4X 2HS5A 1BR1A 2R5ZA 4XIDA 1MNEA 2HOSA 3M07A 3HSEA 1LVAA 2BW3B 5L3GA 1GUUA 4BS9A 5EJCA 2LP0A 3PJRA 3OOPA 2GOMA 2M4GA 1X19A 4OAZA 1I6HJ 2MD0A 1YX3A 2LH9A 5BMZA 3ZQ7A 4RM3A 3BROA 4M71A 3L2UA 4XLPF 1E0EA 1KQ0A 4A3LJ 3G1OA 3RCOA 2WB1A 2A68F 5FLXK 4ZJZA 3ZN0A 5GTHC 3C2GA 1GV2A 2X85A 5BPIA 2D45A 3CF5F 3HRUA 4EJWA 1YJWI 4RM2A 5HLIA 2QVOA 1IDZA 2H1KA 5JFRA 2Y9ZA 3RKXA 1IN8A 1MIJA 2WB1N 3BG6A 1GVJA 3CLQA 5LGNA 2DK5A 2M7AA 1LDKB 1YW7A 1FP2A 2ZC2A 2HGCA 4RLQA 4BEHA 3ULQB 2ZJ2A 2X1DA 4I2OA 3KE2A 4BUPA 1FC3A 3F72A 3ZQCA 2JA2A 4A3JJ 1W5SA 1M1EB 1OPCA 2MABA 2YUSA 3WTWC 2UZKA 1TP4A 1TWFJ 2LF8A 4UUVA 5D8KB 1EH6A 2L9SA 3UR3C 3WTYC 1Z21A 1E17A 2NAZA 1K83J 2E34A 5F0CA 4ZYDA 2V9VA 3ZGKA 4HDVA 1WH5A 1KQ8A 4XR6A 4A5NA 3BLYA 2W48A 1OLTA 3HRTA 3IH4A 1YHQI 3CTAA 3JSPA 1YI2I 1XCVA 1DDNA 3AG2H 2TDXA 3ABUA 1QHHD 2YSRA 4QIWN 3SDBA 2LC2A 3GZNB 3S2WA 3FX3A 4ZTFA 5CVRA 1ERDA 2CFOA 2F4OB 3KZYA 2JVHA 1CGPA 3JAMZ 3G4SI 2GA1A 5FLVA 2X0LA 3F6OA 2Y69H 2WWYA 4PK4A 5ERIA 2IT0A 1SVOA 1R23A 3ZR8X 1RPWA 4YELA 5ED4A 3IL2A 2Y0SA 3L7WA 3OIQA 1QPMA 4MEXF 2K02A 2VPLA 3V7CA 5C3EJ 3ZQGA 1LFPA 1Q1VA 1YIJI 2A5YB 3IWFA 2QM3A 2R3SA 1G8XA 2M1BA 2VIXA 3FKJA 1MJ9A 3LSKA 4G7HF 3CO7C 5ICCA 4EGYA 3IAM2 4ASNA 2R7DA 1MMAA 4RAFA 1WVRA 4YFXF 5BQTA 2L5QA 3R0JA 2E71A 1ON2A 3P9IA 2VLAA 4MQ9F 5JI6A 5A2QZ 1Z05A 2KQRA 2K3FA 2KFDA 4XK4A 1ENHA 4I02A 3RPUD 2Y0MA 3NEUA 1XGOA 2F2EA 2M7BA 1YTYA 1VQ4I 1OR7C 1FYMA 4U88A 2IA2A 3F6VA 2OZUA 1GV5A 5LD2C 1H0MA 5K5QA 4LIUA 2BW3A 5JR3A 3QPLA 3QOEA 1PUEE 4I76A 3OS2A 4LOCA 4MLOA 2IVMA 4QWQA 3SHFA 4CGZA 2FOKA 1MJBA 1GXPA 2BBYA 2K9NA 4QTRA 1NG6A 2CUEA 3KZIC 1ZRDA 2XB0X 5F64A 3F9KA 1MBFA 4A3GJ 2ESNA 5K7ZA 2DU9A 4BQQA 1I3AA 1IN7A 4XRSA 3IAS2 5E3OA 4CYCB 4A3FJ 3H9QA 4XL9A 1Z7LA 1FBUA 2VJIA 4FASD 5CLSA 3V7SA 1X1CA 1LUJB 1WJAA 4BAYA 1B9NA 2FA5A 2MGQA 1A6IA 2HYFA 3DTEA 3ECOA 3OYNA 4IL6C 2DJIA 1LB2A 3KCCA 5ICGA 1O3QA 3LAPA 2HKOA 1HOMA 1WKMA 3TKYA 4A3EJ 2E2JJ 4XRFA 3FMQA 3BCAA 2BY1A 4M72A 5DM6F 4IPAA 4P1WA 2ICWG 4IO9F 1VQ5I 4HNVA 4XM3A 1SAUA 4QLCU 1FTZA 2EWNA 1WI9A 4CH7A 2DFHA 4MEYF 1WJCA 2WAFA 4XKCA 3CDHA 2DYRH 4WWCA 2VJ5A 5JHFA 4D5FA 2UUZA 2AS5F 4CZZA 5FD6A 3SDGA 3CJTB 1IRZA 4L9JA 4OU0A 1MBHA 1IV6A 3K2ZA 3KP5A 3BZ6A 1BR4A 5J8CA 3CMYA 2DYSH 3BR0A 4KNYA 2K7LA 4B3XA 3A01A 1W4MA 5B1AH 2WAEA 1VQKI 4GGGA 1XMKA 3AKZA 2HPMA 1BW5A 4OIOF 4FTHA 1XSVA 2VONA 1K4SA 4D0PA 5LRSA 2KIMA 2CH0A 5K5OA 4DQ2A 3I56I 2P4WA 1HCRA 2KRHA 1QRYA 4UB8C 2W25A 3OL4A 4F93B 4BDYA 5L3FA 1XPXA 1QBJA 2DA4A 4LB5A 4XLCA 3JRHA 1USTA 1R58A 1MSFC 1FT9A 5TJJA 4RDUA 3DBHB 3WU0A 2KISA 3V8LA 2NOGA 2HVRA 2OV7A 3S1NJ 3TP3A 4IVNA 3WTTC 4WXHA 4GCVA 1IJWC 2J5PA 2ETHA 3KLNA 1D0YA 2W1OA 3GTGJ 1JTYA 1HKQA 5DM7F 4G6DA 2CV2A 3OS1A 3CD6I 3HIFA 2M30A 3KYCB 3PUFA 4ZDLA 1Z7UA 2YU9J 4KITB 4PGHA 3SZPA 4XBFA 1XN7A 5ILUA 3S15J 1J9IA 2YU3A 3W6JB 3E1SA 5BOXA 2IS2A 2ISZA 1K61A 5HLTA 4S0HB 1Y0NA 4E7JA 2L9RA 3CMAI 4CYCA 3IC7A 4B3AA 3TDUC 1O7LA 2VQHA 3EQLF 4L0YB 4M6YA 4JYKA 5CQGA 5TISC 2H09A 2GXGA 2JN6A 3F8MA 4YRVA 1T95A 2VE8A 4C2TA 3DU5A 2VBYA 4Y52J 1WGXA 2W4SA 3TO9A 3OYIA 1DPUA 4PJ0C 1QNTA 3LL7A 3DLAA 1I39A 1JKPC 2CGPA 2MW8A 2LFBA 4L9TA 4HDUA 1UG0A 2X48A 3O8HA 1EJ9A 1R1UA 2RQQA 1BI2A 2PMHA 2V1XA 1OCTC 3WTUC 1K4TA 3HOZJ 2LY1A 5BS6A 1SD6A 4BXFA 5M5WJ 1SFUA 1HLVA 4GXOA 2HDWA 2DMPA 1B1BA 1FOYA 4R8HA 3CP8A 2VBWA 1RR8C 3H3ZA 2K9QA 1Z3YA 2WA0A 4X6AJ 4LLGF 5E3NA 1OCOH 3AAFA 5TGTA 4BHCA 3S17J 1HDPA 1SAXA 2NVQJ 3OYEA 3M1CA 5IYBJ 2Y48A 1F4KA 2A3SA 3WTXC 4GO1A 2DCEA 2DT6A 1S5LC 4IZZA 1DP7P 3S3NA 4YIRX 3HOXJ 2GAUA 3S1MJ 3CCJI 4PJLA 2DBBA 1XGMA 4N9HA 1IRFA 1SD5A 4FX4A 3VYTB 4Q5SF 3H0GJ 5DTDA 2Y2ZA 5F0HA 1EA3A 2JSPA 4O6JA 1S7EA 5D5XB 2DK8A 1D1CA 4IQJA 3BOQA 2DFIA 1UFMA 3FM3A 2FXAA 2LG4A 4UUTA 2HNHA 2ZB9A 4BXXJ 4EM2A 2JA5J 2OF7A 2ZMEC 4A0YA 2Q2EB 1L0OC 1QU3A 2LF7A 4B48A 3I59B 5J1UA 1N25A 2O8XA 1MBEA 1LFUP 1K6YA 3J80Z 1ZRCA 2EZIA 2R7FA 2IA1A 5F27A 1ZQ3P 1A36A 3SFIA 1G6NA 2OQRA 1R49A 2FSWA 4I7HA 2DODA 4BL0B 1IF1A 1G59A 3DQVC 3ZPLA 4S05A 4II2A 5K7HA 5FRMA 4BJ5C 4LIVA 2D1HA 3Q9SA 1WJDA 4ESFA 5J47A 4IOAF 4YEJA 5D6FA 4B8XA 5IT9K 2CW7A 2DOFA 1HC8A 1V55H 1WJBA 4NB5A 1QVTA 1D8JA 3EUKL 4BNCA 2E36A 3GYHX 4XOPA 1SANA 2JUCA 1OMIA 4AIJA 3RDIA 4LB6B 3EYIA 4ON0A 3WODF 4KISA 4NQWB 5E1XA 4A3IJ 3E6DA 3OYFA 4RAZA 1MBKA 2L4MA 3GTOJ 4YFNF 3B73A 4CSWA 3EUAA 2EBIA 2XPVA 5K7FA 3MFKA 2R0QC 4BY7J 3GUDA 5EZHA 5GPAA 3KP2A 4CA0A 2DA6A 1QHGA 4HSTA 3ZQHA 1R1VA 2RKHA 1LJ9A 4M73A 1ODDA 5AONA 3HL2A 2AHQA 1K78B 4EATA 2LK2A 2DA5A 5DCMB 4NDLA 2IBDA 3DPLC 2BGCA 1VQOI 2K85A 3HOTA 5E8IA 3D5RC 2NNYA 2GQQA 3F21A 1DGWY 3PSFA 4PCQA 4G7OF 3I58A 2ZXWH 1RKWA 4BQOA 4UUSB 3RYRA 4YFKF 1AKHB 3GF2A 1IZ1A 1B6AA 2OC6A 2HZTA 2L2OA 2OQGA 2K86A 3K4MA 5FD5A 3C1DA 3T0YA 2RN7A 3M8FA 4M9ZA 3CUQB 1YG2A 3TP0A 1D1BA 2XAJA 3LA3A 3PL8A 1FMWA 2CS3A 4M3FA 1ZYRF 3HC7A 2OTLI 4BJ6C 2K9LA 1BJAA 5CYVA 2H27A 1UG2A 3DEUA 1W5CC 3K4CA 3GZ5A 1O57A 2FMYA 1XCBA 2ELKA 3U1DA 3FHZA 1ZH5A 4LMYA
chains in the Genus database with same CATH topology
1WQ2A 4WXDA 3WE2A 2O03A 1KQ9A 2NNNA 1Y0UA 4L0ZB 2ZKZA 5EEGA 3FM5A 2MLKA 3MWMA 1A04A 1J75A 3GVAA 3J81Z 5DYMA 3DFGA 3QU6A 1X3UA 3BY6A 5D4SA 3H3UA 1P92A 1RIOH 3BJOA 1AOYA 4HA8A 2VOOA 2FU4A 4LLNA 4ESJA 4UXNA 2E7WA 2P5KA 3I71A 5LHHA 2JTVA 4RGSA 3GFLA 4BQAA 2PLYA 5K1YA 1TNTA 4KIFA 2EA4A 4I0BA 5HVQC 2L4AA 2P6SA 4TV7A 2Z99A 3RKYA 1YLFA 2HQNA 1K78A 1S7AA 4EJUA 4OMYA 5DCMA 4KMFA 5LEKA 5ILVA 3E6BA 4HF2A 3BDDA 4GYGA 4RB0A 5HS8A 2STTA 1PP8F 2L3DA 5CVVA 3GW2A 2EK5A 2JZYA 4LJZF 2G7HA 1ZREA 4A2UA 3HRSA 1FPQA 5IT3A 2XV4S 2LKPA 3HHHA 3HOSA 1BIBA 1B59A 2L54A 4KYWA 2DQRA 5H6RA 2NS0A 1T2KA 5FFXA 4I09A 3TDZC 5DD8A 5CVJA 3J80K 5D8LB 3ZMVA 4LG0B 3TO6A 2WC2A 1MKMA 4Y13A 4IF4A 3LA2A 3RKWA 2E1NA 2CQKA 2XGXA 3ZMSA 4CO8A 1SFEA 1C0WA 2PEXA 2IP2A 2O61A 2XROA 1HKTA 2XAHA 1HKSA 4HX4A 4ENJA 2HKXA 1S7OA 2VN2A 2PQ8A 4H0EA 2A69F 2PFBA 2ESHA 1PDNC 2PN6A 3J7AO 5EEHA 3RPQA 3F8CA 4RS8A 4R79A 5HLGA 4HF1A 1HSTA 4UVBA 1V3FA 4OIRF 1R36A 4I98B 2DPDA 2ZMEA 1XGNA 3DF8A 1E2XA 3K0LA 1HBXG 3I5UA 1MDMA 1IN4A 4GYIA 3COAC 4ZYHA 1REPC 4EJTA 2ZBKA 1TQIA 2MA3A 3BWGA 1J2XA 3D0SA 1IXSB 2KIFA 4A6EA 2HYGD 4HX7A 3L09A 5HDGA 1R22A 2W85A 1ZG1A 2HR3A 4IXAA 5D6EA 1LDJA 3R6SA 5BPDA 2VBZA 4HLYA 1FY7A 3W6KB 3E6MA 5LRRA 4B09A 2RC4A 1T98A 1YO5C 2O3FA 4L5JA 4Z2YA 4LK0F 3KETA 1G4DA 2IA0A 3ABTA 3I54A 2EFNA 1P4XA 1KU2A 4LG0A 3RIRA 1ZG5A 1Z6RA 1FZPB 5FO5A 1GHCA 1O7FA 3MEXA 4KN4X 1BI0A 3EYYA 3OV8A 4RB1A 3GEZA 2FEZA 4A0ZA 1BIAA 3RJPA 3J81K 3T1BA 1DPRA 1XB4A 3IKTA 4IHTA 3K1MA 3L00A 2HTJA 3I4PA 3P7NA 4ENKA 4HBLA 2YR2A 2EV6A 2V6CA 3N4MA 3QPTA 4PZJA 1QO0D 2CYYA 1FLIA 2VC0A 1W7PA 3V4GA 2YPRA 5H20A 4UVCA 1LEAA 3HSRA 4OOIA 3LFKA 5FFZA 4UV8A 1FNNA 1O3SA 5HDNA 2FQ3A 3LSTA 4Y15A 1PP7U 2DT5A 3WTSC 2EFPA 2GA2A 5AIQA 4XSXF 2PJPA 1UHMA 2XAFA 1LNWA 4ESBA 2ZFWA 1XD7A 3DKWA 3DXJF 5E1WA 2IRFG 2G9WA 2A61A 2HWVA 3KLOA 2LNBA 3GWZA 2EA2A 5HS9A 2UXNA 4FT8A 3ECHA 3LWFA 3JTGA 1P4AA 4LFUA 2P8TA 2ZNZA 2P5VA 2DW4A 4P96A 2QLZA 2OU2A 4KT5C 4P5OA 2X4HA 3N97A 1TNSA 3HUGA 4AWXB 2VC1A 2AXLA 2F5EA 3EUHA 3Q5FA 4UVAA 1U8RA 4EMSA 1IAWA 2YX4A 4I0AA 3E5QA 1KYWA 4A6DA 3VODA 4CHUA 2P5LC 5CVUA 2ZNYA 2PBIA 4KA4A 4G9YA 2D1VA 2FNAA 1ZAOA 1BC8C 3FMRA 4G7ZF 3E97A 3T8RA 1U78A 1KYZA 1MGTA 4HOBA 3FWEA 1EH7A 1RNLA 3ML6A 2QQAA 2CW0F 3KP4A 3HRMA 2XUBA 3JAMK 3REOA 1F1ZA 4JBAA 2MC3A 4EQQA 4BXUA 4Q47A 1T38A 2RDPA 3RYPA 3WU1B 3V8JA 2GIVA 1QZYA 5E8GA 3R60A 4U0YA 3KP3A 4XSZF 4YIFA 4HQEA 2FBHA 2KKOA 2XIGA 2A6EF 5A2QK 4KIBA 2Q0OA 1YIOA 2F5CA 4ZH4F 2MH9A 2PI0A 2STWA 3JW4A 3L2CA 3HTSB 4RGXA 3QP5A 3ZMDA 5JHUA 1FSEA 3QPHA 3HTUA 3QRFF 4FX0A 3K1NA 4KIGA 3NRVA 5L3BA 3FZVA 3ELKA 2ZO4A 1XMAA 1LQ1A 1FBQA 1ZHFA 2RQPA 3FXUA 3PQJA 2H6CA 5LHGA 3R0AA 1ZRFA 5LBQA 3C3WA 2FBKA 3KEOA 2XRNA 5H6QA 2EJRA 4HV5A 4G8XA 1EH8A 3SXYA 4CYDA 4LK1F 5HDKA 1FWZA 4F7ZA 2IW5A 4M9XA 5DV5A 3WGHA 4HW0A 1S3JA 1OYIA 3F8BA 3SQNA 3BPVA 4RB2C 4U7BA 4HQMA 4OIPF 1H9GA 3QU3A 2RGVA 1T39A 3C7JA 3LQQA 2WV0A 4FHTA 4PDKA 4BH9A 3ERED 2QENA 1Z9CA 1D8KA 3DPTA 3KFWX 1DUXC 6PAXA 3TGNA 1P2FA 4IRGA 1J7KA 3CLOA 3EETA 5L3CA 3F8FA 1SMYF 5F1RA 4CDGA 1MZBA 4XLNF 2Z9OA 2L02A 3ROUA 1ZARA 1KU9A 4U0VA 2FE3A 5K5RA 2OBPA 2J5OA 1MJAA 4HLXA 2KJBA 2JT1A 1IUYA 3M7GA 2Q8KA 1BI3A 1QGPA 4MTDA 1YS7A 2RNJA 1EV7A 5ILSA 2MH2A 2P6TA 4WF2A 1B9MA 2QQBA 1OKRA 1ZN2A 5KK1A 4O3MA 1V4RA 2O0YA 3GFJA 1BC7C 2L01A 3U2RA 2HTSA 3E6CC 1WWXA 1BN5A 2QWWA 2V1DA 2E7XA 4IHSA 1WRJA 3MZYA 5ICEA 3M1EA 4MTEA 4WK8F 1QZZA 4U0WA 2BE5F 3VB2A 1YW8A 3LQRA 2A6HF 2ZMEB 1J59A 1ZLJA 1T0FA 5D5UB 1MDMB 3V8KA 1CF7A 2B0LA 1ON1A 4L5IA 4RGUA 1YS6A 3SFZA 2UXXA 5ICFA 4P9FA 1R7JA 1FOKA 4YIIA 4BHBA 5FGMA 3LAJA 4IRHA 1O3RA 4OIQF 3ZMZA 1ULYA 1ONVA 2NRAC 1UCRA 2XVCA 2GXBA 