2FBVA

Wrn exonuclease, mn complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
HSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbvA00
4FJMA 5DK5A 5C25A 3EYZA 5C24A 2XY5A 3O4NA 3TAPA 2IOCA 3CYMA 2G8WA 4CJTA 3LWLA 1NK4A 1B9FA 1KLMA 3MXJA 1RBSA 2D0BA 3QNOA 3OYIA 4Q0BA 2OZSA 2O4GA 2QK9A 5J2PA 1EETA 1ZBFA 2OPPA 3DOKA 2VWJA 1LW0A 3KK1A 1RDBA 3LAMA 1SL1A 4CEZA 3VA3A 3SCXA 5CYQA 2YKNA 4OKKA 4DMNA 3DYAA 4F8RA 3KD1E 3AO1A 4PUOA 3NH0A 2IAJA 3KKSA 2G8KA 4J2BA 3NF9A 4M3WA 1HNVA 1QSYA 1J5OA 1Y97A 3DLBA 5HRNA 1RT4A 3PUFA 4QCLA 3AA5X 1KLNA 1S6QA 4OLAA 3S3OA 2ZQBA 4B3OA 4ID5A 2G8IA 1BL3A 1TL1A 3DOLA 4W5NA 4N5SA 4DG1A 1LWEA 4HUGA 3LZJA 3JSMA 2HB5A 4RG8A 3ZSQA 2D0CA 3O3FA 1TKTA 4TSXA 4JLHA 3AO4A 4FLZA 1NOZA 1TV6A 3NBPA 4KB1A 3PO5A 4N56A 2FBXA 4CF1A 4KI4A 2YNGA 1WSJA 2E6MA 2PYJA 5KGWA 3OY9A 1EKEA 3S3MA 2ETJA 1LAWA 4FLYA 4C8OA 3SQ2A 1XC9A 4E89A 3OJUA 1JLFA 4E0DA 4FJ7A 1SKWA 1ZBHA 1QQCA 4H4MA 4RW8A 1ITGA 3HPHA 2HHVA 1RT5A 3DM2A 3RR8A 4B9NA 1J54A 2OPQA 1BIZA 4CHPA 3RMBA 3SPYA 4E1NA 2YHAA 3SPZA 3IAYA 4CJKA 2BDPA 5I42A 4J2EA 1NJZA 1IKVA 1SL2A 4LH4A 4O44A 1JL1A 2BGGA 1JLCA 5SZTA 3OYKA 3KLEA 3HYFA 4W5QA 4EZ9A 1ASWA 2GUIA 2NUBA 1S6PA 3ZCMA 2HMIA 3ZSZA 3P83D 3EY1A 5HBMA 4CFDA 4NYFA 5D3GA 1KTQA 1LW2A 3NCIA 1A5XA 1B92A 4CEFA 4CGFA 4FJHA 1RILA 1VSEA 3DRRA 5I3UA 4DTSA 1YTAA 2HHXA 1VSHA 2EHGA 4DTUA 4CJ3A 4FM0A 4DFJA 1RBTA 2P51A 4MQ3A 3CFOA 2DY4A 1A5VA 1C1BA 1NK0A 4FW1A 3TR8A 3V1OA 4E7LA 3KKRA 1SUQA 4YNQA 2XY7A 3TI0A 1RDCA 2G8VA 1L3TA 3HO1A 3OJSA 4OLBA 4AHUA 5KRTA 4AH9A 4FLTA 4DU1A 4JS4A 2GBZA 4BDPA 3D0PA 3M8QA 1C0MA 2OPRA 1VSMA 4B9MA 1O1WA 1C0UA 4KHQA 3OVNA 3MEGA 4M41A 4Z4CA 3NDKA 3C6TA 1HPZA 3OYMA 4DLGA 4KREA 3AVJA 3D45A 4KRFA 3VQEA 5K14A 4KHWA 1TAQA 4DQQA 1SKSA 1F21A 4LD0A 3L2RA 3ASMA 3PX4A 1WSFA 1TK5A 4AHTA 3KLGA 1NKBA 3K2PA 3F9KA 4WE1A 4I9QA 1BGXT 1ASUA 4CEEA 1X9WA 3HXMA 3K5MA 4CJ5A 2PY5A 4CK3A 3NHGA 3DLEA 4FK0A 1CXQA 3QEWA 1U4BA 1HJRA 1Q8IA 3RMDA 1RTIA 1LV5A 3AVAA 1LWFA 3VQCA 4PA1A 1VSKA 2KTQA 1UWBA 2HVHA 1WSHA 4Y1CA 3V6DA 3L2UA 3OYJA 3RMAA 3QLHA 4FK2A 3PO4A 4DSFA 4BE0A 4DF8A 4KPYA 1RT2A 4H4OA 3SYZA 3CM6A 3AVKA 3P1GA 1EP4A 4QAGA 4CEOA 3QESA 1K6YA 3ALYA 1NK9A 3CFRA 4M45A 3K59A 1CLQA 2IS3A 1JXBA 3AVLA 4IKFA 3OYNA 1WSGA 1L5UA 1ZYQA 1JKHA 4I7FA 3TAMA 4W5TA 1NKEA 1T7PA 4FJ5A 3AA3A 3V9SA 3V9XA 4H8KA 4CJSA 3OYGA 4FJKA 2F8TA 1NJYA 3NH2A 4B9VA 3KLIA 1TKDA 1BCMA 4CE9A 4DQPA 3MEDA 2YV0X 4CEDA 1RNHA 4CJUA 4N47A 3DI6A 4DFKA 2QKKA 2YHBA 1VSIA 3VQDA 4F3TA 4KHNA 4IFVA 4CIGA 4PY5A 4RW7A 3ZT2A 3IRXA 3OYDA 3LWMA 3U6FA 1G15A 2FBVA 3SJJA 4IFYA 3NE6A 4AHVA 2RF2A 3TARA 4ZTFA 2JLEA 4DU4A 1C0TA 2IDOA 1BIUA 1UOCA 3TAQA 4FXDA 5CZ2A 1CXUA 3AO3A 3B6OA 1C1AA 3WNGA 2VWKA 2OA8A 4CFAA 2Y1IA 1GOCA 1TVRA 1S9EA 4KTZA 3L2QA 3MXIA 2PYLA 3VQ9A 1I3AA 4E7IA 1NK6A 4K8XA 1REVA 1RBRA 3NFAA 3VQQA 1NOYA 1HQEA 3MEEA 3T19A 4CEAA 3QEXA 4B08A 1T05A 1TGOA 5FROA 4W5RA 1QSSA 4KFBA 4OKJA 4CGDA 2OPSA 2ZE2A 1HQUA 3OYBA 3K5NA 4DSLA 4FJIA 3VQAA 4FZXC 4EZ6A 2O4IA 3BGRA 4CFCA 2F8SA 3S3NA 4KAZA 3PV8A 3NF7A 4AHSA 4CHZA 3HT3A 1KSPA 3LANA 3NGIA 2KZMA 2HNYA 1KRPA 5JS1A 1FK9A 1S1VA 2VG7A 3HPOA 2FC0A 3HVTA 4NCGA 3T3FA 3NGZA 4CF0A 3ZT1A 3CG7A 3K5OA 1FKOA 5HRRA 5E41A 3PX6A 3AVIA 4J2DA 4BDYA 4G1QA 3SUOA 4KB0A 4C8LA 4RW9A 1WSEA 3LZIA 3C6UA 1RDDA 3HPGA 3V4IA 1WAFA 5KTQA 3HM9A 3M8PA 4E19A 3KTQA 2YNIA 3AVCA 4OGCA 1B9DA 3PX0A 2RN2A 3VQ8A 3V81A 4CJ4A 3OYFA 5HP1A 4HVJA 1NK7A 1RT1A 1QSLA 1VK0A 2ZD1A 1HYVA 4CGIA 5KRSA 1MU2A 4DTJA 3VQ4A 1IKYA 1QHTA 2WONA 3AVNA 4LSNA 5C42A 4FM2A 3LP1A 1YVUA 4BACA 1JLBA 4DTPA 1Z26A 2A1SA 1RBUA 3OYLA 4CEQA 2KFNA 3ZSVA 3DRSA 4Z4FA 4FYDA 1WNSA 2HHSA 1HRHA 3ZT0A 2X78A 4F4KA 4KKOA 3UIQA 3LPTA 4JRPA 3VQ6A 3KLHA 1VSFA 2DFHA 4FLUA 2VG6A 5FDLA 3K5LA 1C6VA 2BANA 2YNHA 4GVMA 4CF9A 3M8SA 2LSNA 4DFMA 1D9DA 1N6QA 4Z4IA 3SUPA 4AHRA 4CGGA 3WNHA 3AVBA 2B4JA 3L3UA 2YKMA 4Y1DA 3E01A 4CJLA 1UA0A 1D9FA 4B9LA 2F96A 3TAGA 3HSTB 1TKXA 4DLEA 2OZMA 2XRIA 4CHOA 2QXFA 3OYEA 2AJQA 4FJ9A 3SQ0A 4Z0UA 3KD5E 4FJGA 1X9MA 2FBTA 4DQRA 3AA2A 4FLWA 4L8RB 3U3YA 4FJJA 4C8MA 1KVCA 2I5JA 4DWIA 3ZT4A 3MAQA 2Y1JA 2DTUA 4ZHRA 1IO2A 4B9SA 3LALA 1BQMA 1DTQA 1RT6A 2B5JA 3U3GA 4E7HA 4ELUA 4ELVA 4F2RA 1X1PA 3NAEA 3RMCA 2XO7A 4HHTA 4FVMA 5HRSA 3VQPA 4KV8A 4XIUA 4HUEA 5J2QA 4DSEA 4DFPA 2HHQA 1ZBUA 3VQ7A 1UA1A 2YNFA 4FK4A 3AA4A 1BI4A 2HNZA 1NK5A 2D0AA 4OKEA 3ZSOA 1KFSA 3O4QA 4OGEA 3ZSXA 4E7KA 5DMRA 3TANA 5FRNA 4JS5A 3V9WA 4Z4GA 3K57A 4FJNA 3WNEA 3F73A 1D8YA 2P5GA 3LPUA 3NF6A 2HHTA 3SV4A 1WLJA 3QEVA 1IKXA 1JLEA 1EXQA 1WAJA 1JLAA 1VRTA 4M3RA 4B9UA 2DFFA 4EP5A 2G8HA 2Z1HA 3C95A 4BWJA 3AVMA 1RTDA 4CHYA 2KZZA 4FCYA 3A2FA 4JRQA 2HHUA 1KVAA 1HYSA 3ZSWA 4IDKA 4N76A 1KVBA 3QETA 2XY6A 2KW4A 5CZ1A 1RT3A 3SI6A 1J9AA 3SV3A 5HLFA 3RR7A 3ULDA 2HW3A 1XWLA 2JGUA 4GMJB 1S1TA 4M3UA 1U48A 3RTVA 4HCBA 1ZBIA 1CZ9A 3BDPA 5CY4A 2FBYA 4CIFA 2G8FA 3RRGA 2OYQA 2Q3SA 1TK0A 4CJQA 3EZ5A 1VRUA 4ICLA 1BHLA 1WSIA 3DRPA 4Z4HA 4NCAA 4I2QA 1HNIA 4E3SA 4CF8A 3TAFA 4CJEA 2Z1IA 1JLGA 1LAVA 2W42A 3KIOA 4CHNA 4OJRA 3QINA 3KJVA 1NJXA 4Z4EA 1YTUA 3KK3A 4KO0A 1DLOA 3DLRA 4ID1A 3PY8A 4N41A 1IKWA 1RTJA 3ZT3A 4FZZA 4PWDA 2A1RA 4E1MA 3AV9A 3S9HA 2ATQA 5KI6A 3CFPA 4BDZA 1QE1A 1LWCA 2P5OA 4OPKA 1VSLA 3I8DA 2XHBA 1JL2A 4F3OA 3V1RA 1U45A 1U04A 4DQSA 4HCCA 3FFIA 1FXXA 4FLXA 4RW6A 1U49A 4M42A 4KHYA 4O55A 4NCBA 1RT7A 1QS4A 4ZTJA 2RPIA 3I0SA 3QO9A 2X6NA 4FW2A 1I39A 4CCHA 1RCHA 2E6LA 1IH7A 1XI1A 4FJLA 4Q5VA 1XHZA 3V9UA 2B6AA 4DTMA 2G8UA 3DLKA 4M3ZA 2EX3A 4BE2A 4CF2A 1RDAA 3HP9A 1TKZA 3LP2A 4QOZB 4PQUA 1BCOA 3KK2A 3LP0A 1N5YA 4M3TA 4J2AA 4HUFA 1W0HA 4R5PA 1VSDA 4BE1A 5EU7A 1XHXA 2XY8A 3OYCA 4IBNA 3TABA 3QERA 4F2SA 3VQBA 1NKCA 3LDSA 3CM5A 3MECA 2BE2A 3HL8A 1S1XA 4I9LA 3QEPA 4W5OA 3SUNA 4K8ZA 4CESA 1RBVA 4LY7A 3HP6A 1X9SA 3QEIA 3IS9A 4CHQA 1C1CA 2IGIA 3H08A 1DTTA 3C94A 3SNNA 3KLFA 1YT3A 4C8KA 1D5AA 4CGHA 1RTHA 1U47A 4B8AB 1L3UA 3OS1A 4O0JA 1S5JA 3SQ1A 5SWMA 1SKRA 1BI4B 4FJ8A 1JXEA 1KCFA 3RRHA 3SZ2A 5J2NA 1ASVA 4AHCA 5KGXA 4CJWA 1CZBA 2HNDA 2Z1GA 3P5JA 3LP3A 4DS5A 2KQ2A 1A5WA 5J2MA 4DTNA 1L3SA 4OVLA 4BWMA 4CFBA 2Z1JA 1JLQA 3NGYA 1NJWA 3B6PA 4O5BA 1GOBA 1R0AA 1SL0A 1S9GA 1EX4A 3AO5A 3AO2A 1TK8A 1QTMA 3LAKA 2ITGA 4NYNA 4IG3A 3K58A 4EP4A 1SV5A 3TWHA 3VA0A 4DU3A 4KHSA 1BQNA 4I2PA 1GOAA 4LSLA 4DTOA 5HRPA 2GV9A 3OS2A 3L2WA 4CECA 3OYHA 1WN7A 5HROA 1HMVA 3IG1A 4DTRA 1VSJA 4KTQA 4CERA 3HJFA 4M3XA 4IG0A 4LH5A 1BISA 4CJPA 1NK8A 3T1AA 3TAEA 2WOMA 3JYTA 3G0ZA 2X6SA 3M8RA 3RWUA 3VN5A 1T8EA 3ZSRA 4CJFA 3QIOA 4KTWA 2D5RA 4DF4A 4O0IA 1TAUA 4OPJA 4UQGA 3NF8A 1Z25A 3OS0A 4YFUA 3THVA 3MXMA 3NH1A 1Q9YA 4CIEA 4E7JA 1L3VA 1IG9A 1T03A 4ELTA 3VQ5A 3DLGA 3AVGA 1TL3A 3L3VA 4CK2A 1KFDA 5CYMA 4DSJA 2KFZA 3QIPA 4DTXA 2DFEA 3L2VA 4DSIA 3G10A 1ZBLA 3ISNC 2IC3A 4HTUA 4FZYA 5J1EA 2QKBA 4FM1A 4MFBA 3QNNA 3SUQA 2HVIA 5FRMA 1HYZA 1FKPA 2VG5A 4CK1A 4CGJA 3O3HA 4FLVA 2X74A 3V1QA 4DS4A 3SQ4A 4B9TA 3L8BA 4CEBA 1J53A 3DLHA 4GW6A 1Q9XA 4AILC 1S1WA 5T7BA 4RW4A 2R7YA 2HHWA 2PZSA 3OYAA 1UAXA 3I0RA 3WNFA 3ITHA 4CJVA 3DMJA 3AVFA 3ZSYA 3V9ZA 4M3YA 3HK2A 5JS2A 1W9HA 1S1UA 4B8CA 4CJRA 4C8NA 2RKIA 3CQ8A 4KI6A 3O3GA 4DSKA 4DQIA 4O4GA 4FJXA 3AVHA 4KHUA 3HVRA 2E4LA 2P1JA
