2FBQA

The crystal structure of transcriptional regulator pa3006
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
213
structure length
213
Chain Sequence
AQSETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFLGPFCASLEKELDRRQAKPEAQHATLEDLLHLLVSQAMAVKPRSGNDLSIFMRLLGLAFSQSQGHLRKYLEEVYGKVFRRYMLLVNEAAPKLPPIELFWRVHFMLGAAAFSMSGIKALRAMAETDFGVNTSTEQVMHLMVPFFAAGMRAESGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of transcriptional regulator PA3006
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
molecule keywords probable transcriptional regulator
total genus 88
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fbqA00
5FKOA 5GPCA 1JTYA 2O7TA 3B6CA 3ON2A 5D19A 4D7MA 3VVXA 2QOPA 2NS8A 4JKZA 5FGLA 2XPUA 3NRGA 5K7HA 5F1JA 2DG8A 5GP9A 3HTAA 2F07A 3BTJA 1JTXA 3IH3A 5HSZA 1QVUA 2ID6A 2IEKA 4AC6A 3BHQA 2XPVA 3AQSA 4AF5A 5IOZA 3KZ9A 2GBYA 5FKLA 2NS7A 3VPRA 3G56A 5CW8A 2XB5A 3IH4A 3NNRA 5FKNA 3IH2A 4JNNA 5EZHA 5F04A 3QKXA 3KNWA 3RH2A 2NP5A 5K7FA 4M3BA 3BR2A 2TRTA 3BQYA 2PBXA 5F08A 5K7ZA 2ZB9A 5FKMA 4DW6A 2TCTA 2Q24A 4B3AA 2QTQA 4JYKA 1RKTA 2FBQA 3VIBA 2FD5A 5EYRA 2ZOZA 1Z0XA 2G3BA 2EH3A 3CCYA 5H9TA 2ZCMA 2NX4A 3NI7A 4YZEA 3SFIA 3LWJA 3TP0A 3BTIA 4M3DA 1JUPA 5GPAA 2UXPA 3VOXA 4GCKA 2W53A 2HKUA 3B81A 3E7QA 3HGGA 3FIWA 3ANGA 3QPLA 2FJ1A 2OERA 3QQAA 3ZQIA 1ZKGA 3CRJA 3BTCA 4NELA 3S5RA 3VW0A 3G1MA 2X6OA 3KKDA 2ZCNA 3KKCA 4M3FA 3ZQLA 3HTHA 4I6ZA 4MO7A 3EUPA 3G7RA 4L62A 3O8HA 3VVZA 3AQTA 5D18A 2IAIA 2JK3A 2JJ7A 2RASA 4D7NA 3COLA 4W97A 4ACIA 3MNLA 1QPIA 2NP3A 3SDGA 1ORKA 2YVHA 2XDNA 3LSRA 3GZIA 1RPWA 4B1RA 5DAJA 2HYTA 4ABZA 4XK4A 3BTLA 3O8GA 4G12A 3VW1A 2OF7A 4GCLA 2GUHA 3FK6A 3VW2A 3BNIA 3PM1A 3QPSA 5FMPA 1JUMA 3GEUA 5C4YA 1T56A 3HTJA 3WHBA 3EGQA 2HXIA 4MXMA 2XPWA 3G1LA 3BR6A 5HBUA 4ICHA 3PPBA 5CXIA 3CJDA 4GFLA 4I76A 5J1RA 1Z77A 2O7OA 1U9NA 4JL3A 4GCTA 3CWRA 3HIMA 5D1RA 5F27A 3B6AA 5J1YA 3Q3SA 2WGBA 2VKEA 2IU5A 2OPTA 1BJZA 3BQZA 1VI0A 3NPIA 2V57A 2XRLA 4KWAA 3HGYA 2G7LA 2VKVA 5F0FA 3LHQA 2UXHA 5IOYA 2IBDA 1QVTA 3ANPA 2XGDA 2HYJA 3LSPA 4AC0A 2QCOA 5F0CA 2X9DA 2GENA 1RKWA 3HTIA 2QIBA 5IP6A 3ZQHA 2D6YA 3F1BA 3Q0WA 3MVPA 2PZ9A 2HQ5A 1A6IA 3ON4A 1U9OA 2HXOA 3BR3A 2G7GA 5J3LA 4AUXA 1UI6A 5EZGA 3CDLA 3G1OA 3IUVA 3TP3A 3VUQA 