3GFMA 2XKOA 3JTHA 1I5ZA 3IKVA 3TO7A 4HF0A 1HSJA 4ETSA 2Z3YA 2VE9A 3T8TA 2LSOA 2KIUA 1R1TA 2KJCA 4L18B 1UHWA 3G73A 1P4WA 3GFIA 3DV8A 3WG9A 5DUIA 2K4JA 1ZLKA 2W57A 3L9FA 4EGZA 3H92A 1Z6TA 2QBYB 1P6RA 2F5DA 5F6FA 1HQCA 1U2WA 3CUOA 2FMLA 1W7PB 5HOOA 1G3TA 2E1CA 4ENMA 1OYYA 1YW9A 2ADUA 3ZMUA 1RI7A 1BI1A 2H94A 2DLLA 1KGSA 5LLQA 1U5TA 3QAHA 4EJVA 4L9NA 5JVTA 1MD0A 1TW2A 1JXSA 2EB7A 5KVRA 1J0RA 1RZ4A 2FBIA 3E5XA 3WTZA 2XAQA 3TQNA 4RB3C 1RUOA 1BBYA 3P9KA 4HV6A 2GWRA 2M87A 4WCGA 2F5FA 2OA4A 3EDPA 5CVIA 2K4BA 3ISPA 2M5WA 3MCZA 1LEBA 5E17F 3E5UA 2DPUA 3R4KA 4ZZDA 2FRHA 3M9AA 4EM1A 2QYOA 5AIPA 1OYWA 3I64A 1IN6A 2DQLA 4HYEA 3RPUA 2JPBA 5IT9Z 1FX7A 3LA7A 1W7PD 1IN5A 1Q1HA 1G3WA 1J5YA 4YG2F 1FYLA 2A07F 2P7CB 1LDDA 2QBYA 4HZFA 3CJNA 3ZMTA 1JE8A 1F9NA 4R1HA 4UV9A 1QQIA 1R5HA 2YX7A 4UNOA 4ZYGA 3FXQA 3F3XA 2ISYA 1BM9A 4KN7X 5J8FA 2VXZA 2CFXA 3O3KA 2NYXA 3D5LA 1GXQA 4CXFA 4WX9A 1VTNC 4Q4ZF 2Y75A 3IWZA 2VT3A 3KZZA 2HQRA 3K9TA 4WXCA 2XASA 2BEOA 2VOPA 2Z33A 1UB9A 4IJAA 2FNPA 5CJ9A 2PG4A 3MZHA 5E1ZB 3TOAA 3R61A 4KDPA 4AD9A 1IRGA 3KP7A 2EFWA 4Y17A 1B4AA 3F8NA 1SD4A 1HXDA 2KRFA 1ZG3A 2EFQA 4EV0A 2JRTA 3GO5A 4MNUA 1XGSA 3F22A 3SZTA 4KICA 2DTRA 1IXRC 3RI4A 1KA8A 1D5VA 5DUKA 4BHPA 4LD5A 1K7AA 2RVCA 3CUQC 2DAOA 2LDUA 4MHGA 3JSOA 1STZA 2HFHA 4UHTA 1TTYA 4N0BA 4HX8A 2EFOA 2QQ9A 3NQOA 1TQMA 2GZWA 3GZ6A 2ZXJA 4RAYA 4S04A 4M6XA 1U3EM 1XSXA 4MQVA 1R5GA 4IRIA 2EV0A 1TBXA 2BYVE 2CO5A 2D2WA 2QUFA 5DEQA 2HDCA 4OMZA 3I53A 2XKPA 1TLHB 1S6LA 2P7VB 1Z91A 4P55A 5J6XA 1Z1DA 3K1PA 4G94A 3TOBA 1S8NA 1FSHA 2C6YA 2MD5A 5LHIA 2G7UA 5TRDA 3QP6A 1XDSA 2ZCWA 3G3ZA 5L3EA 4JK1X 3P9CA 1YYVA 1FBSA 2COMA 3KEQA 4BYYA 3ZN1A 3VOEA 3M8EA 3WTVC 3O2PE 2K27A 1T6SA 2DO7A 4JQFA 1WSUA 2VT2A 5LEJA 4M9SA 3QOPA 3FXRA 1U5TC 5LGUA 2OAZA 3IHUA 1SMTA 5DDGA 1FP1D 2EV5A 4LLLA 3I0TA 1L3LA 4O5VA 4N9IA 1KU7A 4KFCA 2QZ8A 4KMUX 4U7DA 1JHHA 2VBXA 3GX4X 5FLXZ 5D5VB 4OINF 1JGSA 1NHAA 4AIHA 1HW5A 3HYIA 2WTEA 5DCFA 4AVPA 3FMSA 4CICA 3BP8A 1FYKA 2HOEA 4E70A 1R00A 2PMUA 3KP6A 2FF4A 2W24A 5LGTA 3E3VA 2OD5A 3CO6C 3WE3A 3IRRA 2IJLA 3VFZA 1SFXA 4A0XA 2VODA 3FF5A 1YQAA 3MAJA 4ENNA 3DP7A 2ACJA 1ZGAA 3O6BB 1CF7B 4A5MA 1ZGJA 4Q48A 2BV6A 2MLGA 1F5TA 1JHFA 1RUNA 5D4RA 4HAMA 3B02A 3BJAA 1I6XA 5FB2A 4AIKA 1OR7A 2Z5UA 1XSDA 1AWCA 1O3TA 3WGGA 3WGIA 1S29A 3V7RA 4DNCA 3MQ0A 3T5XA 3ZP5A 2CSOA 2CG4A 3IRQA 2V1UA 3U9GA 4PGGA 3HHGA 1TQPA 2MBFA 3VEPA 2DI3A 2Q2EA 3GXOA 3I59A 5HLHA 4EJOA 1K6OA 2W84A 4L9VA 5E20A 3RTRA 1USSA 1K79A 4M74A 2H6BA 4ZYEA 2JSCA 1BOAA 3PFIA 2UWMA 4NHJA 1D3YA 1I27A 1IW7F 1TW3A 1HW2A 5D5WB 1KU3A 3BPXA 4A12A 1YFHA 2IPQX 1I1GA 4NQWA 4EVIA 4G6QA 5HS7A 1HW1A 3C18A 2OZ6A 2XHKA 4LGWA 3PQKA 4P9UA 1U5TB 1XDUA 3K69A 1U6GA 2RV8A 1G3SA 1G3YA 3Q9VA 4KUMA 5L3DA 2O6GE 1H9TA 1IXCA 4EM0B 2V79A 2M8EA 1I1SA 1W5TA 4MGRA 4RGRA 2CWEA 3GLXA 4ZZLA 3BJ6A 3CUQA 4I01A 5E18F 3F23A 2ELHA 2XAGA 5DD4A 1SD7A 2M45A 3HSFA 2HEOA 2JPCA 4K2EA 2HS5A 3HSEA 1LVAA 5L3GA 3OOPA 5BMZA 3ZQ7A 3BROA 4M71A 4XLPF 1KQ0A 2A68F 5FLXK 3ZN0A 2D45A 5BPIA 3HRUA 4EJWA 5HLIA 2QVOA 5JFRA 3RKXA 1IN8A 1GVJA 5LGNA 2DK5A 1LDKB 1YW7A 1FP2A 2HGCA 3ULQB 2ZJ2A 4I2OA 3KE2A 1FC3A 3F72A 1W5SA 1OPCA 3WTWC 2UZKA 2LF8A 4UUVA 5D8KB 1EH6A 3WTYC 1E17A 2NAZA 4ZYDA 2V9VA 4HDVA 1KQ8A 4A5NA 3HRTA 1DDNA 3CTAA 3JSPA 1XCVA 2TDXA 3ABUA 2YSRA 3S2WA 3FX3A 5CVRA 3KZYA 1CGPA 3JAMZ 2GA1A 2X0LA 3F6OA 2WWYA 5ERIA 2IT0A 1R23A 5ED4A 3IL2A 3L7WA 1QPMA 4MEXF 2K02A 3V7CA 2A5YB 3IWFA 2QM3A 2R3SA 2M1BA 4G7HF 1MJ9A 3CO7C 5ICCA 4EGYA 4ASNA 2R7DA 4YFXF 5BQTA 3R0JA 3P9IA 1ON2A 4MQ9F 5JI6A 5A2QZ 1Z05A 4I02A 2Y0MA 3NEUA 1XGOA 2F2EA 1YTYA 1FYMA 4U88A 2IA2A 3F6VA 2OZUA 1H0MA 5K5QA 5JR3A 1PUEE 4QWQA 2IVMA 3SHFA 4CGZA 2FOKA 1MJBA 1GXPA 2BBYA 1ZRDA 5F64A 2ESNA 2DU9A 1IN7A 1FBUA 5CLSA 3V7SA 4BAYA 1B9NA 2FA5A 2HYFA 3ECOA 1LB2A 3KCCA 5ICGA 1O3QA 3LAPA 2HKOA 1WKMA 3TKYA 4XRFA 3FMQA 4M72A 4IPAA 4QLCU 2EWNA 1WI9A 4MEYF 3CDHA 4WWCA 2AS5F 4CZZA 5FD6A 4L9JA 4OU0A 3K2ZA 3KP5A 3BZ6A 5J8CA 4KNYA 2K7LA 1W4MA 4GGGA 1XMKA 4OIOF 1XSVA 2VONA 4D0PA 5LRSA 2KIMA 5K5OA 4DQ2A 2P4WA 2W25A 5L3FA 1QBJA 4LB5A 1USTA 1R58A 1FT9A 5TJJA 3WU0A 3V8LA 4IVNA 3WTTC 4WXHA 4GCVA 2J5PA 2ETHA 3KLNA 1HKQA 4G6DA 3HIFA 2M30A 1Z7UA 5ILUA 4PGHA 3SZPA 4XBFA 1XN7A 1J9IA 2YU3A 3W6JB 5BOXA 2ISZA 3IC7A 3TDUC 1O7LA 3EQLF 4L0YB 4M6YA 2H09A 2GXGA 3F8MA 2VE8A 2VBYA 3TO9A 1DPUA 1QNTA 2CGPA 4L9TA 4HDUA 1R1UA 1BI2A 2PMHA 2V1XA 3WTUC 5BS6A 1SD6A 1SFUA 4GXOA 1B1BA 4R8HA 2VBWA 3H3ZA 4LLGF 3AAFA 4BHCA 1SAXA 2Y48A 1F4KA 2A3SA 3WTXC 4GO1A 1DP7P 2GAUA 2DBBA 1XGMA 4N9HA 1IRFA 1SD5A 4FX4A 4Q5SF 4O6JA 5D5XB 2DK8A 3BOQA 2DFIA 1UFMA 3FM3A 2FXAA 4EM2A 4A0YA 1L0OC 2LF7A 3I59B 2O8XA 3J80Z 1ZRCA 2R7FA 2IA1A 1G6NA 2OQRA 2FSWA 4I7HA 1IF1A 3ZPLA 3DQVC 4S05A 2D1HA 3Q9SA 4ESFA 5D6FA 4B8XA 5IT9K 1D8JA 4NB5A 4BNCA 3GYHX 1OMIA 4AIJA 3RDIA 4LB6B 3EYIA 4ON0A 3WODF 5E1XA 3E6DA 4RAZA 2L4MA 4YFNF 3B73A 3MFKA 3GUDA 3KP2A 1R1VA 2RKHA 1LJ9A 4M73A 1ODDA 5AONA 1K78B 5DCMB 3DPLC 2BGCA 3HOTA 5E8IA 2NNYA 2GQQA 3F21A 4PCQA 4G7OF 3I58A 3RYRA 4YFKF 3GF2A 1IZ1A 1B6AA 2HZTA 2OQGA 2K86A 5FD5A 3C1DA 3T0YA 2RN7A 3M8FA 4M9ZA 3CUQB 1YG2A 2XAJA 3LA3A 1ZYRF 2H27A 1BJAA 5CYVA 3DEUA 3GZ5A 1O57A 2FMYA 1XCBA 3U1DA 3FHZA 1ZH5A 4LMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQ2 A;  4WXD A;  3WE2 A;  2O03 A;  1KQ9 A;  2NNN A;  1Y0U A;  4L0Z B;  2ZKZ A;  5EEG A;  3FM5 A;  2MLK A;  3MWM A;  1A04 A;  1J75 A;  3GVA A;  3J81 Z;  5DYM A;  3DFG A;  3QU6 A;  1X3U A;  3BY6 A;  5D4S A;  3H3U A;  1P92 A;  1RIO H;  3BJO A;  1AOY A;  4HA8 A;  2VOO A;  2FU4 A;  4LLN A;  4ESJ A;  4UXN A;  2E7W A;  2P5K A;  3I71 A;  5LHH A;  2JTV A;  4RGS A;  3GFL A;  4BQA A;  2PLY A;  5K1Y A;  1TNT A;  4KIF A;  2EA4 A;  4I0B A;  5HVQ C;  2L4A A;  2P6S A;  4TV7 A;  2Z99 A;  3RKY A;  1YLF A;  2HQN A;  1K78 A;  1S7A A;  4EJU A;  4OMY A;  5DCM A;  4KMF A;  5LEK A;  5ILV A;  3E6B A;  4HF2 A;  3BDD A;  4GYG A;  4RB0 A;  5HS8 A;  2STT A;  1PP8 F;  2L3D A;  5CVV A;  3GW2 A;  2EK5 A;  2JZY A;  4LJZ F;  2G7H A;  1ZRE A;  4A2U A;  3HRS A;  1FPQ A;  5IT3 A;  2XV4 S;  2LKP A;  3HHH A;  3HOS A;  1BIB A;  1B59 A;  2L54 A;  4KYW A;  2DQR A;  5H6R A;  2NS0 A;  1T2K A;  5FFX A;  4I09 A;  3TDZ C;  5DD8 A;  5CVJ A;  3J80 K;  5D8L B;  3ZMV A;  4LG0 B;  3TO6 A;  2WC2 A;  1MKM A;  4Y13 A;  4IF4 A;  3LA2 A;  3RKW A;  2E1N A;  2CQK A;  2XGX A;  3ZMS A;  4CO8 A;  1SFE A;  1C0W A;  2PEX A;  2IP2 A;  2O61 A;  2XRO A;  1HKT A;  2XAH A;  1HKS A;  4HX4 A;  4ENJ A;  2HKX A;  1S7O A;  2VN2 A;  2PQ8 A;  4H0E A;  2A69 F;  2PFB A;  2ESH A;  1PDN C;  2PN6 A;  3J7A O;  5EEH A;  3RPQ A;  3F8C A;  4RS8 A;  4R79 A;  5HLG A;  4HF1 A;  1HST A;  4UVB A;  1V3F A;  4OIR F;  1R36 A;  4I98 B;  2DPD A;  2ZME A;  1XGN A;  3DF8 A;  1E2X A;  3K0L A;  1HBX G;  3I5U A;  1MDM A;  1IN4 A;  4GYI A;  3COA C;  4ZYH A;  1REP C;  4EJT A;  2ZBK A;  1TQI A;  2MA3 A;  3BWG A;  1J2X A;  3D0S A;  1IXS B;  2KIF A;  4A6E A;  2HYG D;  4HX7 A;  3L09 A;  5HDG A;  1R22 A;  2W85 A;  1ZG1 A;  2HR3 A;  4IXA A;  5D6E A;  1LDJ A;  3R6S A;  5BPD A;  2VBZ A;  4HLY A;  1FY7 A;  3W6K B;  3E6M A;  5LRR A;  4B09 A;  2RC4 A;  1T98 A;  1YO5 C;  2O3F A;  4L5J A;  4Z2Y A;  4LK0 F;  3KET A;  1G4D A;  2IA0 A;  3ABT A;  3I54 A;  2EFN A;  1P4X A;  1KU2 A;  4LG0 A;  3RIR A;  1ZG5 A;  1Z6R A;  1FZP B;  5FO5 A;  1GHC A;  1O7F A;  3MEX A;  4KN4 X;  1BI0 A;  3EYY A;  3OV8 A;  4RB1 A;  3GEZ A;  2FEZ A;  4A0Z A;  1BIA A;  3RJP A;  3J81 K;  3T1B A;  1DPR A;  1XB4 A;  3IKT A;  4IHT A;  3K1M A;  3L00 A;  2HTJ A;  3I4P A;  3P7N A;  4ENK A;  4HBL A;  2YR2 A;  2EV6 A;  2V6C A;  3N4M A;  3QPT A;  4PZJ A;  1QO0 D;  2CYY A;  1FLI A;  2VC0 A;  1W7P A;  3V4G A;  2YPR A;  5H20 A;  4UVC A;  1LEA A;  3HSR A;  4OOI A;  3LFK A;  5FFZ A;  4UV8 A;  1FNN A;  1O3S A;  5HDN A;  2FQ3 A;  3LST A;  4Y15 A;  1PP7 U;  2DT5 A;  3WTS C;  2EFP A;  2GA2 A;  5AIQ A;  4XSX F;  2PJP A;  1UHM A;  2XAF A;  1LNW A;  4ESB A;  2ZFW A;  1XD7 A;  3DKW A;  3DXJ F;  5E1W A;  2IRF G;  2G9W A;  2A61 A;  2HWV A;  3KLO A;  2LNB A;  3GWZ A;  2EA2 A;  5HS9 A;  2UXN A;  4FT8 A;  3ECH A;  3LWF A;  3JTG A;  1P4A A;  4LFU A;  2P8T A;  2ZNZ A;  2P5V A;  2DW4 A;  4P96 A;  2QLZ A;  2OU2 A;  4KT5 C;  4P5O A;  2X4H A;  3N97 A;  1TNS A;  3HUG A;  4AWX B;  2VC1 A;  2AXL A;  2F5E A;  3EUH A;  3Q5F A;  4UVA A;  1U8R A;  4EMS A;  1IAW A;  2YX4 A;  4I0A A;  3E5Q A;  1KYW A;  4A6D A;  3VOD A;  4CHU A;  2P5L C;  5CVU A;  2ZNY A;  2PBI A;  4KA4 A;  4G9Y A;  2D1V A;  2FNA A;  1ZAO A;  1BC8 C;  3FMR A;  4G7Z F;  3E97 A;  3T8R A;  1U78 A;  1KYZ A;  1MGT A;  4HOB A;  3FWE A;  1EH7 A;  1RNL A;  3ML6 A;  2QQA A;  2CW0 F;  3KP4 A;  3HRM A;  