2FBQA

The crystal structure of transcriptional regulator pa3006
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
213
structure length
213
Chain Sequence
b'AQSETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFLGPFCASLEKELDRRQAKPEAQHATLEDLLHLLVSQAMAVKPRSGNDLSIFMRLLGLAFSQSQGHLRKYLEEVYGKVFRRYMLLVNEAAPKLPPIELFWRVHFMLGAAAFSMSGIKALRAMAETDFGVNTSTEQVMHLMVPFFAAGMRAESGID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
molecule tags Transcription
source organism Pseudomonas aeruginosa
publication title The crystal structure of transcriptional regulator PA3006
rcsb
total genus 88
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fbqA00
2G7SA 3GZIA 5FGLA 3MVPA 2XGDA 5FKNA 2JK3A 3BTCA 3LSJA 4D7MA 2NS7A 4MO7A 5J1YA 3LHQA 2VKEA 1JUMA 1JUSA 2WGBA 2GFNA 5F27A 5K7FA 4MK6A 4X1EA 3VP5A 5J1UA 1UI6A 3LSPA 1QPIA 2PZ9A 3EGQA 3G7RA 2XPUA 3SDGA 3BNIA 4JYKA 2IAIA 2OF7A 4JNNA 3G1LA 4PXIA 2OPTA 2PBXA 4D5CA 4ABZA 3AQTA 4G12A 2RAEA 5AQCA 3VVYA 4UDSA 3E7QA 4M3FA 5F0FA 5FKMA 2Q24A 3CDLA 2VPRA 3GEUA 3JSJA 5IP6A 2EH3A 3ZQIA 3LSRA 2FD5A 3COLA 3IUVA 3VOKA 2QKOA 3LJLA 2NP3A 4GCKA 2Y31A 3VIBA 5F0CA 4AUXA 2W53A 5GP9A 4M3BA 4AC6A 3Q0VA 3B6AA 4L62A 4GCLA 3VW1A 2NS8A 3BQYA 3B81A 5IPAA 3ON2A 4YZEA 3ZQFA 3BRUA 3QPLA 3HTHA 4I76A 3C07A 5D19A 5GPCA 5CXIA 3HGYA 5FKOA 3RH2A 3VVZA 4W97A 2UXPA 2FBQA 2TCTA 1SGMA 4ACIA 3KKCA 2IBDA 3BR5A 3WHBA 4M3EA 3KNWA 2ZCNA 2HQ5A 3CJDA 3SFIA 3NXCA 2XRLA 4GFKA 2XPWA 5DAJA 2HYTA 1A6IA 4JKZA 3ZQLA 2G0EA 4GCTA 4M3GA 2ZB9A 3QQAA 5EZHA 2HXOA 5HAWA 2HXIA 5IOYA 4GFLA 5EYRA 4AC0A 1BJZA 3FRQA 4HKUA 3WHCA 3HIMA 4V2GA 3ANGA 3VW0A 2GUHA 3Q0UA 4ME9A 3CWRA 3BTLA 2F07A 2ID6A 2OERA 3ANPA 2FX0A 2QTQA 2HKUA 3O8HA 2DTZA 2RASA 4NN1A 2Y2ZA 5EZGA 1T33A 2REKA 3V78A 3G1MA 2ZOYA 2IU5A 3PASA 3FK7A 3ZQHA 2XGEA 1Z77A 3VPRA 3BR3A 2UXOA 4D5FA 3FK6A 1RKWA 3IH3A 1U9OA 5J1RA 1RPWA 2ZCXA 1JT0A 1JTYA 2DG8A 1QVTA 3HTIA 3KZ9A 3QKXA 3ON4A 3BCGA 3FIWA 5J3LA 3BR0A 3BT9A 2YVHA 5K58A 2UXHA 2O7TA 5CXGA 4V2FA 2G3BA 3ZQGA 2G7GA 4MXMA 3DCFA 2UXUA 3QBMA 2O7OA 3PM1A 3QPSA 5C4YA 3O8GA 4W1UA 3TP3A 4KWAA 2WV1A 2GENA 3EUPA 1UI5A 4B1RA 3AQSA 1T56A 2YVEA 2HYJA 2WUIA 2OI8A 3T6NA 3S5RA 2NX4A 2XPVA 4M3DA 3VW2A 5D18A 3V6GA 3B6CA 5F08A 3G1OA 5HSZA 2GBYA 3KKDA 3BR2A 3NNRA 5FKLA 