2FBQA

The crystal structure of transcriptional regulator pa3006
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
213
structure length
213
Chain Sequence
AQSETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFLGPFCASLEKELDRRQAKPEAQHATLEDLLHLLVSQAMAVKPRSGNDLSIFMRLLGLAFSQSQGHLRKYLEEVYGKVFRRYMLLVNEAAPKLPPIELFWRVHFMLGAAAFSMSGIKALRAMAETDFGVNTSTEQVMHLMVPFFAAGMRAESGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of transcriptional regulator PA3006
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
molecule keywords probable transcriptional regulator
total genus 88
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fbqA00
4XK4A 5F0HA 4MXMA 2ZOZA 3IH4A 4D7MA 3P9TA 3AQSA 2XPWA 4ACIA 4NN1A 2UXOA 2OF7A 2XPVA 4B1RA 3FIWA 3IH2A 1ZKGA 2XDNA 3O60A 3VPRA 5H9TA 2ZCXA 4HKUA 3BR2A 4GCTA 2ZB9A 5FKNA 3VVYA 3KNWA 5F1JA 3DEWA 2GBYA 2RASA 3CCYA 3VW0A 5F08A 5IPAA 4JNNA 2XPUA 2OERA 3ANPA 2NP3A 2GUHA 5AQCA 3CDLA 3LSJA 5IOYA 3NNRA 3HGGA 4CGRA 4GCLA 5GPCA 3CWRA 4PXIA 3TP3A 3BR6A 2PBXA 1JUMA 5FHPA 2OI8A 3MVPA 2G7SA 5J3LA 3HTAA 5IOZA 2FJ1A 1RKWA 3NI7A 1QVTA 3CJDA 2OPTA 2VKEA 5HBUA 2Y30A 2UXPA 3QPLA 3LHQA 2WUIA 3B6CA 2O7OA 1T56A 3FK7A 1QVUA 5EFYA 3S5RA 5K58A 3VW2A 2D6YA 3ZQIA 2YVEA 3BR5A 3O8HA 3SDGA 5J1YA 1Z77A 1JUPA 2GFNA 3GZIA 2XB5A 3WHCA 3BNIA 2HKUA 5J1RA 4D7NA 2G7LA 5CXGA 5GP9A 5K7HA 2IU5A 2G3BA 5IP6A 5F27A 2F07A 3BTLA 3B81A 3WHBA 2W53A 2QOPA 3JSJA 5FKOA 5EYRA 3F1BA 2FD5A 3HTHA 3TP0A 3GEUA 3DCFA 1UI6A 5F0CA 3BJBA 3Q0UA 3IH3A 3LOCA 3NXCA 3G1LA 3HIMA 5FMPA 3IUVA 3C2BA 2NS7A 4NELA 2HXOA 4DW6A 3RD3A 2X6OA 2TRTA 3ON4A 2Y2ZA 3BQZA 3AQTA 3ZQFA 2REKA 3E7QA 2HQ5A 2G7GA 5EZHA 3VUQA 3Q3SA 1JTYA 5F04A 3ZQGA 3BT9A 5D19A 1Z0XA 2ZOYA 3BR1A 2G0EA 1RKTA 3QPSA 3PM1A 3VOXA 2ID3A 2I10A 3Q0WA 2RHAA 2FBQA 3BTCA 4YZEA 2IAIA 2XGEA 3BR3A 2XGDA 4JYKA 4M3BA 3FK6A 4AF5A 4AC6A 4MO7A 1ZK8A 3VVXA 4D5FA 1JTXA 2YVHA 2HYJA 1VI0A 3HGYA 5FGLA 3VP5A 3QKXA 2PZ9A 3VIBA 2DG8A 3LSPA 3MNLA 5CW8A 3B6AA 3BHQA 5J1UA 3VW1A 2QTQA 2JK3A 3BRUA 3G1MA 5GPAA 4V2GA 2TCTA 3PASA 2IBDA 1QPIA 1JT0A 3G7RA 1T33A 2Q24A 3VOKA 3DPJA 4KWAA 3F0CA 2QKOA 3PPBA 2DTZA 3G56A 2O7TA 4M3GA 2WV1A 3BTJA 5C4YA 4M3DA 2HYTA 4ICHA 3HTJA 3QQAA 5FKKA 2X9DA 1A6IA 3BCGA 3KZ9A 1UI5A 1BJZA 1U9OA 2ID6A 2NS8A 