2FBQA

The crystal structure of transcriptional regulator pa3006
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
213
structure length
213
Chain Sequence
AQSETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFLGPFCASLEKELDRRQAKPEAQHATLEDLLHLLVSQAMAVKPRSGNDLSIFMRLLGLAFSQSQGHLRKYLEEVYGKVFRRYMLLVNEAAPKLPPIELFWRVHFMLGAAAFSMSGIKALRAMAETDFGVNTSTEQVMHLMVPFFAAGMRAESGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
publication title The crystal structure of transcriptional regulator PA3006
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 88
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fbqA00
2G7LA 5GP9A 3CJDA 5H9TA 3BR0A 5IPAA 2XRLA 5FMPA 5FKOA 2JJ7A 3BR6A 1T33A 5F27A 4AC0A 2G7GA 3ANGA 2ZOZA 4HKUA 2XB5A 3HTHA 2HYJA 2Y2ZA 3S5RA 2HKUA 1Z77A 3VOKA 2Q24A 3CCYA 1JTXA 2FBQA 1QVTA 3NI7A 4NELA 2VKEA 2ZCXA 3COLA 2I10A 5FKKA 2X6OA 4JKZA 2DG7A 4V2GA 2DG8A 1ZKGA 3TP3A 1T56A 3BTCA 3CWRA 2HYTA 2IAIA 4M3GA 3BJBA 2D6YA 2G7SA 3B6CA 4AC6A 3O60A 4MK6A 3VVXA 2X9DA 4GCLA 2XPUA 3B81A 3CDLA 1UI6A 2XGEA 5EFYA 3DEWA 3BR3A 2XGCA 2XPWA 4W97A 2EH3A 2Y31A 4D5FA 3VVYA 4JL3A 3FIWA 1QVUA 4ACIA 5K7ZA 2VPRA 1JT6A 5EZHA 2DTZA 1JUMA 2IU5A 5K7HA 5D18A 2YVHA 5CXGA 3BTJA 3G7RA 2G3BA 3VW0A 5J3LA 2XGDA 3MNLA 5F04A 3GEUA 3ON4A 2ID3A 5J1YA 3VP5A 2O7TA 3ZQLA 2XDNA 2XPVA 2RHAA 4ICHA 2OI8A 3BR2A 3BNIA 4ME9A 3FRQA 2FQ4A 4D7NA 5FHPA 3ZQIA 4CGRA 4XK4A 3IUVA 3TP0A 3BCGA 2G0EA 5FKLA 5F0HA 2Y30A 5D19A 1Z0XA 3G1OA 5HSZA 3KNWA 2UXPA 3V6GA 3WHBA 2HXIA 2IBDA 2F07A 2WGBA 1BJZA 2REKA 3AQTA 3IH3A 3BQYA 4KWAA 3HGYA 2QWTA 3FK6A 3Q0UA 1ZK8A 2O7OA 4D5CA 4PXIA 4I6ZA 3NXCA 3PASA 3G56A 3FK7A 1JTYA 3VW2A 3NPIA 3B6AA 3KKDA 3LOCA 4ABZA 4GFKA 2QKOA 3F1BA 3NRGA 5J1UA 3T6NA 5F0FA 4D7MA 4GCTA 3WHCA 4B1RA 4NN1A 5K58A 3AQSA 2PZ9A 5GPCA 1UI5A 5F08A 2WUIA 1JUSA 2ZB9A 5FKMA 3HTAA 5F1JA 3O8HA 5C4YA 2NS8A 3ZQFA 3IH4A 2WV1A 5IOZA 2UXIA 3G1MA 3QPLA 4MXMA 5DAJA 3IH2A 3KZ9A 2V57A 3CRJA 3VOXA 2TCTA 5K7FA 2QOPA 3O8GA 2UXHA 3G1LA 2IEKA 2QTQA 2ZOYA 2OF7A 3BTIA 3QQAA 5AQCA 3SDGA 4G12A 5HAWA 3JSJA 5IP6A 5F0CA 3DPJA 4UDSA 2NX4A 2VKVA 3Q0VA 3LSRA 4JYKA 3RD3A 3BR5A 1U9NA 3PPBA 2GBYA 3C07A 3BT9A 3LSJA 4GCKA 3C2BA 3DCFA 3V78A 3BHQA 3GZIA 3Q0WA 3ON2A 2FX0A 4M3DA 1SGMA 3HTJA 1RKWA 2YVEA 2ID6A 