2XGCA 4I6ZA 3F0CA 2XB5A 2IEKA 2QIBA 3PPBA 3BTIA 3IH2A 3NPIA 2X6OA 3HTJA 2V57A 2ZCMA 3O60A 5K7HA 5CW8A 3BHQA 4CGRA 1QVUA 3NRGA 2G7LA 2I10A 2UXIA 2RHAA 2NP5A 5IOZA 5GPAA 2QCOA 4XK4A 5F1JA 4NELA 1VI0A 3LOCA 4JL3A 3P9TA 1Z0XA 3BR1A 2VKVA 4B3AA 5EFYA 3VOXA 2DG7A 5F0HA 2ZOZA 3HE0A 1JUPA 4AF5A 3BJBA 4D7NA 3RD3A 1ZKGA 5FHPA 2QWTA 3C2BA 3G56A 2QOPA 3MNLA 2TRTA 2XDNA 2JJ7A 1RKTA 3IH4A 5K7ZA 3TP0A 2X9DA 3BTJA 2FJ1A 2FQ4A 5H9TA 1JTXA 4DW6A 5FKKA 3LWJA 5D1RA 3F1BA 3VVXA 2ID3A 5HBUA 3VUQA 1ZK8A 2Y30A 3BR6A 3CCYA 3HTAA 2D6YA 1JT6A 3Q0WA 1ORKA 3BQZA 3CRJA 3NI7A 3DPJA 4ICHA 5FMPA 5F04A 1U9NA 3HGGA 3Q3SA 3DEWA
chains in the Genus database with same CATH superfamily
2G7SA 3GZIA 5FGLA 3MVPA 2XGDA 5FKNA 2JK3A 3KYLA 3K8PC 3BTCA 3LSJA 4D7MA 2NS7A 4MO7A 5J1YA 3LHQA 2VKEA 1JUMA 1JUSA 2WGBA 2GFNA 5F27A 5K7FA 4MK6A 2R7SA 2R7VA 4X1EA 3VP5A 5J1UA 1UI6A 3LSPA 1QPIA 3FHNA 2PZ9A 3EGQA 3G7RA 2XPUA 3SDGA 3BNIA 4JYKA 2IAIA 2OF7A 4JNNA 3G1LA 4PXIA 2OPTA 2PBXA 4D5CA 4ABZA 4U9LA 2R7XA 3AQTA 4G12A 2RAEA 5AQCA 3VVYA 4UDSA 3E7QA 3NS4A 4M3FA 5F0FA 5FKMA 2Q24A 3CDLA 2VPRA 3GEUA 3JSJA 5IP6A 2EH3A 3ZQIA 3LSRA 2FD5A 3COLA 3IUVA 3VOKA 2QKOA 3LJLA 2NP3A 4GCKA 2Y31A 3VIBA 5F0CA 4AUXA 2W53A 5GP9A 4M3BA 4AC6A 3Q0VA 2FJI1 3B6AA 4L62A 4GCLA 3VW1A 2NS8A 3BQYA 3B81A 5IPAA 3ON2A 4YZEA 3ZQFA 3BRUA 3QPLA 3HTHA 4I76A 3C07A 2A2FX 5D19A 5GPCA 5CXIA 3HGYA 5FKOA 3RH2A 3VVZA 4W97A 2UXPA 2FBQA 2TCTA 1SGMA 4ACIA 3KKCA 2IBDA 3BR5A 3WHBA 4M3EA 3KNWA 2ZCNA 2HQ5A 3CJDA 3SFIA 3NXCA 2XRLA 4GFKA 2XPWA 5DAJA 2HYTA 1A6IA 4JKZA 3ZQLA 2G0EA 4GCTA 4M3GA 2ZB9A 3QQAA 5EZHA 2PFVA 2HXOA 5HAWA 2HXIA 5IOYA 4GFLA 5EYRA 4AC0A 1BJZA 3FRQA 4HKUA 3WHCA 3HIMA 4WIBA 4V2GA 3ANGA 3VW0A 2GUHA 3DU5A 3Q0UA 4ME9A 3CWRA 3BTLA 2F07A 2R7OA 2ID6A 2OERA 3ANPA 2FX0A 2QTQA 2B3WA 2HKUA 3O8HA 2B1EA 2DTZA 2RASA 4NN1A 2Y2ZA 5EZGA 1T33A 2REKA 3V78A 3G1MA 2ZOYA 2IU5A 3PASA 3FK7A 3ZQHA 2XGEA 1Z77A 3VPRA 3BR3A 2UXOA 4D5FA 3FK6A 1RKWA 3IH3A 1U9OA 2R7TA 5J1RA 1RPWA 2ZCXA 1JT0A 1JTYA 2DG8A 1QVTA 3HTIA 3KZ9A 3QKXA 3ON4A 4OD4A 3BCGA 3FIWA 5J3LA 3BR0A 3BT9A 2YVHA 5K58A 2UXHA 2O7TA 2R7UA 5CXGA 4V2FA 2G3BA 3ZQGA 2G7GA 4MXMA 3DCFA 2UXUA 3QBMA 2O7OA 3PM1A 3QPSA 5C4YA 3O8GA 4W1UA 3TP3A 4KWAA 2WV1A 2GENA 3EUPA 3SWHA 1UI5A 4B1RA 4OD5A 3AQSA 1T56A 2YVEA 2HYJA 2WUIA 2OI8A 3T6NA 3S5RA 2NX4A 2XPVA 4M3DA 3VW2A 5D18A 3V6GA 3B6CA 5F08A 4DVYP 2YVXA 3G1OA 5HSZA 2GBYA 3KKDA 2R7QA 3BR2A 3NNRA 5FKLA 2XGCA 4I6ZA 3F0CA 2XB5A 2IEKA 2QIBA 3PPBA 3BTIA 3IH2A 3NPIA 2X6OA 3HTJA 2V57A 2ZCMA 3O60A 5K7HA 5CW8A 3BHQA 4CGRA 1QVUA 3NRGA 2G7LA 2I10A 2UXIA 2RHAA 2NP5A 5IOZA 5CQGA 5GPAA 2QCOA 4XK4A 5F1JA 3VTIA 4NELA 1VI0A 3LOCA 4JL3A 3P9TA 1Z0XA 3BR1A 4IRVA 2VKVA 4B3AA 5EFYA 3VOXA 2DG7A 5F0HA 2ZY9A 2ZOZA 3HE0A 1JUPA 4AF5A 3BJBA 4D7NA 4U9NA 3RD3A 1ZKGA 2R7WA 3DU6A 5FHPA 2QWTA 3C2BA 3G56A 2QOPA 3MNLA 2R7RA 2TRTA 2XDNA 4C2MA 2JJ7A 1RKTA 3IH4A 5K7ZA 3TP0A 2X9DA 3BTJA 2FJ1A 2FQ4A 5H9TA 1JTXA 4DW6A 5FKKA 3LWJA 5D1RA 3F1BA 3VVXA 2ID3A 5HBUA 3VUQA 1ZK8A 2Y30A 3BR6A 3CCYA 3HTAA 2D6YA 1JT6A 3Q0WA 1ORKA 3BQZA 3CRJA 3NI7A 3DPJA 4ICHA 5FMPA 5F04A 1U9NA 3HGGA 3Q3SA 3DEWA
chains in the Genus database with same CATH topology
2G7SA 3GZIA 5FGLA 3MVPA 2XGDA 5FKNA 2JK3A 3BTCA 3LSJA 4D7MA 2NS7A 4MO7A 5J1YA 3LHQA 2VKEA 1JUMA 1JUSA 2WGBA 2GFNA 5F27A 5K7FA 4MK6A 4X1EA 3VP5A 5J1UA 1UI6A 3LSPA 1QPIA 2PZ9A 3EGQA 3G7RA 2XPUA 3SDGA 3BNIA 4JYKA 2IAIA 2OF7A 4JNNA 3G1LA 4PXIA 2OPTA 2PBXA 4D5CA 4ABZA 3AQTA 4G12A 2RAEA 5AQCA 3VVYA 4UDSA 3E7QA 4M3FA 5F0FA 5FKMA 2Q24A 3CDLA 2VPRA 3GEUA 3JSJA 5IP6A 2EH3A 3ZQIA 3LSRA 2FD5A 3COLA 3IUVA 3VOKA 2QKOA 3LJLA 2NP3A 4GCKA 2Y31A 3VIBA 5F0CA 4AUXA 2W53A 5GP9A 4M3BA 4AC6A 3Q0VA 3B6AA 4L62A 4GCLA 3VW1A 2NS8A 3BQYA 3B81A 5IPAA 3ON2A 4YZEA 3ZQFA 3BRUA 3QPLA 3HTHA 4I76A 3C07A 5D19A 5GPCA 5CXIA 3HGYA 5FKOA 3RH2A 3VVZA 4W97A 2UXPA 2FBQA 2TCTA 1SGMA 4ACIA 3KKCA 2IBDA 3BR5A 3WHBA 4M3EA 3KNWA 2ZCNA 2HQ5A 3CJDA 3SFIA 3NXCA 2XRLA 4GFKA 2XPWA 5DAJA 2HYTA 1A6IA 4JKZA 3ZQLA 2G0EA 4GCTA 4M3GA 2ZB9A 3QQAA 5EZHA 2HXOA 5HAWA 2HXIA 5IOYA 4GFLA 5EYRA 4AC0A 1BJZA 3FRQA 4HKUA 3WHCA 3HIMA 4V2GA 3ANGA 3VW0A 2GUHA 3Q0UA 4ME9A 3CWRA 3BTLA 2F07A 2ID6A 2OERA 3ANPA 2FX0A 2QTQA 2HKUA 3O8HA 2DTZA 2RASA 4NN1A 2Y2ZA 5EZGA 1T33A 2REKA 3V78A 3G1MA 2ZOYA 2IU5A 3PASA 3FK7A 3ZQHA 2XGEA 1Z77A 3VPRA 3BR3A 2UXOA 4D5FA 3FK6A 1RKWA 3IH3A 1U9OA 5J1RA 1RPWA 2ZCXA 1JT0A 1JTYA 2DG8A 1QVTA 3HTIA 3KZ9A 3QKXA 3ON4A 3BCGA 3FIWA 5J3LA 3BR0A 3BT9A 2YVHA 5K58A 2UXHA 2O7TA 5CXGA 4V2FA 2G3BA 3ZQGA 2G7GA 4MXMA 3DCFA 2UXUA 3QBMA 2O7OA 3PM1A 