2XUB A;  3JAM K;  3REO A;  1F1Z A;  4JBA A;  2MC3 A;  4EQQ A;  4BXU A;  4Q47 A;  1T38 A;  2RDP A;  3RYP A;  3WU1 B;  3V8J A;  2GIV A;  1QZY A;  5E8G A;  3R60 A;  4U0Y A;  3KP3 A;  4XSZ F;  4YIF A;  4HQE A;  2FBH A;  2KKO A;  2XIG A;  2A6E F;  5A2Q K;  4KIB A;  2Q0O A;  1YIO A;  2F5C A;  4ZH4 F;  2MH9 A;  2PI0 A;  2STW A;  3JW4 A;  3L2C A;  3HTS B;  4RGX A;  3QP5 A;  3ZMD A;  5JHU A;  1FSE A;  3QPH A;  3HTU A;  3QRF F;  4FX0 A;  3K1N A;  4KIG A;  3NRV A;  5L3B A;  3FZV A;  3ELK A;  2ZO4 A;  1XMA A;  1LQ1 A;  1FBQ A;  1ZHF A;  2RQP A;  3FXU A;  3PQJ A;  2H6C A;  5LHG A;  3R0A A;  1ZRF A;  5LBQ A;  3C3W A;  2FBK A;  3KEO A;  2XRN A;  5H6Q A;  2EJR A;  4HV5 A;  4G8X A;  1EH8 A;  3SXY A;  4CYD A;  4LK1 F;  5HDK A;  1FWZ A;  4F7Z A;  2IW5 A;  4M9X A;  5DV5 A;  3WGH A;  4HW0 A;  1S3J A;  1OYI A;  3F8B A;  3SQN A;  3BPV A;  4RB2 C;  4U7B A;  4HQM A;  4OIP F;  1H9G A;  3QU3 A;  2RGV A;  1T39 A;  3C7J A;  3LQQ A;  2WV0 A;  4FHT A;  4PDK A;  4BH9 A;  3ERE D;  2QEN A;  1Z9C A;  1D8K A;  3DPT A;  3KFW X;  1DUX C;  6PAX A;  3TGN A;  1P2F A;  4IRG A;  1J7K A;  3CLO A;  3EET A;  5L3C A;  3F8F A;  1SMY F;  5F1R A;  4CDG A;  1MZB A;  4XLN F;  2Z9O A;  2L02 A;  3ROU A;  1ZAR A;  1KU9 A;  4U0V A;  2FE3 A;  5K5R A;  2OBP A;  2J5O A;  1MJA A;  4HLX A;  2KJB A;  2JT1 A;  1IUY A;  3M7G A;  2Q8K A;  1BI3 A;  1QGP A;  4MTD A;  1YS7 A;  2RNJ A;  1EV7 A;  5ILS A;  2MH2 A;  2P6T A;  4WF2 A;  1B9M A;  2QQB A;  1OKR A;  1ZN2 A;  5KK1 A;  4O3M A;  1V4R A;  2O0Y A;  3GFJ A;  1BC7 C;  2L01 A;  3U2R A;  2HTS A;  3E6C C;  1WWX A;  1BN5 A;  2QWW A;  2V1D A;  2E7X A;  4IHS A;  1WRJ A;  3MZY A;  5ICE A;  3M1E A;  4MTE A;  4WK8 F;  1QZZ A;  4U0W A;  2BE5 F;  3VB2 A;  1YW8 A;  3LQR A;  2A6H F;  2ZME B;  1J59 A;  1ZLJ A;  1T0F A;  5D5U B;  1MDM B;  3V8K A;  1CF7 A;  2B0L A;  1ON1 A;  4L5I A;  4RGU A;  1YS6 A;  3SFZ A;  2UXX A;  5ICF A;  4P9F A;  1R7J A;  1FOK A;  4YII A;  4BHB A;  5FGM A;  3LAJ A;  4IRH A;  1O3R A;  4OIQ F;  3ZMZ A;  1ULY A;  1ONV A;  2NRA C;  1UCR A;  2XVC A;  2GXB A;  3GFM A;  2XKO A;  3JTH A;  1I5Z A;  3IKV A;  3TO7 A;  4HF0 A;  1HSJ A;  4ETS A;  2Z3Y A;  2VE9 A;  3T8T A;  2LSO A;  2KIU A;  1R1T A;  2KJC A;  4L18 B;  1UHW A;  3G73 A;  1P4W A;  3GFI A;  3DV8 A;  3WG9 A;  5DUI A;  2K4J A;  1ZLK A;  2W57 A;  3L9F A;  4EGZ A;  3H92 A;  1Z6T A;  2QBY B;  1P6R A;  2F5D A;  5F6F A;  1HQC A;  1U2W A;  3CUO A;  2FML A;  1W7P B;  5HOO A;  1G3T A;  2E1C A;  4ENM A;  1OYY A;  1YW9 A;  2ADU A;  3ZMU A;  1RI7 A;  1BI1 A;  2H94 A;  2DLL A;  1KGS A;  5LLQ A;  1U5T A;  3QAH A;  4EJV A;  4L9N A;  5JVT A;  1MD0 A;  1TW2 A;  1JXS A;  2EB7 A;  5KVR A;  1J0R A;  1RZ4 A;  2FBI A;  3E5X A;  3WTZ A;  2XAQ A;  3TQN A;  4RB3 C;  1RUO A;  1BBY A;  3P9K A;  4HV6 A;  2GWR A;  2M87 A;  4WCG A;  2F5F A;  2OA4 A;  3EDP A;  5CVI A;  2K4B A;  3ISP A;  2M5W A;  3MCZ A;  1LEB A;  5E17 F;  3E5U A;  2DPU A;  3R4K A;  4ZZD A;  2FRH A;  3M9A A;  4EM1 A;  2QYO A;  5AIP A;  1OYW A;  3I64 A;  1IN6 A;  2DQL A;  4HYE A;  3RPU A;  2JPB A;  5IT9 Z;  1FX7 A;  3LA7 A;  1W7P D;  1IN5 A;  1Q1H A;  1G3W A;  1J5Y A;  4YG2 F;  1FYL A;  2A07 F;  2P7C B;  1LDD A;  2QBY A;  4HZF A;  3CJN A;  3ZMT A;  1JE8 A;  1F9N A;  4R1H A;  4UV9 A;  1QQI A;  1R5H A;  2YX7 A;  4UNO A;  4ZYG A;  3FXQ A;  3F3X A;  2ISY A;  1BM9 A;  4KN7 X;  5J8F A;  2VXZ A;  2CFX A;  3O3K A;  2NYX A;  3D5L A;  1GXQ A;  4CXF A;  4WX9 A;  1VTN C;  4Q4Z F;  2Y75 A;  3IWZ A;  2VT3 A;  3KZZ A;  2HQR A;  3K9T A;  4WXC A;  2XAS A;  2BEO A;  2VOP A;  2Z33 A;  1UB9 A;  4IJA A;  2FNP A;  5CJ9 A;  2PG4 A;  3MZH A;  5E1Z B;  3TOA A;  3R61 A;  4KDP A;  4AD9 A;  1IRG A;  3KP7 A;  2EFW A;  4Y17 A;  1B4A A;  3F8N A;  1SD4 A;  1HXD A;  2KRF A;  1ZG3 A;  2EFQ A;  4EV0 A;  2JRT A;  3GO5 A;  4MNU A;  1XGS A;  3F22 A;  3SZT A;  4KIC A;  2DTR A;  1IXR C;  3RI4 A;  1KA8 A;  1D5V A;  5DUK A;  4BHP A;  4LD5 A;  1K7A A;  2RVC A;  3CUQ C;  2DAO A;  2LDU A;  4MHG A;  3JSO A;  1STZ A;  2HFH A;  4UHT A;  1TTY A;  4N0B A;  4HX8 A;  2EFO A;  2QQ9 A;  3NQO A;  1TQM A;  2GZW A;  3GZ6 A;  2ZXJ A;  4RAY A;  4S04 A;  4M6X A;  1U3E M;  1XSX A;  4MQV A;  1R5G A;  4IRI A;  2EV0 A;  1TBX A;  2BYV E;  2CO5 A;  2D2W A;  2QUF A;  5DEQ A;  2HDC A;  4OMZ A;  3I53 A;  2XKP A;  1TLH B;  1S6L A;  2P7V B;  1Z91 A;  4P55 A;  5J6X A;  1Z1D A;  3K1P A;  4G94 A;  3TOB A;  1S8N A;  1FSH A;  2C6Y A;  2MD5 A;  5LHI A;  2G7U A;  5TRD A;  3QP6 A;  1XDS A;  2ZCW A;  3G3Z A;  5L3E A;  4JK1 X;  3P9C A;  1YYV A;  1FBS A;  2COM A;  3KEQ A;  4BYY A;  3ZN1 A;  3VOE A;  3M8E A;  3WTV C;  3O2P E;  2K27 A;  1T6S A;  2DO7 A;  4JQF A;  1WSU A;  2VT2 A;  5LEJ A;  4M9S A;  3QOP A;  3FXR A;  1U5T C;  5LGU A;  2OAZ A;  3IHU A;  1SMT A;  5DDG A;  1FP1 D;  2EV5 A;  4LLL A;  3I0T A;  1L3L A;  4O5V A;  4N9I A;  1KU7 A;  4KFC A;  2QZ8 A;  4KMU X;  4U7D A;  1JHH A;  2VBX A;  3GX4 X;  5FLX Z;  5D5V B;  4OIN F;  1JGS A;  1NHA A;  4AIH A;  1HW5 A;  3HYI A;  2WTE A;  5DCF A;  4AVP A;  3FMS A;  4CIC A;  3BP8 A;  1FYK A;  2HOE A;  4E70 A;  1R00 A;  2PMU A;  3KP6 A;  2FF4 A;  2W24 A;  5LGT A;  3E3V A;  2OD5 A;  3CO6 C;  3WE3 A;  3IRR A;  2IJL A;  3VFZ A;  1SFX A;  4A0X A;  2VOD A;  3FF5 A;  1YQA A;  3MAJ A;  4ENN A;  3DP7 A;  2ACJ A;  1ZGA A;  3O6B B;  1CF7 B;  4A5M A;  1ZGJ A;  4Q48 A;  2BV6 A;  2MLG A;  1F5T A;  1JHF A;  1RUN A;  5D4R A;  4HAM A;  3B02 A;  3BJA A;  1I6X A;  5FB2 A;  4AIK A;  1OR7 A;  2Z5U A;  1XSD A;  1AWC A;  1O3T A;  3WGG A;  3WGI A;  1S29 A;  3V7R A;  4DNC A;  3MQ0 A;  3T5X A;  3ZP5 A;  2CSO A;  2CG4 A;  3IRQ A;  2V1U A;  3U9G A;  4PGG A;  3HHG A;  1TQP A;  2MBF A;  3VEP A;  2DI3 A;  2Q2E A;  3GXO A;  3I59 A;  5HLH A;  4EJO A;  1K6O A;  2W84 A;  4L9V A;  5E20 A;  3RTR A;  1USS A;  1K79 A;  4M74 A;  2H6B A;  4ZYE A;  2JSC A;  1BOA A;  3PFI A;  2UWM A;  4NHJ A;  1D3Y A;  1I27 A;  1IW7 F;  1TW3 A;  1HW2 A;  5D5W B;  1KU3 A;  3BPX A;  4A12 A;  1YFH A;  2IPQ X;  1I1G A;  4NQW A;  4EVI A;  4G6Q A;  5HS7 A;  1HW1 A;  3C18 A;  2OZ6 A;  2XHK A;  4LGW A;  3PQK A;  4P9U A;  1U5T B;  1XDU A;  3K69 A;  1U6G A;  2RV8 A;  1G3S A;  1G3Y A;  3Q9V A;  4KUM A;  5L3D A;  2O6G E;  1H9T A;  1IXC A;  4EM0 B;  2V79 A;  2M8E A;  1I1S A;  1W5T A;  4MGR A;  4RGR A;  2CWE A;  3GLX A;  4ZZL A;  3BJ6 A;  3CUQ A;  4I01 A;  5E18 F;  3F23 A;  2ELH A;  2XAG A;  5DD4 A;  1SD7 A;  2M45 A;  3HSF A;  2HEO A;  2JPC A;  4K2E A;  2HS5 A;  3HSE A;  1LVA A;  5L3G A;  3OOP A;  5BMZ A;  3ZQ7 A;  3BRO A;  4M71 A;  4XLP F;  1KQ0 A;  2A68 F;  5FLX K;  3ZN0 A;  2D45 A;  5BPI A;  3HRU A;  4EJW A;  5HLI A;  2QVO A;  5JFR A;  3RKX A;  1IN8 A;  1GVJ A;  5LGN A;  2DK5 A;  1LDK B;  1YW7 A;  1FP2 A;  2HGC A;  3ULQ B;  2ZJ2 A;  4I2O A;  3KE2 A;  1FC3 A;  3F72 A;  1W5S A;  1OPC A;  3WTW C;  2UZK A;  2LF8 A;  4UUV A;  5D8K B;  1EH6 A;  3WTY C;  1E17 A;  2NAZ A;  4ZYD A;  2V9V A;  4HDV A;  1KQ8 A;  4A5N A;  3HRT A;  1DDN A;  3CTA A;  3JSP A;  1XCV A;  2TDX A;  3ABU A;  2YSR A;  3S2W A;  3FX3 A;  5CVR A;  3KZY A;  1CGP A;  3JAM Z;  2GA1 A;  2X0L A;  3F6O A;  2WWY A;  5ERI A;  2IT0 A;  1R23 A;  5ED4 A;  3IL2 A;  3L7W A;  1QPM A;  4MEX F;  2K02 A;  3V7C A;  2A5Y B;  3IWF A;  2QM3 A;  2R3S A;  2M1B A;  4G7H F;  1MJ9 A;  3CO7 C;  5ICC A;  4EGY A;  4ASN A;  2R7D A;  4YFX F;  5BQT A;  3R0J A;  3P9I A;  1ON2 A;  4MQ9 F;  5JI6 A;  5A2Q Z;  1Z05 A;  4I02 A;  2Y0M A;  3NEU A;  1XGO A;  2F2E A;  1YTY A;  1FYM A;  4U88 A;  2IA2 A;  3F6V A;  2OZU A;  1H0M A;  5K5Q A;  5JR3 A;  1PUE E;  4QWQ A;  2IVM A;  3SHF A;  4CGZ A;  2FOK A;  1MJB A;  1GXP A;  2BBY A;  1ZRD A;  5F64 A;  2ESN A;  2DU9 A;  1IN7 A;  1FBU A;  5CLS A;  3V7S A;  4BAY A;  1B9N A;  2FA5 A;  2HYF A;  3ECO A;  1LB2 A;  3KCC A;  5ICG A;  1O3Q A;  3LAP A;  2HKO A;  1WKM A;  3TKY A;  4XRF A;  3FMQ A;  4M72 A;  4IPA A;  4QLC U;  2EWN A;  1WI9 A;  4MEY F;  3CDH A;  4WWC A;  2AS5 F;  4CZZ A;  5FD6 A;  4L9J A;  4OU0 A;  3K2Z A;  3KP5 A;  3BZ6 A;  5J8C A;  4KNY A;  2K7L A;  1W4M A;  4GGG A;  1XMK A;  4OIO F;  1XSV A;  2VON A;  4D0P A;  5LRS A;  2KIM A;  5K5O A;  4DQ2 A;  2P4W A;  2W25 A;  5L3F A;  1QBJ A;  4LB5 A;  1UST A;  1R58 A;  1FT9 A;  5TJJ A;  3WU0 A;  3V8L A;  4IVN A;  3WTT C;  4WXH A;  4GCV A;  2J5P A;  2ETH A;  3KLN A;  1HKQ A;  4G6D A;  3HIF A;  2M30 A;  1Z7U A;  5ILU A;  4PGH A;  3SZP A;  4XBF A;  1XN7 A;  1J9I A;  2YU3 A;  3W6J B;  5BOX A;  2ISZ A;  3IC7 A;  3TDU C;  1O7L A;  3EQL F;  4L0Y B;  4M6Y A;  2H09 A;  2GXG A;  3F8M A;  2VE8 A;  2VBY A;  3TO9 A;  1DPU A;  1QNT A;  2CGP A;  4L9T A;  4HDU A;  1R1U A;  1BI2 A;  2PMH A;  2V1X A;  3WTU C;  5BS6 A;  1SD6 A;  1SFU A;  4GXO A;  1B1B A;  4R8H A;  2VBW A;  3H3Z A;  4LLG F;  3AAF A;  4BHC A;  1SAX A;  2Y48 A;  1F4K A;  2A3S A;  3WTX C;  4GO1 A;  1DP7 P;  2GAU A;  2DBB A;  1XGM A;  4N9H A;  1IRF A;  1SD5 A;  4FX4 A;  4Q5S F;  4O6J A;  5D5X B;  2DK8 A;  3BOQ A;  2DFI A;  1UFM A;  3FM3 A;  2FXA A;  4EM2 A;  4A0Y A;  1L0O C;  2LF7 A;  3I59 B;  2O8X A;  3J80 Z;  1ZRC A;  2R7F A;  2IA1 A;  1G6N A;  2OQR A;  2FSW A;  4I7H A;  1IF1 A;  3ZPL A;  3DQV C;  4S05 A;  2D1H A;  3Q9S A;  4ESF A;  5D6F A;  4B8X A;  5IT9 K;  1D8J A;  4NB5 A;  4BNC A;  3GYH X;  1OMI A;  4AIJ A;  3RDI A;  4LB6 B;  3EYI A;  4ON0 A;  3WOD F;  5E1X A;  3E6D A;  4RAZ A;  2L4M A;  4YFN F;  3B73 A;  3MFK A;  3GUD A;  3KP2 A;  1R1V A;  2RKH A;  1LJ9 A;  4M73 A;  1ODD A;  5AON A;  1K78 B;  5DCM B;  3DPL C;  2BGC A;  3HOT A;  5E8I A;  2NNY A;  2GQQ A;  3F21 A;  4PCQ A;  4G7O F;  3I58 A;  3RYR A;  4YFK F;  3GF2 A;  1IZ1 A;  1B6A A;  2HZT A;  2OQG A;  2K86 A;  5FD5 A;  3C1D A;  3T0Y A;  2RN7 A;  3M8F A;  4M9Z A;  3CUQ B;  1YG2 A;  2XAJ A;  3LA3 A;  1ZYR F;  2H27 A;  1BJA A;  5CYV A;  3DEU A;  3GZ5 A;  1O57 A;  2FMY A;  1XCB A;  3U1D A;  3FHZ A;  1ZH5 A;  4LMY A; 