2QIBA 5J1RA 4M3FA 4L62A 3BR1A 1JT0A 3LHQA 4DW6A 3EUPA 4AUXA 4MO7A 1U9OA 3QPSA 5CW8A 2UXUA 5FKNA 2OPTA 2UXOA 3BRUA 4W1UA 4AF5A 5FGLA 4I76A 2JK3A 3PM1A 3ZQHA 2FJ1A 4B3AA 2HXOA 3BQZA 3RH2A 3VPRA 2RASA 3F0CA 3VVZA 2OERA 5EYRA 3HTIA 5EZGA 2NP3A 5IOYA 2TRTA 3LSPA 3Q3SA 3SFIA 2PBXA 1ORKA 4YZEA 3QBMA 3VW1A 2GFNA 2W53A 4GFLA 2QCOA 5HBUA 3MVPA 2GENA 3VIBA 2NS7A 4X1EA 5D1RA 2ZCNA 3KKCA 3ZQGA 3HIMA 3QKXA 3ANPA 3E7QA 5CXIA 2RAEA 1QPIA 2ZCMA 4M3EA 1RKTA 2HQ5A 3HE0A 4V2FA 3LJLA 2NP5A 3LWJA 3VUQA 3NNRA 1VI0A 3BTLA 1JUPA 3HGGA 2GUHA 4JNNA 1RPWA 1A6IA 5GPAA 2FD5A 3P9TA 3EGQA 4M3BA
chains in the Genus database with same CATH superfamily
2G7LA 5GP9A 3CJDA 5H9TA 3BR0A 5IPAA 2XRLA 5FMPA 5FKOA 2JJ7A 3BR6A 1T33A 5F27A 4AC0A 2G7GA 3ANGA 2ZOZA 4HKUA 2XB5A 3HTHA 2HYJA 3DU6A 2Y2ZA 3S5RA 2HKUA 1Z77A 3VOKA 2Q24A 3CCYA 1JTXA 2FBQA 1QVTA 3NI7A 4NELA 2VKEA 2ZCXA 2R7XA 3COLA 2I10A 5FKKA 2X6OA 4JKZA 2DG7A 4V2GA 2DG8A 1ZKGA 3TP3A 1T56A 3BTCA 3CWRA 2HYTA 2IAIA 4M3GA 3BJBA 2D6YA 2G7SA 3B6CA 2PFVA 4AC6A 3FHNA 3O60A 4MK6A 4OD4A 3VVXA 2X9DA 4GCLA 2XPUA 3B81A 3CDLA 1UI6A 2XGEA 5EFYA 3DEWA 3BR3A 2XGCA 2R7QA 2XPWA 4W97A 2EH3A 2Y31A 4D5FA 3VVYA 4JL3A 3FIWA 1QVUA 4ACIA 5K7ZA 2VPRA 1JT6A 2ZY9A 2DTZA 5EZHA 1JUMA 2IU5A 5K7HA 5D18A 2YVHA 5CXGA 3BTJA 3G7RA 2G3BA 3VW0A 5J3LA 2XGDA 3MNLA 5F04A 3GEUA 3ON4A 2ID3A 5J1YA 3VP5A 2O7TA 3ZQLA 2XDNA 2XPVA 2RHAA 4ICHA 2OI8A 3BR2A 3BNIA 4WIBA 4ME9A 3FRQA 2FQ4A 4D7NA 5FHPA 3ZQIA 4CGRA 3NS4A 4XK4A 3IUVA 3TP0A 5CQGA 3BCGA 2G0EA 5FKLA 5F0HA 2Y30A 4U9NA 5D19A 1Z0XA 3G1OA 5HSZA 3KNWA 2UXPA 3V6GA 3WHBA 2HXIA 2IBDA 2F07A 2WGBA 1BJZA 2REKA 3AQTA 3IH3A 3BQYA 4KWAA 3HGYA 2QWTA 3FK6A 3Q0UA 1ZK8A 2O7OA 3KYLA 4D5CA 4PXIA 4I6ZA 3NXCA 3PASA 3G56A 3FK7A 1JTYA 3VW2A 3NPIA 3B6AA 2R7RA 3KKDA 3LOCA 4ABZA 4GFKA 2QKOA 3F1BA 3NRGA 5J1UA 3DU5A 3T6NA 5F0FA 4D7MA 4GCTA 3WHCA 4B1RA 4NN1A 5K58A 3AQSA 2PZ9A 5GPCA 1UI5A 5F08A 2WUIA 4C2MA 1JUSA 5FKMA 2ZB9A 2R7OA 3HTAA 5F1JA 3O8HA 5C4YA 2NS8A 3ZQFA 3IH4A 2WV1A 5IOZA 2UXIA 3G1MA 3QPLA 4MXMA 5DAJA 3IH2A 3KZ9A 2V57A 3CRJA 3VOXA 2TCTA 5K7FA 2QOPA 3O8GA 2UXHA 3G1LA 2IEKA 2QTQA 2ZOYA 2OF7A 3BTIA 3QQAA 5AQCA 3SDGA 2YVXA 4G12A 5HAWA 3JSJA 5IP6A 5F0CA 3DPJA 4UDSA 2NX4A 2VKVA 3Q0VA 3LSRA 4JYKA 3RD3A 3BR5A 1U9NA 3PPBA 