3P9TA 2XGEA 2FQ4A 2Y31A 2FX0A 3BCGA 4M3GA 5AQCA 3V6GA 5F0HA 4GFKA 2ID3A 2G0EA 2QKOA 4CGRA 2ZOYA 2RAEA 2YVEA 4V2FA 3QBMA 3FRQA 5K58A 3O60A 4MK6A 2G7SA 2Y2ZA 1SGMA 3RD3A 3PASA 3BT9A 3LJLA 1JT6A 3C2BA 3HE0A 2DTZA 4X1EA 3LSJA 5CXGA 3V78A 5IPAA 3C07A 2RHAA 2WV1A 3FK7A 3NXCA 4HKUA 5FKKA 3BRUA 2Y30A 4D5FA 3BJBA 3DPJA 3VP5A 2WUIA 3LOCA 3DEWA 4M3EA 5HAWA 3BR0A 2VPRA 1UI5A 1ZK8A 4V2GA 4UDSA 4NN1A 3Q0VA 2OI8A 2ZCXA 4W1UA 3WHCA 5J1UA 5EFYA 1T33A 3VVYA 2I10A 3T6NA 1JUSA 3VOKA 2XGCA 4PXIA 1JT0A 3ZQGA 4D5CA 2REKA 2UXUA 3DCFA 2UXIA 3F0CA 4ME9A 3JSJA 3BR1A 5FHPA 2QWTA 3ZQFA 2GFNA 2DG7A 3BR5A 2UXOA 3Q0UA
chains in the Genus database with same CATH superfamily
5FKOA 5GPCA 1JTYA 2O7TA 3B6CA 3ON2A 3K8PC 5D19A 4D7MA 4U9NA 3VVXA 2QOPA 2NS8A 4JKZA 5FGLA 2XPUA 3NRGA 5K7HA 5F1JA 2DG8A 5GP9A 3HTAA 2F07A 3BTJA 1JTXA 3IH3A 5HSZA 1QVUA 2ID6A 2IEKA 4AC6A 3BHQA 2XPVA 3AQSA 4AF5A 5IOZA 3KZ9A 2GBYA 5FKLA 2NS7A 3VPRA 3G56A 5CW8A 2XB5A 3IH4A 3NNRA 5FKNA 2B1EA 3IH2A 4JNNA 3KYLA 4WIBA 5EZHA 5F04A 3QKXA 3KNWA 3RH2A 2NP5A 5K7FA 4M3BA 3BR2A 4OD4A 2TRTA 3VTIA 3BQYA 2PBXA 5F08A 5K7ZA 2ZB9A 5FKMA 4DW6A 2TCTA 2Q24A 4B3AA 2QTQA 4JYKA 1RKTA 2R7SA 2FBQA 3VIBA 2FD5A 5EYRA 2ZOZA 1Z0XA 2G3BA 2EH3A 3CCYA 5H9TA 2R7TA 2ZCMA 2NX4A 3NI7A 4YZEA 3SFIA 3LWJA 3TP0A 3BTIA 4M3DA 1JUPA 5GPAA 2UXPA 3VOXA 4GCKA 2W53A 2HKUA 3B81A 3E7QA 3HGGA 3FIWA 3ANGA 3QPLA 2FJ1A 2FJI1 2OERA 3QQAA 3NS4A 1ZKGA 3ZQIA 3CRJA 3BTCA 4NELA 3S5RA 3VW0A 3G1MA 2X6OA 3KKDA 2ZCNA 3DU6A 3KKCA 4M3FA 3ZQLA 3HTHA 4I6ZA 4MO7A 3EUPA 2R7OA 3G7RA 4L62A 3O8HA 3VVZA 3AQTA 5D18A 2IAIA 2JK3A 2JJ7A 2RASA 4D7NA 3COLA 4W97A 4ACIA 2A2FX 3MNLA 1QPIA 2NP3A 3SDGA 1ORKA 2YVHA 2XDNA 3LSRA 3GZIA 1RPWA 4B1RA 5DAJA 2HYTA 4ABZA 4XK4A 3BTLA 2R7VA 3O8GA 4G12A 3VW1A 2R7WA 2OF7A 4GCLA 2GUHA 2B3WA 3FK6A 3VW2A 3BNIA 3PM1A 3QPSA 5FMPA 1JUMA 3GEUA 5C4YA 1T56A 3HTJA 3WHBA 3EGQA 2HXIA 4MXMA 2XPWA 4IRVA 3G1LA 3BR6A 5HBUA 4ICHA 3PPBA 2PFVA 5CXIA 3CJDA 4GFLA 4I76A 5J1RA 1Z77A 2O7OA 2R7QA 1U9NA 4JL3A 4GCTA 3CWRA 3HIMA 5D1RA 5F27A 3B6AA 5J1YA 3Q3SA 2WGBA 2VKEA 4DVYP 2IU5A 2OPTA 1BJZA 3BQZA 1VI0A 3NPIA 2V57A 2XRLA 4KWAA 3HGYA 2G7LA 2VKVA 5F0FA 3LHQA 2UXHA 5IOYA 2IBDA 1QVTA 3ANPA 2XGDA 2HYJA 3LSPA 4AC0A 2QCOA 5F0CA 2YVXA 2X9DA 2GENA 1RKWA 3HTIA 2QIBA 