#chains in the Genus database with same CATH topology
 3HKZ N;  3K10 A;  1WQ2 A;  4WXD A;  3WE2 A;  4X0G A;  2O03 A;  1KQ9 A;  2CRG A;  3S2H J;  4ANJ A;  2NNN A;  1LKX A;  2IAI A;  2CMP A;  3WHC A;  1Y0U A;  4XON A;  4L0Z B;  5JLX A;  2ZKZ A;  5EEG A;  3J7Y J;  3OYJ A;  1YRN A;  2IXS A;  3FM5 A;  2MLK A;  3MWM A;  1A04 A;  1QZE A;  2HZD A;  5M5X J;  1J75 A;  3GVA A;  3J81 Z;  4MFE A;  5DYM A;  2VUM J;  3DFG A;  3QU6 A;  4M6V A;  1X3U A;  1MND A;  3NWT A;  1FJL A;  4Y7N J;  2E5Z A;  3BY6 A;  5D4S A;  3H3U A;  1UAA A;  3VPR A;  1P92 A;  1GT0 C;  5GTI C;  1RIO H;  3BJO A;  1AOY A;  4HA8 A;  2VOO A;  2JRM A;  2W00 A;  1WJ5 A;  2FU4 A;  4LLN A;  1A5J A;  3CF2 A;  4ESJ A;  4UXN A;  2E7W A;  2M8G X;  2P5K A;  3I71 A;  3VDX A;  2XRL A;  4I6Z A;  1V5E A;  5LHH A;  2JTV A;  4RGS A;  3GFL A;  3G71 I;  4BQA A;  2B7E A;  2PLY A;  2IS6 A;  1R5I D;  3U21 A;  5K1Y A;  1TNT A;  4KIF A;  1I3Q J;  1YE9 A;  2EA4 A;  1Z3X A;  4I0B A;  4PUS A;  5J3L A;  4E7S A;  5HVQ C;  3L2Q A;  1EF4 A;  2L4A A;  4DYQ A;  2P6S A;  4TV7 A;  2Z99 A;  3RKY A;  1NTC A;  1YLF A;  2HQN A;  1K78 A;  1S7A A;  3VYU B;  4EJU A;  4G6T B;  5DCM A;  4OMY A;  4KMF A;  5LEK A;  4M3B A;  2BHZ A;  5ILV A;  3EUH C;  1ETV A;  3E6B A;  4F92 B;  3S14 J;  4HF2 A;  3BDD A;  4B47 A;  4DGW B;  3PO2 J;  3BQY A;  4GYG A;  4RB0 A;  4UUS A;  5E3L A;  1AKH A;  5HS8 A;  2OTJ I;  2ELJ A;  2R7T A;  4KT6 A;  4E7I A;  4ZTJ A;  2STT A;  3OYA A;  2JUG A;  1PP8 F;  2E1M B;  2L3D A;  5CVV A;  5M5Y J;  3K7A J;  3C2B A;  3GW2 A;  2EK5 A;  2ZSH B;  2JZY A;  3CMM A;  4LJZ F;  2G7H A;  3ZOB A;  1ZRE A;  2MC4 A;  4A2U A;  3HRS A;  1FPQ A;  3QQA A;  5IT3 A;  3SYT A;  3H3V K;  3S1R J;  4E6K G;  1JT0 A;  2XV4 S;  2LKP A;  3HHH A;  3HOS A;  2NS8 A;  1JT6 A;  4RAG A;  1BIB A;  1B59 A;  2L54 A;  2KIQ A;  3Q0V A;  4M3G A;  4KYW A;  4FQG A;  2DQR A;  2XPU A;  3SEQ A;  5FKM A;  3LSM A;  5H6R A;  2NS0 A;  3UKG A;  1T2K A;  2O7O A;  5FFX A;  3DTI A;  4I09 A;  3TDZ C;  1VI0 A;  5DD8 A;  1A6Q A;  5CVJ A;  1U9N A;  2HI3 A;  1FTT A;  3OR2 C;  2M2E A;  3J80 K;  5D8L B;  3W2A A;  1G2H A;  3ASN H;  3DEE A;  3ZMV A;  4LG0 B;  1W0T A;  1X2M A;  1KZH A;  3TO6 A;  2WC2 A;  1MKM A;  4Y13 A;  4IF4 A;  1WZ2 A;  3LA2 A;  4Y3O A;  3RKW A;  2E1N A;  1JI8 A;  2EIJ H;  5CKT A;  2CQK A;  2XGX A;  3ZMS A;  3BTI A;  4CO8 A;  1SFE A;  1OCC H;  5FKK A;  1C0W A;  2PEX A;  1RES A;  2IP2 A;  2O61 A;  4ZYA A;  1JKR C;  2XRO A;  1HKT A;  2CJJ A;  2X6X A;  4XN0 A;  2XAH A;  1HKS A;  2LKX A;  4HX4 A;  2EIN H;  4ENJ A;  2HKX A;  2WY8 Q;  3HJE A;  1S7O A;  2JA7 J;  2VN2 A;  4X1E A;  2BXY A;  3GCM A;  2L9V A;  2PQ8 A;  2HPI A;  4H0E A;  2HQA A;  2COB A;  5F04 A;  2A69 F;  3A0B C;  2PFB A;  2ESH A;  1PDN C;  2PN6 A;  3J7A O;  2JVG A;  5EZG A;  2HVQ A;  2EZK A;  4N4O B;  1X3W B;  5EEH A;  3RPQ A;  2XF6 A;  3CZ6 A;  3F8C A;  4RS8 A;  4DBQ A;  4CUG A;  4R79 A;  3FXK A;  1NK2 P;  5HLG A;  3D5S C;  4HF1 A;  2DOA A;  3O8G A;  1HST A;  4UVB A;  1V3F A;  4OIR F;  1R36 A;  1DU0 A;  4I98 B;  2DPD A;  2D5V A;  3EPZ A;  2ZME A;  1XGN A;  4XIC A;  2NVT J;  3DF8 A;  1E2X A;  1TWA J;  2I5U A;  2L7K A;  1R4M B;  2E1O A;  3K0L A;  5E3M A;  1HF0 A;  1NG7 A;  1HBX G;  3I5U A;  3A01 B;  1IN4 A;  2KZG A;  1MDM A;  4RLF A;  4GYI A;  3COA C;  3H35 A;  2RNG A;  2XDV A;  3HM5 A;  2BY3 A;  3CCY A;  2ID6 A;  4ZYH A;  1REP C;  4EJT A;  2ZBK A;  1TQI A;  2XGE A;  2MA3 A;  3BWG A;  1J2X A;  3D0S A;  4L5E A;  2KP6 A;  3H9G A;  1IXS B;  3K70 C;  2KIF A;  4A6E A;  3KIO A;  4CZC A;  2HYG D;  2AO9 A;  3S16 J;  2R7Z J;  2R7V A;  4HX7 A;  1I50 J;  3L09 A;  5HDG A;  1R22 A;  2XAU A;  4U87 A;  3VSK A;  3JRF A;  1T33 A;  2RAE A;  2W85 A;  1ZG1 A;  2HR3 A;  2LR8 A;  1SEU A;  4IXA A;  2JK3 A;  5D6E A;  1SVL A;  1VQ6 I;  1LDJ A;  1EKE A;  1W0U A;  3R6S A;  5BPD A;  2VBZ A;  1Y6I A;  2QF7 A;  4HLY A;  4UB6 C;  1FY7 A;  3W6K B;  3A4C A;  4Y4R A;  3E6M A;  3HZJ A;  5LRR A;  4FE7 A;  4B09 A;  5E79 C;  2RC4 A;  4Z6Y A;  1T98 A;  1YO5 C;  2O3F A;  4L5J A;  4JX4 A;  3HOW J;  1QPI A;  4Z2Y A;  3ASO H;  4LK0 F;  4DZP A;  3KET A;  1G4D A;  2IA0 A;  3ABT A;  3F0C A;  3I54 A;  2EFN A;  1P4X A;  1X1B A;  3ONQ A;  1KU2 A;  1ITY A;  4LG0 A;  3RIR A;  1ZG5 A;  1Z6R A;  3K4L A;  3JRG A;  1MNM C;  1FZP B;  5FO5 A;  1GHC A;  4EEF G;  1O7F A;  3MEX A;  1WI3 A;  4KN4 X;  1BI0 A;  2K5C A;  3EYY A;  3OV8 A;  4AVZ A;  3FDY A;  1RRJ A;  1F36 A;  4FCY A;  4RB1 A;  3GEZ A;  2FEZ A;  4A0Z A;  1BIA A;  3S32 A;  3RJP A;  1IO2 A;  3J81 K;  3DLL F;  3CME I;  1U8B A;  3T1B A;  1DPR A;  1XB4 A;  1ZGW A;  3IKT A;  4IHT A;  3K1M A;  3DKY A;  3L00 A;  5M3M J;  2HTJ A;  3MN2 A;  3I4P A;  3X2Q H;  4DJA A;  5F1J A;  1QA6 A;  3P7N A;  4ENK A;  4OWR B;  1Y1V J;  4HBL A;  5BNG A;  2YR2 A;  3FXM A;  3JCU C;  4D7N A;  2EV6 A;  4BE0 A;  2V6C A;  2VQL A;  3N4M A;  4HSR A;  3IP4 B;  3QPT A;  4PZJ A;  4DIQ A;  3KYL A;  1QO0 D;  2CYY A;  5GP9 A;  2QKL B;  3U1K A;  1FLI A;  2VC0 A;  1W7P A;  5C4J J;  5IY5 H;  2EZH A;  3HOY J;  3V4G A;  2YPR A;  2R7R A;  5H20 A;  4UVC A;  1LEA A;  3HSR A;  4OOI A;  3LFK A;  3VSL A;  5FFZ A;  4UV8 A;  1FNN A;  5IYC J;  1AA7 A;  1O3S A;  2CU7 A;  5HDN A;  3FKI J;  2DA2 A;  2FQ3 A;  3LST A;  4Y15 A;  1U0J A;  4BDZ A;  3A2K A;  2ZFU A;  1PP7 U;  2DT5 A;  3WTS C;  2HXO A;  2EFP A;  3H1C A;  3RQI A;  2IEK A;  2GA2 A;  5AIQ A;  4V2G A;  4XSX F;  2PJP A;  1BL0 A;  1UHM A;  2XAF A;  3W2V A;  5HOD A;  1LNW A;  1IV8 A;  4ESB A;  3BR5 A;  1XS9 A;  2ZFW A;  1XD7 A;  5FRN A;  3DKW A;  3DXJ F;  5E1W A;  2IRF G;  1IRX A;  5M3F J;  2G9W A;  4Y33 A;  2A61 A;  2HWV A;  3PSI A;  1T0F C;  2VKV A;  1OCR H;  3KLO A;  1X58 A;  3V42 A;  1X1D A;  2LNB A;  1TL8 A;  3IH3 A;  4A3K J;  3BR6 A;  2H8W A;  2EA2 A;  2QSF X;  3GWZ A;  3QYF A;  5B5E C;  5HS9 A;  1AU7 A;  3BTL A;  2UXN A;  4FT8 A;  2V6E A;  3ECH A;  3LWF A;  3LNQ A;  3JTG A;  1P4A A;  2AQE A;  4LFU A;  3HB9 A;  3CJQ B;  2P8T A;  2ZNZ A;  2P5V A;  2DW4 A;  5KCM A;  2KZV A;  4P96 A;  2QLZ A;  4PJJ A;  2OU2 A;  4KT5 C;  4P5O A;  1X3Z B;  3ERM A;  2XSJ C;  1V5F A;  2X4H A;  3N97 A;  4AM3 A;  2ME6 A;  1TNS A;  3ZXS A;  4XLH A;  2UV1 A;  2X1C A;  4XOT A;  3HUG A;  3P5J A;  4AWX B;  3W2W A;  3MKZ A;  2WAD A;  3FXJ A;  2VC1 A;  3PNT A;  2AXL A;  2F5E A;  3EUH A;  4W1U A;  3Q5F A;  1HDD C;  3PFY A;  4UVA A;  1JUM A;  4M3E A;  3AL0 C;  4DZJ A;  1U8R A;  4D1Q A;  4EMS A;  1IAW A;  3HOV J;  2YX4 A;  4I0A A;  5C44 J;  3E5Q A;  2OCE A;  1SFO J;  1VQP I;  1ZKG A;  2DFF A;  2R5Y A;  2O9L A;  3B6A A;  2Q1Z B;  1KYW A;  3TBI A;  1IGN A;  1RET A;  3W6V A;  2QSG X;  4A6D A;  3VOD A;  4CHU A;  4MIM A;  2P5L C;  5CVU A;  2ZNY A;  2PBI A;  4KA4 A;  4G9Y A;  4BGD A;  2D1V A;  2FNA A;  1ZAO A;  1FOX A;  1BC8 C;  3FMR A;  3E97 A;  4HPQ A;  4G7Z F;  1ZR2 A;  1X4P A;  3T8R A;  1U78 A;  1KYZ A;  1MGT A;  1N75 A;  4HOB A;  3FWE A;  1EH7 A;  2LYC A;  1NH3 A;  4HEA 2;  2QSH X;  1RNL A;  2H1L A;  3ML6 A;  2QQA A;  2CW0 F;  4RMN A;  4PJN A;  3KP4 A;  3HRM A;  2XUB A;  5JVG F;  3JAM K;  3REO A;  1F1Z A;  5LFA A;  2NVY J;  2BOL A;  1P9Q C;  4JBA A;  2GLO A;  2MC3 A;  4EQQ A;  3LMM A;  4BXU A;  3L2R A;  2PMZ N;  4Q47 A;  3LSJ A;  1X4O A;  1P7J A;  1T38 A;  2RDP A;  3RYP A;  3WU1 B;  1JUS A;  3V8J A;  2GIV A;  1VFC A;  1KON A;  1QZY A;  3AG4 H;  5E8G A;  3R60 A;  5FKO A;  2Y30 A;  4U0Y A;  3KP3 A;  