2RAEA 4I76A 3BQYA 3V6GA 3ZQLA 3LSRA 3G1OA 3NRGA 5K7ZA 3BR0A 3EGQA 1JT6A 4I6ZA 5HAWA 5CXIA 2UXIA 2UXUA 3V78A 4UDSA 2VKVA 2VPRA 4GFLA 3ANGA 5FKLA 2FQ4A 4GFKA 2QWTA 2V57A 3FRQA 3O8GA 3VVZA 1SGMA 2NP5A 4L62A 3C07A 2XGCA 3HE0A 3LJLA 3RH2A 3LWJA 3ON2A 1JUSA 5D1RA 4GCKA 4G12A 2XRLA 4W1UA 5EZGA 2ZCNA 3CRJA 2IEKA 5D18A 1RPWA 4B3AA 4W97A 2WGBA 3EUPA 4JL3A 2QIBA 3KKDA 3BTIA 2NX4A 4MK6A 4JKZA 2JJ7A 1U9NA 3ZQHA 5FKMA 4V2FA 4AC0A 2UXHA 5K7FA 5DAJA 5F0FA 3HTIA 4M3EA 2GENA 4X1EA 3COLA 2Y31A 2HXIA 2FX0A 5HSZA 3NPIA 3SFIA 4M3FA 2QCOA 4ABZA 3T6NA 3Q0VA 2ZCMA 2EH3A 4D5CA 4ME9A 1ORKA 3QBMA 3KKCA 2DG7A 4AUXA
chains in the Genus database with same CATH superfamily
4XK4A 5F0HA 4MXMA 2ZOZA 3IH4A 4D7MA 3P9TA 3AQSA 2XPWA 4ACIA 4NN1A 2UXOA 2OF7A 2XPVA 4B1RA 3FIWA 3IH2A 1ZKGA 2XDNA 3O60A 3VPRA 5H9TA 2ZCXA 2B3WA 4HKUA 3BR2A 4GCTA 2R7RA 2ZB9A 5FKNA 4C2MA 3VVYA 3KNWA 5F1JA 3DEWA 2GBYA 2RASA 3CCYA 3K8PC 3VW0A 5F08A 5IPAA 4JNNA 2XPUA 2OERA 3ANPA 2NP3A 2GUHA 5AQCA 3CDLA 3LSJA 5IOYA 3NNRA 3HGGA 4CGRA 4GCLA 2B1EA 5GPCA 3CWRA 4PXIA 3TP3A 3BR6A 2PBXA 1JUMA 5FHPA 2R7XA 2OI8A 3MVPA 2G7SA 2R7WA 5J3LA 3HTAA 2R7VA 5IOZA 2FJ1A 1RKWA 3NI7A 1QVTA 3CJDA 2OPTA 2VKEA 5HBUA 2Y30A 2UXPA 3QPLA 3LHQA 2WUIA 3B6CA 2O7OA 1T56A 4DVYP 3FK7A 1QVUA 5EFYA 3S5RA 5K58A 3VW2A 2D6YA 3ZQIA 2YVEA 3BR5A 3O8HA 3SDGA 5J1YA 1Z77A 1JUPA 2GFNA 3GZIA 2XB5A 3WHCA 3BNIA 2HKUA 5J1RA 2G7LA 4D7NA 5CXGA 5GP9A 5K7HA 2IU5A 2G3BA 5IP6A 5F27A 2F07A 3BTLA 3B81A 3WHBA 2W53A 2QOPA 3JSJA 5FKOA 5EYRA 3F1BA 2FD5A 2PFVA 3HTHA 3TP0A 3GEUA 3DCFA 1UI6A 5F0CA 3BJBA 3Q0UA 5CQGA 3IH3A 3LOCA 3NXCA 3G1LA 3HIMA 5FMPA 3IUVA 3C2BA 2NS7A 3KYLA 4NELA 2HXOA 4DW6A 3RD3A 2X6OA 2TRTA 3ON4A 2Y2ZA 3BQZA 2FJI1 3AQTA 3ZQFA 2REKA 2R7UA 3E7QA 2HQ5A 2ZY9A 2G7GA 5EZHA 3VUQA 3Q3SA 1JTYA 5F04A 2R7QA 3ZQGA 3BT9A 5D19A 1Z0XA 3NS4A 2ZOYA 3BR1A 2G0EA 1RKTA 3QPSA 3DU5A 3PM1A 3VOXA 2ID3A 2I10A 3Q0WA 2RHAA 3DU6A 2FBQA 3BTCA 4YZEA 2IAIA 2XGEA 3BR3A 2XGDA 4JYKA 4M3BA 3FK6A 4AF5A 4AC6A 4MO7A 1ZK8A 3VVXA 4D5FA 1JTXA 2YVHA 2HYJA 1VI0A 3HGYA 5FGLA 3VP5A 4IRVA 3QKXA 2PZ9A 3VIBA 2DG8A 3LSPA 3MNLA 5CW8A 3B6AA 3BHQA 2R7SA 5J1UA 3VW1A 2QTQA 2JK3A 3BRUA 3G1MA 5GPAA 4V2GA 2TCTA 3PASA 2IBDA 1QPIA 2A2FX 1JT0A 3G7RA 1T33A 2Q24A 4U9NA 3VOKA 3DPJA 4KWAA 3F0CA 