2FBQA

The crystal structure of transcriptional regulator pa3006
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
213
structure length
213
Chain Sequence
b'AQSETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFLGPFCASLEKELDRRQAKPEAQHATLEDLLHLLVSQAMAVKPRSGNDLSIFMRLLGLAFSQSQGHLRKYLEEVYGKVFRRYMLLVNEAAPKLPPIELFWRVHFMLGAAAFSMSGIKALRAMAETDFGVNTSTEQVMHLMVPFFAAGMRAESGID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
publication title The crystal structure of transcriptional regulator PA3006
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 88
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17939 TetR_C_30 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fbqA00
3BQYA 3FIWA 2NS7A 4ABZA 3VVXA 3T6NA 3CCYA 5HBUA 3NRGA 1U9NA 3PASA 2ZCNA 3BTJA 3DCFA 4XK4A 3G7RA 2ID6A 1JUSA 3ZQIA 3V6GA 5K58A 4JKZA 2FQ4A 3Q0UA 2HXOA 2HXIA 5CXGA 3WHCA 2RAEA 3VW0A 2TCTA 2QCOA 2JJ7A 4B3AA 1RPWA 4M3GA 2ZCMA 5K7ZA 2Y30A 2XB5A 3BR2A 3VVZA 1QVTA 4DW6A 2NP3A 5D18A 2NS8A 3B81A 2YVEA 1RKWA 4V2GA 3HTHA 2ZCXA 3LSRA 1BJZA 3GZIA 3ANPA 3BTLA 3G1OA 3FRQA 4GCTA 4ME9A 2G7SA 5EZHA 2Q24A 2QTQA 3ON4A 4NN1A 2RHAA 5GPCA 4MK6A 4CGRA 2PBXA 3BRUA 3EGQA 4D7NA 5FKNA 3ZQHA 3LSJA 4GFLA 3ON2A 3LWJA 3ZQFA 3BT9A 2ID3A 3V78A 3TP3A 4L62A 1Z77A 5K7HA 1RKTA 5HSZA 3QQAA 3C2BA 1UI5A 4JYKA 1SGMA 3DEWA 4MO7A 4ICHA 2D6YA 1JUPA 3HTIA 5IOYA 4W97A 4ACIA 4PXIA 5J3LA 3RH2A 5C4YA 2OPTA 5EZGA 3MVPA 2XPUA 5CW8A 3QKXA 3G56A 3FK6A 3MNLA 5AQCA 1JTYA 3ANGA 3VP5A 2ZOYA 3DPJA 2O7OA 3WHBA 1ZK8A 4AUXA 3F1BA 3KNWA 3NPIA 3BNIA 5FKMA 5FHPA 1A6IA 2X9DA 3Q0WA 3IH4A 3BR3A 4GFKA 3G1MA 3BCGA 2Y31A 2TRTA 2HYJA 3BJBA 3HIMA 3QPSA 3ZQLA 2IAIA 3BHQA 5F1JA 2PZ9A 3COLA 2XGDA 2HYTA 1Z0XA 2XDNA 2IU5A 4I6ZA 4GCKA 2G7GA 4D5CA 3VPRA 2UXOA 3CDLA 2G7LA 5EYRA 3RD3A 3CWRA 2FD5A 3BR6A 4JNNA 2ZB9A 2OERA 2QOPA 4G12A 2GBYA 2DTZA 1QPIA 3F0CA 5FKKA 4AC0A 3O8HA 4JL3A 5FMPA 2FX0A 3HTJA 2FBQA 5K7FA 2HKUA 3VUQA 3TP0A 5F0HA 2OI8A 2DG7A 2Y2ZA 2UXHA 2XPVA 4I76A 5IP6A 2WUIA 3VOKA 4W1UA 3G1LA 3BTIA 2VKEA 4M3FA 5J1YA 4D5FA 3NI7A 1JUMA 3QBMA 1JTXA 4AC6A 5GP9A 3BR0A 3VIBA 1UI6A 3FK7A 3HE0A 3HGGA 2NP5A 2XRLA 3CRJA 3HGYA 1QVUA 4M3EA 4AF5A 2V57A 4V2FA 3SFIA 2ZOZA 3GEUA 3E7QA 5J1RA 2F07A 1ZKGA 3BTCA 2FJ1A 2X6OA 4HKUA 2XGCA 5J1UA 