5IP6A 3ZQHA 2D6YA 3F1BA 3Q0WA 3MVPA 2PZ9A 2HQ5A 1A6IA 4U9LA 3ON4A 1U9OA 2HXOA 3BR3A 2G7GA 5J3LA 4AUXA 1UI6A 5EZGA 3CDLA 3G1OA 3IUVA 3TP3A 3VUQA 3P9TA 2XGEA 2FQ4A 2Y31A 2R7UA 4C2MA 2FX0A 3BCGA 4M3GA 5AQCA 3V6GA 5F0HA 4GFKA 2ID3A 2G0EA 2QKOA 4CGRA 2ZOYA 2RAEA 2YVEA 4V2FA 3QBMA 3FRQA 5K58A 3O60A 4MK6A 2G7SA 2Y2ZA 1SGMA 3RD3A 3PASA 3BT9A 3LJLA 1JT6A 3C2BA 3HE0A 2DTZA 4X1EA 5CQGA 3LSJA 5CXGA 3V78A 5IPAA 3C07A 2R7XA 2RHAA 2WV1A 3FK7A 3NXCA 4HKUA 5FKKA 3BRUA 2Y30A 4D5FA 3BJBA 3DPJA 3VP5A 2WUIA 3LOCA 3DEWA 3DU5A 4M3EA 5HAWA 3FHNA 3BR0A 2VPRA 1UI5A 1ZK8A 4OD5A 4V2GA 4UDSA 3SWHA 4NN1A 3Q0VA 2OI8A 2ZCXA 4W1UA 3WHCA 5J1UA 5EFYA 1T33A 3VVYA 2I10A 3T6NA 2ZY9A 1JUSA 3VOKA 2XGCA 4PXIA 1JT0A 3ZQGA 4D5CA 2REKA 2UXUA 3DCFA 2UXIA 3F0CA 4ME9A 3JSJA 2R7RA 3BR1A 5FHPA 2QWTA 3ZQFA 2GFNA 2DG7A 3BR5A 2UXOA 3Q0UA
chains in the Genus database with same CATH topology
5FKOA 5GPCA 1JTYA 2O7TA 3B6CA 3ON2A 5D19A 4D7MA 3VVXA 2QOPA 2NS8A 4JKZA 5FGLA 2XPUA 3NRGA 5K7HA 5F1JA 2DG8A 5GP9A 3HTAA 2F07A 3BTJA 1JTXA 3IH3A 5HSZA 1QVUA 2ID6A 2IEKA 4AC6A 3BHQA 2XPVA 3AQSA 4AF5A 5IOZA 3KZ9A 2GBYA 5FKLA 2NS7A 3VPRA 3G56A 5CW8A 2XB5A 3IH4A 3NNRA 5FKNA 3IH2A 4JNNA 5EZHA 5F04A 3QKXA 3KNWA 3RH2A 2NP5A 5K7FA 4M3BA 3BR2A 2TRTA 3BQYA 2PBXA 5F08A 5K7ZA 2ZB9A 5FKMA 4DW6A 2TCTA 2Q24A 4B3AA 2QTQA 4JYKA 1RKTA 2FBQA 3VIBA 2FD5A 5EYRA 2ZOZA 1Z0XA 2G3BA 2EH3A 3CCYA 5H9TA 2ZCMA 2NX4A 3NI7A 4YZEA 3SFIA 3LWJA 3TP0A 3BTIA 4M3DA 1JUPA 5GPAA 2UXPA 3VOXA 4GCKA 2W53A 2HKUA 3B81A 3E7QA 3HGGA 3FIWA 3ANGA 3QPLA 2FJ1A 2OERA 3QQAA 3ZQIA 1ZKGA 3CRJA 3BTCA 4NELA 3S5RA 3VW0A 3G1MA 2X6OA 3KKDA 2ZCNA 3KKCA 4M3FA 3ZQLA 3HTHA 4I6ZA 4MO7A 3EUPA 3G7RA 4L62A 3O8HA 3VVZA 3AQTA 5D18A 2IAIA 2JK3A 2JJ7A 2RASA 4D7NA 3COLA 4W97A 4ACIA 3MNLA 1QPIA 2NP3A 3SDGA 1ORKA 2YVHA 2XDNA 3LSRA 3GZIA 1RPWA 4B1RA 5DAJA 2HYTA 4ABZA 4XK4A 3BTLA 3O8GA 4G12A 3VW1A 2OF7A 4GCLA 2GUHA 3FK6A 3VW2A 3BNIA 3PM1A 3QPSA 5FMPA 1JUMA 3GEUA 5C4YA 1T56A 3HTJA 3WHBA 3EGQA 2HXIA 4MXMA 2XPWA 3G1LA 3BR6A 5HBUA 4ICHA 3PPBA 5CXIA 3CJDA 4GFLA 4I76A 5J1RA 1Z77A 2O7OA 1U9NA 4JL3A 4GCTA 3CWRA 3HIMA 5D1RA 5F27A 3B6AA 5J1YA 3Q3SA 2WGBA 2VKEA 2IU5A 2OPTA 1BJZA 3BQZA 1VI0A 3NPIA 2V57A 2XRLA 4KWAA 3HGYA 2G7LA 2VKVA 5F0FA 3LHQA 2UXHA 5IOYA 2IBDA 1QVTA 3ANPA 