2QKOA 3PPBA 2R7OA 2DTZA 3G56A 2O7TA 4M3GA 2WV1A 3BTJA 5C4YA 4M3DA 2HYTA 4ICHA 3HTJA 3QQAA 5FKKA 2X9DA 2YVXA 1A6IA 3BCGA 3KZ9A 1UI5A 1BJZA 1U9OA 2ID6A 2NS8A 2RAEA 4I76A 3BQYA 3V6GA 3ZQLA 4WIBA 3LSRA 3G1OA 3NRGA 5K7ZA 3BR0A 3EGQA 1JT6A 4I6ZA 3VTIA 5HAWA 5CXIA 2UXIA 2UXUA 3V78A 4UDSA 2VKVA 2VPRA 4GFLA 3ANGA 5FKLA 2FQ4A 4GFKA 2QWTA 2V57A 3FRQA 3O8GA 3VVZA 1SGMA 2R7TA 4OD4A 2NP5A 4L62A 3SWHA 3C07A 2XGCA 3HE0A 4OD5A 3LJLA 3RH2A 3LWJA 3ON2A 1JUSA 5D1RA 4GCKA 4G12A 2XRLA 4W1UA 5EZGA 2ZCNA 3CRJA 2IEKA 5D18A 1RPWA 4B3AA 4W97A 2WGBA 3EUPA 4JL3A 2QIBA 3KKDA 3BTIA 2NX4A 4MK6A 4JKZA 2JJ7A 1U9NA 3ZQHA 5FKMA 4V2FA 4AC0A 2UXHA 5K7FA 5DAJA 5F0FA 3HTIA 4M3EA 2GENA 4X1EA 3COLA 2Y31A 2HXIA 2FX0A 5HSZA 4U9LA 3NPIA 3SFIA 4M3FA 2QCOA 4ABZA 3T6NA 3Q0VA 2ZCMA 2EH3A 4D5CA 4ME9A 3FHNA 1ORKA 3QBMA 3KKCA 2DG7A 4AUXA
chains in the Genus database with same CATH topology
4XK4A 5F0HA 4MXMA 2ZOZA 3IH4A 4D7MA 3P9TA 3AQSA 2XPWA 4ACIA 4NN1A 2UXOA 2OF7A 2XPVA 4B1RA 3FIWA 3IH2A 1ZKGA 2XDNA 3O60A 3VPRA 5H9TA 2ZCXA 4HKUA 3BR2A 4GCTA 2ZB9A 5FKNA 3VVYA 3KNWA 5F1JA 3DEWA 2GBYA 2RASA 3CCYA 3VW0A 5F08A 5IPAA 4JNNA 2XPUA 2OERA 3ANPA 2NP3A 2GUHA 5AQCA 3CDLA 3LSJA 5IOYA 3NNRA 3HGGA 4CGRA 4GCLA 5GPCA 3CWRA 4PXIA 3TP3A 3BR6A 2PBXA 1JUMA 5FHPA 2OI8A 3MVPA 2G7SA 5J3LA 3HTAA 5IOZA 2FJ1A 1RKWA 3NI7A 1QVTA 3CJDA 2OPTA 2VKEA 5HBUA 2Y30A 2UXPA 3QPLA 3LHQA 2WUIA 3B6CA 2O7OA 1T56A 3FK7A 1QVUA 5EFYA 3S5RA 5K58A 3VW2A 2D6YA 3ZQIA 2YVEA 3BR5A 3O8HA 3SDGA 5J1YA 1Z77A 1JUPA 2GFNA 3GZIA 2XB5A 3WHCA 3BNIA 2HKUA 5J1RA 4D7NA 2G7LA 5CXGA 5GP9A 5K7HA 2IU5A 2G3BA 5IP6A 5F27A 2F07A 3BTLA 3B81A 3WHBA 2W53A 2QOPA 3JSJA 5FKOA 5EYRA 3F1BA 2FD5A 3HTHA 3TP0A 3GEUA 3DCFA 1UI6A 5F0CA 3BJBA 3Q0UA 3IH3A 3LOCA 3NXCA 3G1LA 3HIMA 5FMPA 3IUVA 3C2BA 2NS7A 4NELA 2HXOA 4DW6A 3RD3A 2X6OA 2TRTA 3ON4A 2Y2ZA 3BQZA 3AQTA 3ZQFA 2REKA 3E7QA 2HQ5A 2G7GA 5EZHA 3VUQA 3Q3SA 1JTYA 5F04A 3ZQGA 3BT9A 5D19A 1Z0XA 2ZOYA 3BR1A 2G0EA 1RKTA 3QPSA 3PM1A 3VOXA 2ID3A 2I10A 3Q0WA 2RHAA 2FBQA 3BTCA 4YZEA 2IAIA 2XGEA 3BR3A 2XGDA 4JYKA 4M3BA 3FK6A 4AF5A 4AC6A 4MO7A 1ZK8A 3VVXA 4D5FA 1JTXA 2YVHA 2HYJA 1VI0A 3HGYA 5FGLA 3VP5A 3QKXA 2PZ9A 3VIBA 2DG8A 3LSPA 3MNLA 5CW8A 3B6AA 3BHQA 5J1UA 3VW1A 2QTQA 2JK3A 3BRUA 3G1MA 5GPAA 4V2GA 2TCTA 3PASA 