4KWAA 2QIBA 4B1RA 2IBDA 3SDGA 2WV1A 3BR1A 3Q0VA 2GFNA 2IEKA 3KZ9A 3Q3SA 1JT0A 2I10A 5IPAA 2HQ5A 2G3BA 2VPRA 5F0CA 3VW2A 3IH3A 3O60A 3VVYA 2YVHA 3LJLA 3B6AA 3PPBA 5D1RA 1T56A 2RASA 2JK3A 3CJDA 5F08A 5D19A 3P9TA 1U9OA 2WGBA 2O7TA 1VI0A 3EUPA 2W53A 2GENA 2UXPA 5CXIA 2GUHA 2DG8A 2UXIA 5F04A 2UXUA 3AQTA 3KKCA 4UDSA 2REKA 2EH3A 3VW1A 5FGLA 5GPAA 4D7MA 3IUVA 5F27A 3KKDA 5DAJA 2G0EA 3C07A 3JSJA 3QPLA 5IOZA 3B6CA 1ORKA 3LOCA 2NX4A 4M3BA 5FKOA 2XPWA 3LSPA 1T33A 2QWTA 3HTAA 3NXCA 4YZEA 5HAWA 4NELA 4GCLA 2XGEA 4M3DA 4X1EA 5FKLA 3LHQA 3ZQGA 2QKOA 1JT6A 3IH2A 3O8GA 5F0FA 5H9TA 3AQSA 3S5RA 3NNRA 3BQZA 4MXMA 3BR5A 3PM1A 3VOXA 2VKVA 2OF7A 5EFYA
chains in the Genus database with same CATH superfamily
3BQYA 3FIWA 2NS7A 4ABZA 3VVXA 3T6NA 3CCYA 5HBUA 3NRGA 1U9NA 3PASA 2ZCNA 3BTJA 3DCFA 4XK4A 3G7RA 2ID6A 1JUSA 3ZQIA 5CQGA 3V6GA 5K58A 4JKZA 2FQ4A 3Q0UA 2HXOA 2HXIA 5CXGA 3WHCA 2RAEA 3VW0A 2TCTA 2QCOA 2JJ7A 4B3AA 1RPWA 4M3GA 2ZCMA 5K7ZA 2Y30A 2XB5A 3BR2A 3VVZA 1QVTA 4DW6A 2NP3A 5D18A 2NS8A 3B81A 2YVEA 1RKWA 4V2GA 3HTHA 2ZCXA 3LSRA 1BJZA 3GZIA 3ANPA 3BTLA 3G1OA 3FRQA 4GCTA 4U9LA 4ME9A 2G7SA 5EZHA 2Q24A 2QTQA 3ON4A 2R7UA 4NN1A 2RHAA 5GPCA 4MK6A 4CGRA 2PBXA 3BRUA 3EGQA 4D7NA 5FKNA 3ZQHA 3LSJA 4GFLA 3ON2A 3LWJA 3ZQFA 3BT9A 3K8PC 2ID3A 2R7WA 3V78A 3TP3A 4L62A 2R7OA 4U9NA 1Z77A 5K7HA 1RKTA 5HSZA 3QQAA 3C2BA 1UI5A 4JYKA 4OD4A 1SGMA 3DEWA 3DU6A 4MO7A 4ICHA 2D6YA 1JUPA 3HTIA 5IOYA 4W97A 4ACIA 4PXIA 5J3LA 3RH2A 5C4YA 2OPTA 5EZGA 3MVPA 2XPUA 5CW8A 3QKXA 3G56A 3FK6A 3MNLA 5AQCA 1JTYA 3ANGA 3VP5A 2ZOYA 3DPJA 2O7OA 3WHBA 1ZK8A 4AUXA 3F1BA 3KNWA 3NPIA 3BNIA 5FKMA 2R7XA 5FHPA 1A6IA 2X9DA 3Q0WA 3IH4A 3BR3A 4GFKA 3G1MA 3BCGA 2Y31A 2TRTA 2HYJA 2FJI1 3BJBA 4WIBA 3HIMA 3QPSA 3ZQLA 2IAIA 3BHQA 5F1JA 2PZ9A 3COLA 2XGDA 2HYTA 2YVXA 1Z0XA 2XDNA 2IU5A 4I6ZA 4GCKA 2G7GA 4D5CA 3VPRA 2UXOA 3CDLA 2G7LA 5EYRA 3RD3A 3CWRA 3VTIA 2FD5A 3BR6A 4JNNA 2ZB9A 4DVYP 2OERA 2QOPA 4G12A 2GBYA 2DTZA 1QPIA 3F0CA 5FKKA 4AC0A 3O8HA 4JL3A 5FMPA 2FX0A 3HTJA 2FBQA 5K7FA 2HKUA 3VUQA 3TP0A 5F0HA 2OI8A 2DG7A 2Y2ZA 2UXHA 2XPVA 4I76A 5IP6A 2WUIA 3VOKA 4W1UA 3G1LA 3BTIA 2VKEA 4M3FA 5J1YA 4D5FA 3NI7A 1JUMA 3QBMA 3KYLA 1JTXA 4AC6A 5GP9A 3BR0A 3VIBA 1UI6A 3FK7A 3HE0A 4C2MA 3HGGA 2A2FX 2NP5A 2XRLA 3CRJA 3HGYA 