chains in the Genus database with same CATH superfamily
4FJMA 3T1HK 2IOCA 3TAPA 4CJTA 4YOTA 3LWLA 3VEOA 1NK4A 3O1BA 5AQMA 1JCEA 2QK9A 1EETA 4BRLA 2VWJA 3KK1A 2WTUA 1RDBA 2WBNA 3D2EA 1ZXOA 3FLCO 3I56N 5F0XA 4F8RA 3KD1E 3O9SA 4RWTA 4DV2K 4M3WA 1HNVA 3DLBA 1Y97A 5BRHA 4QCLA 2FLOA 1S6QA 3S3OA 2ZQBA 4B3OA 1BL3A 2ITMA 1LWEA 4DR7K 4ILJA 3AO4A 1Q86O 1TV6A 3DXMA 1VQKN 1SQKA 4CF1A 3P38A 3THWB 1WSJA 3S3MA 3ENHA 4C8OA 3HBTA 3MDQA 3LDNA 1ZBHA 5AQKA 1QQCA 2UXBK 4O8KA 3OBYA 3A5LC 2GUPA 1BIZA 4FOIA 3RMBA 4E1NA 3SPZA 3VTHA 4CJKA 2BDPA 1NJZA 4BQLA 3JAMO 1JLCA 3O1WA 3OYKA 2P9IB 3HYFA 4EZ9A 3ZSZA 2VQFK 5HBMA 2QI2A 4NYFA 2UUBK 3CPWM 4CEFA 1QVFM 5I3UA 4DTSA 2W6LA 1VSHA 4DTUA 4LFAK 4CJ3A 5AQXA 4JNEA 2P51A 4JD2B 3VPZA 2O8BB 4JHDB 1M1KO 3V1OA 4BY9C 3TSQA 3EO3A 3E9OA 3KKRA 3TI0A 2DPNA 3CXCM 4DR6K 2GBZA 4BDPA 1T3VA 2EWSA 2OPRA 1O1WA 4Z4CA 3OYMA 4DLGA 4KREA 5C10A 3G71N 5LMUK 3D45A 3CJAA 3ZETB 4KRFA 3KK7A 4KHWA 4LD0A 1TK5A 4AHTA 4WE1A 2AA4A 3HTVA 1ASUA 4OPHA 1X9WA 1J5EK 3K5MA 4CJ5A 1S3XA 3DLEA 1CXQA 1RTIA 1LV5A 3D2EB 4PA1A 1VSKA 1ZC6A 3V6DA 3BEXA 4A57A 4KPYA 4H4OA 3VEXA 2O8CB 3A8YA 4PKIA 3QESA 1K6YA 2V7YA 4M45A 3TAMA 3V9XA 2HF4A 4H8KA 4DV4K 4FJKA 5AQHA 4B9VA 3KLIA 1QQOA 2YV0X 3DXMB 4CEDA 4JEPA 3DI6A 4DFKA 3VF6A 2QKKA 4BREA 4KHNA 1BDGA 4PY5A 4RW7A 3ZT2A 1ILYA 2QWRA 4G9ZA 4AHVA 2IDOA 3TAQA 3VESA 3B6OA 1GOCA 1TVRA 3R3LA 4KTZA 2PYLA 4K8XA 3AAQA 1U6ZA 3T19A 1HUXA 3E9PA 5ELZA 3KHYA 1VQON 1QSSA 4OKJA 3OYBA 2HMPA 3BGRA 3CCSN 2F8SA 1SAZA 3S3NA 3DAWA 4KAZA 3HT3A 1KSPA 3LANA 3FZFA 3NGIA 4M63C 5JS1A 3EKSA 4X62K 4H0XB 5E41A 4CZFA 3R8EA 4C8LA 3LZIA 1RDDA 3QFPA 3EE9A 3V4IA 3HM9A 3EE8A 4C1NI 5CHIA 2YNIA 2BTFA 3ZX2A 3PX0A 2A41A 5AQQA 4FPBA 4CJ4A 3OYFA 4HVJA 1NK7A 1QSLA 1VK0A 2ZD1A 5KRSA 1OH7A 1IKYA 5C42A 3LP1A 1YVUA 4BACA 3DRSA 4FYDA 2QA4N 1HRHA 1ATNA 3UIQA 1VSFA 2YNHA 4CF9A 3LM2A 3SUPA 4H0OA 4Z4IA 4CD3A 4A2BA 3L3UA 1D9FA 2YKMA 4CJLA 3TAGA 3HSTB 2GWJA 2E5LK 3VGMA 4FSVA 2OZMA 2XRIA 1EO1A 2QXFA 5BRDA 3SBGA 5AQYA 3ENOA 4Z0UA 4BR2A 3KD5E 4FJGA 3AA2A 4L8RB 3U3YA 4FJJA 3VEWA 3ZT4A 3MAQA 5JICA 3SAGA 1BA1A 3CQXA 4H0PA 3FGUA 2Q0UA 3BUZB 1DTQA 3U3GA 3QMLA 4K43A 4NLCA 2XO7A 2NRTA 5HRSA 4HUEA 4DFPA 1ZBUA 4BRNA 1BI4A 1NK5A 2D0AA 1QVGM 2HBKA 4E7KA 2HF3A 5FRNA 5LJWA 4JS5A 3V9WA 4BRFA 3NF6A 3J80O 1IKXA 1JLEA 1VQNN 3E66A 4O5FA 3L4IA 4JKBA 4B9UA 4B1UB 4EP5A 2G8HA 2Z1HA 1RTDA 1GLDG 4JRQA 4KBOA 3I8BA 1XQSC 4BRMA 1J9AA 5HLFA 3RR7A 2FSJA 1S1TA 2G8FA 2OYQA 1TK0A 1VRUA 3EKUA 2W40A 5M1OA 1GLAG 3FZMA 3H45C 1JLGA 3KIOA 4CHNA 4OJRA 4BVOA 4ID1A 4PWDA 4FZZA 1GLBG 1X9JA 2A1RA 2OTJN 4BDZA 2GEMA 3GDQA 4OPKA 3I8DA 2XHBA 1GLEG 3V1RA 1U45A 1K73O 1JJ2M 3TTDA 1YI2N 2D4WA 3I0SA 4CCHA 1IH7A 1XHZA 2B6AA 2HBJA 4YY3K 4DTMA 1NG9A 1YF5L 5B8HA 3ULEB 1RDAA 3HP9A 1TKZA 1BCOA 4DUYK 5FPDA 3PLAA 2FSNA 3MK6A 2XY8A 4IBNA 3K0SA 4LF5K 3JS6A 1NKCA 1KAYA 4BG9A 4CI6A 4BRGA 4DV3K 2GX9A 3SUNA 4CESA 1RBVA 3QEIA 4CHQA 1BOTO 1C1CA 3H08A 4DV1K 3SNNA 1YT3A 1U47A 1BI4B 1ASVA 3RWUA 1QZ5A 2HNDA 4DS5A 2KQ2A 1BUPA 5JLHA 3D2FA 1T6DA 3NGYA 4O5BA 1GOBA 2H3GX 1R0AA 3CCUN 1SL0A 4C23A 1QTMA 4WFAL 2ITGA 4NYNA 4EHTA 4KHSA 1GOAA 4DTOA 3L2WA 3IG1A 4KTQA 4CERA 1X3MA 4LH5A 2F9WA 3TPQA 1NGAA 2X6SA 3G0ZA 4UY8O 1T8EA 3ZSRA 2D5RA 4IOAL 1TAUA 4O0IA 1Z25A 3MXMA 4BG8A 2QWMA 3R9PA 1L3VA 1T03A 4ELTA 4PHTX 3DLGA 1TL3A 5CYMA 4EAHD 2E2OA 3QIPA 4AQYK 4B3RK 4YDUC 4DSIA 4XH4A 2VGMA 2IC3A 4FZYA 4MFBA 2E20A 5CR4A 1WB9A 5FRMA 2VG5A 1BU6O 5GAGP 3T69A 3V1QA 4B9TA 4DS4A 3L8BA 1J53A 2V7ZA 2UUAK 2UXCK 2HHWA 3V9ZA 3ITHA 3DMJA 3ZSYA 3THYB 5IWAK 1NGFA 4B3TK 4B1XB 4JKCA 4CJRA 1EWQA 4DSKA 1OH8A 4O4GA 4KHUA 3WXKA 3R1XA 2P1JA 1RFQA 5C25A 2XY5A 5BR9A 5GAEP 1B9FA 3MXJA 3QNOA 2OZSA 1ZBFA 1LW0A 3LAMA 1MWMA 1KC8O 3C6AA 4DMNA 3AO1A 4BRDA 4L3QA 1LOTB 2G8KA 3NF9A 3O8MA 4DB3A 1QSYA 1IG8A 5GAHP 3EL2A 1J5OA 4LF9K 3C7NB 3AA5X 4B1ZA 4WCEL 5EOYA 1QHAA 2E88A 4DG1A 4HUGA 4CJ7A 3LZJA 4RG8A 4EHUA 3O3FA 4YOWA 4TSXA 5JLFA 4JLHA 5LMNK 3NBPA 2YNGA 1EKEA 4CZEA 1LAWA 4E89A 4A5BA 2P9UB 1JLFA 4E0DA 4BRHA 1J54A 3G6EN 3J7ZO 1E3MA 4CHPA 4J2EA 3IFRA 5CE3A 1IKVA 1SL2A 1JL1A 3KLEA 4IJAA 3EN9A 4DV6K 4DV0K 5EVZA 3AARA 3ZCMA 2HMIA 1LW2A 1IJJA 2V51B 3MX5A 1RILA 3CCQN 5H1SQ 4IFEA 2FF3B 4CZJA 4DFJA 4NB4A 4MQ3A 4BRCA 3TR8A 4NXNK 4BRKA 4E7LA 4YNQA 1RDCA 3OJSA 4AH9A 4CVNE 2IVNA 3A5MC 3H3OB 1C0MA 4ILHA 1VSMA 4B9MA 1C0UA 5AQIA 3PSIA 1HNXK 3CD6N 4FWMA 3WXLA 5K14A 4DQQA 3LDOA 3L2RA 3TTFA 2CH6A 1NKBA 3CJ1A 3HXMA 3RMDA 2HVHA 3AVAA 2W6KA 4Y1CA 4B1VA 4FK2A 4XEIA 1RT2A 4FL9A 3WXJA 4B9QA 5AQVA 3SYZA 3AVKA 3P1GA 4QAGA 3ALYA 2QWLA 1NK9A 1JXBA 3AVLA 3OYNA 1JKHA 4IWVA 1XNRK 4CJSA 3OYGA 3J7AP 3O80A 3OBWA 4CJUA 2OCEA 2YHBA 2YJFA 1VSIA 4F3TA 4DR1K 1E4FT 3IRXA 3U6FA 1V4TA 3S41A 1TUUA 5JMVA 2CGJA 4QS8A 3BF3A 4CZLA 4ZTFA 1UOCA 3CHWA 1CXUA 3AO3A 1C1AA 2OA8A 2VWKA 4WQ4C 1S9EA 1HNWK 1REVA 3MWPA 3VQQA 1NOYA 1HQEA 5AQFA 3W3DA 4CEAA 1K9MO 1Z05A 3CJBA 5FROA 4KFBA 2QEXN 1HQUA 3K5NA 2O4IA 4KH5A 4FZXC 1Q82O 2ZGYA 4CFCA 3PV8A 4CHZA 3UKUA 3P39A 2PBDA 3ATVA 3K9JA 3CIPA 3QDKA 1FK9A 2VG7A 2GTDA 5FPMA 4DR2K 1ESVA 3CG7A 1FKOA 4JK7A 5AQJA 4BDYA 3SUOA 2NRVA 4RW9A 5JVGL 4BRQA 4GKKK 1WAFA 1MWKA 4BR4A 5A2QO 4V19S 1N36K 5ADXA 3CCJN 4E19A 3E9LA 4YDUA 2HSTA 3FZKA 3UE5A 1QQMA 3VQ4A 1QHTA 2WONA 3D7EO 4LSNA 4FM2A 3NVKA 3THXA 2A3ZA 2A1SA 2KFNA 4Z4FA 3ZT0A 4M7YA 4YOUA 1HX1A 3KLHA 2DFHA 4FLUA 1BA0A 3QICA 4BRAA 5FDLA 3TSPA 1C6VA 5C12A 2ASPA 4H0VB 1N34K 1N6QA 5E26A 4ISEA 4CGGA 1UA0A 1HR0K 2F96A 1TKXA 4KH4A 4CHOA 4IDHA 4FO0A 1DKGD 2FBTA 5F2RA 5JVHL 4DQRA 1QQNA 4GY2B 4C8MA 4DWIA 4LFBK 4B9SA 1RT6A 1CZAN 2B5JA 4E7HA 4LF7K 3H6EA 3NMUA 4F2RA 3NAEA 1D4XA 3RMCA 4FVMA 3CJCA 5J2QA 4DSEA 4WQ5C 3VQ7A 1UA1A 2UU9K 1N8RO 1KFSA 3SK3A 3VENA 2VCPA 