2IBDA 1QPIA 1JT0A 3G7RA 1T33A 2Q24A 3VOKA 3DPJA 4KWAA 3F0CA 2QKOA 3PPBA 2DTZA 3G56A 2O7TA 4M3GA 2WV1A 3BTJA 5C4YA 4M3DA 2HYTA 4ICHA 3HTJA 3QQAA 5FKKA 2X9DA 1A6IA 3BCGA 3KZ9A 1UI5A 1BJZA 1U9OA 2ID6A 2NS8A 2RAEA 4I76A 3BQYA 3V6GA 3ZQLA 3LSRA 3G1OA 3NRGA 5K7ZA 3BR0A 3EGQA 1JT6A 4I6ZA 5HAWA 5CXIA 2UXIA 2UXUA 3V78A 4UDSA 2VKVA 2VPRA 4GFLA 3ANGA 5FKLA 2FQ4A 4GFKA 2QWTA 2V57A 3FRQA 3O8GA 3VVZA 1SGMA 2NP5A 4L62A 3C07A 2XGCA 3HE0A 3LJLA 3RH2A 3LWJA 3ON2A 1JUSA 5D1RA 4GCKA 4G12A 2XRLA 4W1UA 5EZGA 2ZCNA 3CRJA 2IEKA 5D18A 1RPWA 4B3AA 4W97A 2WGBA 3EUPA 4JL3A 2QIBA 3KKDA 3BTIA 2NX4A 4MK6A 4JKZA 2JJ7A 1U9NA 3ZQHA 5FKMA 4V2FA 4AC0A 2UXHA 5K7FA 5DAJA 5F0FA 3HTIA 4M3EA 2GENA 4X1EA 3COLA 2Y31A 2HXIA 2FX0A 5HSZA 3NPIA 3SFIA 4M3FA 2QCOA 4ABZA 3T6NA 3Q0VA 2ZCMA 2EH3A 4D5CA 4ME9A 1ORKA 3QBMA 3KKCA 2DG7A 4AUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK4 A;  5F0H A;  4MXM A;  2ZOZ A;  3IH4 A;  4D7M A;  3P9T A;  3AQS A;  2XPW A;  4ACI A;  4NN1 A;  2UXO A;  2OF7 A;  2XPV A;  4B1R A;  3FIW A;  3IH2 A;  1ZKG A;  2XDN A;  3O60 A;  3VPR A;  5H9T A;  2ZCX A;  4HKU A;  3BR2 A;  4GCT A;  2ZB9 A;  5FKN A;  3VVY A;  3KNW A;  5F1J A;  3DEW A;  2GBY A;  2RAS A;  3CCY A;  3VW0 A;  5F08 A;  5IPA A;  4JNN A;  2XPU A;  2OER A;  3ANP A;  2NP3 A;  2GUH A;  5AQC A;  3CDL A;  3LSJ A;  5IOY A;  3NNR A;  3HGG A;  4CGR A;  4GCL A;  5GPC A;  3CWR A;  4PXI A;  3TP3 A;  3BR6 A;  2PBX A;  1JUM A;  5FHP A;  2OI8 A;  3MVP A;  2G7S A;  5J3L A;  3HTA A;  5IOZ A;  2FJ1 A;  1RKW A;  3NI7 A;  1QVT A;  3CJD A;  2OPT A;  2VKE A;  5HBU A;  2Y30 A;  2UXP A;  3QPL A;  3LHQ A;  2WUI A;  3B6C A;  2O7O A;  1T56 A;  3FK7 A;  1QVU A;  5EFY A;  3S5R A;  5K58 A;  3VW2 A;  2D6Y A;  3ZQI A;  2YVE A;  3BR5 A;  3O8H A;  3SDG A;  5J1Y A;  1Z77 A;  1JUP A;  2GFN A;  3GZI A;  2XB5 A;  3WHC A;  3BNI A;  2HKU A;  5J1R A;  4D7N A;  2G7L A;  5CXG A;  5GP9 A;  5K7H A;  2IU5 A;  2G3B A;  5IP6 A;  5F27 A;  2F07 A;  3BTL A;  3B81 A;  3WHB A;  2W53 A;  2QOP A;  3JSJ A;  5FKO A;  5EYR A;  3F1B A;  2FD5 A;  3HTH A;  3TP0 A;  3GEU A;  3DCF A;  1UI6 A;  5F0C A;  3BJB A;  3Q0U A;  3IH3 A;  3LOC A;  3NXC A;  3G1L A;  3HIM A;  5FMP A;  3IUV A;  3C2B A;  2NS7 A;  4NEL A;  2HXO A;  4DW6 A;  3RD3 A;  2X6O