2XGDA 2HYJA 3LSPA 4AC0A 2QCOA 5F0CA 2X9DA 2GENA 1RKWA 3HTIA 2QIBA 5IP6A 3ZQHA 2D6YA 3F1BA 3Q0WA 3MVPA 2PZ9A 2HQ5A 1A6IA 3ON4A 1U9OA 2HXOA 3BR3A 2G7GA 5J3LA 4AUXA 1UI6A 5EZGA 3CDLA 3G1OA 3IUVA 3TP3A 3VUQA 3P9TA 2XGEA 2FQ4A 2Y31A 2FX0A 3BCGA 4M3GA 5AQCA 3V6GA 5F0HA 4GFKA 2ID3A 2G0EA 2QKOA 4CGRA 2ZOYA 2RAEA 2YVEA 4V2FA 3QBMA 3FRQA 5K58A 3O60A 4MK6A 2G7SA 2Y2ZA 1SGMA 3RD3A 3PASA 3BT9A 3LJLA 1JT6A 3C2BA 3HE0A 2DTZA 4X1EA 3LSJA 5CXGA 3V78A 5IPAA 3C07A 2RHAA 2WV1A 3FK7A 3NXCA 4HKUA 5FKKA 3BRUA 2Y30A 4D5FA 3BJBA 3DPJA 3VP5A 2WUIA 3LOCA 3DEWA 4M3EA 5HAWA 3BR0A 2VPRA 1UI5A 1ZK8A 4V2GA 4UDSA 4NN1A 3Q0VA 2OI8A 2ZCXA 4W1UA 3WHCA 5J1UA 5EFYA 1T33A 3VVYA 2I10A 3T6NA 1JUSA 3VOKA 2XGCA 4PXIA 1JT0A 3ZQGA 4D5CA 2REKA 2UXUA 3DCFA 2UXIA 3F0CA 4ME9A 3JSJA 3BR1A 5FHPA 2QWTA 3ZQFA 2GFNA 2DG7A 3BR5A 2UXOA 3Q0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKO A;  5GPC A;  1JTY A;  2O7T A;  3B6C A;  3ON2 A;  5D19 A;  4D7M A;  3VVX A;  2QOP A;  2NS8 A;  4JKZ A;  5FGL A;  2XPU A;  3NRG A;  5K7H A;  5F1J A;  2DG8 A;  5GP9 A;  3HTA A;  2F07 A;  3BTJ A;  1JTX A;  3IH3 A;  5HSZ A;  1QVU A;  2ID6 A;  2IEK A;  4AC6 A;  3BHQ A;  2XPV A;  3AQS A;  4AF5 A;  5IOZ A;  3KZ9 A;  2GBY A;  5FKL A;  2NS7 A;  3VPR A;  3G56 A;  5CW8 A;  2XB5 A;  3IH4 A;  3NNR A;  5FKN A;  3IH2 A;  4JNN A;  5EZH A;  5F04 A;  3QKX A;  3KNW A;  3RH2 A;  2NP5 A;  5K7F A;  4M3B A;  3BR2 A;  2TRT A;  3BQY A;  2PBX A;  5F08 A;  5K7Z A;  2ZB9 A;  5FKM A;  4DW6 A;  2TCT A;  2Q24 A;  4B3A A;  2QTQ A;  4JYK A;  1RKT A;  2FBQ A;  3VIB A;  2FD5 A;  5EYR A;  2ZOZ A;  1Z0X A;  2G3B A;  2EH3 A;  3CCY A;  5H9T A;  2ZCM A;  2NX4 A;  3NI7 A;  4YZE A;  3SFI A;  3LWJ A;  3TP0 A;  3BTI A;  4M3D A;  1JUP A;  5GPA A;  2UXP A;  3VOX A;  4GCK A;  2W53 A;  2HKU A;  3B81 A;  3E7Q A;  3HGG A;  3FIW A;  3ANG A;  3QPL A;  2FJ1 A;  2OER A;  3QQA A;  3ZQI A;  1ZKG A;  3CRJ A;  3BTC A;  4NEL A;  3S5R A;  3VW0 A;  3G1M A;  2X6O A;  3KKD A;  2ZCN A;  3KKC A;  4M3F A;  3ZQL A;  3HTH A;  4I6Z A;  4MO7 A;  3EUP A;  3G7R A;  4L62 A;  3O8H A;  3VVZ A;  3AQT A;  5D18 A;  2IAI A;  2JK3 A;  2JJ7 A;  2RAS A;  4D7N A;  3COL A;  4W97 A;  4ACI A;  3MNL A;  1QPI A;  2NP3 A;  3SDG A;  1ORK A;  2YVH A;  2XDN A;  3LSR A;  3GZI