4OGEA 3F73A 4MDAA 2P5GA 3SV4A 1WLJA 3BF1A 3UKUB 1VRTA 5TKYA 1YUWA 2DFFA 3C0BA 4BWJA 4FOEA 3AVMA 3O08A 4CHYA 4FCYA 3A2FA 2KLAA 1KVAA 2HHUA 1HYSA 4IDKA 5IT9O 4N76A 1KVBA 5CZ1A 3SMPA 4IO8A 4K41A 5AQLA 4GMJB 2QWPA 4JKHA 4HCBA 1ZBIA 2ZF5O 3RRGA 5EY4A 1WSIA 3DRPA 3F2KA 4Z4HA 5M1KA 4CJEA 1LAVA 4Z4EA 3QINA 1NJXA 2YCHA 4KO0A 1DLOA 3ZT3A 4E1MA 2QWQA 3AV9A 3THXB 3S9HA 5KI6A 3EZWA 1HKBA 3CMEN 1NMNA 3HM8A 2UXDK 3FFIA 1FXXA 4FLXA 4M42A 4NCBA 3WEEA 1QS4A 2RPIA 1R59O 5AQTA 4GKJK 2E6LA 4FJLA 4Q5VA 3V9UA 3DLKA 2EX3A 4F9OA 5LJVA 3O4WA 3LP0A 4HUFA 4BR7A 2JWKA 1VSDA 4JI7K 5EU7A 5M1QA 4H03B 3QERA 2YX6A 3CM5A 4DR3K 3CCLN 3MECA 4I9LA 4W5OA 4K8ZA 5E84A 4LY7A 3IS9A 4RTFD 3VF4A 1D5AA 1RTHA 1FJGK 5SWMA 3MN6A 2O8FA 2CGLA 1XC3A 4MLHA 1L3SA 4JI1K 1NJWA 1JLQA 4IZ9A 1EX4A 2HBLA 3AO2A 3AO5A 3LAKA 4Y0WA 4IG3A 3VA0A 4DQ8A 4EP4A 1BQNA 4I2PA 4LSLA 4JAXA 4WQ4A 5HROA 3HJFA 4A59A 4IG0A 4EIAA 4JI0K 3A0IX 5GINA 4KTWA 2YJEA 4OPJA 4GNIA 1NGGA 4CIEA 1IG9A 3VQ5A 3BZCA 3MX2A 3TSUA 3L3VA 4CK2A 4DSJA 2KFZA 3M3ZA 4FPAA 1IBKK 3G10A 3AAPA 5J1EA 3CETA 2HVIA 5BPNA 2P9NA 4U7BA 4FLVA 1FKPA 2X74A 4CEBA 3M1FA 4FWRA 4AILC 3DJCA 2P9KA 2AP1A 1TYQA 3OYAA 2E1YA 4M3YA 3WEEB 4B8CA 2RKIA 4DQIA 4FJXA 3HVRA 2E4LA 4AM7A 5DK5A 4JYAK 5C24A 3O4NA 1OH5A 2G8WA 1P90A 2BH1A 3LDLA 4Q0BA 3OYIA 5J2PA 4I6MA 1NBWA 1LCUA 1VAZA 3L4QA 4CEZA 3VA3A 1SL1A 1WBDA 5KQ8A 1XMQK 3KKSA 4J2BA 3O5BA 1RT4A 3PUFA 4C1NK 5KQDA 1KD1O 4HTLA 3ZEUA 4ID5A 1TL1A 3DOLA 3Q7BA 3HZ6A 5EX5A 3JSMA 1RGIA 2P9SA 4YOVA 1S72N 3WT0A 3GG4A 4FLZA 1NOZA 4KB1A 3PO5A 4N56A 2FBXA 4JI4K 2E6MA 2PYJA 3AGRA 3OY9A 3AGKA 2ETJA 4FLYA 1W7AA 3BZKA 5AFUH 4NXMK 4FJ7A 4FWOA 4H4MA 5LY3A 3HPHA 2HHVA 3DM2A 5AQWA 3OHRA 2OPQA 4H5NA 3SPYA 3IAYA 3J81O 4WQ5A 4LH4A 2BGGA 3C65A 1E4GT 2GELA 3IUCA 4W5QA 2GUIA 2NUBA 1Z6RA 1S6PA 1YVNA 3O9UA 3P83D 3T1YK 5D3GA 1NLVA 3CCMN 1YHQN 2QXLA 2QWOA 2UYTA 3CPEA 4FM0A 3CFOA 3QFUA 4IEIA 2P9NB 1NK0A 2VYPA 1SUQA 2G8VA 4OLBA 4FLTA 4DU1A 4JS4A 1U2VA 3HI0A 4CZGA 3M8QA 1TYQB 3OVNA 4M41A 5AZJA 3UKRA 1DGKN 3NDKA 3C6TA 3AVJA 3MN9A 1OVYA 1F21A 2NNWA 2NRXA 3K2PA 3F9KA 1BGXT 1NGHA 4CEEA 1K8KA 4FWSA 1ATSA 4CK3A 4FK0A 4DR5K 3OA9A 1HJRA 2P9LA 1LWFA 3VQCA 5ADXH 2KTQA 1UWBA 1FW6A 2PFUA 3L2UA 2HHHK 3RMAA 4DSFA 3B8AX 3CFRA 3K59A 5DM7L 3ZEUB 2YHXA 4DCHA 1L5UA 1O13A 1NWKA 2A40A 2W41A 4I7FA 4W5TA 4PL7A 3AA3A 3V9SA 2F8TA 1NJYA 3DXKA 3FFKB 1TKDA 1BCMA 4DQPA 3FZLA 4BROA 5GIPA 2JWLA 3TTCA 4BQZA 4IFVA 3VGLA 3FE1A 3N4PA 1NM1A 3QB0A 3OYDA 3LWMA 2ZJQL 3SJJA 4IFYA 3NE6A 1T6CA 3TARA 4MO5A 4B1YB 4DU4A 1C0TA 1YITN 2YI1A 3T7ZA 4FXDA 5CZ2A 4JKDA 1OVQA 3WNGA 4LC9B 2IVPA 3CERA 3MXIA 3CI5A 5AQPA 3L2QA 3VQ9A 4E7IA 2ZWHA 1NK6A 1VQ6N 2BUPA 3A5OC 3PIOL 3MEEA 1EQYA 3QEXA 4B08A 4PL8A 3MN7A 4DSLA 2OPSA 2VQEK 3VQAA 4KHPK 3SMSA 2F7TA 4H5TA 3RVCA 2ZGZA 3D2FB 3NF7A 4AHSA 4K0KK 1NGIA 5BN8A 2P9PA 2HNYA 3KVGA 3M6GA 3HPOA 1ATRA 2FC0A 3HVTA 4NCGA 3T3FA 3NGZA 4CF0A 3A5NC 3ZT1A 5HRRA 2NRWA 1Q7YO 3AVIA 2VWBA 4G1QA 4B3MK 5BRFA 3UKRB 1WSEA 3HPGA 3M8PA 1XUPO 3KTQA 3AVCA 4KH6A 1Y64A 1B9DA 3V81A 1K8KB 4OX9K 1WBBA 2QTDA 3CC4N 2Q0RA 1HYVA 1MU2A 4M7XA 3VETA 1JLBA 1Z26A 3OYLA 2X78A 4F4KA 3LPTA 4JRPA 3VQ6A 2VG6A 4JI5K 2BANA 4GVMA 2LSNA 1D9DA 3N4QA 2E2PA 4CZMA 3AVBA 3HSCA 4B9LA 4GV3A 4JKFA 1VQ7N 4DLEA 3OYEA 4HWIA 2AJQA 4B3SK 2I5JA 3KWGA 3P4IA 2Y1JA 2DTUA 4ZHRA 2QW9A 3CCVN 4ELUA 4ELVA 2HBMA 1NGEA 5BR8K 4IOCL 3VQPA 2HHQA 4LFCK 1XMOK 3AA4A 3ZSOA 5AFUA 2RHKA 3ZSXA 3W0LA 5DMRA 1OKJA 3WQUA 3K57A 4FJNA 3ID8A 3GBTA 2HHTA 3OW2M 3QEVA 1KAXA 1EXQA 2QM1A 1WAJA 4A5AA 3O9RA 2D0OA 4M3RA 1NMDA 2ZJPL 4LF8K 1HKCA 3ZSWA 3LL3A 2XY6A 2KW4A 1RT3A 3MWTA 3SBTA 1W97L 3SV3A 2HW3A 2JGUA 3ZETA 1HKGA 2FBYA 5CY4A 4E1JA 2RE2A 2PAVA 3EZ5A 4ICLA 2O8EA 1BHLA 4CD1A 3R6MA 2Q31A 1S22A 3MCPA 1NGJA 4E3SA 2Q36A 1MDUB 4CF8A 1YAGA 2Z1IA 2W42A 5BPMA 1YTUA 3KK3A 3DLRA 1RTJA 3BP8A 4BC3A 3GL1A 3H1QA 2I7NA 4BC2A 3CFPA 3ZX0A 4JI6K 2O8CA 1VSLA 5BPLA 4F3OA 4DQSA 4CZIA 4HCCA 2ASMA 2NRHA 4O55A 1RT7A 3E1YA 4ZTJA 3U9ZA 4FW2A 1RCHA 1XI1A 4DR4K 4FWKA 2G8UA 3SAHA 3NVMA 4JI2K 4J2AA 1W0HA 4R5PA 1I94K 4BE1A 2UUCK 4A62A 3TABA 4DHYA 3LDSA 3QBXA 3HL8A 1KXPA 4RCHA 3BY5A 1IBMK 1DTTA 3C94A 4CGHA 1C0GA 3MMVA 3OS1A 3K9KA 4O0JA 3SQ1A 1JXEA 1TUYA 5J2NA 4AHCA 1N32K 4H0TB 3EEQA 1CZBA 1RDWX 2Z1GA 3LP3A 1A5WA 2QWNA 4DTNA 4BWMA 4CFBA 2E2NA 3B6PA 1HLUA 1X3NA 3K58A 1SV5A 4DU3A 4IJNA 2GV9A 5C15A 1MA9B 3OYHA 1P8ZA 2Q97A 3VEZA 1BISA 3TAEA 3JYTA 5AQZA 3VN5A 4CJFA 5KPRA 1XNQK 4DV5K 5C0YA 4DF4A 3G25A 3NF8A 3THVA 4WFNL 4YFUA 2O8EB 4E7JA 5BN9A 4CBUA 4MLEA 3AVGA 4DTXA 3L2VA 2NRZA 3WXMB 3H3NO 3ISNC 3F5TA 4HTUA 4CZKA 4NLBA 2QKBA 3QNNA 2WUSA 1HYZA 3O3HA 4CBWA 3SQ4A 1DT9A 3DLHA 2IVOA 3O6WA 1IBLK 3F9MA 1S1WA 4RW4A 2R7YA 1W2BM 1UAXA 3HK2A 5JS2A 4O8UA 4C8NA 4DV7K 4JKEA 3J7YP 5M1PA 3EYZA 4NO7A 3CYMA 1KLMA 3G4SN 4LF6K 1RBSA 2D0BA 4JN4A 2O4GA 2OPPA 3DOKA 4EFHA 3PIPL 3SCXA 5CYQA 2YKNA 4OKKA 3DYAA 1JCFA 4PUOA 3NH0A 2IAJA 1YJNN 4FWNA 5HRNA 1OH6A 1KLNA 4OLAA 2G8IA 4WYBA 1JCGA 4GVEA 4MDBA 4PKGA 4W5NA 4WFBL 4N5SA 2IIRA 3L6QA 2HB5A 2Q1NA 3ZSQA 2D0CA 3O9QA 1TKTA 4K42A 4BR0A 4KI4A 1GLCG 5KGWA 3SQ2A 1XC9A 4OO1J 3WQTA 3OJUA 2E8AA 1SKWA 4YOXA 4IOXA 4RW8A 1ITGA 1RT5A 3RR8A 4QS7A 4B9NA 4ISFA 3ZLJA 2F9TA 2YHAA 3ZYYX 5BREA 5I42A 4JKGA 5F1XA 4O44A 3I33A 3D6RA 4JK9A 3L0QA 5SZTA 5AQGA 1ASWA 3EY1A 4CFDA 2O8DA 1KTQA 3NCIA 4YORA 3VMFB 1A5XA 1B92A 1N33K 4CGFA 4FJHA 1VSEA 3DRRA 1YTAA 2HHXA 2EHGA 5GIOA 3ZX3A 1YXQA 3J8AA 1RBTA 2DY4A 2Q2RA 1A5VA 1C1BA 1GLFO 1C0FA 4H5WA 4FW1A 4CBXA 2XY7A 1L3TA 3HO1A 4AHUA 5KRTA 3D0PA 3TU5A 4KHQA 3CC7N 5DM6L 3CJ7A 4R79A 3MEGA 2NLXA 1HPZA 3VEYA 3OTOK 3VQEA 1VQ8N 1TAQA 1SKSA 3ASMA 3PX4A 1WSFA 3ULEA 3VERA 3KLGA 4I9QA 1BO5O 4CZHA 3IDHA 2PY5A 3NHGA 3QEWA 1U4BA 1Q8IA 4PKHA 1WSHA 4BR5A 3QBWA 3OYJA 3QLHA 3PO4A 4BE0A 4DF8A 3GE1A 3CM6A 1EP4A 4CEOA 1CLQA 2IS3A 4IKFA 1WSGA 3SAFA 1ZYQA 1HJOA 1NKEA 1T7PA 4FJ5A 4FWLA 3NH2A 4LF4K 4CE9A 4ILGB 3MEDA 1RNHA 5FPNA 5C2DA 4N47A 4BVPA 3CF5L 1GLJO 3VQDA 1VQ4N 4CIGA 5AQOA 1G15A 5FPEA 4H5VA 2FBVA 2VGNA 4BC5A 1NNEA 2RF2A 4K25A 2JLEA 1BIUA 3IKMA 1YJ9N 3VGKA 4CFAA 2Y1IA 4JKGB 5LL6Z 4GV9A 1GLLO 1I3AA 1RBRA 3NFAA 5AR0A 1VQ9N 2ZJRL 2O8DB 2E2QA 1HNZK 1T05A 1TGOA 4W5RA 3PSFA 3RSEA 4JKAA 4YHHK 2O8FB 4CGDA 2ZE2A 4FJIA 2CH5A 1K8AO 1M90O 3CCEN 3C6HA 1KAZA 4OPAA 2FXUA 2KZMA 1H1VA 1KRPA 1S1VA 3H46O 4JI8K 4X66K 3K5OA 3DLLL 3PX6A 3UB5A 4J2DA 3THYA 5AQUA 4KB0A 3C6UA 2F4VK 4B1WB 5KTQA 3ENBA 1RDUA 4OGCA 2A42A 1SS6A 2RN2A 3VQ8A 