3ZRG A;  4B43 A;  4XSZ F;  4YIF A;  5IP6 A;  4HQE A;  2FBH A;  2KKO A;  2XIG A;  4BQN A;  2A6E F;  2AXT C;  3J7Z I;  4QPO A;  3DU6 A;  5HNF A;  4KIB A;  5A2Q K;  3JRI A;  2Q0O A;  3E7L A;  1RC9 A;  3Q3S A;  4F52 A;  1YIO A;  2F5C A;  4ZH4 F;  3AG1 H;  2MH9 A;  1Y8Q B;  4NUB A;  3UNG C;  2PI0 A;  1S72 I;  3M8J A;  5EGO A;  2STW A;  2EPF A;  3BG7 A;  3LSG A;  2X9D A;  3JW4 A;  2LBF A;  2BVM A;  3L2C A;  3HTS B;  4NNJ A;  4RGX A;  3QP5 A;  3ZMD A;  5JHU A;  5EG0 B;  3CES A;  3D1N I;  1YRN B;  1MMN A;  1FSE A;  1JKQ C;  3QPH A;  5J40 A;  2I8D A;  2X6Y A;  1SVM A;  4J01 A;  2JWT A;  3HTU A;  4XLE A;  3IV5 A;  3QRF F;  1FIA A;  4PFP A;  4FX0 A;  3K1N A;  4KIG A;  3NRV A;  5L3B A;  2VPR A;  3HGG A;  3FZV A;  3ELK A;  4LG3 A;  2ZO4 A;  1XMA A;  3K70 D;  2EQR A;  4E7L A;  1LQ1 A;  1FBQ A;  1ZHF A;  2RQP A;  3FXU A;  3PQJ A;  3SJM A;  2H6C A;  5FLM J;  5LHG A;  1JKO C;  3R0A A;  1ZRF A;  3DCF A;  5LBQ A;  3C3W A;  2B9S A;  2FBK A;  3BR1 A;  3KEO A;  4AID A;  2XRN A;  5B3S H;  5C4X J;  2BVL A;  3H0D A;  5H6Q A;  2EJR A;  2WY7 Q;  3TW7 A;  4HV5 A;  4NC7 A;  4G8X A;  3TW6 A;  4BJT A;  1EH8 A;  1T08 B;  4HNT A;  3SXY A;  4CYD A;  4LK1 F;  3FK7 A;  5HDK A;  1FWZ A;  4QPQ A;  4F7Z A;  2IW5 A;  4M9X A;  5DV5 A;  2XC7 A;  3CQZ J;  2HOT A;  3WGH A;  3A03 A;  4HW0 A;  2WAQ N;  1S3J A;  1W36 C;  1OYI A;  3F8B A;  4AYB N;  3H5N A;  2DMQ A;  3GLL A;  3SQN A;  1RKT A;  3BPV A;  2VQC A;  2QA4 I;  4PJM A;  4DW6 A;  1VQ8 I;  4RB2 C;  4U7B A;  2TRT A;  2HQ5 A;  3W3C A;  4HQM A;  3H5A A;  2PJR B;  2NXN B;  4OIP F;  1H9G A;  3CCM I;  2BHY A;  3QU3 A;  2RGV A;  3OWT A;  1T39 A;  3C7J A;  3LQQ A;  1POG A;  1VQN I;  2WV0 A;  1DGR M;  4FHT A;  2LD5 A;  2HU9 A;  4PDK A;  4BH9 A;  3ERE D;  2QEN A;  3S3O A;  1Z9C A;  2DDB A;  1D8K A;  3DPT A;  3KFW X;  1DUX C;  6PAX A;  3TGN A;  3ZQF A;  5F0F A;  1MBJ A;  3S3M A;  1H8A C;  1P2F A;  4IRG A;  2QEX I;  1J7K A;  3CLO A;  3EET A;  2IS1 A;  5L3C A;  5IPA A;  3F8F A;  1SMY F;  5F1R A;  3HKZ A;  4CDG A;  2X51 A;  1MZB A;  4XLN F;  2LRD A;  1ACI A;  2Z9O A;  2L02 A;  3CDI A;  3ROU A;  2E2H J;  2XSD C;  5GAG J;  4OAY A;  1ZAR A;  1KU9 A;  1V54 H;  4U0V A;  2FE3 A;  5K5R A;  3ZQQ A;  2OBP A;  2IGK A;  3FIS A;  1TWH J;  2J5O A;  3GBG A;  1NK3 P;  1WJF A;  1MJA A;  4HLX A;  2KJB A;  5EYR A;  2JT1 A;  1XTA A;  1IUY A;  3M7G A;  2Q8K A;  1ETW A;  4LIT A;  1BI3 A;  2GOX B;  1QGP A;  2XGC A;  3L2V A;  2R7O A;  2Z2S B;  2ECB A;  4MTD A;  1YS7 A;  2RNJ A;  5EG0 A;  4KJZ A;  1EV7 A;  5ILS A;  1YJN I;  1H88 C;  4IHX A;  2MH2 A;  5GAH J;  1PUF B;  2P6T A;  3QYE A;  4WF2 A;  4XNF A;  1B9M A;  2QQB A;  1OKR A;  2EIL H;  3QOD A;  4NC8 A;  5JLW A;  3GTM J;  4D5C A;  1ZN2 A;  4XOR A;  3I55 I;  1FMV A;  5KK1 A;  4O3M A;  3CCR I;  1D1A A;  1V4R A;  3HXL A;  2O0Y A;  3GFJ A;  4IKF A;  3QPS A;  1BC7 C;  2L01 A;  3U2R A;  1F43 A;  2HTS A;  3A0H C;  2V9P A;  1AHD P;  4FIS A;  1DU6 A;  2DT7 B;  3PM1 A;  4D7M A;  1WWX A;  3OIO A;  3E6C C;  1BN5 A;  3CDL A;  4IHV A;  3K4N A;  5FRO A;  1H89 C;  2QWW A;  2NVX J;  1VND A;  2V1D A;  4J19 A;  4ABZ A;  2E7X A;  4IHS A;  1WRJ A;  3MZY A;  3I4M J;  5ICE A;  3M1E A;  4MTE A;  5J1R A;  2KPM A;  1N78 A;  4WK8 F;  3M3Y J;  1QZZ A;  2P0W A;  4MO7 A;  4U0W A;  4CCN A;  1R6R A;  3OMY A;  2BE5 F;  3BCB A;  3S93 A;  3VB2 A;  1YW8 A;  3LQR A;  2A6H F;  2ZME B;  2XGD A;  1J59 A;  1GLN A;  4ITV A;  4C9Y A;  4D9J A;  1ZLJ A;  1T0F A;  1TC3 C;  3ABM H;  5D5U B;  3HPH A;  3I3L A;  1MDM B;  3V8K A;  3B6C A;  3HBL A;  3WG7 H;  2B0L A;  1CF7 A;  4IEJ A;  1BA5 A;  2F48 A;  1ON1 A;  2PJR A;  4L5I A;  2TCT A;  4RGU A;  2L7F P;  1WCM J;  2FOW A;  1YS6 A;  3SFZ A;  2UXX A;  3OYK A;  5ICF A;  3G1M A;  4P9F A;  4E7H A;  1R7J A;  1FOK A;  2L7M P;  2KT0 A;  3VWB A;  4YII A;  4BHB A;  2DMT A;  2HYJ A;  5FGM A;  4B4C A;  3LAJ A;  2CW8 A;  3LSP A;  1VQ9 I;  2XB5 A;  2OUM A;  3CCQ I;  4A3D J;  4AU7 A;  2KDZ A;  2KRC A;  4IRH A;  3DBL B;  4J00 A;  2N8G A;  3OYC A;  1O3R A;  4OIQ F;  1WHU A;  2V9K A;  3CC7 I;  2HXI A;  1OQY A;  2QCO A;  3ZMZ A;  1ULY A;  1ONV A;  3MKL A;  3BT9 A;  2NRA C;  1GVD A;  4ZDP A;  1UCR A;  2XVC A;  2GXB A;  2V4J C;  1FOW A;  3GFM A;  4XQF A;  2XKO A;  3JTH A;  4C3H J;  4W97 A;  9ANT A;  4CCM A;  1I5Z A;  3OOU A;  3IKV A;  5J4Y A;  3OS0 A;  3TO7 A;  2VI6 A;  4HF0 A;  1HSJ A;  1B72 A;  2K9M A;  4XLA A;  4ETS A;  1YJ9 I;  2Z3Y A;  2VE9 A;  3PUB A;  1PUF A;  1B8I A;  3CP2 A;  1MBG A;  3OIP A;  2MFZ A;  3T8T A;  2LSO A;  5EDN A;  2KIU A;  1O4X A;  1R1T A;  3BQZ A;  4PSX A;  5F08 A;  1GDT A;  1LE8 B;  3SZG A;  2KJC A;  2X6O A;  3AFH A;  4L18 B;  1XX5 A;  1Y39 A;  1UHW A;  3BG9 A;  1P4W A;  3G73 A;  1MMS A;  4HRI A;  3GFI A;  2XF7 A;  4GFB A;  3DV8 A;  3WG9 A;  2BXZ A;  5DUI A;  2K4J A;  1ZLK A;  2W57 A;  2K40 A;  2LY9 A;  3L9F A;  2M3A A;  4EGZ A;  3PIO F;  3S2D J;  3H92 A;  2XPW A;  1T56 A;  4XRM A;  2F6C A;  1Z6T A;  2QBY B;  1BOB A;  2ZJQ F;  1P6R A;  2F5D A;  5F6F A;  1HQC A;  3LSH A;  4E7Z A;  1U2W A;  3N05 A;  3CUO A;  2FML A;  1W7P B;  5HOO A;  1LFB A;  1G3T A;  3BZK A;  2GBY A;  4DBR A;  2VXD A;  2E1C A;  3JRB A;  4ENM A;  4DOZ A;  3HDD A;  1OYY A;  1YW9 A;  3MMY B;  2ADU A;  2LRE A;  3HGY A;  3ZMU A;  1RI7 A;  1S9H A;  1BI1 A;  2CUF A;  2H94 A;  2DLL A;  1KGS A;  5LLQ A;  1U5T A;  3QAH A;  4EJV A;  4L9N A;  3JRE A;  3OSF A;  3PIP F;  5JVT A;  1IG7 A;  2EZL A;  1MD0 A;  2LLK A;  4E7K A;  2O5R A;  1TW2 A;  2WV1 A;  3DEW A;  1JXS A;  2EB7 A;  5KVR A;  1J0R A;  2Z16 A;  3BG5 A;  2M4K A;  1RZ4 A;  2L0K A;  2HDD A;  4DYR A;  3GTP J;  2FBI A;  3I4N J;  3E5X A;  3VYR B;  3WTZ A;  2XAQ A;  3G6E I;  3G2B A;  3TQN A;  4RB3 C;  1RUO A;  5GPC A;  1BBY A;  2ME0 A;  3OR1 C;  3P9K A;  4HV6 A;  2GWR A;  1BR2 A;  2EH3 A;  3KPH A;  1A35 A;  2LY2 A;  2M87 A;  2Y0S N;  4WCG A;  1TZL A;  2F5F A;  2F4M B;  4XKW A;  1PJR A;  2ID3 A;  1W36 D;  3MKW B;  1SFK A;  2OA4 A;  3EDP A;  2DFE A;  5CVI A;  4I99 C;  2K4B A;  3ISP A;  4GDF A;  1ZR4 A;  5GAD J;  2M5W A;  3MCZ A;  3NAU A;  1YOV B;  1LEB A;  5E17 F;  2VJJ A;  3E5U A;  1Z77 A;  4XMY A;  2DPU A;  4JP0 A;  2DDA A;  1V5G A;  3R4K A;  4ZZD A;  1D0X A;  2FRH A;  2JA8 J;  3M9A A;  2HVS A;  2Z1D A;  4EM1 A;  2MG4 A;  2QYO A;  5AIP A;  4M3D A;  3G1L A;  1N77 A;  1LE8 A;  1MW7 A;  1OYW A;  3HUG B;  4CCK A;  3I64 A;  1IN6 A;  2DQL A;  2BZT A;  4FET A;  2H8R A;  4HYE A;  3RPU A;  2JPB A;  5IT9 Z;  1FX7 A;  3LA7 A;  1W7P D;  1J09 A;  4F91 B;  1IN5 A;  1Q1H A;  1G3W A;  1J5Y A;  5GAE J;  1MH4 A;  4YG2 F;  1FYL A;  4B44 A;  4BE1 A;  3CCU I;  2A07 F;  4JOM A;  2WBM A;  2P7C B;  3KX2 A;  2R5Y B;  3OYL A;  1LDD A;  2QBY A;  3S8P A;  4HZF A;  4QSH A;  3CJN A;  3ZMT A;  2R7S A;  1ETQ A;  1JE8 A;  1F9N A;  4R1H A;  4UV9 A;  5IOY A;  1QQI A;  1R5H A;  3TED A;  1UJ8 A;  1UHS A;  2YX7 A;  3RKQ A;  4ZYG A;  4UNO A;  3AG3 H;  3DTK A;  3FXQ A;  3F3X A;  4ZDO A;  1VF9 A;  5IYD J;  3FHN A;  1A31 A;  2ISY A;  1BM9 A;  4KN7 X;  5J8F A;  2VXZ A;  2CFX A;  3O3K A;  3LSI A;  2NYX A;  4A69 C;  3D5L A;  3K4J A;  1GXQ A;  4BBR J;  4CXF A;  3OYB A;  4WX9 A;  2Y9Y A;  1VTN C;  4V2F A;  1E3H A;  2DA1 A;  4FE4 A;  1VQM I;  2LOO A;  1OIS A;  2DMN A;  3BG3 A;  4Q4Z F;  2DOE A;  2Y75 A;  3FXO A;  2OJE D;  2DA7 A;  4C30 A;  2CQN A;  3IWZ A;  3H36 A;  2KLO A;  2VT3 A;  3KZZ A;  2HQR A;  3K9T A;  4WXC A;  5DS9 A;  2XAS A;  4BAC A;  2BEO A;  3ZQL A;  2VOP A;  2Z33 A;  1UB9 A;  4IJA A;  2FNP A;  5CJ9 A;  2PG4 A;  3L2W A;  3MZH A;  4PFO A;  5E1Z B;  3TOA A;  1ETX A;  3CCL I;  3R61 A;  3J7A Y;  1XMX A;  4KDP A;  4AD9 A;  1IRG A;  3CCE I;  1HA8 A;  3BR3 A;  3KP7 A;  4BKX A;  2EFW A;  4Y17 A;  1B4A A;  3F8N A;  1Z67 A;  1R71 A;  1SD4 A;  1HXD A;  5EGO B;  2KRF A;  1ZG3 A;  4CCJ A;  3OYD A;  2EFQ A;  2O8K A;  2R7W A;  4A93 J;  1T8I A;  4EV0 A;  1ORK A;  2JRT A;  2LBF B;  2Y31 A;  2M34 A;  3GO5 A;  1JJ6 C;  3BC8 A;  4MNU A;  1XGS A;  3F22 A;  2JMW A;  2FJ1 A;  3SZT A;  3PNV A;  4KIC A;  2DTR A;  1MMD A;  1IXR C;  4IX7 A;  5KAF C;  2NOJ B;  3ABL H;  4II3 A;  2E35 A;  3RI4 A;  1ETY A;  2R4G A;  1KA8 A;  4A3B J;  1D5V A;  1Z0X A;  5FKN A;  2ZJP F;  5DUK A;  4RA2 A;  4BHP A;  5HNH A;  3OL3 A;  2B63 J;  4LD5 A;  4AUX A;  2CUZ A;  1X1P A;  1OJL A;  1FIP A;  1K7A A;  2RVC A;  3CUQ C;  2DAO A;  2LDU A;  3FK6 A;  4MHG A;  2R7U A;  3JSO A;  3LSR A;  2MYS A;  1STZ A;  2ZXH A;  2HFH A;  3HG9 A;  2DN0 A;  1TTY A;  2V1N A;  4N0B A;  4UHT A;  2DTZ A;  2EFO A;  2QQ9 A;  3LOC A;  3NQO A;  4HX8 A;  3MKY B;  1TQM A;  3SEZ A;  2DXI A;  3HEF A;  3HOU J;  2GZW A;  3WHB A;  