3QPSA 5C4YA 3O8GA 4W1UA 3TP3A 4KWAA 2WV1A 2GENA 3EUPA 1UI5A 4B1RA 3AQSA 1T56A 2YVEA 2HYJA 2WUIA 2OI8A 3T6NA 3S5RA 2NX4A 2XPVA 4M3DA 3VW2A 5D18A 3V6GA 3B6CA 5F08A 3G1OA 5HSZA 2GBYA 3KKDA 3BR2A 3NNRA 5FKLA 2XGCA 4I6ZA 3F0CA 2XB5A 2IEKA 2QIBA 3PPBA 3BTIA 3IH2A 3NPIA 2X6OA 3HTJA 2V57A 2ZCMA 3O60A 5K7HA 5CW8A 3BHQA 4CGRA 1QVUA 3NRGA 2G7LA 2I10A 2UXIA 2RHAA 2NP5A 5IOZA 5GPAA 2QCOA 4XK4A 5F1JA 4NELA 1VI0A 3LOCA 4JL3A 3P9TA 1Z0XA 3BR1A 2VKVA 4B3AA 5EFYA 3VOXA 2DG7A 5F0HA 2ZOZA 3HE0A 1JUPA 4AF5A 3BJBA 4D7NA 3RD3A 1ZKGA 5FHPA 2QWTA 3C2BA 3G56A 2QOPA 3MNLA 2TRTA 2XDNA 2JJ7A 1RKTA 3IH4A 5K7ZA 3TP0A 2X9DA 3BTJA 2FJ1A 2FQ4A 5H9TA 1JTXA 4DW6A 5FKKA 3LWJA 5D1RA 3F1BA 3VVXA 2ID3A 5HBUA 3VUQA 1ZK8A 2Y30A 3BR6A 3CCYA 3HTAA 2D6YA 1JT6A 3Q0WA 1ORKA 3BQZA 3CRJA 3NI7A 3DPJA 4ICHA 5FMPA 5F04A 1U9NA 3HGGA 3Q3SA 3DEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7S A;  3GZI A;  5FGL A;  3MVP A;  2XGD A;  5FKN A;  2JK3 A;  3BTC A;  3LSJ A;  4D7M A;  2NS7 A;  4MO7 A;  5J1Y A;  3LHQ A;  2VKE A;  1JUM A;  1JUS A;  2WGB A;  2GFN A;  5F27 A;  5K7F A;  4MK6 A;  4X1E A;  3VP5 A;  5J1U A;  1UI6 A;  3LSP A;  1QPI A;  2PZ9 A;  3EGQ A;  3G7R A;  2XPU A;  3SDG A;  3BNI A;  4JYK A;  2IAI A;  2OF7 A;  4JNN A;  3G1L A;  4PXI A;  2OPT A;  2PBX A;  4D5C A;  4ABZ A;  3AQT A;  4G12 A;  2RAE A;  5AQC A;  3VVY A;  4UDS A;  3E7Q A;  4M3F A;  5F0F A;  5FKM A;  2Q24 A;  3CDL A;  2VPR A;  3GEU A;  3JSJ A;  5IP6 A;  2EH3 A;  3ZQI A;  3LSR A;  2FD5 A;  3COL A;  3IUV A;  3VOK A;  2QKO A;  3LJL A;  2NP3 A;  4GCK A;  2Y31 A;  3VIB A;  5F0C A;  4AUX A;  2W53 A;  5GP9 A;  4M3B A;  4AC6 A;  3Q0V A;  3B6A A;  4L62 A;  4GCL A;  3VW1 A;  2NS8 A;  3BQY A;  3B81 A;  5IPA A;  3ON2 A;  4YZE A;  3ZQF A;  3BRU A;  3QPL A;  3HTH A;  4I76 A;  3C07 A;  5D19 A;  5GPC A;  5CXI A;  3HGY A;  5FKO A;  3RH2 A;  3VVZ A;  4W97 A;  2UXP A;  2FBQ A;  2TCT A;  1SGM A;  4ACI A;  3KKC A;  2IBD A;  3BR5 A;  3WHB A;  4M3E A;  3KNW A;  2ZCN A;  2HQ5 A;  3CJD A;  3SFI A;  3NXC A;  2XRL A;  4GFK A;  2XPW A;  5DAJ A;  2HYT A;  1A6I A;  4JKZ A;  3ZQL A;  2G0E A;  4GCT A;  4M3G A;  2ZB9 A;  3QQA A;  5EZH A;  2HXO A;  5HAW A;  2HXI A;  5IOY A;  4GFL A;  5EYR A;  4AC0 A;  1BJZ A;  3FRQ A;  4HKU A;  3WHC A;  