A;  1RPW A;  4B1R A;  5DAJ A;  2HYT A;  4ABZ A;  4XK4 A;  3BTL A;  3O8G A;  4G12 A;  3VW1 A;  2OF7 A;  4GCL A;  2GUH A;  3FK6 A;  3VW2 A;  3BNI A;  3PM1 A;  3QPS A;  5FMP A;  1JUM A;  3GEU A;  5C4Y A;  1T56 A;  3HTJ A;  3WHB A;  3EGQ A;  2HXI A;  4MXM A;  2XPW A;  3G1L A;  3BR6 A;  5HBU A;  4ICH A;  3PPB A;  5CXI A;  3CJD A;  4GFL A;  4I76 A;  5J1R A;  1Z77 A;  2O7O A;  1U9N A;  4JL3 A;  4GCT A;  3CWR A;  3HIM A;  5D1R A;  5F27 A;  3B6A A;  5J1Y A;  3Q3S A;  2WGB A;  2VKE A;  2IU5 A;  2OPT A;  1BJZ A;  3BQZ A;  1VI0 A;  3NPI A;  2V57 A;  2XRL A;  4KWA A;  3HGY A;  2G7L A;  2VKV A;  5F0F A;  3LHQ A;  2UXH A;  5IOY A;  2IBD A;  1QVT A;  3ANP A;  2XGD A;  2HYJ A;  3LSP A;  4AC0 A;  2QCO A;  5F0C A;  2X9D A;  2GEN A;  1RKW A;  3HTI A;  2QIB A;  5IP6 A;  3ZQH A;  2D6Y A;  3F1B A;  3Q0W A;  3MVP A;  2PZ9 A;  2HQ5 A;  1A6I A;  3ON4 A;  1U9O A;  2HXO A;  3BR3 A;  2G7G A;  5J3L A;  4AUX A;  1UI6 A;  5EZG A;  3CDL A;  3G1O A;  3IUV A;  3TP3 A;  3VUQ A;  3P9T A;  2XGE A;  2FQ4 A;  2Y31 A;  2FX0 A;  3BCG A;  4M3G A;  5AQC A;  3V6G A;  5F0H A;  4GFK A;  2ID3 A;  2G0E A;  2QKO A;  4CGR A;  2ZOY A;  2RAE A;  2YVE A;  4V2F A;  3QBM A;  3FRQ A;  5K58 A;  3O60 A;  4MK6 A;  2G7S A;  2Y2Z A;  1SGM A;  3RD3 A;  3PAS A;  3BT9 A;  3LJL A;  1JT6 A;  3C2B A;  3HE0 A;  2DTZ A;  4X1E A;  3LSJ A;  5CXG A;  3V78 A;  5IPA A;  3C07 A;  2RHA A;  2WV1 A;  3FK7 A;  3NXC A;  4HKU A;  5FKK A;  3BRU A;  2Y30 A;  4D5F A;  3BJB A;  3DPJ A;  3VP5 A;  2WUI A;  3LOC A;  3DEW A;  4M3E A;  5HAW A;  3BR0 A;  2VPR A;  1UI5 A;  1ZK8 A;  4V2G A;  4UDS A;  4NN1 A;  3Q0V A;  2OI8 A;  2ZCX A;  4W1U A;  3WHC A;  5J1U A;  5EFY A;  1T33 A;  3VVY A;  2I10 A;  3T6N A;  1JUS A;  3VOK A;  2XGC A;  4PXI A;  1JT0 A;  3ZQG A;  4D5C A;  2REK A;  2UXU A;  3DCF A;  2UXI A;  3F0C A;  4ME9 A;  3JSJ A;  3BR1 A;  5FHP A;  2QWT A;  3ZQF A;  2GFN A;  2DG7 A;  3BR5 A;  2UXO A;  3Q0U A; 
#chains in the Genus database with same CATH topology