1ETK A;  2K9S A;  3GZ6 A;  4DYC A;  3PO3 J;  4IOC F;  2ZXJ A;  4RAY A;  4S04 A;  4AC0 A;  3JRC A;  1ZTR A;  4H4K C;  4A3M J;  4M6X A;  1U3E M;  1XSX A;  2KMU A;  1VZ0 A;  4MQV A;  1JUP A;  1R5G A;  2E19 A;  4IRI A;  2EV0 A;  1TBX A;  2A5W A;  1YX5 A;  3NWS A;  2GM4 A;  2BYV E;  2W7N A;  2CO5 A;  2R93 J;  2D2W A;  2QUF A;  4BY1 J;  1PVE A;  5DEQ A;  2HDC A;  4OMZ A;  4A3C J;  3I53 A;  1JJ8 C;  3CJR B;  2X6W A;  1TLH B;  2XKP A;  1S6L A;  2P7V B;  2PMZ A;  3QYB A;  1Z91 A;  4BU2 A;  4P55 A;  5J6X A;  2LKS A;  1DP3 A;  1IC8 A;  1Z1D A;  3K1P A;  4G94 A;  3TOB A;  2PX9 A;  4F3Q A;  1JTX A;  1MMG A;  1S8N A;  3A1Y A;  2EIK H;  1OCZ H;  2IS4 A;  4C2M J;  1FSH A;  2C6Y A;  4IHY A;  2MD5 A;  5LHI A;  2G7U A;  2VL8 A;  5TRD A;  3QP6 A;  1XDS A;  2XF5 A;  2VKE A;  2ZCW A;  1Y56 A;  5J1Y A;  2ZJR F;  2GXA A;  3G3Z A;  2P81 A;  4N4N B;  1E3P A;  4JK1 X;  3P9C A;  5L3E A;  4BBS J;  1YYV A;  2JA6 J;  1FBS A;  5CPR B;  2F5V A;  3LFU A;  2COM A;  3GTL J;  3KEQ A;  4BYY A;  3A02 A;  3ZN1 A;  2ZXI A;  3FBI B;  5B1B H;  1U9O A;  3DPU A;  3VOE A;  3M8E A;  3WTV C;  3O2P E;  2K27 A;  4G12 A;  1T6S A;  2DO7 A;  4JQF A;  3CCS I;  1WSU A;  2K3P A;  2VT2 A;  3H9J A;  5LEJ A;  4M9S A;  4JX6 A;  3JRD A;  3BZC A;  3QOP A;  2GIZ A;  3FXR A;  1U5T C;  4XLF A;  1D0Z A;  5LGU A;  4B1R A;  1VQL I;  1XG1 A;  2OAZ A;  3IHU A;  1SMT A;  5DDG A;  1LPQ A;  3CC2 I;  1FP1 D;  2EV5 A;  4IQ4 A;  2EIM H;  3I0T A;  4LLL A;  1L3L A;  1YIT I;  2FX0 A;  3MZ8 A;  4O5V A;  4N9I A;  3HPG A;  1KU7 A;  2CUJ A;  4KFC A;  2QKM B;  3JR9 A;  4JX5 A;  3CCV I;  1WJE A;  3VYS B;  1WPK A;  4XKV A;  2QZ8 A;  4KMU X;  4U7D A;  1JHH A;  2VBX A;  3GX4 X;  2F4I A;  5FLX Z;  2VKD A;  5D5V B;  2AQF A;  3C2H A;  3K4K A;  4OIN F;  1JGS A;  1NHA A;  2CQ7 A;  2CQQ A;  4AIH A;  4CCL A;  1HW5 A;  1WFX A;  2WTE A;  3HYI A;  3K4B A;  5DCF A;  3TMO A;  4AVP A;  3FMS A;  4CIC A;  2E1M C;  3BP8 A;  2DA3 A;  4GRI A;  1FYK A;  2HOE A;  3ZQI A;  4E70 A;  1R00 A;  2HOA A;  3E0J B;  2PMU A;  3DWL E;  3KP6 A;  2FF4 A;  2WAQ A;  2W24 A;  4AYB A;  1MH3 A;  5IP7 J;  5LGT A;  2ECC A;  3E3V A;  2YS9 A;  1APL C;  2BY0 A;  2OD5 A;  3CO6 C;  4F55 A;  3WE3 A;  3IRR A;  2IJL A;  3H5R A;  3VFZ A;  3MD2 A;  1SFX A;  3L1P A;  4A0X A;  2NVU B;  2LMD A;  3WU2 C;  2VOD A;  2M0M A;  3FF5 A;  2OCC H;  2LTP A;  1YQA A;  5FKL A;  3MAJ A;  3FBN B;  4ENN A;  3DKX A;  3DP7 A;  3CC4 I;  2CQX A;  3OYH A;  2ACJ A;  1JGG A;  1ZGA A;  1ZEL A;  3IH2 A;  3O6B B;  1CF7 B;  2E60 A;  2VKH A;  3FXL A;  2DJN A;  3ESW B;  1TWC J;  4A5M A;  1P7I A;  1ZGJ A;  4Q48 A;  2BV6 A;  2MLG A;  1F5T A;  2ZSI B;  1MSE C;  1JHF A;  2VAS A;  1RUN A;  5D4R A;  4HAM A;  3QWL A;  3B02 A;  3BJA A;  4ZC3 A;  1I6X A;  5IOZ A;  5FB2 A;  4AIK A;  1OR7 A;  2Z5U A;  1XSD A;  3JRA A;  1DQU A;  1AWC A;  3ABK H;  1O3T A;  3WGG A;  2RRE A;  1CQT A;  2CV1 A;  3WGI A;  1S29 A;  2MSY A;  2JQ7 A;  1X2N A;  2R7Q A;  4NBQ A;  3V7R A;  1QVU A;  4IHW A;  4DNC A;  3MQ0 A;  3T5X A;  2IGM A;  1W1W E;  3ZP5 A;  2I10 A;  4HNU A;  4CCO A;  2CSO A;  3ZCO A;  1XC5 A;  2CG4 A;  3IRQ A;  2V1U A;  3IUO A;  4XKB A;  3U9G A;  3AL0 B;  1TT0 A;  4E4H A;  2V7F A;  3Q0U A;  2M0C A;  4PGG A;  2E2I J;  1UZC A;  2LVS A;  3HHG A;  2W82 A;  5CQE A;  5FJ8 J;  1TQP A;  2MBF A;  4V19 K;  3KYD B;  5B66 C;  4UY8 I;  2R92 J;  3BTJ A;  3VEP A;  1SC7 A;  1B72 B;  2DI3 A;  3MVP A;  2Q2E A;  3OYM A;  1TT5 B;  2M9H A;  3GXO A;  2JJ7 A;  3I59 A;  4XN3 A;  4EJO A;  5HLH A;  3BR2 A;  2R5Z B;  2W84 A;  1K6O A;  2VB6 A;  1B8I B;  4L9V A;  5E20 A;  3RTR A;  1USS A;  1K79 A;  4M74 A;  1OCP A;  2H6B A;  2QGU A;  3KEY A;  1Y1W J;  4NC6 A;  5KNL A;  4C3I J;  3Q0W A;  2L9N A;  4ZYE A;  2KHM A;  5KAI C;  2JSC A;  1BOA A;  3PFI A;  2UWM A;  4C2U A;  4C3J J;  2CV0 A;  3FIW A;  2VJ4 A;  4NHJ A;  3S1Q J;  4BE2 A;  3OYG A;  2VQG A;  1D3Y A;  2BY2 A;  2X1E A;  1I27 A;  1IW7 F;  2L7Z A;  1TW3 A;  3GTJ J;  3M4O J;  2KDO A;  1HW2 A;  1ETO A;  4BEH B;  1KU3 A;  3BPX A;  5D5W B;  4A12 A;  1YFH A;  1X1A A;  1VQ7 I;  2IPQ X;  3OY9 A;  1I1G A;  4MFD A;  4NQW A;  3GTK J;  2G0E A;  4EVI A;  4G6Q A;  4PSW A;  3RQ4 A;  3I9V 2;  5HS7 A;  1HW1 A;  3C18 A;  2FD5 A;  3DBR B;  2OZ6 A;  2QQ8 A;  3GME A;  2XHK A;  2OPT A;  3PNY A;  4LGW A;  3PQK A;  4XRS G;  4P9U A;  1U5T B;  1XDU A;  3K69 A;  1U6G A;  2FQ4 A;  2RV8 A;  1G3S A;  1G3Y A;  2IGO A;  5J4V A;  3Q9V A;  4KUM A;  5L3D A;  3NAR A;  2O6G E;  1H9T A;  3BTC A;  2A6T A;  1WH7 A;  1IXC A;  4EM0 B;  1RR7 A;  1R9T J;  2V79 A;  1IDY A;  2M8E A;  3RZO J;  1I1S A;  1PYV A;  1Y8R B;  5EEA A;  1W5T A;  1ZK8 A;  3OSG A;  2DMU A;  1FEX A;  4MGR A;  4RGR A;  5IP9 J;  5KHD A;  2FUG 2;  5EF6 A;  2CWE A;  1LVK A;  2KL4 A;  3GLX A;  4ZZL A;  1UEL B;  5H2F C;  4HG2 A;  2V26 A;  2E5N A;  2R7X A;  3K6G A;  3GTQ J;  1BJZ A;  3BJ6 A;  1IUF A;  2A05 A;  3CUQ A;  4I01 A;  5E18 F;  3F23 A;  4RBO A;  1R4N B;  3K2A A;  2ELH A;  1D5Y A;  2XAG A;  5DD4 A;  3RSN A;  1OFC X;  1SD7 A;  1E3O C;  2M45 A;  3RZD J;  2NS7 A;  2IGN A;  1TWG J;  1BW6 A;  3HSF A;  1UMQ A;  2HEO A;  2JPC A;  4K2E A;  3TL4 X;  2HS5 A;  1BR1 A;  2R5Z A;  4XID A;  1MNE A;  2HOS A;  3M07 A;  3HSE A;  1LVA A;  2BW3 B;  5L3G A;  1GUU A;  4BS9 A;  5EJC A;  2LP0 A;  3PJR A;  3OOP A;  2GOM A;  2M4G A;  1X19 A;  4OAZ A;  1I6H J;  2MD0 A;  1YX3 A;  2LH9 A;  5BMZ A;  3ZQ7 A;  4RM3 A;  3BRO A;  4M71 A;  3L2U A;  4XLP F;  1E0E A;  1KQ0 A;  4A3L J;  3G1O A;  3RCO A;  2WB1 A;  2A68 F;  5FLX K;  4ZJZ A;  3ZN0 A;  5GTH C;  3C2G A;  1GV2 A;  2X85 A;  5BPI A;  2D45 A;  3CF5 F;  3HRU A;  4EJW A;  1YJW I;  4RM2 A;  5HLI A;  2QVO A;  1IDZ A;  2H1K A;  5JFR A;  2Y9Z A;  3RKX A;  1IN8 A;  1MIJ A;  2WB1 N;  3BG6 A;  1GVJ A;  3CLQ A;  5LGN A;  2DK5 A;  2M7A A;  1LDK B;  1YW7 A;  1FP2 A;  2ZC2 A;  2HGC A;  4RLQ A;  4BEH A;  3ULQ B;  2ZJ2 A;  2X1D A;  4I2O A;  3KE2 A;  4BUP A;  1FC3 A;  3F72 A;  3ZQC A;  2JA2 A;  4A3J J;  1W5S A;  1M1E B;  1OPC A;  2MAB A;  2YUS A;  3WTW C;  2UZK A;  1TP4 A;  1TWF J;  2LF8 A;  4UUV A;  5D8K B;  1EH6 A;  2L9S A;  3UR3 C;  3WTY C;  1Z21 A;  1E17 A;  2NAZ A;  1K83 J;  2E34 A;  5F0C A;  4ZYD A;  2V9V A;  3ZGK A;  4HDV A;  1WH5 A;  1KQ8 A;  4XR6 A;  4A5N A;  3BLY A;  2W48 A;  1OLT A;  3HRT A;  3IH4 A;  1YHQ I;  3CTA A;  3JSP A;  1YI2 I;  1XCV A;  1DDN A;  3AG2 H;  2TDX A;  3ABU A;  1QHH D;  2YSR A;  4QIW N;  3SDB A;  2LC2 A;  3GZN B;  3S2W A;  3FX3 A;  4ZTF A;  5CVR A;  1ERD A;  2CFO A;  2F4O B;  3KZY A;  2JVH A;  1CGP A;  3JAM Z;  3G4S I;  2GA1 A;  5FLV A;  2X0L A;  3F6O A;  2Y69 H;  2WWY A;  4PK4 A;  5ERI A;  2IT0 A;  1SVO A;  1R23 A;  3ZR8 X;  1RPW A;  4YEL A;  5ED4 A;  3IL2 A;  2Y0S A;  3L7W A;  3OIQ A;  1QPM A;  4MEX F;  2K02 A;  2VPL A;  3V7C A;  5C3E J;  3ZQG A;  1LFP A;  1Q1V A;  1YIJ I;  2A5Y B;  3IWF A;  2QM3 A;  2R3S A;  1G8X A;  2M1B A;  2VIX A;  3FKJ A;  1MJ9 A;  3LSK A;  4G7H F;  3CO7 C;  5ICC A;  4EGY A;  3IAM 2;  4ASN A;  2R7D A;  1MMA A;  4RAF A;  1WVR A;  4YFX F;  5BQT A;  2L5Q A;  3R0J A;  2E71 A;  1ON2 A;  3P9I A;  2VLA A;  4MQ9 F;  5JI6 A;  5A2Q Z;  1Z05 A;  2KQR A;  2K3F A;  2KFD A;  4XK4 A;  1ENH A;  4I02 A;  3RPU D;  2Y0M A;  3NEU A;  1XGO A;  2F2E A;  2M7B A;  1YTY A;  1VQ4 I;  1OR7 C;  1FYM A;  4U88 A;  2IA2 A;  3F6V A;  2OZU A;  1GV5 A;  5LD2 C;  1H0M A;  5K5Q A;  4LIU A;  2BW3 A;  5JR3 A;  3QPL A;  3QOE A;  1PUE E;  4I76 A;  3OS2 A;  4LOC A;  4MLO A;  2IVM A;  4QWQ A;  3SHF A;  4CGZ A;  2FOK A;  1MJB A;  1GXP A;  2BBY A;  2K9N A;  4QTR A;  1NG6 A;  2CUE A;  3KZI C;  1ZRD A;  2XB0 X;  5F64 A;  3F9K A;  1MBF A;  4A3G J;  2ESN A;  5K7Z A;  2DU9 A;  4BQQ A;  1I3A A;  1IN7 A;  4XRS A;  3IAS 2;  5E3O A;  4CYC B;  4A3F J;  3H9Q A;  4XL9 A;  1Z7L A;  1FBU A;  2VJI A;  4FAS D;  5CLS A;  3V7S A;  1X1C A;  1LUJ B;  1WJA A;  4BAY A;  1B9N A;  2FA5 A;  2MGQ A;  1A6I A;  2HYF A;  3DTE A;  3ECO A;  3OYN A;  4IL6 C;  2DJI A;  1LB2 A;  3KCC A;  5ICG A;  1O3Q A;  3LAP A;  2HKO A;  1HOM A;  1WKM A;  3TKY A;  4A3E J;  2E2J J;  4XRF A;  3FMQ A;  3BCA A;  2BY1 A;  4M72 A;  5DM6 F;  4IPA A;  4P1W A;  2ICW G;  4IO9 F;  1VQ5 I;  4HNV A;  4XM3 A;  1SAU A;  4QLC U;  1FTZ A;  2EWN A;  1WI9 A;  4CH7 A;  2DFH A;  4MEY F;  1WJC A;  2WAF A;  4XKC A;  3CDH A;  2DYR H;  4WWC A;  2VJ5 A;  5JHF A;  4D5F A;  2UUZ A;  2AS5 F;  4CZZ A;  5FD6 A;  3SDG A;  3CJT B;  1IRZ A;  4L9J A;  4OU0 A;  1MBH A;  1IV6 A;  3K2Z A;  3KP5 A;  3BZ6 A;  1BR4 A;  5J8C A;  3CMY A;  2DYS H;  3BR0 A;  4KNY A;  2K7L A;  4B3X A;  3A01 A;  1W4M A;  5B1A H;  2WAE A;  1VQK I;  4GGG A;  1XMK A;  3AKZ A;  2HPM A;  1BW5 A;  4OIO F;  4FTH A;  1XSV A;  2VON A;  1K4S A;  4D0P A;  5LRS A;  2KIM A;  2CH0 A;  5K5O A;  4DQ2 A;  3I56 I;  2P4W A;  1HCR A;  2KRH A;  1QRY A;  4UB8 C;  2W25 A;  3OL4 A;  4F93 B;  4BDY A;  5L3F A;  1XPX A;  1QBJ A;  2DA4 A;  4LB5 A;  4XLC A;  3JRH A;  1UST A;  1R58 A;  1MSF C;  1FT9 A;  5TJJ A;  4RDU A;  3DBH B;  3WU0 A;  2KIS A;  3V8L A;  2NOG A;  2HVR A;  2OV7 A;  3S1N J;  3TP3 A;  4IVN A;  3WTT C;  4WXH A;  4GCV A;  1IJW C;  2J5P A;  2ETH A;  3KLN A;  1D0Y A;  2W1O A;  3GTG J;  1JTY A;  1HKQ A;  5DM7 F;  4G6D A;  2CV2 A;  3OS1 A;  3CD6 I;  3HIF A;  2M30 A;  3KYC B;  3PUF A;  4ZDL A;  1Z7U A;  2YU9 J;  4KIT B;  4PGH A;  3SZP A;  4XBF A;  1XN7 A;  5ILU A;  3S15 J;  1J9I A;  2YU3 A;  3W6J B;  3E1S A;  5BOX A;  2IS2 A;  2ISZ A;  1K61 A;  5HLT A;  4S0H B;  1Y0N A;  4E7J A;  2L9R A;  3CMA I;  4CYC A;  3IC7 A;  4B3A A;  3TDU C;  1O7L A;  2VQH A;  3EQL F;  4L0Y B;  4M6Y A;  4JYK A;  5CQG A;  5TIS C;  2H09 A;  2GXG A;  2JN6 A;  3F8M A;  4YRV A;  1T95 A;  2VE8 A;  4C2T A;  3DU5 A;  2VBY A;  4Y52 J;  1WGX A;  2W4S A;  3TO9 A;  3OYI A;  1DPU A;  4PJ0 C;  1QNT A;  3LL7 A;  3DLA A;  1I39 A;  1JKP C;  2CGP A;  2MW8 A;  2LFB A;  4L9T A;  4HDU A;  1UG0 A;  2X48 A;  3O8H A;  1EJ9 A;  1R1U A;  2RQQ A;  1BI2 A;  2PMH A;  2V1X A;  1OCT C;  3WTU C;  1K4T A;  3HOZ J;  2LY1 A;  5BS6 A;  1SD6 A;  4BXF A;  5M5W J;  1SFU A;  1HLV A;  4GXO A;  2HDW A;  2DMP A;  1B1B A;  1FOY A;  4R8H A;  3CP8 A;  2VBW A;  1RR8 C;  3H3Z A;  2K9Q A;  1Z3Y A;  2WA0 A;  4X6A J;  4LLG F;  5E3N A;  1OCO H;  3AAF A;  5TGT A;  4BHC A;  3S17 J;  1HDP A;  1SAX A;  2NVQ J;  3OYE A;  3M1C A;  5IYB J;  2Y48 A;  1F4K A;  2A3S A;  3WTX C;  4GO1 A;  2DCE A;  2DT6 A;  1S5L C;  4IZZ A;  1DP7 P;  3S3N A;  4YIR X;  3HOX J;  2GAU A;  3S1M J;  3CCJ I;  4PJL A;  2DBB A;  1XGM A;  4N9H A;  1IRF A;  1SD5 A;  4FX4 A;  3VYT B;  4Q5S F;  3H0G J;  5DTD A;  2Y2Z A;  5F0H A;  1EA3 A;  2JSP A;  4O6J A;  1S7E A;  5D5X B;  2DK8 A;  1D1C A;  4IQJ A;  3BOQ A;  2DFI A;  1UFM A;  3FM3 A;  2FXA A;  2LG4 A;  4UUT A;  2HNH A;  2ZB9 A;  4BXX J;  4EM2 A;  2JA5 J;  2OF7 A;  2ZME C;  4A0Y A;  2Q2E B;  1L0O C;  1QU3 A;  2LF7 A;  4B48 A;  3I59 B;  5J1U A;  1N25 A;  2O8X A;  1MBE A;  1LFU P;  1K6Y A;  3J80 Z;  1ZRC A;  2EZI A;  2R7F A;  2IA1 A;  5F27 A;  1ZQ3 P;  1A36 A;  3SFI A;  1G6N A;  2OQR A;  1R49 A;  2FSW A;  4I7H A;  2DOD A;  4BL0 B;  1IF1 A;  1G59 A;  3DQV C;  3ZPL A;  4S05 A;  4II2 A;  5K7H A;  5FRM A;  4BJ5 C;  4LIV A;  2D1H A;  3Q9S A;  1WJD A;  4ESF A;  5J47 A;  4IOA F;  4YEJ A;  5D6F A;  4B8X A;  5IT9 K;  2CW7 A;  2DOF A;  1HC8 A;  1V55 H;  1WJB A;  4NB5 A;  1QVT A;  1D8J A;  3EUK L;  4BNC A;  2E36 A;  3GYH X;  4XOP A;  1SAN A;  2JUC A;  1OMI A;  4AIJ A;  3RDI A;  4LB6 B;  3EYI A;  4ON0 A;  3WOD F;  4KIS A;  4NQW B;  5E1X A;  4A3I J;  3E6D A;  3OYF A;  4RAZ A;  1MBK A;  2L4M A;  3GTO J;  4YFN F;  3B73 A;  4CSW A;  3EUA A;  2EBI A;  2XPV A;  5K7F A;  3MFK A;  2R0Q C;  4BY7 J;  3GUD A;  5EZH A;  5GPA A;  3KP2 A;  4CA0 A;  2DA6 A;  1QHG A;  4HST A;  3ZQH A;  1R1V A;  2RKH A;  1LJ9 A;  4M73 A;  1ODD A;  5AON A;  3HL2 A;  2AHQ A;  1K78 B;  4EAT A;  2LK2 A;  2DA5 A;  5DCM B;  4NDL A;  2IBD A;  3DPL C;  2BGC A;  1VQO I;  2K85 A;  3HOT A;  5E8I A;  3D5R C;  2NNY A;  2GQQ A;  3F21 A;  1DGW Y;  3PSF A;  4PCQ A;  4G7O F;  3I58 A;  2ZXW H;  1RKW A;  4BQO A;  4UUS B;  3RYR A;  4YFK F;  1AKH B;  3GF2 A;  1IZ1 A;  1B6A A;  2OC6 A;  2HZT A;  2L2O A;  2OQG A;  2K86 A;  3K4M A;  5FD5 A;  3C1D A;  3T0Y A;  2RN7 A;  3M8F A;  4M9Z A;  3CUQ B;  1YG2 A;  3TP0 A;  1D1B A;  2XAJ A;  3LA3 A;  3PL8 A;  1FMW A;  2CS3 A;  4M3F A;  1ZYR F;  3HC7 A;  2OTL I;  4BJ6 C;  2K9L A;  1BJA A;  5CYV A;  2H27 A;  1UG2 A;  3DEU A;  1W5C C;  3K4C A;  3GZ5 A;  1O57 A;  2FMY A;  1XCB A;  2ELK A;  3U1D A;  3FHZ A;  1ZH5 A;  4LMY A; 
#chains in the Genus database with same CATH homology
 1WQ2 A;  4WXD A;  3WE2 A;  2O03 A;  1KQ9 A;  2NNN A;  1Y0U A;  4L0Z B;  2ZKZ A;  5EEG A;  3FM5 A;  2MLK A;  3MWM A;  1A04 A;  1J75 A;  3GVA A;  3J81 Z;  5DYM A;  3DFG A;  3QU6 A;  1X3U A;  3BY6 A;  5D4S A;  3H3U A;  1P92 A;  1RIO H;  3BJO A;  1AOY A;  4HA8 A;  2VOO A;  2FU4 A;  4LLN A;  4ESJ A;  4UXN A;  2E7W A;  2P5K A;  3I71 A;  5LHH A;  2JTV A;  4RGS A;  3GFL A;  4BQA A;  2PLY A;  5K1Y A;  1TNT A;  4KIF A;  2EA4 A;  4I0B A;  5HVQ C;  2L4A A;  2P6S A;  4TV7 A;  2Z99 A;  3RKY A;  1YLF A;  2HQN A;  1K78 A;  1S7A A;  4EJU A;  4OMY A;  5DCM A;  4KMF A;  5LEK A;  5ILV A;  3E6B A;  4HF2 A;  3BDD A;  4GYG A;  4RB0 A;  5HS8 A;  2STT A;  1PP8 F;  2L3D A;  5CVV A;  3GW2 A;  2EK5 A;  2JZY A;  4LJZ F;  2G7H A;  1ZRE A;  4A2U A;  3HRS A;  1FPQ A;  5IT3 A;  2XV4 S;  2LKP A;  3HHH A;  3HOS A;  1BIB A;  1B59 A;  2L54 A;  4KYW A;  2DQR A;  5H6R A;  2NS0 A;  1T2K A;  5FFX A;  4I09 A;  3TDZ C;  5DD8 A;  5CVJ A;  3J80 K;  5D8L B;  3ZMV A;  4LG0 B;  3TO6 A;  2WC2 A;  1MKM A;  4Y13 A;  4IF4 A;  3LA2 A;  3RKW A;  2E1N A;  2CQK A;  2XGX A;  3ZMS A;  4CO8 A;  1SFE A;  1C0W A;  2PEX A;  2IP2 A;  2O61 A;  2XRO A;  1HKT A;  2XAH A;  1HKS A;  4HX4 A;  4ENJ A;  2HKX A;  1S7O A;  2VN2 A;  2PQ8 A;  4H0E A;  2A69 F;  2PFB A;  2ESH A;  1PDN C;  2PN6 A;  3J7A O;  5EEH A;  3RPQ A;  3F8C A;  4RS8 A;  4R79 A;  5HLG A;  4HF1 A;  1HST A;  4UVB A;  1V3F A;  4OIR F;  1R36 A;  4I98 B;  2DPD A;  2ZME A;  1XGN A;  3DF8 A;  1E2X A;  3K0L A;  1HBX G;  3I5U A;  1MDM A;  1IN4 A;  4GYI A;  3COA C;  4ZYH A;  1REP C;  4EJT A;  2ZBK A;  1TQI A;  2MA3 A;  3BWG A;  1J2X A;  3D0S A;  1IXS B;  2KIF A;  4A6E A;  2HYG D;  4HX7 A;  3L09 A;  5HDG A;  1R22 A;  2W85 A;  1ZG1 A;  2HR3 A;  4IXA A;  5D6E A;  1LDJ A;  3R6S A;  5BPD A;  2VBZ A;  4HLY A;  1FY7 A;  3W6K B;  3E6M A;  5LRR A;  4B09 A;  2RC4 A;  1T98 A;  1YO5 C;  2O3F A;  4L5J A;  4Z2Y A;  4LK0 F;  3KET A;  1G4D A;  2IA0 A;  3ABT A;  3I54 A;  2EFN A;  1P4X A;  1KU2 A;  4LG0 A;  3RIR A;  1ZG5 A;  1Z6R A;  1FZP B;  5FO5 A;  1GHC A;  1O7F A;  3MEX A;  4KN4 X;  1BI0 A;  3EYY A;  3OV8 A;  4RB1 A;  3GEZ A;  2FEZ A;  4A0Z A;  1BIA A;  3RJP A;  3J81 K;  3T1B A;  1DPR A;  1XB4 A;  3IKT A;  4IHT A;  3K1M A;  3L00 A;  2HTJ A;  3I4P A;  3P7N A;  4ENK A;  4HBL A;  2YR2 A;  2EV6 A;  2V6C A;  3N4M A;  3QPT A;  4PZJ A;  1QO0 D;  2CYY A;  1FLI A;  2VC0 A;  1W7P A;  3V4G A;  2YPR A;  5H20 A;  4UVC A;  1LEA A;  3HSR A;  4OOI A;  3LFK A;  5FFZ A;  4UV8 A;  1FNN A;  1O3S A;  5HDN A;  2FQ3 A;  3LST A;  4Y15 A;  1PP7 U;  2DT5 A;  3WTS C;  2EFP A;  2GA2 A;  5AIQ A;  4XSX F;  2PJP A;  1UHM A;  2XAF A;  1LNW A;  4ESB A;  2ZFW A;  1XD7 A;  3DKW A;  3DXJ F;  5E1W A;  2IRF G;  2G9W A;  2A61 A;  2HWV A;  3KLO A;  2LNB A;  3GWZ A;  2EA2 A;  5HS9 A;  2UXN A;  4FT8 A;  3ECH A;  3LWF A;  3JTG A;  1P4A A;  4LFU A;  2P8T A;  2ZNZ A;  2P5V A;  2DW4 A;  4P96 A;  2QLZ A;  2OU2 A;  4KT5 C;  4P5O A;  2X4H A;  3N97 A;  1TNS A;  3HUG A;  4AWX B;  2VC1 A;  2AXL A;  2F5E A;  3EUH A;  3Q5F A;  4UVA A;  1U8R A;  4EMS A;  1IAW A;  2YX4 A;  4I0A A;  3E5Q A;  1KYW A;  4A6D A;  3VOD A;  4CHU A;  2P5L C;  5CVU A;  2ZNY A;  2PBI A;  4KA4 A;  4G9Y A;  2D1V A;  2FNA A;  1ZAO A;  1BC8 C;  3FMR A;  4G7Z F;  3E97 A;  3T8R A;  1U78 A;  1KYZ A;  1MGT A;  4HOB A;  3FWE A;  1EH7 A;  1RNL A;  3ML6 A;  2QQA A;  2CW0 F;  3KP4 A;  3HRM A;  2XUB A;  3JAM K;  3REO A;  1F1Z A;  4JBA A;  2MC3 A;  4EQQ A;  4BXU A;  4Q47 A;  1T38 A;  2RDP A;  3RYP A;  3WU1 B;  3V8J A;  2GIV A;  1QZY A;  5E8G A;  3R60 A;  4U0Y A;  3KP3 A;  4XSZ F;  4YIF A;  4HQE A;  2FBH A;  2KKO A;  2XIG A;  2A6E F;  5A2Q K;  4KIB A;  2Q0O A;  1YIO A;  2F5C A;  4ZH4 F;  2MH9 A;  2PI0 A;  2STW A;  3JW4 A;  3L2C A;  3HTS B;  4RGX A;  3QP5 A;  3ZMD A;  5JHU A;  1FSE A;  3QPH A;  3HTU A;  3QRF F;  4FX0 A;  3K1N A;  4KIG A;  3NRV A;  5L3B A;  3FZV A;  3ELK A;  2ZO4 A;  1XMA A;  1LQ1 A;  1FBQ A;  1ZHF A;  2RQP A;  3FXU A;  3PQJ A;  2H6C A;  5LHG A;  3R0A A;  1ZRF A;  5LBQ A;  3C3W A;  2FBK A;  3KEO A;  2XRN A;  5H6Q A;  2EJR A;  4HV5 A;  4G8X A;  1EH8 A;  3SXY A;  4CYD A;  4LK1 F;  5HDK A;  1FWZ A;  4F7Z A;  2IW5 A;  4M9X A;  5DV5 A;  3WGH A;  4HW0 A;  1S3J A;  1OYI A;  3F8B A;  3SQN A;  3BPV A;  4RB2 C;  4U7B A;  4HQM A;  4OIP F;  1H9G A;  3QU3 A;  2RGV A;  1T39 A;  3C7J A;  3LQQ A;  2WV0 A;  4FHT A;  4PDK A;  4BH9 A;  3ERE D;  2QEN A;  1Z9C A;  1D8K A;  3DPT A;  3KFW X;  1DUX C;  6PAX A;  3TGN A;  1P2F A;  4IRG A;  1J7K A;  3CLO A;  3EET A;  5L3C A;  3F8F A;  1SMY F;  5F1R A;  4CDG A;  1MZB A;  4XLN F;  2Z9O A;  2L02 A;  3ROU A;  1ZAR A;  1KU9 A;  4U0V A;  2FE3 A;  5K5R