1QVUA 4M3EA 4AF5A 2V57A 4V2FA 3SFIA 2ZOZA 3GEUA 3E7QA 5J1RA 2F07A 1ZKGA 3BTCA 2FJ1A 2X6OA 4HKUA 4IRVA 2XGCA 3NS4A 5J1UA 4KWAA 2QIBA 4B1RA 2IBDA 3SDGA 2WV1A 3BR1A 3Q0VA 2B1EA 2GFNA 2IEKA 2R7SA 3KZ9A 3Q3SA 1JT0A 2I10A 5IPAA 2HQ5A 2G3BA 3DU5A 2VPRA 5F0CA 3VW2A 3IH3A 3O60A 3VVYA 2YVHA 3LJLA 3B6AA 3PPBA 5D1RA 1T56A 2RASA 4OD5A 2JK3A 3CJDA 5F08A 5D19A 2ZY9A 2R7TA 3P9TA 2R7QA 1U9OA 2WGBA 2O7TA 1VI0A 3EUPA 2W53A 2PFVA 2GENA 2UXPA 5CXIA 2GUHA 2DG8A 2UXIA 2R7RA 5F04A 3SWHA 2UXUA 3AQTA 3KKCA 4UDSA 2REKA 2EH3A 3VW1A 5FGLA 3FHNA 5GPAA 4D7MA 2R7VA 3IUVA 5F27A 3KKDA 5DAJA 2G0EA 3C07A 2B3WA 3JSJA 3QPLA 5IOZA 3B6CA 1ORKA 3LOCA 2NX4A 4M3BA 5FKOA 2XPWA 3LSPA 1T33A 2QWTA 3HTAA 3NXCA 4YZEA 5HAWA 4NELA 4GCLA 2XGEA 4M3DA 4X1EA 5FKLA 3LHQA 3ZQGA 2QKOA 1JT6A 3IH2A 3O8GA 5F0FA 5H9TA 3AQSA 3S5RA 3NNRA 3BQZA 4MXMA 3BR5A 3PM1A 3VOXA 2VKVA 2OF7A 5EFYA
chains in the Genus database with same CATH topology
3BQYA 3FIWA 2NS7A 4ABZA 3VVXA 3T6NA 3CCYA 5HBUA 3NRGA 1U9NA 3PASA 2ZCNA 3BTJA 3DCFA 4XK4A 3G7RA 2ID6A 1JUSA 3ZQIA 3V6GA 5K58A 4JKZA 2FQ4A 3Q0UA 2HXOA 2HXIA 5CXGA 3WHCA 2RAEA 3VW0A 2TCTA 2QCOA 2JJ7A 4B3AA 1RPWA 4M3GA 2ZCMA 5K7ZA 2Y30A 2XB5A 3BR2A 3VVZA 1QVTA 4DW6A 2NP3A 5D18A 2NS8A 3B81A 2YVEA 1RKWA 4V2GA 3HTHA 2ZCXA 3LSRA 1BJZA 3GZIA 3ANPA 3BTLA 3G1OA 3FRQA 4GCTA 4ME9A 2G7SA 5EZHA 2Q24A 2QTQA 3ON4A 4NN1A 2RHAA 5GPCA 4MK6A 4CGRA 2PBXA 3BRUA 3EGQA 4D7NA 5FKNA 3ZQHA 3LSJA 4GFLA 3ON2A 3LWJA 3ZQFA 3BT9A 2ID3A 3V78A 3TP3A 4L62A 1Z77A 5K7HA 1RKTA 5HSZA 3QQAA 3C2BA 1UI5A 4JYKA 1SGMA 3DEWA 4MO7A 4ICHA 2D6YA 1JUPA 3HTIA 5IOYA 4W97A 4ACIA 4PXIA 5J3LA 3RH2A 5C4YA 2OPTA 5EZGA 3MVPA 2XPUA 5CW8A 3QKXA 3G56A 3FK6A 3MNLA 5AQCA 1JTYA 3ANGA 3VP5A 2ZOYA 3DPJA 2O7OA 3WHBA 1ZK8A 4AUXA 3F1BA 3KNWA 3NPIA 3BNIA 5FKMA 5FHPA 1A6IA 2X9DA 3Q0WA 3IH4A 3BR3A 4GFKA 3G1MA 3BCGA 2Y31A 2TRTA 2HYJA 3BJBA 3HIMA 3QPSA 3ZQLA 2IAIA 3BHQA 5F1JA 2PZ9A 3COLA 2XGDA 2HYTA 1Z0XA 2XDNA 2IU5A 4I6ZA 4GCKA 2G7GA 4D5CA 3VPRA 2UXOA 3CDLA 2G7LA 5EYRA 3RD3A 3CWRA 2FD5A 3BR6A 4JNNA 2ZB9A 2OERA 2QOPA 4G12A 2GBYA 2DTZA 1QPIA 3F0CA 5FKKA 4AC0A 3O8HA 4JL3A 5FMPA 2FX0A 3HTJA 2FBQA 5K7FA 2HKUA 3VUQA 3TP0A 5F0HA 2OI8A 2DG7A 2Y2ZA 2UXHA 2XPVA 4I76A 5IP6A 2WUIA 3VOKA 4W1UA 3G1LA 3BTIA 2VKEA 4M3FA 5J1YA 4D5FA 3NI7A 1JUMA 