2GBYA 3C07A 2A2FX 3BT9A 3LSJA 4GCKA 3C2BA 3DCFA 3V78A 2R7UA 3BHQA 4U9LA 3GZIA 3Q0WA 3ON2A 2FX0A 4M3DA 1SGMA 3HTJA 1RKWA 2YVEA 2ID6A 2QIBA 5J1RA 4M3FA 4L62A 3BR1A 2R7VA 1JT0A 3LHQA 4DW6A 3EUPA 4AUXA 4MO7A 1U9OA 3QPSA 5CW8A 2UXUA 5FKNA 2OPTA 2UXOA 3BRUA 4W1UA 2R7TA 3SWHA 4AF5A 5FGLA 4I76A 2JK3A 3PM1A 3ZQHA 2FJ1A 4B3AA 2HXOA 3BQZA 3RH2A 3VPRA 2RASA 3F0CA 3VVZA 2OERA 5EYRA 3HTIA 5EZGA 3VTIA 2NP3A 5IOYA 2TRTA 3LSPA 3Q3SA 3SFIA 2PBXA 1ORKA 4YZEA 3QBMA 3VW1A 2GFNA 2W53A 4GFLA 2QCOA 2B1EA 5HBUA 3MVPA 2GENA 3VIBA 2NS7A 4X1EA 5D1RA 2ZCNA 3KKCA 3ZQGA 2R7SA 3HIMA 3QKXA 3ANPA 3K8PC 3E7QA 5CXIA 2RAEA 1QPIA 2B3WA 2ZCMA 4M3EA 1RKTA 2FJI1 2HQ5A 3HE0A 4V2FA 3LJLA 2NP5A 3LWJA 3VUQA 3NNRA 1VI0A 3BTLA 1JUPA 4DVYP 3HGGA 2GUHA 2R7WA 4OD5A 4JNNA 1RPWA 4IRVA 1A6IA 5GPAA 2FD5A 3P9TA 3EGQA 4M3BA
chains in the Genus database with same CATH topology
2G7LA 5GP9A 3CJDA 5H9TA 3BR0A 5IPAA 2XRLA 5FMPA 5FKOA 2JJ7A 3BR6A 1T33A 5F27A 4AC0A 2G7GA 3ANGA 2ZOZA 4HKUA 2XB5A 3HTHA 2HYJA 2Y2ZA 3S5RA 2HKUA 1Z77A 3VOKA 2Q24A 3CCYA 1JTXA 2FBQA 1QVTA 3NI7A 4NELA 2VKEA 2ZCXA 3COLA 2I10A 5FKKA 2X6OA 4JKZA 2DG7A 4V2GA 2DG8A 1ZKGA 3TP3A 1T56A 3BTCA 3CWRA 2HYTA 2IAIA 4M3GA 3BJBA 2D6YA 2G7SA 3B6CA 4AC6A 3O60A 4MK6A 3VVXA 2X9DA 4GCLA 2XPUA 3B81A 3CDLA 1UI6A 2XGEA 5EFYA 3DEWA 3BR3A 2XGCA 2XPWA 4W97A 2EH3A 2Y31A 4D5FA 3VVYA 4JL3A 3FIWA 1QVUA 4ACIA 5K7ZA 2VPRA 1JT6A 5EZHA 2DTZA 1JUMA 2IU5A 5K7HA 5D18A 2YVHA 5CXGA 3BTJA 3G7RA 2G3BA 3VW0A 5J3LA 2XGDA 3MNLA 5F04A 3GEUA 3ON4A 2ID3A 5J1YA 3VP5A 2O7TA 3ZQLA 2XDNA 2XPVA 2RHAA 4ICHA 2OI8A 3BR2A 3BNIA 4ME9A 3FRQA 2FQ4A 4D7NA 5FHPA 3ZQIA 4CGRA 4XK4A 3IUVA 3TP0A 3BCGA 2G0EA 5FKLA 5F0HA 2Y30A 5D19A 1Z0XA 3G1OA 5HSZA 3KNWA 2UXPA 3V6GA 3WHBA 2HXIA 2IBDA 2F07A 2WGBA 1BJZA 2REKA 3AQTA 3IH3A 3BQYA 4KWAA 3HGYA 2QWTA 3FK6A 3Q0UA 1ZK8A 2O7OA 4D5CA 4PXIA 4I6ZA 3NXCA 3PASA 3G56A 3FK7A 1JTYA 3VW2A 3NPIA 3B6AA 3KKDA 3LOCA 4ABZA 4GFKA 2QKOA 3F1BA 3NRGA 5J1UA 3T6NA 5F0FA 4D7MA 4GCTA 3WHCA 4B1RA 4NN1A 5K58A 3AQSA 2PZ9A 5GPCA 1UI5A 5F08A 2WUIA 1JUSA 2ZB9A 5FKMA 3HTAA 5F1JA 3O8HA 5C4YA 2NS8A 3ZQFA 3IH4A 2WV1A 5IOZA 2UXIA 3G1MA 3QPLA 4MXMA 5DAJA 3IH2A 3KZ9A 2V57A 3CRJA 3VOXA 2TCTA 5K7FA 2QOPA 3O8GA 2UXHA 3G1LA 2IEKA 2QTQA 2ZOYA 2OF7A 3BTIA 3QQAA 5AQCA 