2HOEA 5HP1A 1RT1A 3ID6A 4Z94A 4CGIA 5C2FA 4DTJA 3AVNA 1NGBA 3U4LA 1VQ5N 4DTPA 4GV6A 5AQRA 1RBUA 4CEQA 5M1FA 3ZSVA 4JV5K 1WNSA 2HHSA 4H0YB 3HOTA 3C7NA 4KKOA 3K5LA 2P9KB 3M8SA 5AQSA 4DFMA 3FZHA 4AHRA 3VF2A 3WNHA 2B4JA 3Q7CA 1T44A 1VHXA 3E01A 3KZBA 4Y1DA 3HRGA 1NU0A 3ATUA 1WOQA 4WF9L 4FJ9A 3SQ0A 2P9UA 1YJWN 1QZ6A 1X9MA 4FLWA 4I6MB 1KVCA 3KWIA 4U67L 3SLCA 3VOVA 1IO2A 3CCRN 3IMXA 3LALA 5HOOA 2OTLN 1BQMA 4YOYA 1X1PA 4HHTA 4KV8A 4XIUA 2YNFA 5I9EB 4FK4A 2HNZA 4OKEA 5EXWA 3O4QA 2V52B 3RSEB 3TANA 1VQMN 4Z4GA 2E1ZA 2P9SB 4MO4A 3WNEA 1D8YA 2KHOA 3LPUA 2NRRA 3FR0A 1JLAA 1EWRA 3C95A 2KZZA 3VEVA 5M1NA 4BRIA 3QETA 3SI6A 2WC9A 5AJ3K 3ULDA 4ISGA 1XWLA 4M3UA 1U48A 3RTVA 5AZIA 2NZTA 1CZ9A 3HOSA 3BDPA 3CQYA 4CIFA 2Q3SA 4CJQA 4XH5A 4NCAA 4J8FA 4I2QA 1HNIA 3CMAN 1G99A 2YHWA 3TAFA 2J4RA 3U9DA 3WUHA 3KJVA 4N41A 3PY8A 1IKWA 2D0PA 2ATQA 1NJIO 1QE1A 1LWCA 2P5OA 1JL2A 5KPTA 1U04A 1U2VB 1U49A 1NGCA 1IV0A 4RW6A 4KHYA 1Q18A 5AZJB 4BGBA 3QO9A 2X6NA 1I39A 4JK8A 5KPZA 2YHYA 1DEJA 3GOIA 3MN5A 1BG3A 4M3ZA 4BE2A 4CF2A 4IXCA 3LP2A 4QOZB 4PQUA 5TKWA 3CJ9A 3KK2A 4M3TA 1N5YA 3LDPA 4DKWA 4X65K 1XHXA 2I7PA 3OYCA 4F2SA 2P9LB 3VQBA 3CC2N 4JI3K 2BE2A 1S1XA 4BC4A 3QEPA 1NGDA 3HP6A 1X9SA 2IGIA 3MCAB 3AY9A 3KLFA 4C8KA 4B8AB 1L3UA 2FF6A 1SKRA 1S5JA 4FJ8A 5AQNA 1KCFA 3RRHA 3SZ2A 4XH1A 5KGXA 4CJWA 5J2MA 3P5JA 2D1KA 3DXKB 4OVLA 2A5XA 3THWA 2Z1JA 3SJHA 2ZM6K 5FLXO 4FVUA 1SZ2A 1J6ZA 1V4SA 1S9GA 1TK8A 3TWHA 3O9TA 3LDQA 3JXUA 5GADP 4IEEA 5HRPA 3OS2A 4CECA 1WN7A 1HMVA 2FSKA 4DTRA 1VSJA 1WUAA 4H5RA 4M3XA 3WXIA 4CJPA 1NK8A 3T1AA 4DUZK 3P31A 2WOMA 3M8RA 3LM9A 1BWFO 4AF1A 3QIOA 5AZIB 2P9IA 3I55N 2ASOA 1Q81O 2WFBA 4UQGA 3OS0A 4IO9L 1Q9YA 3NH1A 1YIJN 4BGAA 1KFDA 4FWQA 2CGKA 2KKZA 2DFEA 3M5RA 1ZBLA 4BR9A 4JD2A 1KQSM 4A61A 3DWLA 4FM1A 2A6AA 3SUQA 2O8BA 4JHDA 1HPMA 5HL7L 4CK1A 4CGJA 2P9PB 4X64K 4AM6A 4BRPA 5MLCQ 4FWPA 4GW6A 1ZBSA 3VTIA 4QS9A 1Q9XA 3U8XA 1VQPN 5T7BA 4CW7B 2PZSA 4EZ6A 3I0RA 3WNFA 4CJVA 4A2AA 3AVFA 1W9HA 2GWKA 1S1UA 3H1VX 3CQ8A 4KI6A 3O3GA 2OANA 3AVHA 1VQLN
chains in the Genus database with same CATH topology
4FJMA 5DK5A 5C25A 3EYZA 5C24A 2XY5A 3O4NA 3TAPA 2IOCA 3CYMA 2G8WA 4CJTA 3LWLA 1NK4A 1B9FA 1KLMA 3MXJA 1RBSA 2D0BA 3QNOA 3OYIA 4Q0BA 2OZSA 2O4GA 2QK9A 5J2PA 1EETA 1ZBFA 2OPPA 3DOKA 2VWJA 1LW0A 3KK1A 1RDBA 3LAMA 1SL1A 4CEZA 3VA3A 3SCXA 5CYQA 2YKNA 4OKKA 4DMNA 3DYAA 4F8RA 3KD1E 3AO1A 4PUOA 3NH0A 2IAJA 3KKSA 2G8KA 4J2BA 3NF9A 4M3WA 1HNVA 1QSYA 1J5OA 1Y97A 3DLBA 5HRNA 1RT4A 3PUFA 4QCLA 3AA5X 1KLNA 1S6QA 4OLAA 3S3OA 2ZQBA 4B3OA 4ID5A 2G8IA 1BL3A 1TL1A 3DOLA 4W5NA 4N5SA 4DG1A 1LWEA 4HUGA 3LZJA 3JSMA 2HB5A 4RG8A 3ZSQA 2D0CA 3O3FA 1TKTA 4TSXA 4JLHA 3AO4A 4FLZA 1NOZA 1TV6A 3NBPA 4KB1A 3PO5A 4N56A 2FBXA 4CF1A 4KI4A 2YNGA 1WSJA 2E6MA 2PYJA 5KGWA 3OY9A 1EKEA 3S3MA 2ETJA 1LAWA 4FLYA 4C8OA 3SQ2A 1XC9A 4E89A 3OJUA 1JLFA 4E0DA 4FJ7A 1SKWA 1ZBHA 1QQCA 4H4MA 4RW8A 1ITGA 3HPHA 2HHVA 1RT5A 3DM2A 3RR8A 4B9NA 1J54A 2OPQA 1BIZA 4CHPA 3RMBA 3SPYA 4E1NA 2YHAA 3SPZA 3IAYA 4CJKA 2BDPA 5I42A 4J2EA 1NJZA 1IKVA 1SL2A 4LH4A 4O44A 1JL1A 2BGGA 1JLCA 5SZTA 3OYKA 3KLEA 3HYFA 4W5QA 4EZ9A 1ASWA 2GUIA 2NUBA 1S6PA 3ZCMA 2HMIA 3ZSZA 3P83D 3EY1A 5HBMA 4CFDA 4NYFA 5D3GA 1KTQA 1LW2A 3NCIA 1A5XA 1B92A 4CEFA 4CGFA 4FJHA 1RILA 1VSEA 3DRRA 5I3UA 4DTSA 1YTAA 2HHXA 1VSHA 2EHGA 4DTUA 4CJ3A 4FM0A 4DFJA 1RBTA 2P51A 4MQ3A 3CFOA 2DY4A 1A5VA 1C1BA 1NK0A 4FW1A 3TR8A 3V1OA 4E7LA 3KKRA 1SUQA 4YNQA 2XY7A 3TI0A 1RDCA 2G8VA 1L3TA 3HO1A 3OJSA 4OLBA 4AHUA 5KRTA 4AH9A 4FLTA 4DU1A 4JS4A 2GBZA 4BDPA 3D0PA 3M8QA 1C0MA 2OPRA 1VSMA 4B9MA 1O1WA 1C0UA 4KHQA 3OVNA 3MEGA 4M41A 4Z4CA 3NDKA 3C6TA 1HPZA 3OYMA 4DLGA 4KREA 3AVJA 3D45A 4KRFA 3VQEA 5K14A 4KHWA 1TAQA 4DQQA 1SKSA 1F21A 4LD0A 3L2RA 3ASMA 3PX4A 1WSFA 1TK5A 4AHTA 3KLGA 1NKBA 3K2PA 3F9KA 4WE1A 4I9QA 1BGXT 1ASUA 4CEEA 1X9WA 3HXMA 3K5MA 4CJ5A 2PY5A 4CK3A 3NHGA 3DLEA 4FK0A 1CXQA 3QEWA 1U4BA 1HJRA 1Q8IA 3RMDA 1RTIA 1LV5A 3AVAA 1LWFA 3VQCA 4PA1A 1VSKA 2KTQA 1UWBA 2HVHA 1WSHA 4Y1CA 3V6DA 3L2UA 3OYJA 3RMAA 3QLHA 4FK2A 3PO4A 4DSFA 4BE0A 4DF8A 4KPYA 1RT2A 4H4OA 3SYZA 3CM6A 3AVKA 3P1GA 1EP4A 4QAGA 4CEOA 3QESA 1K6YA 3ALYA 1NK9A 3CFRA 4M45A 3K59A 1CLQA 2IS3A 1JXBA 3AVLA 4IKFA 3OYNA 1WSGA 1L5UA 1ZYQA 1JKHA 4I7FA 3TAMA 4W5TA 1NKEA 1T7PA 4FJ5A 3AA3A 3V9SA 3V9XA 4H8KA 4CJSA 3OYGA 4FJKA 2F8TA 1NJYA 3NH2A 4B9VA 3KLIA 1TKDA 1BCMA 4CE9A 4DQPA 3MEDA 2YV0X 4CEDA 1RNHA 4CJUA 4N47A 3DI6A 4DFKA 2QKKA 2YHBA 1VSIA 3VQDA 4F3TA 4KHNA 4IFVA 4CIGA 4PY5A 4RW7A 3ZT2A 3IRXA 3OYDA 3LWMA 3U6FA 1G15A 2FBVA 3SJJA 4IFYA 3NE6A 4AHVA 2RF2A 3TARA 4ZTFA 2JLEA 4DU4A 1C0TA 2IDOA 1BIUA 1UOCA 3TAQA 4FXDA 5CZ2A 1CXUA 3AO3A 3B6OA 1C1AA 3WNGA 2VWKA 2OA8A 4CFAA 2Y1IA 1GOCA 1TVRA 1S9EA 4KTZA 3L2QA 3MXIA 2PYLA 3VQ9A 1I3AA 4E7IA 1NK6A 4K8XA 1REVA 1RBRA 3NFAA 3VQQA 1NOYA 1HQEA 3MEEA 3T19A 4CEAA 3QEXA 4B08A 1T05A 1TGOA 5FROA 4W5RA 1QSSA 4KFBA 4OKJA 4CGDA 2OPSA 2ZE2A 1HQUA 3OYBA 3K5NA 4DSLA 4FJIA 3VQAA 4FZXC 4EZ6A 2O4IA 3BGRA 4CFCA 2F8SA 3S3NA 4KAZA 3PV8A 3NF7A 4AHSA 4CHZA 3HT3A 1KSPA 3LANA 3NGIA 2KZMA 2HNYA 1KRPA 5JS1A 1FK9A 1S1VA 2VG7A 3HPOA 2FC0A 3HVTA 4NCGA 3T3FA 3NGZA 4CF0A 3ZT1A 3CG7A 3K5OA 1FKOA 5HRRA 5E41A 3PX6A 3AVIA 4J2DA 4BDYA 4G1QA 3SUOA 4KB0A 4C8LA 4RW9A 1WSEA 3LZIA 3C6UA 1RDDA 3HPGA 3V4IA 1WAFA 5KTQA 3HM9A 3M8PA 4E19A 3KTQA 2YNIA 3AVCA 4OGCA 1B9DA 3PX0A 2RN2A 3VQ8A 3V81A 4CJ4A 3OYFA 5HP1A 4HVJA 1NK7A 1RT1A 1QSLA 1VK0A 2ZD1A 1HYVA 4CGIA 5KRSA 1MU2A 4DTJA 3VQ4A 1IKYA 1QHTA 2WONA 3AVNA 4LSNA 5C42A 4FM2A 3LP1A 1YVUA 4BACA 1JLBA 4DTPA 1Z26A 2A1SA 1RBUA 3OYLA 4CEQA 2KFNA 3ZSVA 3DRSA 4Z4FA 4FYDA 1WNSA 2HHSA 1HRHA 3ZT0A 2X78A 4F4KA 4KKOA 3UIQA 3LPTA 4JRPA 3VQ6A 3KLHA 1VSFA 2DFHA 4FLUA 2VG6A 5FDLA 3K5LA 1C6VA 2BANA 2YNHA 4GVMA 4CF9A 3M8SA 2LSNA 4DFMA 1D9DA 1N6QA 4Z4IA 3SUPA 4AHRA 4CGGA 3WNHA 3AVBA 2B4JA 3L3UA 2YKMA 4Y1DA 3E01A 4CJLA 1UA0A 1D9FA 4B9LA 2F96A 3TAGA 3HSTB 1TKXA 4DLEA 2OZMA 2XRIA 4CHOA 2QXFA 3OYEA 2AJQA 4FJ9A 3SQ0A 4Z0UA 3KD5E 4FJGA 1X9MA 2FBTA 4DQRA 3AA2A 4FLWA 4L8RB 3U3YA 4FJJA 4C8MA 1KVCA 2I5JA 4DWIA 3ZT4A 3MAQA 2Y1JA 2DTUA 4ZHRA 1IO2A 4B9SA 3LALA 1BQMA 1DTQA 1RT6A 2B5JA 3U3GA 4E7HA 4ELUA 4ELVA 4F2RA 1X1PA 3NAEA 3RMCA 2XO7A 4HHTA 4FVMA 5HRSA 3VQPA 4KV8A 4XIUA 4HUEA 5J2QA 4DSEA 4DFPA 2HHQA 1ZBUA 3VQ7A 1UA1A 2YNFA 4FK4A 3AA4A 1BI4A 2HNZA 1NK5A 2D0AA 4OKEA 3ZSOA 1KFSA 3O4QA 4OGEA 3ZSXA 4E7KA 5DMRA 3TANA 5FRNA 4JS5A 3V9WA 4Z4GA 3K57A 4FJNA 3WNEA 3F73A 1D8YA 2P5GA 3LPUA 