A;  2TRT A;  3ON4 A;  2Y2Z A;  3BQZ A;  3AQT A;  3ZQF A;  2REK A;  3E7Q A;  2HQ5 A;  2G7G A;  5EZH A;  3VUQ A;  3Q3S A;  1JTY A;  5F04 A;  3ZQG A;  3BT9 A;  5D19 A;  1Z0X A;  2ZOY A;  3BR1 A;  2G0E A;  1RKT A;  3QPS A;  3PM1 A;  3VOX A;  2ID3 A;  2I10 A;  3Q0W A;  2RHA A;  2FBQ A;  3BTC A;  4YZE A;  2IAI A;  2XGE A;  3BR3 A;  2XGD A;  4JYK A;  4M3B A;  3FK6 A;  4AF5 A;  4AC6 A;  4MO7 A;  1ZK8 A;  3VVX A;  4D5F A;  1JTX A;  2YVH A;  2HYJ A;  1VI0 A;  3HGY A;  5FGL A;  3VP5 A;  3QKX A;  2PZ9 A;  3VIB A;  2DG8 A;  3LSP A;  3MNL A;  5CW8 A;  3B6A A;  3BHQ A;  5J1U A;  3VW1 A;  2QTQ A;  2JK3 A;  3BRU A;  3G1M A;  5GPA A;  4V2G A;  2TCT A;  3PAS A;  2IBD A;  1QPI A;  1JT0 A;  3G7R A;  1T33 A;  2Q24 A;  3VOK A;  3DPJ A;  4KWA A;  3F0C A;  2QKO A;  3PPB A;  2DTZ A;  3G56 A;  2O7T A;  4M3G A;  2WV1 A;  3BTJ A;  5C4Y A;  4M3D A;  2HYT A;  4ICH A;  3HTJ A;  3QQA A;  5FKK A;  2X9D A;  1A6I A;  3BCG A;  3KZ9 A;  1UI5 A;  1BJZ A;  1U9O A;  2ID6 A;  2NS8 A;  2RAE A;  4I76 A;  3BQY A;  3V6G A;  3ZQL A;  3LSR A;  3G1O A;  3NRG A;  5K7Z A;  3BR0 A;  3EGQ A;  1JT6 A;  4I6Z A;  5HAW A;  5CXI A;  2UXI A;  2UXU A;  3V78 A;  4UDS A;  2VKV A;  2VPR A;  4GFL A;  3ANG A;  5FKL A;  2FQ4 A;  4GFK A;  2QWT A;  2V57 A;  3FRQ A;  3O8G A;  3VVZ A;  1SGM A;  2NP5 A;  4L62 A;  3C07 A;  2XGC A;  3HE0 A;  3LJL A;  3RH2 A;  3LWJ A;  3ON2 A;  1JUS A;  5D1R A;  4GCK A;  4G12 A;  2XRL A;  4W1U A;  5EZG A;  2ZCN A;  3CRJ A;  2IEK A;  5D18 A;  1RPW A;  4B3A A;  4W97 A;  2WGB A;  3EUP A;  4JL3 A;  2QIB A;  3KKD A;  3BTI A;  2NX4 A;  4MK6 A;  4JKZ A;  2JJ7 A;  1U9N A;  3ZQH A;  5FKM A;  4V2F A;  4AC0 A;  2UXH A;  5K7F A;  5DAJ A;  5F0F A;  3HTI A;  4M3E A;  2GEN A;  4X1E A;  3COL A;  2Y31 A;  2HXI A;  2FX0 A;  5HSZ A;  3NPI A;  3SFI A;  4M3F A;  2QCO A;  4ABZ A;  3T6N A;  3Q0V A;  2ZCM A;  2EH3 A;  4D5C A;  4ME9 A;  1ORK A;  3QBM A;  3KKC A;  2DG7 A;  4AUX A; 
#chains in the Genus database with same CATH topology