3QBMA 1JTXA 4AC6A 5GP9A 3BR0A 3VIBA 1UI6A 3FK7A 3HE0A 3HGGA 2NP5A 2XRLA 3CRJA 3HGYA 1QVUA 4M3EA 4AF5A 2V57A 4V2FA 3SFIA 2ZOZA 3GEUA 3E7QA 5J1RA 2F07A 1ZKGA 3BTCA 2FJ1A 2X6OA 4HKUA 2XGCA 5J1UA 4KWAA 2QIBA 4B1RA 2IBDA 3SDGA 2WV1A 3BR1A 3Q0VA 2GFNA 2IEKA 3KZ9A 3Q3SA 1JT0A 2I10A 5IPAA 2HQ5A 2G3BA 2VPRA 5F0CA 3VW2A 3IH3A 3O60A 3VVYA 2YVHA 3LJLA 3B6AA 3PPBA 5D1RA 1T56A 2RASA 2JK3A 3CJDA 5F08A 5D19A 3P9TA 1U9OA 2WGBA 2O7TA 1VI0A 3EUPA 2W53A 2GENA 2UXPA 5CXIA 2GUHA 2DG8A 2UXIA 5F04A 2UXUA 3AQTA 3KKCA 4UDSA 2REKA 2EH3A 3VW1A 5FGLA 5GPAA 4D7MA 3IUVA 5F27A 3KKDA 5DAJA 2G0EA 3C07A 3JSJA 3QPLA 5IOZA 3B6CA 1ORKA 3LOCA 2NX4A 4M3BA 5FKOA 2XPWA 3LSPA 1T33A 2QWTA 3HTAA 3NXCA 4YZEA 5HAWA 4NELA 4GCLA 2XGEA 4M3DA 4X1EA 5FKLA 3LHQA 3ZQGA 2QKOA 1JT6A 3IH2A 3O8GA 5F0FA 5H9TA 3AQSA 3S5RA 3NNRA 3BQZA 4MXMA 3BR5A 3PM1A 3VOXA 2VKVA 2OF7A 5EFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQY A;  3FIW A;  2NS7 A;  4ABZ A;  3VVX A;  3T6N A;  3CCY A;  5HBU A;  3NRG A;  1U9N A;  3PAS A;  2ZCN A;  3BTJ A;  3DCF A;  4XK4 A;  3G7R A;  2ID6 A;  1JUS A;  3ZQI A;  3V6G A;  5K58 A;  4JKZ A;  2FQ4 A;  3Q0U A;  2HXO A;  2HXI A;  5CXG A;  3WHC A;  2RAE A;  3VW0 A;  2TCT A;  2QCO A;  2JJ7 A;  4B3A A;  1RPW A;  4M3G A;  2ZCM A;  5K7Z A;  2Y30 A;  2XB5 A;  3BR2 A;  3VVZ A;  1QVT A;  4DW6 A;  2NP3 A;  5D18 A;  2NS8 A;  3B81 A;  2YVE A;  1RKW A;  4V2G A;  3HTH A;  2ZCX A;  3LSR A;  1BJZ A;  3GZI A;  3ANP A;  3BTL A;  3G1O A;  3FRQ A;  4GCT A;  4ME9 A;  2G7S A;  5EZH A;  2Q24 A;  2QTQ A;  3ON4 A;  4NN1 A;  2RHA A;  5GPC A;  4MK6 A;  4CGR A;  2PBX A;  3BRU A;  3EGQ A;  4D7N A;  5FKN A;  3ZQH A;  3LSJ A;  4GFL A;  3ON2 A;  3LWJ A;  3ZQF A;  3BT9 A;  2ID3 A;  3V78 A;  3TP3 A;  4L62 A;  1Z77 A;  5K7H A;  1RKT A;  5HSZ A;  3QQA A;  3C2B A;  1UI5 A;  4JYK A;  1SGM A;  3DEW A;  4MO7 A;  4ICH A;  2D6Y A;  1JUP A;  3HTI A;  5IOY A;  4W97 A;  4ACI A;  4PXI A;  5J3L A;  3RH2 A;  5C4Y A;  2OPT A;  5EZG A;  3MVP A;  2XPU A;  5CW8 A;  3QKX A;  3G56 A;  3FK6 A;  3MNL A;  5AQC A;  1JTY A;  3ANG A;  3VP5 A;  2ZOY A;  3DPJ A;  2O7O A;  3WHB A;  1ZK8 A;  4AUX A;  3F1B A;  3KNW A;  3NPI A;  3BNI A;  5FKM A;  5FHP A;  1A6I A;  2X9D A;  3Q0W A;  3IH4 A;  3BR3 A;  4GFK A;  3G1M A;  3BCG A;  