3NF6A 2HHTA 3SV4A 1WLJA 3QEVA 1IKXA 1JLEA 1EXQA 1WAJA 1JLAA 1VRTA 4M3RA 4B9UA 2DFFA 4EP5A 2G8HA 2Z1HA 3C95A 4BWJA 3AVMA 1RTDA 4CHYA 2KZZA 4FCYA 3A2FA 4JRQA 2HHUA 1KVAA 1HYSA 3ZSWA 4IDKA 4N76A 1KVBA 3QETA 2XY6A 2KW4A 5CZ1A 1RT3A 3SI6A 1J9AA 3SV3A 5HLFA 3RR7A 3ULDA 2HW3A 1XWLA 2JGUA 4GMJB 1S1TA 4M3UA 1U48A 3RTVA 4HCBA 1ZBIA 1CZ9A 3BDPA 5CY4A 2FBYA 4CIFA 2G8FA 3RRGA 2OYQA 2Q3SA 1TK0A 4CJQA 3EZ5A 1VRUA 4ICLA 1BHLA 1WSIA 3DRPA 4Z4HA 4NCAA 4I2QA 1HNIA 4E3SA 4CF8A 3TAFA 4CJEA 2Z1IA 1JLGA 1LAVA 2W42A 3KIOA 4CHNA 4OJRA 3QINA 3KJVA 1NJXA 4Z4EA 1YTUA 3KK3A 4KO0A 1DLOA 3DLRA 4ID1A 3PY8A 4N41A 1IKWA 1RTJA 3ZT3A 4FZZA 4PWDA 2A1RA 4E1MA 3AV9A 3S9HA 2ATQA 5KI6A 3CFPA 4BDZA 1QE1A 1LWCA 2P5OA 4OPKA 1VSLA 3I8DA 2XHBA 1JL2A 4F3OA 3V1RA 1U45A 1U04A 4DQSA 4HCCA 3FFIA 1FXXA 4FLXA 4RW6A 1U49A 4M42A 4KHYA 4O55A 4NCBA 1RT7A 1QS4A 4ZTJA 2RPIA 3I0SA 3QO9A 2X6NA 4FW2A 1I39A 4CCHA 1RCHA 2E6LA 1IH7A 1XI1A 4FJLA 4Q5VA 1XHZA 3V9UA 2B6AA 4DTMA 2G8UA 3DLKA 4M3ZA 2EX3A 4BE2A 4CF2A 1RDAA 3HP9A 1TKZA 3LP2A 4QOZB 4PQUA 1BCOA 3KK2A 3LP0A 1N5YA 4M3TA 4J2AA 4HUFA 1W0HA 4R5PA 1VSDA 4BE1A 5EU7A 1XHXA 2XY8A 3OYCA 4IBNA 3TABA 3QERA 4F2SA 3VQBA 1NKCA 3LDSA 3CM5A 3MECA 2BE2A 3HL8A 1S1XA 4I9LA 3QEPA 4W5OA 3SUNA 4K8ZA 4CESA 1RBVA 4LY7A 3HP6A 1X9SA 3QEIA 3IS9A 4CHQA 1C1CA 2IGIA 3H08A 1DTTA 3C94A 3SNNA 3KLFA 1YT3A 4C8KA 1D5AA 4CGHA 1RTHA 1U47A 4B8AB 1L3UA 3OS1A 4O0JA 1S5JA 3SQ1A 5SWMA 1SKRA 1BI4B 4FJ8A 1JXEA 1KCFA 3RRHA 3SZ2A 5J2NA 1ASVA 4AHCA 5KGXA 4CJWA 1CZBA 2HNDA 2Z1GA 3P5JA 3LP3A 4DS5A 2KQ2A 1A5WA 5J2MA 4DTNA 1L3SA 4OVLA 4BWMA 4CFBA 2Z1JA 1JLQA 3NGYA 1NJWA 3B6PA 4O5BA 1GOBA 1R0AA 1SL0A 1S9GA 1EX4A 3AO5A 3AO2A 1TK8A 1QTMA 3LAKA 2ITGA 4NYNA 4IG3A 3K58A 4EP4A 1SV5A 3TWHA 3VA0A 4DU3A 4KHSA 1BQNA 4I2PA 1GOAA 4LSLA 4DTOA 5HRPA 2GV9A 3OS2A 3L2WA 4CECA 3OYHA 1WN7A 5HROA 1HMVA 3IG1A 4DTRA 1VSJA 4KTQA 4CERA 3HJFA 4M3XA 4IG0A 4LH5A 1BISA 4CJPA 1NK8A 3T1AA 3TAEA 2WOMA 3JYTA 3G0ZA 2X6SA 3M8RA 3RWUA 3VN5A 1T8EA 3ZSRA 4CJFA 3QIOA 4KTWA 2D5RA 4DF4A 4O0IA 1TAUA 4OPJA 4UQGA 3NF8A 1Z25A 3OS0A 4YFUA 3THVA 3MXMA 3NH1A 1Q9YA 4CIEA 4E7JA 1L3VA 1IG9A 1T03A 4ELTA 3VQ5A 3DLGA 3AVGA 1TL3A 3L3VA 4CK2A 1KFDA 5CYMA 4DSJA 2KFZA 3QIPA 4DTXA 2DFEA 3L2VA 4DSIA 3G10A 1ZBLA 3ISNC 2IC3A 4HTUA 4FZYA 5J1EA 2QKBA 4FM1A 4MFBA 3QNNA 3SUQA 2HVIA 5FRMA 1HYZA 1FKPA 2VG5A 4CK1A 4CGJA 3O3HA 4FLVA 2X74A 3V1QA 4DS4A 3SQ4A 4B9TA 3L8BA 4CEBA 1J53A 3DLHA 4GW6A 1Q9XA 4AILC 1S1WA 5T7BA 4RW4A 2R7YA 2HHWA 2PZSA 3OYAA 1UAXA 3I0RA 3WNFA 3ITHA 4CJVA 3DMJA 3AVFA 3ZSYA 3V9ZA 4M3YA 3HK2A 5JS2A 1W9HA 1S1UA 4B8CA 4CJRA 4C8NA 2RKIA 3CQ8A 4KI6A 3O3GA 4DSKA 4DQIA 4O4GA 4FJXA 3AVHA 4KHUA 3HVRA 2E4LA 2P1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJM A;  5DK5 A;  5C25 A;  3EYZ A;  5C24 A;  2XY5 A;  3O4N A;  3TAP A;  2IOC A;  3CYM A;  2G8W A;  4CJT A;  3LWL A;  1NK4 A;  1B9F A;  1KLM A;  3MXJ A;  1RBS A;  2D0B A;  3QNO A;  3OYI A;  4Q0B A;  2OZS A;  2O4G A;  2QK9 A;  5J2P A;  1EET A;  1ZBF A;  2OPP A;  3DOK A;  2VWJ A;  1LW0 A;  3KK1 A;  1RDB A;  3LAM A;  1SL1 A;  4CEZ A;  3VA3 A;  3SCX A;  5CYQ A;  2YKN A;  4OKK A;  4DMN A;  3DYA A;  4F8R A;  3KD1 E;  3AO1 A;  4PUO A;  3NH0 A;  2IAJ A;  3KKS A;  2G8K A;  4J2B A;  3NF9 A;  4M3W A;  1HNV A;  1QSY A;  1J5O A;  1Y97 A;  3DLB A;  5HRN A;  1RT4 A;  3PUF A;  4QCL A;  3AA5 X;  1KLN A;  1S6Q A;  4OLA A;  3S3O A;  2ZQB A;  4B3O A;  4ID5 A;  2G8I A;  1BL3 A;  1TL1 A;  3DOL A;  4W5N A;  4N5S A;  4DG1 A;  1LWE A;  4HUG A;  3LZJ A;  3JSM A;  2HB5 A;  4RG8 A;  3ZSQ A;  2D0C A;  3O3F A;  1TKT A;  4TSX A;  4JLH A;  3AO4 A;  4FLZ A;  1NOZ A;  1TV6 A;  3NBP A;  4KB1 A;  3PO5 A;  4N56 A;  2FBX A;  4CF1 A;  4KI4 A;  2YNG A;  1WSJ A;  2E6M A;  2PYJ A;  5KGW A;  3OY9 A;  1EKE A;  3S3M A;  2ETJ A;  1LAW A;  4FLY A;  4C8O A;  3SQ2 A;  1XC9 A;  4E89 A;  3OJU A;  1JLF A;  4E0D A;  4FJ7 A;  1SKW A;  1ZBH A;  1QQC A;  4H4M A;  4RW8 A;  1ITG A;  3HPH A;  2HHV A;  1RT5 A;  3DM2 A;  3RR8 A;  4B9N A;  1J54 A;  2OPQ A;  1BIZ A;  4CHP A;  3RMB A;  3SPY A;  4E1N A;  2YHA A;  3SPZ A;  3IAY A;  4CJK A;  2BDP A;  5I42 A;  4J2E A;  1NJZ A;  1IKV A;  1SL2 A;  4LH4 A;  4O44 A;  1JL1 A;  2BGG A;  1JLC A;  5SZT A;  3OYK A;  3KLE A;  3HYF A;  4W5Q A;  4EZ9 A;  1ASW A;  2GUI A;  2NUB A;  1S6P A;  3ZCM A;  2HMI A;  3ZSZ A;  3P83 D;  3EY1 A;  5HBM A;  4CFD A;  4NYF A;  5D3G A;  1KTQ A;  1LW2 A;  3NCI A;  1A5X A;  1B92 A;  4CEF A;  4CGF A;  4FJH A;  1RIL A;  1VSE A;  3DRR A;  5I3U A;  4DTS A;  1YTA A;  2HHX A;  1VSH A;  2EHG A;  4DTU A;  4CJ3 A;  4FM0 A;  4DFJ A;  1RBT A;  2P51 A;  4MQ3 A;  3CFO A;  2DY4 A;  1A5V A;  1C1B A;  1NK0 A;  4FW1 A;  3TR8 A;  3V1O A;  4E7L A;  3KKR A;  1SUQ A;  4YNQ A;  2XY7 A;  3TI0 A;  1RDC A;  2G8V A;  1L3T A;  3HO1 A;  3OJS A;  4OLB A;  4AHU A;  5KRT A;  4AH9 A;  4FLT A;  4DU1 A;  4JS4 A;  2GBZ A;  4BDP A;  3D0P A;  3M8Q A;  1C0M A;  2OPR A;  1VSM A;  4B9M A;  1O1W A;  1C0U A;  4KHQ A;  3OVN A;  3MEG A;  4M41 A;  4Z4C A;  3NDK A;  3C6T A;  1HPZ A;  3OYM A;  4DLG A;  4KRE A;  3AVJ A;  3D45 A;  4KRF A;  3VQE A;  5K14 A;  4KHW A;  1TAQ A;  4DQQ A;  1SKS A;  1F21 A;  4LD0 A;  3L2R A;  3ASM A;  3PX4 A;  1WSF A;  1TK5 A;  4AHT A;  3KLG A;  1NKB A;  3K2P A;  3F9K A;  4WE1 A;  4I9Q A;  1BGX T;  1ASU A;  4CEE A;  1X9W A;  3HXM A;  3K5M A;  4CJ5 A;  2PY5 A;  4CK3 A;  3NHG A;  3DLE A;  4FK0 A;  1CXQ A;  3QEW A;  1U4B A;  1HJR A;  1Q8I A;  3RMD A;  1RTI A;  1LV5 A;  3AVA A;  1LWF A;  3VQC A;  4PA1 A;  1VSK A;  2KTQ A;  1UWB A;  2HVH A;  1WSH A;  4Y1C A;  3V6D A;  3L2U A;  3OYJ A;  3RMA A;  3QLH A;  4FK2 A;  3PO4 A;  4DSF A;  4BE0 A;  4DF8 A;  4KPY A;  1RT2 A;  4H4O A;  3SYZ A;  3CM6 A;  3AVK A;  3P1G A;  1EP4 A;  4QAG A;  4CEO A;  3QES A;  1K6Y A;  3ALY A;  1NK9 A;  3CFR A;  4M45 A;  3K59 A;  1CLQ A;  2IS3 A;  1JXB A;  3AVL A;  4IKF A;  3OYN A;  1WSG A;  1L5U A;  1ZYQ A;  1JKH A;  4I7F A;  3TAM A;  4W5T A;  1NKE A;  1T7P A;  4FJ5 A;  3AA3 A;  3V9S A;  3V9X A;  4H8K A;  4CJS A;  3OYG A;  4FJK A;  2F8T A;  1NJY A;  3NH2 A;  4B9V A;  3KLI A;  1TKD A;  1BCM A;  4CE9 A;  4DQP A;  3MED A;  2YV0 X;  4CED A;  1RNH A;  4CJU A;  4N47 A;  3DI6 A;  4DFK A;  2QKK A;  2YHB A;  1VSI A;  3VQD A;  4F3T A;  4KHN A;  4IFV A;  4CIG A;  4PY5 A;  4RW7 A;  3ZT2 A;  3IRX A;  3OYD A;  3LWM A;  3U6F A;  1G15 A;  2FBV A;  3SJJ A;  4IFY A;  3NE6 A;  4AHV A;  2RF2 A;  3TAR