3SDGA 4G12A 5HAWA 3JSJA 5IP6A 5F0CA 3DPJA 4UDSA 2NX4A 2VKVA 3Q0VA 3LSRA 4JYKA 3RD3A 3BR5A 1U9NA 3PPBA 2GBYA 3C07A 3BT9A 3LSJA 4GCKA 3C2BA 3DCFA 3V78A 3BHQA 3GZIA 3Q0WA 3ON2A 2FX0A 4M3DA 1SGMA 3HTJA 1RKWA 2YVEA 2ID6A 2QIBA 5J1RA 4M3FA 4L62A 3BR1A 1JT0A 3LHQA 4DW6A 3EUPA 4AUXA 4MO7A 1U9OA 3QPSA 5CW8A 2UXUA 5FKNA 2OPTA 2UXOA 3BRUA 4W1UA 4AF5A 5FGLA 4I76A 2JK3A 3PM1A 3ZQHA 2FJ1A 4B3AA 2HXOA 3BQZA 3RH2A 3VPRA 2RASA 3F0CA 3VVZA 2OERA 5EYRA 3HTIA 5EZGA 2NP3A 5IOYA 2TRTA 3LSPA 3Q3SA 3SFIA 2PBXA 1ORKA 4YZEA 3QBMA 3VW1A 2GFNA 2W53A 4GFLA 2QCOA 5HBUA 3MVPA 2GENA 3VIBA 2NS7A 4X1EA 5D1RA 2ZCNA 3KKCA 3ZQGA 3HIMA 3QKXA 3ANPA 3E7QA 5CXIA 2RAEA 1QPIA 2ZCMA 4M3EA 1RKTA 2HQ5A 3HE0A 4V2FA 3LJLA 2NP5A 3LWJA 3VUQA 3NNRA 1VI0A 3BTLA 1JUPA 3HGGA 2GUHA 4JNNA 1RPWA 1A6IA 5GPAA 2FD5A 3P9TA 3EGQA 4M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7L A;  5GP9 A;  3CJD A;  5H9T A;  3BR0 A;  5IPA A;  2XRL A;  5FMP A;  5FKO A;  2JJ7 A;  3BR6 A;  1T33 A;  5F27 A;  4AC0 A;  2G7G A;  3ANG A;  2ZOZ A;  4HKU A;  2XB5 A;  3HTH A;  2HYJ A;  2Y2Z A;  3S5R A;  2HKU A;  1Z77 A;  3VOK A;  2Q24 A;  3CCY A;  1JTX A;  2FBQ A;  1QVT A;  3NI7 A;  4NEL A;  2VKE A;  2ZCX A;  3COL A;  2I10 A;  5FKK A;  2X6O A;  4JKZ A;  2DG7 A;  4V2G A;  2DG8 A;  1ZKG A;  3TP3 A;  1T56 A;  3BTC A;  3CWR A;  2HYT A;  2IAI A;  4M3G A;  3BJB A;  2D6Y A;  2G7S A;  3B6C A;  4AC6 A;  3O60 A;  4MK6 A;  3VVX A;  2X9D A;  4GCL A;  2XPU A;  3B81 A;  3CDL A;  1UI6 A;  2XGE A;  5EFY A;  3DEW A;  3BR3 A;  2XGC A;  2XPW A;  4W97 A;  2EH3 A;  2Y31 A;  4D5F A;  3VVY A;  4JL3 A;  3FIW A;  1QVU A;  4ACI A;  5K7Z A;  2VPR A;  1JT6 A;  5EZH A;  2DTZ A;  1JUM A;  2IU5 A;  5K7H A;  5D18 A;  2YVH A;  5CXG A;  3BTJ A;  3G7R A;  2G3B A;  3VW0 A;  5J3L A;  2XGD A;  3MNL A;  5F04 A;  3GEU A;  3ON4 A;  2ID3 A;  5J1Y A;  3VP5 A;  2O7T A;  3ZQL A;  2XDN A;  2XPV A;  2RHA A;  4ICH A;  2OI8 A;  3BR2 A;  3BNI A;  4ME9 A;  3FRQ A;  2FQ4 A;  4D7N A;  5FHP A;  3ZQI A;  4CGR A;  4XK4 A;  3IUV A;  3TP0 A;  3BCG A;  2G0E A;  5FKL A;  5F0H A;  2Y30 A;  5D19 A;  1Z0X A;  3G1O A;  5HSZ A;  3KNW A;  2UXP A;  3V6G A;  3WHB A;  2HXI A;  2IBD A;  2F07 A;  2WGB A;  1BJZ A;  2REK A;  3AQT A;  3IH3 A;  3BQY A;  4KWA A;  3HGY A;  