 4XK4 A;  5F0H A;  4MXM A;  2ZOZ A;  3IH4 A;  4D7M A;  3P9T A;  3AQS A;  2XPW A;  4ACI A;  4NN1 A;  2UXO A;  2OF7 A;  2XPV A;  4B1R A;  3FIW A;  3IH2 A;  1ZKG A;  2XDN A;  3O60 A;  3VPR A;  5H9T A;  2ZCX A;  2B3W A;  4HKU A;  3BR2 A;  4GCT A;  2R7R A;  2ZB9 A;  5FKN A;  4C2M A;  3VVY A;  3KNW A;  5F1J A;  3DEW A;  2GBY A;  2RAS A;  3CCY A;  3K8P C;  3VW0 A;  5F08 A;  5IPA A;  4JNN A;  2XPU A;  2OER A;  3ANP A;  2NP3 A;  2GUH A;  5AQC A;  3CDL A;  3LSJ A;  5IOY A;  3NNR A;  3HGG A;  4CGR A;  4GCL A;  2B1E A;  5GPC A;  3CWR A;  4PXI A;  3TP3 A;  3BR6 A;  2PBX A;  1JUM A;  5FHP A;  2R7X A;  2OI8 A;  3MVP A;  2G7S A;  2R7W A;  5J3L A;  3HTA A;  2R7V A;  5IOZ A;  2FJ1 A;  1RKW A;  3NI7 A;  1QVT A;  3CJD A;  2OPT A;  2VKE A;  5HBU A;  2Y30 A;  2UXP A;  3QPL A;  3LHQ A;  2WUI A;  3B6C A;  2O7O A;  1T56 A;  4DVY P;  3FK7 A;  1QVU A;  5EFY A;  3S5R A;  5K58 A;  3VW2 A;  2D6Y A;  3ZQI A;  2YVE A;  3BR5 A;  3O8H A;  3SDG A;  5J1Y A;  1Z77 A;  1JUP A;  2GFN A;  3GZI A;  2XB5 A;  3WHC A;  3BNI A;  2HKU A;  5J1R A;  2G7L A;  4D7N A;  5CXG A;  5GP9 A;  5K7H A;  2IU5 A;  2G3B A;  5IP6 A;  5F27 A;  2F07 A;  3BTL A;  3B81 A;  3WHB A;  2W53 A;  2QOP A;  3JSJ A;  5FKO A;  5EYR A;  3F1B A;  2FD5 A;  2PFV A;  3HTH A;  3TP0 A;  3GEU A;  3DCF A;  1UI6 A;  5F0C A;  3BJB A;  3Q0U A;  5CQG A;  3IH3 A;  3LOC A;  3NXC A;  3G1L A;  3HIM A;  5FMP A;  3IUV A;  3C2B A;  2NS7 A;  3KYL A;  4NEL A;  2HXO A;  4DW6 A;  3RD3 A;  2X6O A;  2TRT A;  3ON4 A;  2Y2Z A;  3BQZ A;  2FJI 1;  3AQT A;  3ZQF A;  2REK A;  2R7U A;  3E7Q A;  2HQ5 A;  2ZY9 A;  2G7G A;  5EZH A;  3VUQ A;  3Q3S A;  1JTY A;  5F04 A;  2R7Q A;  3ZQG A;  3BT9 A;  5D19 A;  1Z0X A;  3NS4 A;  2ZOY A;  3BR1 A;  2G0E A;  1RKT A;  3QPS A;  3DU5 A;  3PM1 A;  3VOX A;  2ID3 A;  2I10 A;  3Q0W A;  2RHA A;  3DU6 A;  2FBQ A;  3BTC A;  4YZE A;  2IAI A;  2XGE A;  3BR3 A;  2XGD A;  4JYK A;  4M3B A;  3FK6 A;  4AF5 A;  4AC6 A;  4MO7 A;  1ZK8 A;  3VVX A;  4D5F A;  1JTX A;  2YVH A;  2HYJ A;  1VI0 A;  3HGY A;  5FGL A;  3VP5 A;  4IRV A;  3QKX A;  2PZ9 A;  3VIB A;  2DG8 A;  3LSP A;  3MNL A;  5CW8 A;  3B6A A;  3BHQ A;  2R7S A;  5J1U A;  3VW1 A;  2QTQ A;  2JK3 A;  3BRU A;  3G1M A;  5GPA A;  4V2G A;  2TCT A;  3PAS A;  2IBD A;  1QPI A;  2A2F X;  1JT0 A;  3G7R A;  1T33 A;  2Q24 A;  4U9N A;  3VOK A;  3DPJ A;  4KWA A;  3F0C A;  2QKO A;  3PPB A;  2R7O A;  2DTZ A;  3G56 A;  2O7T A;  4M3G A;  2WV1 A;  3BTJ A;  5C4Y A;  4M3D A;  2HYT A;  4ICH A;  3HTJ A;  3QQA A;  5FKK A;  2X9D