A;  4ZTF A;  2JLE A;  4DU4 A;  1C0T A;  2IDO A;  1BIU A;  1UOC A;  3TAQ A;  4FXD A;  5CZ2 A;  1CXU A;  3AO3 A;  3B6O A;  1C1A A;  3WNG A;  2VWK A;  2OA8 A;  4CFA A;  2Y1I A;  1GOC A;  1TVR A;  1S9E A;  4KTZ A;  3L2Q A;  3MXI A;  2PYL A;  3VQ9 A;  1I3A A;  4E7I A;  1NK6 A;  4K8X A;  1REV A;  1RBR A;  3NFA A;  3VQQ A;  1NOY A;  1HQE A;  3MEE A;  3T19 A;  4CEA A;  3QEX A;  4B08 A;  1T05 A;  1TGO A;  5FRO A;  4W5R A;  1QSS A;  4KFB A;  4OKJ A;  4CGD A;  2OPS A;  2ZE2 A;  1HQU A;  3OYB A;  3K5N A;  4DSL A;  4FJI A;  3VQA A;  4FZX C;  4EZ6 A;  2O4I A;  3BGR A;  4CFC A;  2F8S A;  3S3N A;  4KAZ A;  3PV8 A;  3NF7 A;  4AHS A;  4CHZ A;  3HT3 A;  1KSP A;  3LAN A;  3NGI A;  2KZM A;  2HNY A;  1KRP A;  5JS1 A;  1FK9 A;  1S1V A;  2VG7 A;  3HPO A;  2FC0 A;  3HVT A;  4NCG A;  3T3F A;  3NGZ A;  4CF0 A;  3ZT1 A;  3CG7 A;  3K5O A;  1FKO A;  5HRR A;  5E41 A;  3PX6 A;  3AVI A;  4J2D A;  4BDY A;  4G1Q A;  3SUO A;  4KB0 A;  4C8L A;  4RW9 A;  1WSE A;  3LZI A;  3C6U A;  1RDD A;  3HPG A;  3V4I A;  1WAF A;  5KTQ A;  3HM9 A;  3M8P A;  4E19 A;  3KTQ A;  2YNI A;  3AVC A;  4OGC A;  1B9D A;  3PX0 A;  2RN2 A;  3VQ8 A;  3V81 A;  4CJ4 A;  3OYF A;  5HP1 A;  4HVJ A;  1NK7 A;  1RT1 A;  1QSL A;  1VK0 A;  2ZD1 A;  1HYV A;  4CGI A;  5KRS A;  1MU2 A;  4DTJ A;  3VQ4 A;  1IKY A;  1QHT A;  2WON A;  3AVN A;  4LSN A;  5C42 A;  4FM2 A;  3LP1 A;  1YVU A;  4BAC A;  1JLB A;  4DTP A;  1Z26 A;  2A1S A;  1RBU A;  3OYL A;  4CEQ A;  2KFN A;  3ZSV A;  3DRS A;  4Z4F A;  4FYD A;  1WNS A;  2HHS A;  1HRH A;  3ZT0 A;  2X78 A;  4F4K A;  4KKO A;  3UIQ A;  3LPT A;  4JRP A;  3VQ6 A;  3KLH A;  1VSF A;  2DFH A;  4FLU A;  2VG6 A;  5FDL A;  3K5L A;  1C6V A;  2BAN A;  2YNH A;  4GVM A;  4CF9 A;  3M8S A;  2LSN A;  4DFM A;  1D9D A;  1N6Q A;  4Z4I A;  3SUP A;  4AHR A;  4CGG A;  3WNH A;  3AVB A;  2B4J A;  3L3U A;  2YKM A;  4Y1D A;  3E01 A;  4CJL A;  1UA0 A;  1D9F A;  4B9L A;  2F96 A;  3TAG A;  3HST B;  1TKX A;  4DLE A;  2OZM A;  2XRI A;  4CHO A;  2QXF A;  3OYE A;  2AJQ A;  4FJ9 A;  3SQ0 A;  4Z0U A;  3KD5 E;  4FJG A;  1X9M A;  2FBT A;  4DQR A;  3AA2 A;  4FLW A;  4L8R B;  3U3Y A;  4FJJ A;  4C8M A;  1KVC A;  2I5J A;  4DWI A;  3ZT4 A;  3MAQ A;  2Y1J A;  2DTU A;  4ZHR A;  1IO2 A;  4B9S A;  3LAL A;  1BQM A;  1DTQ A;  1RT6 A;  2B5J A;  3U3G A;  4E7H A;  4ELU A;  4ELV A;  4F2R A;  1X1P A;  3NAE A;  3RMC A;  2XO7 A;  4HHT A;  4FVM A;  5HRS A;  3VQP A;  4KV8 A;  4XIU A;  4HUE A;  5J2Q A;  4DSE A;  4DFP A;  2HHQ A;  1ZBU A;  3VQ7 A;  1UA1 A;  2YNF A;  4FK4 A;  3AA4 A;  1BI4 A;  2HNZ A;  1NK5 A;  2D0A A;  4OKE A;  3ZSO A;  1KFS A;  3O4Q A;  4OGE A;  3ZSX A;  4E7K A;  5DMR A;  3TAN A;  5FRN A;  4JS5 A;  3V9W A;  4Z4G A;  3K57 A;  4FJN A;  3WNE A;  3F73 A;  1D8Y A;  2P5G A;  3LPU A;  3NF6 A;  2HHT A;  3SV4 A;  1WLJ A;  3QEV A;  1IKX A;  1JLE A;  1EXQ A;  1WAJ A;  1JLA A;  1VRT A;  4M3R A;  4B9U A;  2DFF A;  4EP5 A;  2G8H A;  2Z1H A;  3C95 A;  4BWJ A;  3AVM A;  1RTD A;  4CHY A;  2KZZ A;  4FCY A;  3A2F A;  4JRQ A;  2HHU A;  1KVA A;  1HYS A;  3ZSW A;  4IDK A;  4N76 A;  1KVB A;  3QET A;  2XY6 A;  2KW4 A;  5CZ1 A;  1RT3 A;  3SI6 A;  1J9A A;  3SV3 A;  5HLF A;  3RR7 A;  3ULD A;  2HW3 A;  1XWL A;  2JGU A;  4GMJ B;  1S1T A;  4M3U A;  1U48 A;  3RTV A;  4HCB A;  1ZBI A;  1CZ9 A;  3BDP A;  5CY4 A;  2FBY A;  4CIF A;  2G8F A;  3RRG A;  2OYQ A;  2Q3S A;  1TK0 A;  4CJQ A;  3EZ5 A;  1VRU A;  4ICL A;  1BHL A;  1WSI A;  3DRP A;  4Z4H A;  4NCA A;  4I2Q A;  1HNI A;  4E3S A;  4CF8 A;  3TAF A;  4CJE A;  2Z1I A;  1JLG A;  1LAV A;  2W42 A;  3KIO A;  4CHN A;  4OJR A;  3QIN A;  3KJV A;  1NJX A;  4Z4E A;  1YTU A;  3KK3 A;  4KO0 A;  1DLO A;  3DLR A;  4ID1 A;  3PY8 A;  4N41 A;  1IKW A;  1RTJ A;  3ZT3 A;  4FZZ A;  4PWD A;  2A1R A;  4E1M A;  3AV9 A;  3S9H A;  2ATQ A;  5KI6 A;  3CFP A;  4BDZ A;  1QE1 A;  1LWC A;  2P5O A;  4OPK A;  1VSL A;  3I8D A;  2XHB A;  1JL2 A;  4F3O A;  3V1R A;  1U45 A;  1U04 A;  4DQS A;  4HCC A;  3FFI A;  1FXX A;  4FLX A;  4RW6 A;  1U49 A;  4M42 A;  4KHY A;  4O55 A;  4NCB A;  1RT7 A;  1QS4 A;  4ZTJ A;  2RPI A;  3I0S A;  3QO9 A;  2X6N A;  4FW2 A;  1I39 A;  4CCH A;  1RCH A;  2E6L A;  1IH7 A;  1XI1 A;  4FJL A;  4Q5V A;  1XHZ A;  3V9U A;  2B6A A;  4DTM A;  2G8U A;  3DLK A;  4M3Z A;  2EX3 A;  4BE2 A;  4CF2 A;  1RDA A;  3HP9 A;  1TKZ A;  3LP2 A;  4QOZ B;  4PQU A;  1BCO A;  3KK2 A;  3LP0 A;  1N5Y A;  4M3T A;  4J2A A;  4HUF A;  1W0H A;  4R5P A;  1VSD A;  4BE1 A;  5EU7 A;  1XHX A;  2XY8 A;  3OYC A;  4IBN A;  3TAB A;  3QER A;  4F2S A;  3VQB A;  1NKC A;  3LDS A;  3CM5 A;  3MEC A;  2BE2 A;  3HL8 A;  1S1X A;  4I9L A;  3QEP A;  4W5O A;  3SUN A;  4K8Z A;  4CES A;  1RBV A;  4LY7 A;  3HP6 A;  1X9S A;  3QEI A;  3IS9 A;  4CHQ A;  1C1C A;  2IGI A;  3H08 A;  1DTT A;  3C94 A;  3SNN A;  3KLF A;  1YT3 A;  4C8K A;  1D5A A;  4CGH A;  1RTH A;  1U47 A;  4B8A B;  1L3U A;  3OS1 A;  4O0J A;  1S5J A;  3SQ1 A;  5SWM A;  1SKR A;  1BI4 B;  4FJ8 A;  1JXE A;  1KCF A;  3RRH A;  3SZ2 A;  5J2N A;  1ASV A;  4AHC A;  5KGX A;  4CJW A;  1CZB A;  2HND A;  2Z1G A;  3P5J A;  3LP3 A;  4DS5 A;  2KQ2 A;  1A5W A;  5J2M A;  4DTN A;  1L3S A;  4OVL A;  4BWM A;  4CFB A;  2Z1J A;  1JLQ A;  3NGY A;  1NJW A;  3B6P A;  4O5B A;  1GOB A;  1R0A A;  1SL0 A;  1S9G A;  1EX4 A;  3AO5 A;  3AO2 A;  1TK8 A;  1QTM A;  3LAK A;  2ITG A;  4NYN A;  4IG3 A;  3K58 A;  4EP4 A;  1SV5 A;  3TWH A;  3VA0 A;  4DU3 A;  4KHS A;  1BQN A;  4I2P A;  1GOA A;  4LSL A;  4DTO A;  5HRP A;  2GV9 A;  3OS2 A;  3L2W A;  4CEC A;  3OYH A;  1WN7 A;  5HRO A;  1HMV A;  3IG1 A;  4DTR A;  1VSJ A;  4KTQ A;  4CER A;  3HJF A;  4M3X A;  4IG0 A;  4LH5 A;  1BIS A;  4CJP A;  1NK8 A;  3T1A A;  3TAE A;  2WOM A;  3JYT A;  3G0Z A;  2X6S A;  3M8R A;  3RWU A;  3VN5 A;  1T8E A;  3ZSR A;  4CJF A;  3QIO A;  4KTW A;  2D5R A;  4DF4 A;  4O0I A;  1TAU A;  4OPJ A;  4UQG A;  3NF8 A;  1Z25 A;  3OS0 A;  4YFU A;  3THV A;  3MXM A;  3NH1 A;  1Q9Y A;  4CIE A;  4E7J A;  1L3V A;  1IG9 A;  1T03 A;  4ELT A;  3VQ5 A;  3DLG A;  3AVG A;  1TL3 A;  3L3V A;  4CK2 A;  1KFD A;  5CYM A;  4DSJ A;  2KFZ A;  3QIP A;  4DTX A;  2DFE A;  3L2V A;  4DSI A;  3G10 A;  1ZBL A;  3ISN C;  2IC3 A;  4HTU A;  4FZY A;  5J1E A;  2QKB A;  4FM1 A;  4MFB A;  3QNN A;  3SUQ A;  2HVI A;  5FRM A;  1HYZ A;  1FKP A;  2VG5 A;  4CK1 A;  4CGJ A;  3O3H A;  4FLV A;  2X74 A;  3V1Q A;  4DS4 A;  3SQ4 A;  4B9T A;  3L8B A;  4CEB A;  1J53 A;  3DLH A;  4GW6 A;  1Q9X A;  4AIL C;  1S1W A;  5T7B A;  4RW4 A;  2R7Y A;  2HHW A;  2PZS A;  3OYA A;  1UAX A;  3I0R A;  3WNF A;  3ITH A;  4CJV A;  3DMJ A;  3AVF A;  3ZSY A;  3V9Z A;  4M3Y A;  3HK2 A;  5JS2 A;  1W9H A;  1S1U A;  4B8C A;  4CJR A;  4C8N A;  2RKI A;  3CQ8 A;  4KI6 A;  3O3G A;  4DSK A;  4DQI A;  4O4G A;  4FJX A;  3AVH A;  4KHU A;  3HVR A;  2E4L A;  2P1J A; 