2QWT A;  3FK6 A;  3Q0U A;  1ZK8 A;  2O7O A;  4D5C A;  4PXI A;  4I6Z A;  3NXC A;  3PAS A;  3G56 A;  3FK7 A;  1JTY A;  3VW2 A;  3NPI A;  3B6A A;  3KKD A;  3LOC A;  4ABZ A;  4GFK A;  2QKO A;  3F1B A;  3NRG A;  5J1U A;  3T6N A;  5F0F A;  4D7M A;  4GCT A;  3WHC A;  4B1R A;  4NN1 A;  5K58 A;  3AQS A;  2PZ9 A;  5GPC A;  1UI5 A;  5F08 A;  2WUI A;  1JUS A;  2ZB9 A;  5FKM A;  3HTA A;  5F1J A;  3O8H A;  5C4Y A;  2NS8 A;  3ZQF A;  3IH4 A;  2WV1 A;  5IOZ A;  2UXI A;  3G1M A;  3QPL A;  4MXM A;  5DAJ A;  3IH2 A;  3KZ9 A;  2V57 A;  3CRJ A;  3VOX A;  2TCT A;  5K7F A;  2QOP A;  3O8G A;  2UXH A;  3G1L A;  2IEK A;  2QTQ A;  2ZOY A;  2OF7 A;  3BTI A;  3QQA A;  5AQC A;  3SDG A;  4G12 A;  5HAW A;  3JSJ A;  5IP6 A;  5F0C A;  3DPJ A;  4UDS A;  2NX4 A;  2VKV A;  3Q0V A;  3LSR A;  4JYK A;  3RD3 A;  3BR5 A;  1U9N A;  3PPB A;  2GBY A;  3C07 A;  3BT9 A;  3LSJ A;  4GCK A;  3C2B A;  3DCF A;  3V78 A;  3BHQ A;  3GZI A;  3Q0W A;  3ON2 A;  2FX0 A;  4M3D A;  1SGM A;  3HTJ A;  1RKW A;  2YVE A;  2ID6 A;  2QIB A;  5J1R A;  4M3F A;  4L62 A;  3BR1 A;  1JT0 A;  3LHQ A;  4DW6 A;  3EUP A;  4AUX A;  4MO7 A;  1U9O A;  3QPS A;  5CW8 A;  2UXU A;  5FKN A;  2OPT A;  2UXO A;  3BRU A;  4W1U A;  4AF5 A;  5FGL A;  4I76 A;  2JK3 A;  3PM1 A;  3ZQH A;  2FJ1 A;  4B3A A;  2HXO A;  3BQZ A;  3RH2 A;  3VPR A;  2RAS A;  3F0C A;  3VVZ A;  2OER A;  5EYR A;  3HTI A;  5EZG A;  2NP3 A;  5IOY A;  2TRT A;  3LSP A;  3Q3S A;  3SFI A;  2PBX A;  1ORK A;  4YZE A;  3QBM A;  3VW1 A;  2GFN A;  2W53 A;  4GFL A;  2QCO A;  5HBU A;  3MVP A;  2GEN A;  3VIB A;  2NS7 A;  4X1E A;  5D1R A;  2ZCN A;  3KKC A;  3ZQG A;  3HIM A;  3QKX A;  3ANP A;  3E7Q A;  5CXI A;  2RAE A;  1QPI A;  2ZCM A;  4M3E A;  1RKT A;  2HQ5 A;  3HE0 A;  4V2F A;  3LJL A;  2NP5 A;  3LWJ A;  3VUQ A;  3NNR A;  1VI0 A;  3BTL A;  1JUP A;  3HGG A;  2GUH A;  4JNN A;  1RPW A;  1A6I A;  5GPA A;  2FD5 A;  3P9T A;  3EGQ A;  4M3B A; 
#chains in the Genus database with same CATH topology