 5FKO A;  5GPC A;  1JTY A;  2O7T A;  3B6C A;  3ON2 A;  3K8P C;  5D19 A;  4D7M A;  4U9N A;  3VVX A;  2QOP A;  2NS8 A;  4JKZ A;  5FGL A;  2XPU A;  3NRG A;  5K7H A;  5F1J A;  2DG8 A;  5GP9 A;  3HTA A;  2F07 A;  3BTJ A;  1JTX A;  3IH3 A;  5HSZ A;  1QVU A;  2ID6 A;  2IEK A;  4AC6 A;  3BHQ A;  2XPV A;  3AQS A;  4AF5 A;  5IOZ A;  3KZ9 A;  2GBY A;  5FKL A;  2NS7 A;  3VPR A;  3G56 A;  5CW8 A;  2XB5 A;  3IH4 A;  3NNR A;  5FKN A;  2B1E A;  3IH2 A;  4JNN A;  3KYL A;  4WIB A;  5EZH A;  5F04 A;  3QKX A;  3KNW A;  3RH2 A;  2NP5 A;  5K7F A;  4M3B A;  3BR2 A;  4OD4 A;  2TRT A;  3VTI A;  3BQY A;  2PBX A;  5F08 A;  5K7Z A;  2ZB9 A;  5FKM A;  4DW6 A;  2TCT A;  2Q24 A;  4B3A A;  2QTQ A;  4JYK A;  1RKT A;  2R7S A;  2FBQ A;  3VIB A;  2FD5 A;  5EYR A;  2ZOZ A;  1Z0X A;  2G3B A;  2EH3 A;  3CCY A;  5H9T A;  2R7T A;  2ZCM A;  2NX4 A;  3NI7 A;  4YZE A;  3SFI A;  3LWJ A;  3TP0 A;  3BTI A;  4M3D A;  1JUP A;  5GPA A;  2UXP A;  3VOX A;  4GCK A;  2W53 A;  2HKU A;  3B81 A;  3E7Q A;  3HGG A;  3FIW A;  3ANG A;  3QPL A;  2FJ1 A;  2FJI 1;  2OER A;  3QQA A;  3NS4 A;  1ZKG A;  3ZQI A;  3CRJ A;  3BTC A;  4NEL A;  3S5R A;  3VW0 A;  3G1M A;  2X6O A;  3KKD A;  2ZCN A;  3DU6 A;  3KKC A;  4M3F A;  3ZQL A;  3HTH A;  4I6Z A;  4MO7 A;  3EUP A;  2R7O A;  3G7R A;  4L62 A;  3O8H A;  3VVZ A;  3AQT A;  5D18 A;  2IAI A;  2JK3 A;  2JJ7 A;  2RAS A;  4D7N A;  3COL A;  4W97 A;  4ACI A;  2A2F X;  3MNL A;  1QPI A;  2NP3 A;  3SDG A;  1ORK A;  2YVH A;  2XDN A;  3LSR A;  3GZI A;  1RPW A;  4B1R A;  5DAJ A;  2HYT A;  4ABZ A;  4XK4 A;  3BTL A;  2R7V A;  3O8G A;  4G12 A;  3VW1 A;  2R7W A;  2OF7 A;  4GCL A;  2GUH A;  2B3W A;  3FK6 A;  3VW2 A;  3BNI A;  3PM1 A;  3QPS A;  5FMP A;  1JUM A;  3GEU A;  5C4Y A;  1T56 A;  3HTJ A;  3WHB A;  3EGQ A;  2HXI A;  4MXM A;  2XPW A;  4IRV A;  3G1L A;  3BR6 A;  5HBU A;  4ICH A;  3PPB A;  2PFV A;  5CXI A;  3CJD A;  4GFL A;  4I76 A;  5J1R A;  1Z77 A;  2O7O A;  2R7Q A;  1U9N A;  4JL3 A;  4GCT A;  3CWR A;  3HIM A;  5D1R A;  5F27 A;  3B6A A;  5J1Y A;  3Q3S A;  2WGB A;  2VKE A;  4DVY P;  2IU5 A;  2OPT A;  1BJZ A;  3BQZ A;  1VI0 A;  3NPI A;  2V57 A;  2XRL A;  4KWA A;  3HGY A;  2G7L A;  2VKV A;  5F0F A;  3LHQ A;  2UXH A;  5IOY A;  2IBD A;  1QVT A;  3ANP A;  2XGD A;  2HYJ A;  3LSP A;  4AC0 A;  2QCO A;  5F0C A;  2YVX A;  2X9D A;  2GEN A;  1RKW A;  3HTI A;  2QIB A;  5IP6 A;  3ZQH A;  2D6Y A;  3F1B A;  3Q0W A;  3MVP A;  2PZ9 A;  2HQ5 A;  1A6I A;  4U9L A;  3ON4 A;  1U9O A;  2HXO A;  3BR3 A;  2G7G A;  5J3L A;  4AUX