#chains in the Genus database with same CATH topology
 4FJM A;  3T1H K;  2IOC A;  3TAP A;  4CJT A;  4YOT A;  3LWL A;  3VEO A;  1NK4 A;  3O1B A;  5AQM A;  1JCE A;  2QK9 A;  1EET A;  4BRL A;  2VWJ A;  3KK1 A;  2WTU A;  1RDB A;  2WBN A;  3D2E A;  1ZXO A;  3FLC O;  3I56 N;  5F0X A;  4F8R A;  3KD1 E;  3O9S A;  4RWT A;  4DV2 K;  4M3W A;  1HNV A;  3DLB A;  1Y97 A;  5BRH A;  4QCL A;  2FLO A;  1S6Q A;  3S3O A;  2ZQB A;  4B3O A;  1BL3 A;  2ITM A;  1LWE A;  4DR7 K;  4ILJ A;  3AO4 A;  1Q86 O;  1TV6 A;  3DXM A;  1VQK N;  1SQK A;  4CF1 A;  3P38 A;  3THW B;  1WSJ A;  3S3M A;  3ENH A;  4C8O A;  3HBT A;  3MDQ A;  3LDN A;  1ZBH A;  5AQK A;  1QQC A;  2UXB K;  4O8K A;  3OBY A;  3A5L C;  2GUP A;  1BIZ A;  4FOI A;  3RMB A;  4E1N A;  3SPZ A;  3VTH A;  4CJK A;  2BDP A;  1NJZ A;  4BQL A;  3JAM O;  1JLC A;  3O1W A;  3OYK A;  2P9I B;  3HYF A;  4EZ9 A;  3ZSZ A;  2VQF K;  5HBM A;  2QI2 A;  4NYF A;  2UUB K;  3CPW M;  4CEF A;  1QVF M;  5I3U A;  4DTS A;  2W6L A;  1VSH A;  4DTU A;  4LFA K;  4CJ3 A;  5AQX A;  4JNE A;  2P51 A;  4JD2 B;  3VPZ A;  2O8B B;  4JHD B;  1M1K O;  3V1O A;  4BY9 C;  3TSQ A;  3EO3 A;  3E9O A;  3KKR A;  3TI0 A;  2DPN A;  3CXC M;  4DR6 K;  2GBZ A;  4BDP A;  1T3V A;  2EWS A;  2OPR A;  1O1W A;  4Z4C A;  3OYM A;  4DLG A;  4KRE A;  5C10 A;  3G71 N;  5LMU K;  3D45 A;  3CJA A;  3ZET B;  4KRF A;  3KK7 A;  4KHW A;  4LD0 A;  1TK5 A;  4AHT A;  4WE1 A;  2AA4 A;  3HTV A;  1ASU A;  4OPH A;  1X9W A;  1J5E K;  3K5M A;  4CJ5 A;  1S3X A;  3DLE A;  1CXQ A;  1RTI A;  1LV5 A;  3D2E B;  4PA1 A;  1VSK A;  1ZC6 A;  3V6D A;  3BEX A;  4A57 A;  4KPY A;  4H4O A;  3VEX A;  2O8C B;  3A8Y A;  4PKI A;  3QES A;  1K6Y A;  2V7Y A;  4M45 A;  3TAM A;  3V9X A;  2HF4 A;  4H8K A;  4DV4 K;  4FJK A;  5AQH A;  4B9V A;  3KLI A;  1QQO A;  2YV0 X;  3DXM B;  4CED A;  4JEP A;  3DI6 A;  4DFK A;  3VF6 A;  2QKK A;  4BRE A;  4KHN A;  1BDG A;  4PY5 A;  4RW7 A;  3ZT2 A;  1ILY A;  2QWR A;  4G9Z A;  4AHV A;  2IDO A;  3TAQ A;  3VES A;  3B6O A;  1GOC A;  1TVR A;  3R3L A;  4KTZ A;  2PYL A;  4K8X A;  3AAQ A;  1U6Z A;  3T19 A;  1HUX A;  3E9P A;  5ELZ A;  3KHY A;  1VQO N;  1QSS A;  4OKJ A;  3OYB A;  2HMP A;  3BGR A;  3CCS N;  2F8S A;  1SAZ A;  3S3N A;  3DAW A;  4KAZ A;  3HT3 A;  1KSP A;  3LAN A;  3FZF A;  3NGI A;  4M63 C;  5JS1 A;  3EKS A;  4X62 K;  4H0X B;  5E41 A;  4CZF A;  3R8E A;  4C8L A;  3LZI A;  1RDD A;  3QFP A;  3EE9 A;  3V4I A;  3HM9 A;  3EE8 A;  4C1N I;  5CHI A;  2YNI A;  2BTF A;  3ZX2 A;  3PX0 A;  2A41 A;  5AQQ A;  4FPB A;  4CJ4 A;  3OYF A;  4HVJ A;  1NK7 A;  1QSL A;  1VK0 A;  2ZD1 A;  5KRS A;  1OH7 A;  1IKY A;  5C42 A;  3LP1 A;  1YVU A;  4BAC A;  3DRS A;  4FYD A;  2QA4 N;  1HRH A;  1ATN A;  3UIQ A;  1VSF A;  2YNH A;  4CF9 A;  3LM2 A;  3SUP A;  4H0O A;  4Z4I A;  4CD3 A;  4A2B A;  3L3U A;  1D9F A;  2YKM A;  4CJL A;  3TAG A;  3HST B;  2GWJ A;  2E5L K;  3VGM A;  4FSV A;  2OZM A;  2XRI A;  1EO1 A;  2QXF A;  5BRD A;  3SBG A;  5AQY A;  3ENO A;  4Z0U A;  4BR2 A;  3KD5 E;  4FJG A;  3AA2 A;  4L8R B;  3U3Y A;  4FJJ A;  3VEW A;  3ZT4 A;  3MAQ A;  5JIC A;  3SAG A;  1BA1 A;  3CQX A;  4H0P A;  3FGU A;  2Q0U A;  3BUZ B;  1DTQ A;  3U3G A;  3QML A;  4K43 A;  4NLC A;  2XO7 A;  2NRT A;  5HRS A;  4HUE A;  4DFP A;  1ZBU A;  4BRN A;  1BI4 A;  1NK5 A;  2D0A A;  1QVG M;  2HBK A;  4E7K A;  2HF3 A;  5FRN A;  5LJW A;  4JS5 A;  3V9W A;  4BRF A;  3NF6 A;  3J80 O;  1IKX A;  1JLE A;  1VQN N;  3E66 A;  4O5F A;  3L4I A;  4JKB A;  4B9U A;  4B1U B;  4EP5 A;  2G8H A;  2Z1H A;  1RTD A;  1GLD G;  4JRQ A;  4KBO A;  3I8B A;  1XQS C;  4BRM A;  1J9A A;  5HLF A;  3RR7 A;  2FSJ A;  1S1T A;  2G8F A;  2OYQ A;  1TK0 A;  1VRU A;  3EKU A;  2W40 A;  5M1O A;  1GLA G;  3FZM A;  3H45 C;  1JLG A;  3KIO A;  4CHN A;  4OJR A;  4BVO A;  4ID1 A;  4PWD A;  4FZZ A;  1GLB G;  1X9J A;  2A1R A;  2OTJ N;  4BDZ A;  2GEM A;  3GDQ A;  4OPK A;  3I8D A;  2XHB A;  1GLE G;  3V1R A;  1U45 A;  1K73 O;  1JJ2 M;  3TTD A;  1YI2 N;  2D4W A;  3I0S A;  4CCH A;  1IH7 A;  1XHZ A;  2B6A A;  2HBJ A;  4YY3 K;  4DTM A;  1NG9 A;  1YF5 L;  5B8H A;  3ULE B;  1RDA A;  3HP9 A;  1TKZ A;  1BCO A;  4DUY K;  5FPD A;  3PLA A;  2FSN A;  3MK6 A;  2XY8 A;  4IBN A;  3K0S A;  4LF5 K;  3JS6 A;  1NKC A;  1KAY A;  4BG9 A;  4CI6 A;  4BRG A;  4DV3 K;  2GX9 A;  3SUN A;  4CES A;  1RBV A;  3QEI A;  4CHQ A;  1BOT O;  1C1C A;  3H08 A;  4DV1 K;  3SNN A;  1YT3 A;  1U47 A;  1BI4 B;  1ASV A;  3RWU A;  1QZ5 A;  2HND A;  4DS5 A;  2KQ2 A;  1BUP A;  5JLH A;  3D2F A;  1T6D A;  3NGY A;  4O5B A;  1GOB A;  2H3G X;  1R0A A;  3CCU N;  1SL0 A;  4C23 A;  1QTM A;  4WFA L;  2ITG A;  4NYN A;  4EHT A;  4KHS A;  1GOA A;  4DTO A;  3L2W A;  3IG1 A;  4KTQ A;  4CER A;  1X3M A;  4LH5 A;  2F9W A;  3TPQ A;  1NGA A;  2X6S A;  3G0Z A;  4UY8 O;  1T8E A;  3ZSR A;  2D5R A;  4IOA L;  1TAU A;  4O0I A;  1Z25 A;  3MXM A;  4BG8 A;  2QWM A;  3R9P A;  1L3V A;  1T03 A;  4ELT A;  4PHT X;  3DLG A;  1TL3 A;  5CYM A;  4EAH D;  2E2O A;  3QIP A;  4AQY K;  4B3R K;  4YDU C;  4DSI A;  4XH4 A;  2VGM A;  2IC3 A;  4FZY A;  4MFB A;  2E20 A;  5CR4 A;  1WB9 A;  5FRM A;  2VG5 A;  1BU6 O;  5GAG P;  3T69 A;  3V1Q A;  4B9T A;  4DS4 A;  3L8B A;  1J53 A;  2V7Z A;  2UUA K;  2UXC K;  2HHW A;  3V9Z A;  3ITH A;  3DMJ A;  3ZSY A;  3THY B;  5IWA K;  1NGF A;  4B3T K;  4B1X B;  4JKC A;  4CJR A;  1EWQ A;  4DSK A;  1OH8 A;  4O4G A;  4KHU A;  3WXK A;  3R1X A;  2P1J A;  1RFQ A;  5C25 A;  2XY5 A;  5BR9 A;  5GAE P;  1B9F A;  3MXJ A;  3QNO A;  2OZS A;  1ZBF A;  1LW0 A;  3LAM A;  1MWM A;  1KC8 O;  3C6A A;  4DMN A;  3AO1 A;  4BRD A;  4L3Q A;  1LOT B;  2G8K A;  3NF9 A;  3O8M A;  4DB3 A;  1QSY A;  1IG8 A;  5GAH P;  3EL2 A;  1J5O A;  4LF9 K;  3C7N B;  3AA5 X;  4B1Z A;  4WCE L;  5EOY A;  1QHA A;  2E88 A;  4DG1 A;  4HUG A;  4CJ7 A;  3LZJ A;  4RG8 A;  4EHU A;  3O3F A;  4YOW A;  4TSX A;  5JLF A;  4JLH A;  5LMN K;  3NBP A;  2YNG A;  1EKE A;  4CZE A;  1LAW A;  4E89 A;  4A5B A;  2P9U B;  1JLF A;  4E0D A;  4BRH A;  1J54 A;  3G6E N;  3J7Z O;  1E3M A;  4CHP A;  