2Y31 A;  2TRT A;  2HYJ A;  3BJB A;  3HIM A;  3QPS A;  3ZQL A;  2IAI A;  3BHQ A;  5F1J A;  2PZ9 A;  3COL A;  2XGD A;  2HYT A;  1Z0X A;  2XDN A;  2IU5 A;  4I6Z A;  4GCK A;  2G7G A;  4D5C A;  3VPR A;  2UXO A;  3CDL A;  2G7L A;  5EYR A;  3RD3 A;  3CWR A;  2FD5 A;  3BR6 A;  4JNN A;  2ZB9 A;  2OER A;  2QOP A;  4G12 A;  2GBY A;  2DTZ A;  1QPI A;  3F0C A;  5FKK A;  4AC0 A;  3O8H A;  4JL3 A;  5FMP A;  2FX0 A;  3HTJ A;  2FBQ A;  5K7F A;  2HKU A;  3VUQ A;  3TP0 A;  5F0H A;  2OI8 A;  2DG7 A;  2Y2Z A;  2UXH A;  2XPV A;  4I76 A;  5IP6 A;  2WUI A;  3VOK A;  4W1U A;  3G1L A;  3BTI A;  2VKE A;  4M3F A;  5J1Y A;  4D5F A;  3NI7 A;  1JUM A;  3QBM A;  1JTX A;  4AC6 A;  5GP9 A;  3BR0 A;  3VIB A;  1UI6 A;  3FK7 A;  3HE0 A;  3HGG A;  2NP5 A;  2XRL A;  3CRJ A;  3HGY A;  1QVU A;  4M3E A;  4AF5 A;  2V57 A;  4V2F A;  3SFI A;  2ZOZ A;  3GEU A;  3E7Q A;  5J1R A;  2F07 A;  1ZKG A;  3BTC A;  2FJ1 A;  2X6O A;  4HKU A;  2XGC A;  5J1U A;  4KWA A;  2QIB A;  4B1R A;  2IBD A;  3SDG A;  2WV1 A;  3BR1 A;  3Q0V A;  2GFN A;  2IEK A;  3KZ9 A;  3Q3S A;  1JT0 A;  2I10 A;  5IPA A;  2HQ5 A;  2G3B A;  2VPR A;  5F0C A;  3VW2 A;  3IH3 A;  3O60 A;  3VVY A;  2YVH A;  3LJL A;  3B6A A;  3PPB A;  5D1R A;  1T56 A;  2RAS A;  2JK3 A;  3CJD A;  5F08 A;  5D19 A;  3P9T A;  1U9O A;  2WGB A;  2O7T A;  1VI0 A;  3EUP A;  2W53 A;  2GEN A;  2UXP A;  5CXI A;  2GUH A;  2DG8 A;  2UXI A;  5F04 A;  2UXU A;  3AQT A;  3KKC A;  4UDS A;  2REK A;  2EH3 A;  3VW1 A;  5FGL A;  5GPA A;  4D7M A;  3IUV A;  5F27 A;  3KKD A;  5DAJ A;  2G0E A;  3C07 A;  3JSJ A;  3QPL A;  5IOZ A;  3B6C A;  1ORK A;  3LOC A;  2NX4 A;  4M3B A;  5FKO A;  2XPW A;  3LSP A;  1T33 A;  2QWT A;  3HTA A;  3NXC A;  4YZE A;  5HAW A;  4NEL A;  4GCL A;  2XGE A;  4M3D A;  4X1E A;  5FKL A;  3LHQ A;  3ZQG A;  2QKO A;  1JT6 A;  3IH2 A;  3O8G A;  5F0F A;  5H9T A;  3AQS A;  3S5R A;  3NNR A;  3BQZ A;  4MXM A;  3BR5 A;  3PM1 A;  3VOX A;  2VKV A;  2OF7 A;  5EFY A; 
#chains in the Genus database with same CATH topology