 2G7L A;  5GP9 A;  3CJD A;  5H9T A;  3BR0 A;  5IPA A;  2XRL A;  5FMP A;  5FKO A;  2JJ7 A;  3BR6 A;  1T33 A;  5F27 A;  4AC0 A;  2G7G A;  3ANG A;  2ZOZ A;  4HKU A;  2XB5 A;  3HTH A;  2HYJ A;  3DU6 A;  2Y2Z A;  3S5R A;  2HKU A;  1Z77 A;  3VOK A;  2Q24 A;  3CCY A;  1JTX A;  2FBQ A;  1QVT A;  3NI7 A;  4NEL A;  2VKE A;  2ZCX A;  2R7X A;  3COL A;  2I10 A;  5FKK A;  2X6O A;  4JKZ A;  2DG7 A;  4V2G A;  2DG8 A;  1ZKG A;  3TP3 A;  1T56 A;  3BTC A;  3CWR A;  2HYT A;  2IAI A;  4M3G A;  3BJB A;  2D6Y A;  2G7S A;  3B6C A;  2PFV A;  4AC6 A;  3FHN A;  3O60 A;  4MK6 A;  4OD4 A;  3VVX A;  2X9D A;  4GCL A;  2XPU A;  3B81 A;  3CDL A;  1UI6 A;  2XGE A;  5EFY A;  3DEW A;  3BR3 A;  2XGC A;  2R7Q A;  2XPW A;  4W97 A;  2EH3 A;  2Y31 A;  4D5F A;  3VVY A;  4JL3 A;  3FIW A;  1QVU A;  4ACI A;  5K7Z A;  2VPR A;  1JT6 A;  2ZY9 A;  2DTZ A;  5EZH A;  1JUM A;  2IU5 A;  5K7H A;  5D18 A;  2YVH A;  5CXG A;  3BTJ A;  3G7R A;  2G3B A;  3VW0 A;  5J3L A;  2XGD A;  3MNL A;  5F04 A;  3GEU A;  3ON4 A;  2ID3 A;  5J1Y A;  3VP5 A;  2O7T A;  3ZQL A;  2XDN A;  2XPV A;  2RHA A;  4ICH A;  2OI8 A;  3BR2 A;  3BNI A;  4WIB A;  4ME9 A;  3FRQ A;  2FQ4 A;  4D7N A;  5FHP A;  3ZQI A;  4CGR A;  3NS4 A;  4XK4 A;  3IUV A;  3TP0 A;  5CQG A;  3BCG A;  2G0E A;  5FKL A;  5F0H A;  2Y30 A;  4U9N A;  5D19 A;  1Z0X A;  3G1O A;  5HSZ A;  3KNW A;  2UXP A;  3V6G A;  3WHB A;  2HXI A;  2IBD A;  2F07 A;  2WGB A;  1BJZ A;  2REK A;  3AQT A;  3IH3 A;  3BQY A;  4KWA A;  3HGY A;  2QWT A;  3FK6 A;  3Q0U A;  1ZK8 A;  2O7O A;  3KYL A;  4D5C A;  4PXI A;  4I6Z A;  3NXC A;  3PAS A;  3G56 A;  3FK7 A;  1JTY A;  3VW2 A;  3NPI A;  3B6A A;  2R7R A;  3KKD A;  3LOC A;  4ABZ A;  4GFK A;  2QKO A;  3F1B A;  3NRG A;  5J1U A;  3DU5 A;  3T6N A;  5F0F A;  4D7M A;  4GCT A;  3WHC A;  4B1R A;  4NN1 A;  5K58 A;  3AQS A;  2PZ9 A;  5GPC A;  1UI5 A;  5F08 A;  2WUI A;  4C2M A;  1JUS A;  5FKM A;  2ZB9 A;  2R7O A;  3HTA A;  5F1J A;  3O8H A;  5C4Y A;  2NS8 A;  3ZQF A;  3IH4 A;  2WV1 A;  5IOZ A;  2UXI A;  3G1M A;  3QPL A;  4MXM A;  5DAJ A;  3IH2 A;  3KZ9 A;  2V57 A;  3CRJ A;  3VOX A;  2TCT A;  5K7F A;  2QOP A;  3O8G A;  2UXH A;  3G1L A;  2IEK A;  2QTQ A;  2ZOY A;  2OF7 A;  3BTI A;  3QQA A;  5AQC A;  3SDG A;  2YVX A;  4G12 A;  5HAW A;  3JSJ A;  5IP6 A;  5F0C A;  3DPJ A;  4UDS A;  2NX4 A;  2VKV A;  3Q0V A;  3LSR A;  4JYK A;  3RD3 A;  3BR5 A;  1U9N A;  3PPB A;  2GBY A;  3C07 A;  2A2F X;  3BT9 A;  3LSJ A;  4GCK A;  3C2B A;  3DCF A;  3V78 A;  2R7U A;  3BHQ A;  4U9L A;  3GZI A;  3Q0W A;  