A;  2OBP A;  2J5O A;  1MJA A;  4HLX A;  2KJB A;  2JT1 A;  1IUY A;  3M7G A;  2Q8K A;  1BI3 A;  1QGP A;  4MTD A;  1YS7 A;  2RNJ A;  1EV7 A;  5ILS A;  2MH2 A;  2P6T A;  4WF2 A;  1B9M A;  2QQB A;  1OKR A;  1ZN2 A;  5KK1 A;  4O3M A;  1V4R A;  2O0Y A;  3GFJ A;  1BC7 C;  2L01 A;  3U2R A;  2HTS A;  3E6C C;  1WWX A;  1BN5 A;  2QWW A;  2V1D A;  2E7X A;  4IHS A;  1WRJ A;  3MZY A;  5ICE A;  3M1E A;  4MTE A;  4WK8 F;  1QZZ A;  4U0W A;  2BE5 F;  3VB2 A;  1YW8 A;  3LQR A;  2A6H F;  2ZME B;  1J59 A;  1ZLJ A;  1T0F A;  5D5U B;  1MDM B;  3V8K A;  1CF7 A;  2B0L A;  1ON1 A;  4L5I A;  4RGU A;  1YS6 A;  3SFZ A;  2UXX A;  5ICF A;  4P9F A;  1R7J A;  1FOK A;  4YII A;  4BHB A;  5FGM A;  3LAJ A;  4IRH A;  1O3R A;  4OIQ F;  3ZMZ A;  1ULY A;  1ONV A;  2NRA C;  1UCR A;  2XVC A;  2GXB A;  3GFM A;  2XKO A;  3JTH A;  1I5Z A;  3IKV A;  3TO7 A;  4HF0 A;  1HSJ A;  4ETS A;  2Z3Y A;  2VE9 A;  3T8T A;  2LSO A;  2KIU A;  1R1T A;  2KJC A;  4L18 B;  1UHW A;  3G73 A;  1P4W A;  3GFI A;  3DV8 A;  3WG9 A;  5DUI A;  2K4J A;  1ZLK A;  2W57 A;  3L9F A;  4EGZ A;  3H92 A;  1Z6T A;  2QBY B;  1P6R A;  2F5D A;  5F6F A;  1HQC A;  1U2W A;  3CUO A;  2FML A;  1W7P B;  5HOO A;  1G3T A;  2E1C A;  4ENM A;  1OYY A;  1YW9 A;  2ADU A;  3ZMU A;  1RI7 A;  1BI1 A;  2H94 A;  2DLL A;  1KGS A;  5LLQ A;  1U5T A;  3QAH A;  4EJV A;  4L9N A;  5JVT A;  1MD0 A;  1TW2 A;  1JXS A;  2EB7 A;  5KVR A;  1J0R A;  1RZ4 A;  2FBI A;  3E5X A;  3WTZ A;  2XAQ A;  3TQN A;  4RB3 C;  1RUO A;  1BBY A;  3P9K A;  4HV6 A;  2GWR A;  2M87 A;  4WCG A;  2F5F A;  2OA4 A;  3EDP A;  5CVI A;  2K4B A;  3ISP A;  2M5W A;  3MCZ A;  1LEB A;  5E17 F;  3E5U A;  2DPU A;  3R4K A;  4ZZD A;  2FRH A;  3M9A A;  4EM1 A;  2QYO A;  5AIP A;  1OYW A;  3I64 A;  1IN6 A;  2DQL A;  4HYE A;  3RPU A;  2JPB A;  5IT9 Z;  1FX7 A;  3LA7 A;  1W7P D;  1IN5 A;  1Q1H A;  1G3W A;  1J5Y A;  4YG2 F;  1FYL A;  2A07 F;  2P7C B;  1LDD A;  2QBY A;  4HZF A;  3CJN A;  3ZMT A;  1JE8 A;  1F9N A;  4R1H A;  4UV9 A;  1QQI A;  1R5H A;  2YX7 A;  4UNO A;  4ZYG A;  3FXQ A;  3F3X A;  2ISY A;  1BM9 A;  4KN7 X;  5J8F A;  2VXZ A;  2CFX A;  3O3K A;  2NYX A;  3D5L A;  1GXQ A;  4CXF A;  4WX9 A;  1VTN C;  4Q4Z F;  2Y75 A;  3IWZ A;  2VT3 A;  3KZZ A;  2HQR A;  3K9T A;  4WXC A;  2XAS A;  2BEO A;  2VOP A;  2Z33 A;  1UB9 A;  4IJA A;  2FNP A;  5CJ9 A;  2PG4 A;  3MZH A;  5E1Z B;  3TOA A;  3R61 A;  4KDP A;  4AD9 A;  1IRG A;  3KP7 A;  2EFW A;  4Y17 A;  1B4A A;  3F8N A;  1SD4 A;  1HXD A;  2KRF A;  1ZG3 A;  2EFQ A;  4EV0 A;  2JRT A;  3GO5 A;  4MNU A;  1XGS A;  3F22 A;  3SZT A;  4KIC A;  2DTR A;  1IXR C;  3RI4 A;  1KA8 A;  1D5V A;  5DUK A;  4BHP A;  4LD5 A;  1K7A A;  2RVC A;  3CUQ C;  2DAO A;  2LDU A;  4MHG A;  3JSO A;  1STZ A;  2HFH A;  4UHT A;  1TTY A;  4N0B A;  4HX8 A;  2EFO A;  2QQ9 A;  3NQO A;  1TQM A;  2GZW A;  3GZ6 A;  2ZXJ A;  4RAY A;  4S04 A;  4M6X A;  1U3E M;  1XSX A;  4MQV A;  1R5G A;  4IRI A;  2EV0 A;  1TBX A;  2BYV E;  2CO5 A;  2D2W A;  2QUF A;  5DEQ A;  2HDC A;  4OMZ A;  3I53 A;  2XKP A;  1TLH B;  1S6L A;  2P7V B;  1Z91 A;  4P55 A;  5J6X A;  1Z1D A;  3K1P A;  4G94 A;  3TOB A;  1S8N A;  1FSH A;  2C6Y A;  2MD5 A;  5LHI A;  2G7U A;  5TRD A;  3QP6 A;  1XDS A;  2ZCW A;  3G3Z A;  5L3E A;  4JK1 X;  3P9C A;  1YYV A;  1FBS A;  2COM A;  3KEQ A;  4BYY A;  3ZN1 A;  3VOE A;  3M8E A;  3WTV C;  3O2P E;  2K27 A;  1T6S A;  2DO7 A;  4JQF A;  1WSU A;  2VT2 A;  5LEJ A;  4M9S A;  3QOP A;  3FXR A;  1U5T C;  5LGU A;  2OAZ A;  3IHU A;  1SMT A;  5DDG A;  1FP1 D;  2EV5 A;  4LLL A;  3I0T A;  1L3L A;  4O5V A;  4N9I A;  1KU7 A;  4KFC A;  2QZ8 A;  4KMU X;  4U7D A;  1JHH A;  2VBX A;  3GX4 X;  5FLX Z;  5D5V B;  4OIN F;  1JGS A;  1NHA A;  4AIH A;  1HW5 A;  3HYI A;  2WTE A;  5DCF A;  4AVP A;  3FMS A;  4CIC A;  3BP8 A;  1FYK A;  2HOE A;  4E70 A;  1R00 A;  2PMU A;  3KP6 A;  2FF4 A;  2W24 A;  5LGT A;  3E3V A;  2OD5 A;  3CO6 C;  3WE3 A;  3IRR A;  2IJL A;  3VFZ A;  1SFX A;  4A0X A;  2VOD A;  3FF5 A;  1YQA A;  3MAJ A;  4ENN A;  3DP7 A;  2ACJ A;  1ZGA A;  3O6B B;  1CF7 B;  4A5M A;  1ZGJ A;  4Q48 A;  2BV6 A;  2MLG A;  1F5T A;  1JHF A;  1RUN A;  5D4R A;  4HAM A;  3B02 A;  3BJA A;  1I6X A;  5FB2 A;  4AIK A;  1OR7 A;  2Z5U A;  1XSD A;  1AWC A;  1O3T A;  3WGG A;  3WGI A;  1S29 A;  3V7R A;  4DNC A;  3MQ0 A;  3T5X A;  3ZP5 A;  2CSO A;  2CG4 A;  3IRQ A;  2V1U A;  3U9G A;  4PGG A;  3HHG A;  1TQP A;  2MBF A;  3VEP A;  2DI3 A;  2Q2E A;  3GXO A;  3I59 A;  5HLH A;  4EJO A;  1K6O A;  2W84 A;  4L9V A;  5E20 A;  3RTR A;  1USS A;  1K79 A;  4M74 A;  2H6B A;  4ZYE A;  2JSC A;  1BOA A;  3PFI A;  2UWM A;  4NHJ A;  1D3Y A;  1I27 A;  1IW7 F;  1TW3 A;  1HW2 A;  5D5W B;  1KU3 A;  3BPX A;  4A12 A;  1YFH A;  2IPQ X;  1I1G A;  4NQW A;  4EVI A;  4G6Q A;  5HS7 A;  1HW1 A;  3C18 A;  2OZ6 A;  2XHK A;  4LGW A;  3PQK A;  4P9U A;  1U5T B;  1XDU A;  3K69 A;  1U6G A;  2RV8 A;  1G3S A;  1G3Y A;  3Q9V A;  4KUM A;  5L3D A;  2O6G E;  1H9T A;  1IXC A;  4EM0 B;  2V79 A;  2M8E A;  1I1S A;  1W5T A;  4MGR A;  4RGR A;  2CWE A;  3GLX A;  4ZZL A;  3BJ6 A;  3CUQ A;  4I01 A;  5E18 F;  3F23 A;  2ELH A;  2XAG A;  5DD4 A;  1SD7 A;  2M45 A;  3HSF A;  2HEO A;  2JPC A;  4K2E A;  2HS5 A;  3HSE A;  1LVA A;  5L3G A;  3OOP A;  5BMZ A;  3ZQ7 A;  3BRO A;  4M71 A;  4XLP F;  1KQ0 A;  2A68 F;  5FLX K;  3ZN0 A;  2D45 A;  5BPI A;  3HRU A;  4EJW A;  5HLI A;  2QVO A;  5JFR A;  3RKX A;  1IN8 A;  1GVJ A;  5LGN A;  2DK5 A;  1LDK B;  1YW7 A;  1FP2 A;  2HGC A;  3ULQ B;  2ZJ2 A;  4I2O A;  3KE2 A;  1FC3 A;  3F72 A;  1W5S A;  1OPC A;  3WTW C;  2UZK A;  2LF8 A;  4UUV A;  5D8K B;  1EH6 A;  3WTY C;  1E17 A;  2NAZ A;  4ZYD A;  2V9V A;  4HDV A;  1KQ8 A;  4A5N A;  3HRT A;  1DDN A;  3CTA A;  3JSP A;  1XCV A;  2TDX A;  3ABU A;  2YSR A;  3S2W A;  3FX3 A;  5CVR A;  3KZY A;  1CGP A;  3JAM Z;  2GA1 A;  2X0L A;  3F6O A;  2WWY A;  5ERI A;  2IT0 A;  1R23 A;  5ED4 A;  3IL2 A;  3L7W A;  1QPM A;  4MEX F;  2K02 A;  3V7C A;  2A5Y B;  3IWF A;  2QM3 A;  2R3S A;  2M1B A;  4G7H F;  1MJ9 A;  3CO7 C;  5ICC A;  4EGY A;  4ASN A;  2R7D A;  4YFX F;  5BQT A;  3R0J A;  3P9I A;  1ON2 A;  4MQ9 F;  5JI6 A;  5A2Q Z;  1Z05 A;  4I02 A;  2Y0M A;  3NEU A;  1XGO A;  2F2E A;  1YTY A;  1FYM A;  4U88 A;  2IA2 A;  3F6V A;  2OZU A;  1H0M A;  5K5Q A;  5JR3 A;  1PUE E;  4QWQ A;  2IVM A;  3SHF A;  4CGZ A;  2FOK A;  1MJB A;  1GXP A;  2BBY A;  1ZRD A;  5F64 A;  2ESN A;  2DU9 A;  1IN7 A;  1FBU A;  5CLS A;  3V7S A;  4BAY A;  1B9N A;  2FA5 A;  2HYF A;  3ECO A;  1LB2 A;  3KCC A;  5ICG A;  1O3Q A;  3LAP A;  2HKO A;  1WKM A;  3TKY A;  4XRF A;  3FMQ A;  4M72 A;  4IPA A;  4QLC U;  2EWN A;  1WI9 A;  4MEY F;  3CDH A;  4WWC A;  2AS5 F;  4CZZ A;  5FD6 A;  4L9J A;  4OU0 A;  3K2Z A;  3KP5 A;  3BZ6 A;  5J8C A;  4KNY A;  2K7L A;  1W4M A;  4GGG A;  1XMK A;  4OIO F;  1XSV A;  2VON A;  4D0P A;  5LRS A;  2KIM A;  5K5O A;  4DQ2 A;  2P4W A;  2W25 A;  5L3F A;  1QBJ A;  4LB5 A;  1UST A;  1R58 A;  1FT9 A;  5TJJ A;  3WU0 A;  3V8L A;  4IVN A;  3WTT C;  4WXH A;  4GCV A;  2J5P A;  2ETH A;  3KLN A;  1HKQ A;  4G6D A;  3HIF A;  2M30 A;  1Z7U A;  5ILU A;  4PGH A;  3SZP A;  4XBF A;  1XN7 A;  1J9I A;  2YU3 A;  3W6J B;  5BOX A;  2ISZ A;  3IC7 A;  3TDU C;  1O7L A;  3EQL F;  4L0Y B;  4M6Y A;  2H09 A;  2GXG A;  3F8M A;  2VE8 A;  2VBY A;  3TO9 A;  1DPU A;  1QNT A;  2CGP A;  4L9T A;  4HDU A;  1R1U A;  1BI2 A;  2PMH A;  2V1X A;  3WTU C;  5BS6 A;  1SD6 A;  1SFU A;  4GXO A;  1B1B A;  4R8H A;  2VBW A;  3H3Z A;  4LLG F;  3AAF A;  4BHC A;  1SAX A;  2Y48 A;  1F4K A;  2A3S A;  3WTX C;  4GO1 A;  1DP7 P;  2GAU A;  2DBB A;  1XGM A;  4N9H A;  1IRF A;  1SD5 A;  4FX4 A;  4Q5S F;  4O6J A;  5D5X B;  2DK8 A;  3BOQ A;  2DFI A;  1UFM A;  3FM3 A;  2FXA A;  4EM2 A;  4A0Y A;  1L0O C;  2LF7 A;  3I59 B;  2O8X A;  3J80 Z;  1ZRC A;  2R7F A;  2IA1 A;  1G6N A;  2OQR A;  2FSW A;  4I7H A;  1IF1 A;  3ZPL A;  3DQV C;  4S05 A;  2D1H A;  3Q9S A;  4ESF A;  5D6F A;  4B8X A;  5IT9 K;  1D8J A;  4NB5 A;  4BNC A;  3GYH X;  1OMI A;  4AIJ A;  3RDI A;  4LB6 B;  3EYI A;  4ON0 A;  3WOD F;  5E1X A;  3E6D A;  4RAZ A;  2L4M A;  4YFN F;  3B73 A;  3MFK A;  3GUD A;  3KP2 A;  1R1V A;  2RKH A;  1LJ9 A;  4M73 A;  1ODD A;  5AON A;  1K78 B;  5DCM B;  3DPL C;  2BGC A;  3HOT A;  5E8I A;  2NNY A;  2GQQ A;  3F21 A;  4PCQ A;  4G7O F;  3I58 A;  3RYR A;  4YFK F;  3GF2 A;  1IZ1 A;  1B6A A;  2HZT A;  2OQG A;  2K86 A;  5FD5 A;  3C1D A;  3T0Y A;  2RN7 A;  3M8F A;  4M9Z A;  3CUQ B;  1YG2 A;  2XAJ A;  3LA3 A;  1ZYR F;  2H27 A;  1BJA A;  5CYV A;  3DEU A;  3GZ5 A;  1O57 A;  2FMY A;  1XCB A;  3U1D A;  3FHZ A;  1ZH5 A;  4LMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...