A;  1UI6 A;  5EZG A;  3CDL A;  3G1O A;  3IUV A;  3TP3 A;  3VUQ A;  3P9T A;  2XGE A;  2FQ4 A;  2Y31 A;  2R7U A;  4C2M A;  2FX0 A;  3BCG A;  4M3G A;  5AQC A;  3V6G A;  5F0H A;  4GFK A;  2ID3 A;  2G0E A;  2QKO A;  4CGR A;  2ZOY A;  2RAE A;  2YVE A;  4V2F A;  3QBM A;  3FRQ A;  5K58 A;  3O60 A;  4MK6 A;  2G7S A;  2Y2Z A;  1SGM A;  3RD3 A;  3PAS A;  3BT9 A;  3LJL A;  1JT6 A;  3C2B A;  3HE0 A;  2DTZ A;  4X1E A;  5CQG A;  3LSJ A;  5CXG A;  3V78 A;  5IPA A;  3C07 A;  2R7X A;  2RHA A;  2WV1 A;  3FK7 A;  3NXC A;  4HKU A;  5FKK A;  3BRU A;  2Y30 A;  4D5F A;  3BJB A;  3DPJ A;  3VP5 A;  2WUI A;  3LOC A;  3DEW A;  3DU5 A;  4M3E A;  5HAW A;  3FHN A;  3BR0 A;  2VPR A;  1UI5 A;  1ZK8 A;  4OD5 A;  4V2G A;  4UDS A;  3SWH A;  4NN1 A;  3Q0V A;  2OI8 A;  2ZCX A;  4W1U A;  3WHC A;  5J1U A;  5EFY A;  1T33 A;  3VVY A;  2I10 A;  3T6N A;  2ZY9 A;  1JUS A;  3VOK A;  2XGC A;  4PXI A;  1JT0 A;  3ZQG A;  4D5C A;  2REK A;  2UXU A;  3DCF A;  2UXI A;  3F0C A;  4ME9 A;  3JSJ A;  2R7R A;  3BR1 A;  5FHP A;  2QWT A;  3ZQF A;  2GFN A;  2DG7 A;  3BR5 A;  2UXO A;  3Q0U A; 
#chains in the Genus database with same CATH homology
 5FKO A;  5GPC A;  1JTY A;  2O7T A;  3B6C A;  3ON2 A;  5D19 A;  4D7M A;  3VVX A;  2QOP A;  2NS8 A;  4JKZ A;  5FGL A;  2XPU A;  3NRG A;  5K7H A;  5F1J A;  2DG8 A;  5GP9 A;  3HTA A;  2F07 A;  3BTJ A;  1JTX A;  3IH3 A;  5HSZ A;  1QVU A;  2ID6 A;  2IEK A;  4AC6 A;  3BHQ A;  2XPV A;  3AQS A;  4AF5 A;  5IOZ A;  3KZ9 A;  2GBY A;  5FKL A;  2NS7 A;  3VPR A;  3G56 A;  5CW8 A;  2XB5 A;  3IH4 A;  3NNR A;  5FKN A;  3IH2 A;  4JNN A;  5EZH A;  5F04 A;  3QKX A;  3KNW A;  3RH2 A;  2NP5 A;  5K7F A;  4M3B A;  3BR2 A;  2TRT A;  3BQY A;  2PBX A;  5F08 A;  5K7Z A;  2ZB9 A;  5FKM A;  4DW6 A;  2TCT A;  2Q24 A;  4B3A A;  2QTQ A;  4JYK A;  1RKT A;  2FBQ A;  3VIB A;  2FD5 A;  5EYR A;  2ZOZ A;  1Z0X A;  2G3B A;  2EH3 A;  3CCY A;  5H9T A;  2ZCM A;  2NX4 A;  3NI7 A;  4YZE A;  3SFI A;  3LWJ A;  3TP0 A;  3BTI A;  4M3D A;  1JUP A;  5GPA A;  2UXP A;  3VOX A;  4GCK A;  2W53 A;  2HKU A;  3B81 A;  3E7Q A;  3HGG A;  3FIW A;  3ANG A;  3QPL A;  2FJ1 A;  2OER A;  3QQA A;  3ZQI A;  1ZKG A;  3CRJ A;  3BTC A;  4NEL A;  3S5R A;  3VW0 A;  3G1M A;  2X6O A;  3KKD A;  2ZCN A;  3KKC A;  