3HIM A;  4V2G A;  3ANG A;  3VW0 A;  2GUH A;  3Q0U A;  4ME9 A;  3CWR A;  3BTL A;  2F07 A;  2ID6 A;  2OER A;  3ANP A;  2FX0 A;  2QTQ A;  2HKU A;  3O8H A;  2DTZ A;  2RAS A;  4NN1 A;  2Y2Z A;  5EZG A;  1T33 A;  2REK A;  3V78 A;  3G1M A;  2ZOY A;  2IU5 A;  3PAS A;  3FK7 A;  3ZQH A;  2XGE A;  1Z77 A;  3VPR A;  3BR3 A;  2UXO A;  4D5F A;  3FK6 A;  1RKW A;  3IH3 A;  1U9O A;  5J1R A;  1RPW A;  2ZCX A;  1JT0 A;  1JTY A;  2DG8 A;  1QVT A;  3HTI A;  3KZ9 A;  3QKX A;  3ON4 A;  3BCG A;  3FIW A;  5J3L A;  3BR0 A;  3BT9 A;  2YVH A;  5K58 A;  2UXH A;  2O7T A;  5CXG A;  4V2F A;  2G3B A;  3ZQG A;  2G7G A;  4MXM A;  3DCF A;  2UXU A;  3QBM A;  2O7O A;  3PM1 A;  3QPS A;  5C4Y A;  3O8G A;  4W1U A;  3TP3 A;  4KWA A;  2WV1 A;  2GEN A;  3EUP A;  1UI5 A;  4B1R A;  3AQS A;  1T56 A;  2YVE A;  2HYJ A;  2WUI A;  2OI8 A;  3T6N A;  3S5R A;  2NX4 A;  2XPV A;  4M3D A;  3VW2 A;  5D18 A;  3V6G A;  3B6C A;  5F08 A;  3G1O A;  5HSZ A;  2GBY A;  3KKD A;  3BR2 A;  3NNR A;  5FKL A;  2XGC A;  4I6Z A;  3F0C A;  2XB5 A;  2IEK A;  2QIB A;  3PPB A;  3BTI A;  3IH2 A;  3NPI A;  2X6O A;  3HTJ A;  2V57 A;  2ZCM A;  3O60 A;  5K7H A;  5CW8 A;  3BHQ A;  4CGR A;  1QVU A;  3NRG A;  2G7L A;  2I10 A;  2UXI A;  2RHA A;  2NP5 A;  5IOZ A;  5GPA A;  2QCO A;  4XK4 A;  5F1J A;  4NEL A;  1VI0 A;  3LOC A;  4JL3 A;  3P9T A;  1Z0X A;  3BR1 A;  2VKV A;  4B3A A;  5EFY A;  3VOX A;  2DG7 A;  5F0H A;  2ZOZ A;  3HE0 A;  1JUP A;  4AF5 A;  3BJB A;  4D7N A;  3RD3 A;  1ZKG A;  5FHP A;  2QWT A;  3C2B A;  3G56 A;  2QOP A;  3MNL A;  2TRT A;  2XDN A;  2JJ7 A;  1RKT A;  3IH4 A;  5K7Z A;  3TP0 A;  2X9D A;  3BTJ A;  2FJ1 A;  2FQ4 A;  5H9T A;  1JTX A;  4DW6 A;  5FKK A;  3LWJ A;  5D1R A;  3F1B A;  3VVX A;  2ID3 A;  5HBU A;  3VUQ A;  1ZK8 A;  2Y30 A;  3BR6 A;  3CCY A;  3HTA A;  2D6Y A;  1JT6 A;  3Q0W A;  1ORK A;  3BQZ A;  3CRJ A;  3NI7 A;  3DPJ A;  4ICH A;  5FMP A;  5F04 A;  1U9N A;  3HGG A;  3Q3S A;  3DEW A; 
#chains in the Genus database with same CATH topology