A;  2YVX A;  1A6I A;  3BCG A;  3KZ9 A;  1UI5 A;  1BJZ A;  1U9O A;  2ID6 A;  2NS8 A;  2RAE A;  4I76 A;  3BQY A;  3V6G A;  3ZQL A;  4WIB A;  3LSR A;  3G1O A;  3NRG A;  5K7Z A;  3BR0 A;  3EGQ A;  1JT6 A;  4I6Z A;  3VTI A;  5HAW A;  5CXI A;  2UXI A;  2UXU A;  3V78 A;  4UDS A;  2VKV A;  2VPR A;  4GFL A;  3ANG A;  5FKL A;  2FQ4 A;  4GFK A;  2QWT A;  2V57 A;  3FRQ A;  3O8G A;  3VVZ A;  1SGM A;  2R7T A;  4OD4 A;  2NP5 A;  4L62 A;  3SWH A;  3C07 A;  2XGC A;  3HE0 A;  4OD5 A;  3LJL A;  3RH2 A;  3LWJ A;  3ON2 A;  1JUS A;  5D1R A;  4GCK A;  4G12 A;  2XRL A;  4W1U A;  5EZG A;  2ZCN A;  3CRJ A;  2IEK A;  5D18 A;  1RPW A;  4B3A A;  4W97 A;  2WGB A;  3EUP A;  4JL3 A;  2QIB A;  3KKD A;  3BTI A;  2NX4 A;  4MK6 A;  4JKZ A;  2JJ7 A;  1U9N A;  3ZQH A;  5FKM A;  4V2F A;  4AC0 A;  2UXH A;  5K7F A;  5DAJ A;  5F0F A;  3HTI A;  4M3E A;  2GEN A;  4X1E A;  3COL A;  2Y31 A;  2HXI A;  2FX0 A;  5HSZ A;  4U9L A;  3NPI A;  3SFI A;  4M3F A;  2QCO A;  4ABZ A;  3T6N A;  3Q0V A;  2ZCM A;  2EH3 A;  4D5C A;  4ME9 A;  3FHN A;  1ORK A;  3QBM A;  3KKC A;  2DG7 A;  4AUX A; 
#chains in the Genus database with same CATH homology
 4XK4 A;  5F0H A;  4MXM A;  2ZOZ A;  3IH4 A;  4D7M A;  3P9T A;  3AQS A;  2XPW A;  4ACI A;  4NN1 A;  2UXO A;  2OF7 A;  2XPV A;  4B1R A;  3FIW A;  3IH2 A;  1ZKG A;  2XDN A;  3O60 A;  3VPR A;  5H9T A;  2ZCX A;  4HKU A;  3BR2 A;  4GCT A;  2ZB9 A;  5FKN A;  3VVY A;  3KNW A;  5F1J A;  3DEW A;  2GBY A;  2RAS A;  3CCY A;  3VW0 A;  5F08 A;  5IPA A;  4JNN A;  2XPU A;  2OER A;  3ANP A;  2NP3 A;  2GUH A;  5AQC A;  3CDL A;  3LSJ A;  5IOY A;  3NNR A;  3HGG A;  4CGR A;  4GCL A;  5GPC A;  3CWR A;  4PXI A;  3TP3 A;  3BR6 A;  2PBX A;  1JUM A;  5FHP A;  2OI8 A;  3MVP A;  2G7S A;  5J3L A;  3HTA A;  5IOZ A;  2FJ1 A;  1RKW A;  3NI7 A;  1QVT A;  3CJD A;  2OPT A;  2VKE A;  5HBU A;  2Y30 A;  2UXP A;  3QPL A;  3LHQ A;  2WUI A;  3B6C A;  2O7O A;  1T56 A;  3FK7 A;  1QVU A;  5EFY A;  3S5R A;  5K58 A;  3VW2 A;  2D6Y A;  3ZQI A;  2YVE A;  3BR5 A;  3O8H A;  3SDG A;  5J1Y A;  1Z77 A;  1JUP A;  2GFN A;  3GZI A;  2XB5 A;  3WHC A;  3BNI A;  2HKU A;  5J1R A;  4D7N A;  2G7L A;  5CXG A;  5GP9 A;  5K7H A;  2IU5 A;  2G3B A;  5IP6 A;  5F27 A;  2F07 A;  3BTL A;  3B81 A;  3WHB A;  