3ON2 A;  2FX0 A;  4M3D A;  1SGM A;  3HTJ A;  1RKW A;  2YVE A;  2ID6 A;  2QIB A;  5J1R A;  4M3F A;  4L62 A;  3BR1 A;  2R7V A;  1JT0 A;  3LHQ A;  4DW6 A;  3EUP A;  4AUX A;  4MO7 A;  1U9O A;  3QPS A;  5CW8 A;  2UXU A;  5FKN A;  2OPT A;  2UXO A;  3BRU A;  4W1U A;  2R7T A;  3SWH A;  4AF5 A;  5FGL A;  4I76 A;  2JK3 A;  3PM1 A;  3ZQH A;  2FJ1 A;  4B3A A;  2HXO A;  3BQZ A;  3RH2 A;  3VPR A;  2RAS A;  3F0C A;  3VVZ A;  2OER A;  5EYR A;  3HTI A;  5EZG A;  3VTI A;  2NP3 A;  5IOY A;  2TRT A;  3LSP A;  3Q3S A;  3SFI A;  2PBX A;  1ORK A;  4YZE A;  3QBM A;  3VW1 A;  2GFN A;  2W53 A;  4GFL A;  2QCO A;  2B1E A;  5HBU A;  3MVP A;  2GEN A;  3VIB A;  2NS7 A;  4X1E A;  5D1R A;  2ZCN A;  3KKC A;  3ZQG A;  2R7S A;  3HIM A;  3QKX A;  3ANP A;  3K8P C;  3E7Q A;  5CXI A;  2RAE A;  1QPI A;  2B3W A;  2ZCM A;  4M3E A;  1RKT A;  2FJI 1;  2HQ5 A;  3HE0 A;  4V2F A;  3LJL A;  2NP5 A;  3LWJ A;  3VUQ A;  3NNR A;  1VI0 A;  3BTL A;  1JUP A;  4DVY P;  3HGG A;  2GUH A;  2R7W A;  4OD5 A;  4JNN A;  1RPW A;  4IRV A;  1A6I A;  5GPA A;  2FD5 A;  3P9T A;  3EGQ A;  4M3B A; 
#chains in the Genus database with same CATH homology
 2G7L A;  5GP9 A;  3CJD A;  5H9T A;  3BR0 A;  5IPA A;  2XRL A;  5FMP A;  5FKO A;  2JJ7 A;  3BR6 A;  1T33 A;  5F27 A;  4AC0 A;  2G7G A;  3ANG A;  2ZOZ A;  4HKU A;  2XB5 A;  3HTH A;  2HYJ A;  2Y2Z A;  3S5R A;  2HKU A;  1Z77 A;  3VOK A;  2Q24 A;  3CCY A;  1JTX A;  2FBQ A;  1QVT A;  3NI7 A;  4NEL A;  2VKE A;  2ZCX A;  3COL A;  2I10 A;  5FKK A;  2X6O A;  4JKZ A;  2DG7 A;  4V2G A;  2DG8 A;  1ZKG A;  3TP3 A;  1T56 A;  3BTC A;  3CWR A;  2HYT A;  2IAI A;  4M3G A;  3BJB A;  2D6Y A;  2G7S A;  3B6C A;  4AC6 A;  3O60 A;  4MK6 A;  3VVX A;  2X9D A;  4GCL A;  2XPU A;  3B81 A;  3CDL A;  1UI6 A;  2XGE A;  5EFY A;  3DEW A;  3BR3 A;  2XGC A;  2XPW A;  4W97 A;  2EH3 A;  2Y31 A;  4D5F A;  3VVY A;  4JL3 A;  3FIW A;  1QVU A;  4ACI A;  5K7Z A;  2VPR A;  1JT6 A;  5EZH A;  2DTZ A;  1JUM A;  2IU5 A;  5K7H A;  5D18 A;  2YVH A;  5CXG A;  3BTJ A;  3G7R A;  2G3B A;  3VW0 A;  5J3L A;  2XGD A;  3MNL A;  5F04 A;  3GEU A;  3ON4 A;  2ID3 A;  5J1Y A;  3VP5 A;  2O7T A;  3ZQL A;  2XDN A;  2XPV A;  2RHA A;  4ICH A;  2OI8 A;  3BR2 A;  3BNI A;  4ME9 A;  3FRQ A;  2FQ4 A;  4D7N A;  