4M3F A;  3ZQL A;  3HTH A;  4I6Z A;  4MO7 A;  3EUP A;  3G7R A;  4L62 A;  3O8H A;  3VVZ A;  3AQT A;  5D18 A;  2IAI A;  2JK3 A;  2JJ7 A;  2RAS A;  4D7N A;  3COL A;  4W97 A;  4ACI A;  3MNL A;  1QPI A;  2NP3 A;  3SDG A;  1ORK A;  2YVH A;  2XDN A;  3LSR A;  3GZI A;  1RPW A;  4B1R A;  5DAJ A;  2HYT A;  4ABZ A;  4XK4 A;  3BTL A;  3O8G A;  4G12 A;  3VW1 A;  2OF7 A;  4GCL A;  2GUH A;  3FK6 A;  3VW2 A;  3BNI A;  3PM1 A;  3QPS A;  5FMP A;  1JUM A;  3GEU A;  5C4Y A;  1T56 A;  3HTJ A;  3WHB A;  3EGQ A;  2HXI A;  4MXM A;  2XPW A;  3G1L A;  3BR6 A;  5HBU A;  4ICH A;  3PPB A;  5CXI A;  3CJD A;  4GFL A;  4I76 A;  5J1R A;  1Z77 A;  2O7O A;  1U9N A;  4JL3 A;  4GCT A;  3CWR A;  3HIM A;  5D1R A;  5F27 A;  3B6A A;  5J1Y A;  3Q3S A;  2WGB A;  2VKE A;  2IU5 A;  2OPT A;  1BJZ A;  3BQZ A;  1VI0 A;  3NPI A;  2V57 A;  2XRL A;  4KWA A;  3HGY A;  2G7L A;  2VKV A;  5F0F A;  3LHQ A;  2UXH A;  5IOY A;  2IBD A;  1QVT A;  3ANP A;  2XGD A;  2HYJ A;  3LSP A;  4AC0 A;  2QCO A;  5F0C A;  2X9D A;  2GEN A;  1RKW A;  3HTI A;  2QIB A;  5IP6 A;  3ZQH A;  2D6Y A;  3F1B A;  3Q0W A;  3MVP A;  2PZ9 A;  2HQ5 A;  1A6I A;  3ON4 A;  1U9O A;  2HXO A;  3BR3 A;  2G7G A;  5J3L A;  4AUX A;  1UI6 A;  5EZG A;  3CDL A;  3G1O A;  3IUV A;  3TP3 A;  3VUQ A;  3P9T A;  2XGE A;  2FQ4 A;  2Y31 A;  2FX0 A;  3BCG A;  4M3G A;  5AQC A;  3V6G A;  5F0H A;  4GFK A;  2ID3 A;  2G0E A;  2QKO A;  4CGR A;  2ZOY A;  2RAE A;  2YVE A;  4V2F A;  3QBM A;  3FRQ A;  5K58 A;  3O60 A;  4MK6 A;  2G7S A;  2Y2Z A;  1SGM A;  3RD3 A;  3PAS A;  3BT9 A;  3LJL A;  1JT6 A;  3C2B A;  3HE0 A;  2DTZ A;  4X1E A;  3LSJ A;  5CXG A;  3V78 A;  5IPA A;  3C07 A;  2RHA A;  2WV1 A;  3FK7 A;  3NXC A;  4HKU A;  5FKK A;  3BRU A;  2Y30 A;  4D5F A;  3BJB A;  3DPJ A;  3VP5 A;  2WUI A;  3LOC A;  3DEW A;  4M3E A;  5HAW A;  3BR0 A;  2VPR A;  1UI5 A;  1ZK8 A;  4V2G A;  4UDS A;  4NN1 A;  3Q0V A;  2OI8 A;  2ZCX A;  4W1U A;  3WHC A;  5J1U A;  5EFY A;  1T33 A;  3VVY A;  2I10 A;  3T6N A;  1JUS A;  3VOK A;  2XGC A;  4PXI A;  1JT0 A;  3ZQG A;  4D5C A;  2REK A;  2UXU A;  3DCF A;  2UXI A;  3F0C A;  4ME9 A;  3JSJ A;  3BR1 A;  5FHP A;  2QWT A;  3ZQF A;  2GFN A;  2DG7 A;  3BR5 A;  2UXO A;  3Q0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...