 3BQY A;  3FIW A;  2NS7 A;  4ABZ A;  3VVX A;  3T6N A;  3CCY A;  5HBU A;  3NRG A;  1U9N A;  3PAS A;  2ZCN A;  3BTJ A;  3DCF A;  4XK4 A;  3G7R A;  2ID6 A;  1JUS A;  3ZQI A;  5CQG A;  3V6G A;  5K58 A;  4JKZ A;  2FQ4 A;  3Q0U A;  2HXO A;  2HXI A;  5CXG A;  3WHC A;  2RAE A;  3VW0 A;  2TCT A;  2QCO A;  2JJ7 A;  4B3A A;  1RPW A;  4M3G A;  2ZCM A;  5K7Z A;  2Y30 A;  2XB5 A;  3BR2 A;  3VVZ A;  1QVT A;  4DW6 A;  2NP3 A;  5D18 A;  2NS8 A;  3B81 A;  2YVE A;  1RKW A;  4V2G A;  3HTH A;  2ZCX A;  3LSR A;  1BJZ A;  3GZI A;  3ANP A;  3BTL A;  3G1O A;  3FRQ A;  4GCT A;  4U9L A;  4ME9 A;  2G7S A;  5EZH A;  2Q24 A;  2QTQ A;  3ON4 A;  2R7U A;  4NN1 A;  2RHA A;  5GPC A;  4MK6 A;  4CGR A;  2PBX A;  3BRU A;  3EGQ A;  4D7N A;  5FKN A;  3ZQH A;  3LSJ A;  4GFL A;  3ON2 A;  3LWJ A;  3ZQF A;  3BT9 A;  3K8P C;  2ID3 A;  2R7W A;  3V78 A;  3TP3 A;  4L62 A;  2R7O A;  4U9N A;  1Z77 A;  5K7H A;  1RKT A;  5HSZ A;  3QQA A;  3C2B A;  1UI5 A;  4JYK A;  4OD4 A;  1SGM A;  3DEW A;  3DU6 A;  4MO7 A;  4ICH A;  2D6Y A;  1JUP A;  3HTI A;  5IOY A;  4W97 A;  4ACI A;  4PXI A;  5J3L A;  3RH2 A;  5C4Y A;  2OPT A;  5EZG A;  3MVP A;  2XPU A;  5CW8 A;  3QKX A;  3G56 A;  3FK6 A;  3MNL A;  5AQC A;  1JTY A;  3ANG A;  3VP5 A;  2ZOY A;  3DPJ A;  2O7O A;  3WHB A;  1ZK8 A;  4AUX A;  3F1B A;  3KNW A;  3NPI A;  3BNI A;  5FKM A;  2R7X A;  5FHP A;  1A6I A;  2X9D A;  3Q0W A;  3IH4 A;  3BR3 A;  4GFK A;  3G1M A;  3BCG A;  2Y31 A;  2TRT A;  2HYJ A;  2FJI 1;  3BJB A;  4WIB A;  3HIM A;  3QPS A;  3ZQL A;  2IAI A;  3BHQ A;  5F1J A;  2PZ9 A;  3COL A;  2XGD A;  2HYT A;  2YVX A;  1Z0X A;  2XDN A;  2IU5 A;  4I6Z A;  4GCK A;  2G7G A;  4D5C A;  3VPR A;  2UXO A;  3CDL A;  2G7L A;  5EYR A;  3RD3 A;  3CWR A;  3VTI A;  2FD5 A;  3BR6 A;  4JNN A;  2ZB9 A;  4DVY P;  2OER A;  2QOP A;  4G12 A;  2GBY A;  2DTZ A;  1QPI A;  3F0C A;  5FKK A;  4AC0 A;  3O8H A;  4JL3 A;  5FMP A;  2FX0 A;  3HTJ A;  2FBQ A;  5K7F A;  2HKU A;  3VUQ A;  3TP0 A;  5F0H A;  2OI8 A;  2DG7 A;  2Y2Z A;  2UXH A;  2XPV A;  4I76 A;  5IP6 A;  2WUI A;  3VOK A;  4W1U A;  3G1L A;  3BTI A;  2VKE A;  4M3F A;  5J1Y A;  4D5F A;  3NI7 A;  1JUM A;  3QBM A;  3KYL A;  1JTX A;  4AC6 A;  5GP9 A;  3BR0 A;  3VIB A;  1UI6 A;  3FK7 A;  3HE0 A;  4C2M A;  3HGG A;  2A2F X;  2NP5 A;  2XRL A;  3CRJ A;  3HGY A;  1QVU A;  4M3E A;  4AF5 A;  2V57 A;  4V2F A;  3SFI A;  2ZOZ A;  3GEU A;  3E7Q A;  5J1R A;  2F07 A;  1ZKG A;  3BTC A;  2FJ1 A;  2X6O A;  4HKU A;  4IRV A;  2XGC A;  3NS4 A;  5J1U A;  4KWA A;  