2W53 A;  2QOP A;  3JSJ A;  5FKO A;  5EYR A;  3F1B A;  2FD5 A;  3HTH A;  3TP0 A;  3GEU A;  3DCF A;  1UI6 A;  5F0C A;  3BJB A;  3Q0U A;  3IH3 A;  3LOC A;  3NXC A;  3G1L A;  3HIM A;  5FMP A;  3IUV A;  3C2B A;  2NS7 A;  4NEL A;  2HXO A;  4DW6 A;  3RD3 A;  2X6O A;  2TRT A;  3ON4 A;  2Y2Z A;  3BQZ A;  3AQT A;  3ZQF A;  2REK A;  3E7Q A;  2HQ5 A;  2G7G A;  5EZH A;  3VUQ A;  3Q3S A;  1JTY A;  5F04 A;  3ZQG A;  3BT9 A;  5D19 A;  1Z0X A;  2ZOY A;  3BR1 A;  2G0E A;  1RKT A;  3QPS A;  3PM1 A;  3VOX A;  2ID3 A;  2I10 A;  3Q0W A;  2RHA A;  2FBQ A;  3BTC A;  4YZE A;  2IAI A;  2XGE A;  3BR3 A;  2XGD A;  4JYK A;  4M3B A;  3FK6 A;  4AF5 A;  4AC6 A;  4MO7 A;  1ZK8 A;  3VVX A;  4D5F A;  1JTX A;  2YVH A;  2HYJ A;  1VI0 A;  3HGY A;  5FGL A;  3VP5 A;  3QKX A;  2PZ9 A;  3VIB A;  2DG8 A;  3LSP A;  3MNL A;  5CW8 A;  3B6A A;  3BHQ A;  5J1U A;  3VW1 A;  2QTQ A;  2JK3 A;  3BRU A;  3G1M A;  5GPA A;  4V2G A;  2TCT A;  3PAS A;  2IBD A;  1QPI A;  1JT0 A;  3G7R A;  1T33 A;  2Q24 A;  3VOK A;  3DPJ A;  4KWA A;  3F0C A;  2QKO A;  3PPB A;  2DTZ A;  3G56 A;  2O7T A;  4M3G A;  2WV1 A;  3BTJ A;  5C4Y A;  4M3D A;  2HYT A;  4ICH A;  3HTJ A;  3QQA A;  5FKK A;  2X9D A;  1A6I A;  3BCG A;  3KZ9 A;  1UI5 A;  1BJZ A;  1U9O A;  2ID6 A;  2NS8 A;  2RAE A;  4I76 A;  3BQY A;  3V6G A;  3ZQL A;  3LSR A;  3G1O A;  3NRG A;  5K7Z A;  3BR0 A;  3EGQ A;  1JT6 A;  4I6Z A;  5HAW A;  5CXI A;  2UXI A;  2UXU A;  3V78 A;  4UDS A;  2VKV A;  2VPR A;  4GFL A;  3ANG A;  5FKL A;  2FQ4 A;  4GFK A;  2QWT A;  2V57 A;  3FRQ A;  3O8G A;  3VVZ A;  1SGM A;  2NP5 A;  4L62 A;  3C07 A;  2XGC A;  3HE0 A;  3LJL A;  3RH2 A;  3LWJ A;  3ON2 A;  1JUS A;  5D1R A;  4GCK A;  4G12 A;  2XRL A;  4W1U A;  5EZG A;  2ZCN A;  3CRJ A;  2IEK A;  5D18 A;  1RPW A;  4B3A A;  4W97 A;  2WGB A;  3EUP A;  4JL3 A;  2QIB A;  3KKD A;  3BTI A;  2NX4 A;  4MK6 A;  4JKZ A;  2JJ7 A;  1U9N A;  3ZQH A;  5FKM A;  4V2F A;  4AC0 A;  2UXH A;  5K7F A;  5DAJ A;  5F0F A;  3HTI A;  4M3E A;  2GEN A;  4X1E A;  3COL A;  2Y31 A;  2HXI A;  2FX0 A;  5HSZ A;  3NPI A;  3SFI A;  4M3F A;  2QCO A;  4ABZ A;  3T6N A;  3Q0V A;  2ZCM A;  2EH3 A;  4D5C A;  4ME9 A;  1ORK A;  3QBM A;  3KKC A;  2DG7 A;  4AUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...