 2G7S A;  3GZI A;  5FGL A;  3MVP A;  2XGD A;  5FKN A;  2JK3 A;  3KYL A;  3K8P C;  3BTC A;  3LSJ A;  4D7M A;  2NS7 A;  4MO7 A;  5J1Y A;  3LHQ A;  2VKE A;  1JUM A;  1JUS A;  2WGB A;  2GFN A;  5F27 A;  5K7F A;  4MK6 A;  2R7S A;  2R7V A;  4X1E A;  3VP5 A;  5J1U A;  1UI6 A;  3LSP A;  1QPI A;  3FHN A;  2PZ9 A;  3EGQ A;  3G7R A;  2XPU A;  3SDG A;  3BNI A;  4JYK A;  2IAI A;  2OF7 A;  4JNN A;  3G1L A;  4PXI A;  2OPT A;  2PBX A;  4D5C A;  4ABZ A;  4U9L A;  2R7X A;  3AQT A;  4G12 A;  2RAE A;  5AQC A;  3VVY A;  4UDS A;  3E7Q A;  3NS4 A;  4M3F A;  5F0F A;  5FKM A;  2Q24 A;  3CDL A;  2VPR A;  3GEU A;  3JSJ A;  5IP6 A;  2EH3 A;  3ZQI A;  3LSR A;  2FD5 A;  3COL A;  3IUV A;  3VOK A;  2QKO A;  3LJL A;  2NP3 A;  4GCK A;  2Y31 A;  3VIB A;  5F0C A;  4AUX A;  2W53 A;  5GP9 A;  4M3B A;  4AC6 A;  3Q0V A;  2FJI 1;  3B6A A;  4L62 A;  4GCL A;  3VW1 A;  2NS8 A;  3BQY A;  3B81 A;  5IPA A;  3ON2 A;  4YZE A;  3ZQF A;  3BRU A;  3QPL A;  3HTH A;  4I76 A;  3C07 A;  2A2F X;  5D19 A;  5GPC A;  5CXI A;  3HGY A;  5FKO A;  3RH2 A;  3VVZ A;  4W97 A;  2UXP A;  2FBQ A;  2TCT A;  1SGM A;  4ACI A;  3KKC A;  2IBD A;  3BR5 A;  3WHB A;  4M3E A;  3KNW A;  2ZCN A;  2HQ5 A;  3CJD A;  3SFI A;  3NXC A;  2XRL A;  4GFK A;  2XPW A;  5DAJ A;  2HYT A;  1A6I A;  4JKZ A;  3ZQL A;  2G0E A;  4GCT A;  4M3G A;  2ZB9 A;  3QQA A;  5EZH A;  2PFV A;  2HXO A;  5HAW A;  2HXI A;  5IOY A;  4GFL A;  5EYR A;  4AC0 A;  1BJZ A;  3FRQ A;  4HKU A;  3WHC A;  3HIM A;  4WIB A;  4V2G A;  3ANG A;  3VW0 A;  2GUH A;  3DU5 A;  3Q0U A;  4ME9 A;  3CWR A;  3BTL A;  2F07 A;  2R7O A;  2ID6 A;  2OER A;  3ANP A;  2FX0 A;  2QTQ A;  2B3W A;  2HKU A;  3O8H A;  2B1E A;  2DTZ A;  2RAS A;  4NN1 A;  2Y2Z A;  5EZG A;  1T33 A;  2REK A;  3V78 A;  3G1M A;  2ZOY A;  2IU5 A;  3PAS A;  3FK7 A;  3ZQH A;  2XGE A;  1Z77 A;  3VPR A;  3BR3 A;  2UXO A;  4D5F A;  3FK6 A;  1RKW A;  3IH3 A;  1U9O A;  2R7T A;  5J1R A;  1RPW A;  2ZCX A;  1JT0 A;  1JTY A;  2DG8 A;  1QVT A;  3HTI A;  3KZ9 A;  3QKX A;  3ON4 A;  4OD4 A;  3BCG A;  3FIW A;  5J3L A;  3BR0 A;  3BT9 A;  2YVH A;  5K58 A;  2UXH A;  2O7T A;  2R7U A;  5CXG A;  4V2F A;  2G3B A;  3ZQG A;  2G7G A;  4MXM A;  3DCF A;  2UXU A;  3QBM A;  2O7O A;  3PM1 A;  3QPS A;  5C4Y A;  3O8G A;  4W1U A;  3TP3 A;  4KWA A;  2WV1 A;  2GEN A;  3EUP A;  3SWH A;  1UI5 A;  4B1R A;  4OD5 A;  3AQS A;  1T56 A;  2YVE A;  2HYJ A;  2WUI A;  2OI8 A;  3T6N A;  3S5R A;  2NX4 A;  2XPV A;  4M3D A;  3VW2 A;  5D18 A;  3V6G A;  3B6C A;  5F08 A;  4DVY P;  2YVX A;  