2QIB A;  4B1R A;  2IBD A;  3SDG A;  2WV1 A;  3BR1 A;  3Q0V A;  2B1E A;  2GFN A;  2IEK A;  2R7S A;  3KZ9 A;  3Q3S A;  1JT0 A;  2I10 A;  5IPA A;  2HQ5 A;  2G3B A;  3DU5 A;  2VPR A;  5F0C A;  3VW2 A;  3IH3 A;  3O60 A;  3VVY A;  2YVH A;  3LJL A;  3B6A A;  3PPB A;  5D1R A;  1T56 A;  2RAS A;  4OD5 A;  2JK3 A;  3CJD A;  5F08 A;  5D19 A;  2ZY9 A;  2R7T A;  3P9T A;  2R7Q A;  1U9O A;  2WGB A;  2O7T A;  1VI0 A;  3EUP A;  2W53 A;  2PFV A;  2GEN A;  2UXP A;  5CXI A;  2GUH A;  2DG8 A;  2UXI A;  2R7R A;  5F04 A;  3SWH A;  2UXU A;  3AQT A;  3KKC A;  4UDS A;  2REK A;  2EH3 A;  3VW1 A;  5FGL A;  3FHN A;  5GPA A;  4D7M A;  2R7V A;  3IUV A;  5F27 A;  3KKD A;  5DAJ A;  2G0E A;  3C07 A;  2B3W A;  3JSJ A;  3QPL A;  5IOZ A;  3B6C A;  1ORK A;  3LOC A;  2NX4 A;  4M3B A;  5FKO A;  2XPW A;  3LSP A;  1T33 A;  2QWT A;  3HTA A;  3NXC A;  4YZE A;  5HAW A;  4NEL A;  4GCL A;  2XGE A;  4M3D A;  4X1E A;  5FKL A;  3LHQ A;  3ZQG A;  2QKO A;  1JT6 A;  3IH2 A;  3O8G A;  5F0F A;  5H9T A;  3AQS A;  3S5R A;  3NNR A;  3BQZ A;  4MXM A;  3BR5 A;  3PM1 A;  3VOX A;  2VKV A;  2OF7 A;  5EFY A; 
#chains in the Genus database with same CATH homology
 3BQY A;  3FIW A;  2NS7 A;  4ABZ A;  3VVX A;  3T6N A;  3CCY A;  5HBU A;  3NRG A;  1U9N A;  3PAS A;  2ZCN A;  3BTJ A;  3DCF A;  4XK4 A;  3G7R A;  2ID6 A;  1JUS A;  3ZQI A;  3V6G A;  5K58 A;  4JKZ A;  2FQ4 A;  3Q0U A;  2HXO A;  2HXI A;  5CXG A;  3WHC A;  2RAE A;  3VW0 A;  2TCT A;  2QCO A;  2JJ7 A;  4B3A A;  1RPW A;  4M3G A;  2ZCM A;  5K7Z A;  2Y30 A;  2XB5 A;  3BR2 A;  3VVZ A;  1QVT A;  4DW6 A;  2NP3 A;  5D18 A;  2NS8 A;  3B81 A;  2YVE A;  1RKW A;  4V2G A;  3HTH A;  2ZCX A;  3LSR A;  1BJZ A;  3GZI A;  3ANP A;  3BTL A;  3G1O A;  3FRQ A;  4GCT A;  4ME9 A;  2G7S A;  5EZH A;  2Q24 A;  2QTQ A;  3ON4 A;  4NN1 A;  2RHA A;  5GPC A;  4MK6 A;  4CGR A;  2PBX A;  3BRU A;  3EGQ A;  4D7N A;  5FKN A;  3ZQH A;  3LSJ A;  4GFL A;  3ON2 A;  3LWJ A;  3ZQF A;  3BT9 A;  2ID3 A;  3V78 A;  3TP3 A;  4L62 A;  1Z77 A;  5K7H A;  1RKT A;  5HSZ A;  3QQA A;  3C2B A;  1UI5 A;  4JYK A;  1SGM A;  3DEW A;  4MO7 A;  4ICH A;  2D6Y A;  1JUP A;  3HTI A;  5IOY A;  4W97 A;  4ACI A;  4PXI A;  5J3L A;  3RH2 A;  5C4Y A;  2OPT A;  5EZG A;  3MVP A;  2XPU A;  5CW8 A;  3QKX A;  3G56 