5FHP A;  3ZQI A;  4CGR A;  4XK4 A;  3IUV A;  3TP0 A;  3BCG A;  2G0E A;  5FKL A;  5F0H A;  2Y30 A;  5D19 A;  1Z0X A;  3G1O A;  5HSZ A;  3KNW A;  2UXP A;  3V6G A;  3WHB A;  2HXI A;  2IBD A;  2F07 A;  2WGB A;  1BJZ A;  2REK A;  3AQT A;  3IH3 A;  3BQY A;  4KWA A;  3HGY A;  2QWT A;  3FK6 A;  3Q0U A;  1ZK8 A;  2O7O A;  4D5C A;  4PXI A;  4I6Z A;  3NXC A;  3PAS A;  3G56 A;  3FK7 A;  1JTY A;  3VW2 A;  3NPI A;  3B6A A;  3KKD A;  3LOC A;  4ABZ A;  4GFK A;  2QKO A;  3F1B A;  3NRG A;  5J1U A;  3T6N A;  5F0F A;  4D7M A;  4GCT A;  3WHC A;  4B1R A;  4NN1 A;  5K58 A;  3AQS A;  2PZ9 A;  5GPC A;  1UI5 A;  5F08 A;  2WUI A;  1JUS A;  2ZB9 A;  5FKM A;  3HTA A;  5F1J A;  3O8H A;  5C4Y A;  2NS8 A;  3ZQF A;  3IH4 A;  2WV1 A;  5IOZ A;  2UXI A;  3G1M A;  3QPL A;  4MXM A;  5DAJ A;  3IH2 A;  3KZ9 A;  2V57 A;  3CRJ A;  3VOX A;  2TCT A;  5K7F A;  2QOP A;  3O8G A;  2UXH A;  3G1L A;  2IEK A;  2QTQ A;  2ZOY A;  2OF7 A;  3BTI A;  3QQA A;  5AQC A;  3SDG A;  4G12 A;  5HAW A;  3JSJ A;  5IP6 A;  5F0C A;  3DPJ A;  4UDS A;  2NX4 A;  2VKV A;  3Q0V A;  3LSR A;  4JYK A;  3RD3 A;  3BR5 A;  1U9N A;  3PPB A;  2GBY A;  3C07 A;  3BT9 A;  3LSJ A;  4GCK A;  3C2B A;  3DCF A;  3V78 A;  3BHQ A;  3GZI A;  3Q0W A;  3ON2 A;  2FX0 A;  4M3D A;  1SGM A;  3HTJ A;  1RKW A;  2YVE A;  2ID6 A;  2QIB A;  5J1R A;  4M3F A;  4L62 A;  3BR1 A;  1JT0 A;  3LHQ A;  4DW6 A;  3EUP A;  4AUX A;  4MO7 A;  1U9O A;  3QPS A;  5CW8 A;  2UXU A;  5FKN A;  2OPT A;  2UXO A;  3BRU A;  4W1U A;  4AF5 A;  5FGL A;  4I76 A;  2JK3 A;  3PM1 A;  3ZQH A;  2FJ1 A;  4B3A A;  2HXO A;  3BQZ A;  3RH2 A;  3VPR A;  2RAS A;  3F0C A;  3VVZ A;  2OER A;  5EYR A;  3HTI A;  5EZG A;  2NP3 A;  5IOY A;  2TRT A;  3LSP A;  3Q3S A;  3SFI A;  2PBX A;  1ORK A;  4YZE A;  3QBM A;  3VW1 A;  2GFN A;  2W53 A;  4GFL A;  2QCO A;  5HBU A;  3MVP A;  2GEN A;  3VIB A;  2NS7 A;  4X1E A;  5D1R A;  2ZCN A;  3KKC A;  3ZQG A;  3HIM A;  3QKX A;  3ANP A;  3E7Q A;  5CXI A;  2RAE A;  1QPI A;  2ZCM A;  4M3E A;  1RKT A;  2HQ5 A;  3HE0 A;  4V2F A;  3LJL A;  2NP5 A;  3LWJ A;  3VUQ A;  3NNR A;  1VI0 A;  3BTL A;  1JUP A;  3HGG A;  2GUH A;  4JNN A;  1RPW A;  1A6I A;  5GPA A;  2FD5 A;  3P9T A;  3EGQ A;  4M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...