3G1O A;  5HSZ A;  2GBY A;  3KKD A;  2R7Q A;  3BR2 A;  3NNR A;  5FKL A;  2XGC A;  4I6Z A;  3F0C A;  2XB5 A;  2IEK A;  2QIB A;  3PPB A;  3BTI A;  3IH2 A;  3NPI A;  2X6O A;  3HTJ A;  2V57 A;  2ZCM A;  3O60 A;  5K7H A;  5CW8 A;  3BHQ A;  4CGR A;  1QVU A;  3NRG A;  2G7L A;  2I10 A;  2UXI A;  2RHA A;  2NP5 A;  5IOZ A;  5CQG A;  5GPA A;  2QCO A;  4XK4 A;  5F1J A;  3VTI A;  4NEL A;  1VI0 A;  3LOC A;  4JL3 A;  3P9T A;  1Z0X A;  3BR1 A;  4IRV A;  2VKV A;  4B3A A;  5EFY A;  3VOX A;  2DG7 A;  5F0H A;  2ZY9 A;  2ZOZ A;  3HE0 A;  1JUP A;  4AF5 A;  3BJB A;  4D7N A;  4U9N A;  3RD3 A;  1ZKG A;  2R7W A;  3DU6 A;  5FHP A;  2QWT A;  3C2B A;  3G56 A;  2QOP A;  3MNL A;  2R7R A;  2TRT A;  2XDN A;  4C2M A;  2JJ7 A;  1RKT A;  3IH4 A;  5K7Z A;  3TP0 A;  2X9D A;  3BTJ A;  2FJ1 A;  2FQ4 A;  5H9T A;  1JTX A;  4DW6 A;  5FKK A;  3LWJ A;  5D1R A;  3F1B A;  3VVX A;  2ID3 A;  5HBU A;  3VUQ A;  1ZK8 A;  2Y30 A;  3BR6 A;  3CCY A;  3HTA A;  2D6Y A;  1JT6 A;  3Q0W A;  1ORK A;  3BQZ A;  3CRJ A;  3NI7 A;  3DPJ A;  4ICH A;  5FMP A;  5F04 A;  1U9N A;  3HGG A;  3Q3S A;  3DEW A; 
#chains in the Genus database with same CATH homology
 2G7S A;  3GZI A;  5FGL A;  3MVP A;  2XGD A;  5FKN A;  2JK3 A;  3BTC A;  3LSJ A;  4D7M A;  2NS7 A;  4MO7 A;  5J1Y A;  3LHQ A;  2VKE A;  1JUM A;  1JUS A;  2WGB A;  2GFN A;  5F27 A;  5K7F A;  4MK6 A;  4X1E A;  3VP5 A;  5J1U A;  1UI6 A;  3LSP A;  1QPI A;  2PZ9 A;  3EGQ A;  3G7R A;  2XPU A;  3SDG A;  3BNI A;  4JYK A;  2IAI A;  2OF7 A;  4JNN A;  3G1L A;  4PXI A;  2OPT A;  2PBX A;  4D5C A;  4ABZ A;  3AQT A;  4G12 A;  2RAE A;  5AQC A;  3VVY A;  4UDS A;  3E7Q A;  4M3F A;  5F0F A;  5FKM A;  2Q24 A;  3CDL A;  2VPR A;  3GEU A;  3JSJ A;  5IP6 A;  2EH3 A;  3ZQI A;  3LSR A;  2FD5 A;  3COL A;  3IUV A;  3VOK A;  2QKO A;  3LJL A;  2NP3 A;  4GCK A;  2Y31 A;  3VIB A;  5F0C A;  4AUX A;  2W53 A;  5GP9 A;  4M3B A;  4AC6 A;  3Q0V A;  3B6A A;  4L62 A;  4GCL A;  3VW1 A;  2NS8 A;  3BQY A;  3B81 A;  5IPA A;  3ON2 A;  4YZE A;  3ZQF A;  3BRU A;  3QPL A;  3HTH A;  4I76 A;  3C07 A;  5D19 A;  5GPC A;  5CXI A;  3HGY A;  5FKO A;  3RH2 A;  3VVZ A;  4W97 A;  2UXP A;  2FBQ A;  2TCT A;  1SGM A;  4ACI A;  3KKC A;  2IBD A;  3BR5 A;  3WHB A;  4M3E A;  3KNW A;  2ZCN A;  2HQ5 A;  