A;  3FK6 A;  3MNL A;  5AQC A;  1JTY A;  3ANG A;  3VP5 A;  2ZOY A;  3DPJ A;  2O7O A;  3WHB A;  1ZK8 A;  4AUX A;  3F1B A;  3KNW A;  3NPI A;  3BNI A;  5FKM A;  5FHP A;  1A6I A;  2X9D A;  3Q0W A;  3IH4 A;  3BR3 A;  4GFK A;  3G1M A;  3BCG A;  2Y31 A;  2TRT A;  2HYJ A;  3BJB A;  3HIM A;  3QPS A;  3ZQL A;  2IAI A;  3BHQ A;  5F1J A;  2PZ9 A;  3COL A;  2XGD A;  2HYT A;  1Z0X A;  2XDN A;  2IU5 A;  4I6Z A;  4GCK A;  2G7G A;  4D5C A;  3VPR A;  2UXO A;  3CDL A;  2G7L A;  5EYR A;  3RD3 A;  3CWR A;  2FD5 A;  3BR6 A;  4JNN A;  2ZB9 A;  2OER A;  2QOP A;  4G12 A;  2GBY A;  2DTZ A;  1QPI A;  3F0C A;  5FKK A;  4AC0 A;  3O8H A;  4JL3 A;  5FMP A;  2FX0 A;  3HTJ A;  2FBQ A;  5K7F A;  2HKU A;  3VUQ A;  3TP0 A;  5F0H A;  2OI8 A;  2DG7 A;  2Y2Z A;  2UXH A;  2XPV A;  4I76 A;  5IP6 A;  2WUI A;  3VOK A;  4W1U A;  3G1L A;  3BTI A;  2VKE A;  4M3F A;  5J1Y A;  4D5F A;  3NI7 A;  1JUM A;  3QBM A;  1JTX A;  4AC6 A;  5GP9 A;  3BR0 A;  3VIB A;  1UI6 A;  3FK7 A;  3HE0 A;  3HGG A;  2NP5 A;  2XRL A;  3CRJ A;  3HGY A;  1QVU A;  4M3E A;  4AF5 A;  2V57 A;  4V2F A;  3SFI A;  2ZOZ A;  3GEU A;  3E7Q A;  5J1R A;  2F07 A;  1ZKG A;  3BTC A;  2FJ1 A;  2X6O A;  4HKU A;  2XGC A;  5J1U A;  4KWA A;  2QIB A;  4B1R A;  2IBD A;  3SDG A;  2WV1 A;  3BR1 A;  3Q0V A;  2GFN A;  2IEK A;  3KZ9 A;  3Q3S A;  1JT0 A;  2I10 A;  5IPA A;  2HQ5 A;  2G3B A;  2VPR A;  5F0C A;  3VW2 A;  3IH3 A;  3O60 A;  3VVY A;  2YVH A;  3LJL A;  3B6A A;  3PPB A;  5D1R A;  1T56 A;  2RAS A;  2JK3 A;  3CJD A;  5F08 A;  5D19 A;  3P9T A;  1U9O A;  2WGB A;  2O7T A;  1VI0 A;  3EUP A;  2W53 A;  2GEN A;  2UXP A;  5CXI A;  2GUH A;  2DG8 A;  2UXI A;  5F04 A;  2UXU A;  3AQT A;  3KKC A;  4UDS A;  2REK A;  2EH3 A;  3VW1 A;  5FGL A;  5GPA A;  4D7M A;  3IUV A;  5F27 A;  3KKD A;  5DAJ A;  2G0E A;  3C07 A;  3JSJ A;  3QPL A;  5IOZ A;  3B6C A;  1ORK A;  3LOC A;  2NX4 A;  4M3B A;  5FKO A;  2XPW A;  3LSP A;  1T33 A;  2QWT A;  3HTA A;  3NXC A;  4YZE A;  5HAW A;  4NEL A;  4GCL A;  2XGE A;  4M3D A;  4X1E A;  5FKL A;  3LHQ A;  3ZQG A;  2QKO A;  1JT6 A;  3IH2 A;  3O8G A;  5F0F A;  5H9T A;  3AQS A;  3S5R A;  3NNR A;  3BQZ A;  4MXM A;  3BR5 A;  3PM1 A;  3VOX A;  2VKV A;  2OF7 A;  5EFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...