3CJD A;  3SFI A;  3NXC A;  2XRL A;  4GFK A;  2XPW A;  5DAJ A;  2HYT A;  1A6I A;  4JKZ A;  3ZQL A;  2G0E A;  4GCT A;  4M3G A;  2ZB9 A;  3QQA A;  5EZH A;  2HXO A;  5HAW A;  2HXI A;  5IOY A;  4GFL A;  5EYR A;  4AC0 A;  1BJZ A;  3FRQ A;  4HKU A;  3WHC A;  3HIM A;  4V2G A;  3ANG A;  3VW0 A;  2GUH A;  3Q0U A;  4ME9 A;  3CWR A;  3BTL A;  2F07 A;  2ID6 A;  2OER A;  3ANP A;  2FX0 A;  2QTQ A;  2HKU A;  3O8H A;  2DTZ A;  2RAS A;  4NN1 A;  2Y2Z A;  5EZG A;  1T33 A;  2REK A;  3V78 A;  3G1M A;  2ZOY A;  2IU5 A;  3PAS A;  3FK7 A;  3ZQH A;  2XGE A;  1Z77 A;  3VPR A;  3BR3 A;  2UXO A;  4D5F A;  3FK6 A;  1RKW A;  3IH3 A;  1U9O A;  5J1R A;  1RPW A;  2ZCX A;  1JT0 A;  1JTY A;  2DG8 A;  1QVT A;  3HTI A;  3KZ9 A;  3QKX A;  3ON4 A;  3BCG A;  3FIW A;  5J3L A;  3BR0 A;  3BT9 A;  2YVH A;  5K58 A;  2UXH A;  2O7T A;  5CXG A;  4V2F A;  2G3B A;  3ZQG A;  2G7G A;  4MXM A;  3DCF A;  2UXU A;  3QBM A;  2O7O A;  3PM1 A;  3QPS A;  5C4Y A;  3O8G A;  4W1U A;  3TP3 A;  4KWA A;  2WV1 A;  2GEN A;  3EUP A;  1UI5 A;  4B1R A;  3AQS A;  1T56 A;  2YVE A;  2HYJ A;  2WUI A;  2OI8 A;  3T6N A;  3S5R A;  2NX4 A;  2XPV A;  4M3D A;  3VW2 A;  5D18 A;  3V6G A;  3B6C A;  5F08 A;  3G1O A;  5HSZ A;  2GBY A;  3KKD A;  3BR2 A;  3NNR A;  5FKL A;  2XGC A;  4I6Z A;  3F0C A;  2XB5 A;  2IEK A;  2QIB A;  3PPB A;  3BTI A;  3IH2 A;  3NPI A;  2X6O A;  3HTJ A;  2V57 A;  2ZCM A;  3O60 A;  5K7H A;  5CW8 A;  3BHQ A;  4CGR A;  1QVU A;  3NRG A;  2G7L A;  2I10 A;  2UXI A;  2RHA A;  2NP5 A;  5IOZ A;  5GPA A;  2QCO A;  4XK4 A;  5F1J A;  4NEL A;  1VI0 A;  3LOC A;  4JL3 A;  3P9T A;  1Z0X A;  3BR1 A;  2VKV A;  4B3A A;  5EFY A;  3VOX A;  2DG7 A;  5F0H A;  2ZOZ A;  3HE0 A;  1JUP A;  4AF5 A;  3BJB A;  4D7N A;  3RD3 A;  1ZKG A;  5FHP A;  2QWT A;  3C2B A;  3G56 A;  2QOP A;  3MNL A;  2TRT A;  2XDN A;  2JJ7 A;  1RKT A;  3IH4 A;  5K7Z A;  3TP0 A;  2X9D A;  3BTJ A;  2FJ1 A;  2FQ4 A;  5H9T A;  1JTX A;  4DW6 A;  5FKK A;  3LWJ A;  5D1R A;  3F1B A;  3VVX A;  2ID3 A;  5HBU A;  3VUQ A;  1ZK8 A;  2Y30 A;  3BR6 A;  3CCY A;  3HTA A;  2D6Y A;  1JT6 A;  3Q0W A;  1ORK A;  3BQZ A;  3CRJ A;  3NI7 A;  3DPJ A;  4ICH A;  5FMP A;  5F04 A;  1U9N A;  3HGG A;  3Q3S A;  3DEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...