4J2E A;  3IFR A;  5CE3 A;  1IKV A;  1SL2 A;  1JL1 A;  3KLE A;  4IJA A;  3EN9 A;  4DV6 K;  4DV0 K;  5EVZ A;  3AAR A;  3ZCM A;  2HMI A;  1LW2 A;  1IJJ A;  2V51 B;  3MX5 A;  1RIL A;  3CCQ N;  5H1S Q;  4IFE A;  2FF3 B;  4CZJ A;  4DFJ A;  4NB4 A;  4MQ3 A;  4BRC A;  3TR8 A;  4NXN K;  4BRK A;  4E7L A;  4YNQ A;  1RDC A;  3OJS A;  4AH9 A;  4CVN E;  2IVN A;  3A5M C;  3H3O B;  1C0M A;  4ILH A;  1VSM A;  4B9M A;  1C0U A;  5AQI A;  3PSI A;  1HNX K;  3CD6 N;  4FWM A;  3WXL A;  5K14 A;  4DQQ A;  3LDO A;  3L2R A;  3TTF A;  2CH6 A;  1NKB A;  3CJ1 A;  3HXM A;  3RMD A;  2HVH A;  3AVA A;  2W6K A;  4Y1C A;  4B1V A;  4FK2 A;  4XEI A;  1RT2 A;  4FL9 A;  3WXJ A;  4B9Q A;  5AQV A;  3SYZ A;  3AVK A;  3P1G A;  4QAG A;  3ALY A;  2QWL A;  1NK9 A;  1JXB A;  3AVL A;  3OYN A;  1JKH A;  4IWV A;  1XNR K;  4CJS A;  3OYG A;  3J7A P;  3O80 A;  3OBW A;  4CJU A;  2OCE A;  2YHB A;  2YJF A;  1VSI A;  4F3T A;  4DR1 K;  1E4F T;  3IRX A;  3U6F A;  1V4T A;  3S41 A;  1TUU A;  5JMV A;  2CGJ A;  4QS8 A;  3BF3 A;  4CZL A;  4ZTF A;  1UOC A;  3CHW A;  1CXU A;  3AO3 A;  1C1A A;  2OA8 A;  2VWK A;  4WQ4 C;  1S9E A;  1HNW K;  1REV A;  3MWP A;  3VQQ A;  1NOY A;  1HQE A;  5AQF A;  3W3D A;  4CEA A;  1K9M O;  1Z05 A;  3CJB A;  5FRO A;  4KFB A;  2QEX N;  1HQU A;  3K5N A;  2O4I A;  4KH5 A;  4FZX C;  1Q82 O;  2ZGY A;  4CFC A;  3PV8 A;  4CHZ A;  3UKU A;  3P39 A;  2PBD A;  3ATV A;  3K9J A;  3CIP A;  3QDK A;  1FK9 A;  2VG7 A;  2GTD A;  5FPM A;  4DR2 K;  1ESV A;  3CG7 A;  1FKO A;  4JK7 A;  5AQJ A;  4BDY A;  3SUO A;  2NRV A;  4RW9 A;  5JVG L;  4BRQ A;  4GKK K;  1WAF A;  1MWK A;  4BR4 A;  5A2Q O;  4V19 S;  1N36 K;  5ADX A;  3CCJ N;  4E19 A;  3E9L A;  4YDU A;  2HST A;  3FZK A;  3UE5 A;  1QQM A;  3VQ4 A;  1QHT A;  2WON A;  3D7E O;  4LSN A;  4FM2 A;  3NVK A;  3THX A;  2A3Z A;  2A1S A;  2KFN A;  4Z4F A;  3ZT0 A;  4M7Y A;  4YOU A;  1HX1 A;  3KLH A;  2DFH A;  4FLU A;  1BA0 A;  3QIC A;  4BRA A;  5FDL A;  3TSP A;  1C6V A;  5C12 A;  2ASP A;  4H0V B;  1N34 K;  1N6Q A;  5E26 A;  4ISE A;  4CGG A;  1UA0 A;  1HR0 K;  2F96 A;  1TKX A;  4KH4 A;  4CHO A;  4IDH A;  4FO0 A;  1DKG D;  2FBT A;  5F2R A;  5JVH L;  4DQR A;  1QQN A;  4GY2 B;  4C8M A;  4DWI A;  4LFB K;  4B9S A;  1RT6 A;  1CZA N;  2B5J A;  4E7H A;  4LF7 K;  3H6E A;  3NMU A;  4F2R A;  3NAE A;  1D4X A;  3RMC A;  4FVM A;  3CJC A;  5J2Q A;  4DSE A;  4WQ5 C;  3VQ7 A;  1UA1 A;  2UU9 K;  1N8R O;  1KFS A;  3SK3 A;  3VEN A;  2VCP A;  4OGE A;  3F73 A;  4MDA A;  2P5G A;  3SV4 A;  1WLJ A;  3BF1 A;  3UKU B;  1VRT A;  5TKY A;  1YUW A;  2DFF A;  3C0B A;  4BWJ A;  4FOE A;  3AVM A;  3O08 A;  4CHY A;  4FCY A;  3A2F A;  2KLA A;  1KVA A;  2HHU A;  1HYS A;  4IDK A;  5IT9 O;  4N76 A;  1KVB A;  5CZ1 A;  3SMP A;  4IO8 A;  4K41 A;  5AQL A;  4GMJ B;  2QWP A;  4JKH A;  4HCB A;  1ZBI A;  2ZF5 O;  3RRG A;  5EY4 A;  1WSI A;  3DRP A;  3F2K A;  4Z4H A;  5M1K A;  4CJE A;  1LAV A;  4Z4E A;  3QIN A;  1NJX A;  2YCH A;  4KO0 A;  1DLO A;  3ZT3 A;  4E1M A;  2QWQ A;  3AV9 A;  3THX B;  3S9H A;  5KI6 A;  3EZW A;  1HKB A;  3CME N;  1NMN A;  3HM8 A;  2UXD K;  3FFI A;  1FXX A;  4FLX A;  4M42 A;  4NCB A;  3WEE A;  1QS4 A;  2RPI A;  1R59 O;  5AQT A;  4GKJ K;  2E6L A;  4FJL A;  4Q5V A;  3V9U A;  3DLK A;  2EX3 A;  4F9O A;  5LJV A;  3O4W A;  3LP0 A;  4HUF A;  4BR7 A;  2JWK A;  1VSD A;  4JI7 K;  5EU7 A;  5M1Q A;  4H03 B;  3QER A;  2YX6 A;  3CM5 A;  4DR3 K;  3CCL N;  3MEC A;  4I9L A;  4W5O A;  4K8Z A;  5E84 A;  4LY7 A;  3IS9 A;  4RTF D;  3VF4 A;  1D5A A;  1RTH A;  1FJG K;  5SWM A;  3MN6 A;  2O8F A;  2CGL A;  1XC3 A;  4MLH A;  1L3S A;  4JI1 K;  1NJW A;  1JLQ A;  4IZ9 A;  1EX4 A;  2HBL A;  3AO2 A;  3AO5 A;  3LAK A;  4Y0W A;  4IG3 A;  3VA0 A;  4DQ8 A;  4EP4 A;  1BQN A;  4I2P A;  4LSL A;  4JAX A;  4WQ4 A;  5HRO A;  3HJF A;  4A59 A;  4IG0 A;  4EIA A;  4JI0 K;  3A0I X;  5GIN A;  4KTW A;  2YJE A;  4OPJ A;  4GNI A;  1NGG A;  4CIE A;  1IG9 A;  3VQ5 A;  3BZC A;  3MX2 A;  3TSU A;  3L3V A;  4CK2 A;  4DSJ A;  2KFZ A;  3M3Z A;  4FPA A;  1IBK K;  3G10 A;  3AAP A;  5J1E A;  3CET A;  2HVI A;  5BPN A;  2P9N A;  4U7B A;  4FLV A;  1FKP A;  2X74 A;  4CEB A;  3M1F A;  4FWR A;  4AIL C;  3DJC A;  2P9K A;  2AP1 A;  1TYQ A;  3OYA A;  2E1Y A;  4M3Y A;  3WEE B;  4B8C A;  2RKI A;  4DQI A;  4FJX A;  3HVR A;  2E4L A;  4AM7 A;  5DK5 A;  4JYA K;  5C24 A;  3O4N A;  1OH5 A;  2G8W A;  1P90 A;  2BH1 A;  3LDL A;  4Q0B A;  3OYI A;  5J2P A;  4I6M A;  1NBW A;  1LCU A;  1VAZ A;  3L4Q A;  4CEZ A;  3VA3 A;  1SL1 A;  1WBD A;  5KQ8 A;  1XMQ K;  3KKS A;  4J2B A;  3O5B A;  1RT4 A;  3PUF A;  4C1N K;  5KQD A;  1KD1 O;  4HTL A;  3ZEU A;  4ID5 A;  1TL1 A;  3DOL A;  3Q7B A;  3HZ6 A;  5EX5 A;  3JSM A;  1RGI A;  2P9S A;  4YOV A;  1S72 N;  3WT0 A;  3GG4 A;  4FLZ A;  1NOZ A;  4KB1 A;  3PO5 A;  4N56 A;  2FBX A;  4JI4 K;  2E6M A;  2PYJ A;  3AGR A;  3OY9 A;  3AGK A;  2ETJ A;  4FLY A;  1W7A A;  3BZK A;  5AFU H;  4NXM K;  4FJ7 A;  4FWO A;  4H4M A;  5LY3 A;  3HPH A;  2HHV A;  3DM2 A;  5AQW A;  3OHR A;  2OPQ A;  4H5N A;  3SPY A;  3IAY A;  3J81 O;  4WQ5 A;  4LH4 A;  2BGG A;  3C65 A;  1E4G T;  2GEL A;  3IUC A;  4W5Q A;  2GUI A;  2NUB A;  1Z6R A;  1S6P A;  1YVN A;  3O9U A;  3P83 D;  3T1Y K;  5D3G A;  1NLV A;  3CCM N;  1YHQ N;  2QXL A;  2QWO A;  2UYT A;  3CPE A;  4FM0 A;  3CFO A;  3QFU A;  4IEI A;  2P9N B;  1NK0 A;  2VYP A;  1SUQ A;  2G8V A;  4OLB A;  4FLT A;  4DU1 A;  4JS4 A;  1U2V A;  3HI0 A;  4CZG A;  3M8Q A;  1TYQ B;  3OVN A;  4M41 A;  5AZJ A;  3UKR A;  1DGK N;  3NDK A;  3C6T A;  3AVJ A;  3MN9 A;  1OVY A;  1F21 A;  2NNW A;  2NRX A;  3K2P A;  3F9K A;  1BGX T;  1NGH A;  4CEE A;  1K8K A;  4FWS A;  1ATS A;  4CK3 A;  4FK0 A;  4DR5 K;  3OA9 A;  1HJR A;  2P9L A;  1LWF A;  3VQC A;  5ADX H;  2KTQ A;  1UWB A;  1FW6 A;  2PFU A;  3L2U A;  2HHH K;  3RMA A;  4DSF A;  3B8A X;  3CFR A;  3K59 A;  5DM7 L;  3ZEU B;  2YHX A;  4DCH A;  1L5U A;  1O13 A;  1NWK A;  2A40 A;  2W41 A;  4I7F A;  4W5T A;  4PL7 A;  3AA3 A;  3V9S A;  2F8T A;  1NJY A;  3DXK A;  3FFK B;  1TKD A;  1BCM A;  4DQP A;  3FZL A;  4BRO A;  5GIP A;  2JWL A;  3TTC A;  4BQZ A;  4IFV A;  3VGL A;  3FE1 A;  3N4P A;  1NM1 A;  3QB0 A;  3OYD A;  3LWM A;  2ZJQ L;  3SJJ A;  4IFY A;  3NE6 A;  1T6C A;  3TAR A;  4MO5 A;  4B1Y B;  4DU4 A;  1C0T A;  1YIT N;  2YI1 A;  3T7Z A;  4FXD A;  5CZ2 A;  4JKD A;  1OVQ A;  3WNG A;  4LC9 B;  2IVP A;  3CER A;  3MXI A;  3CI5 A;  5AQP A;  3L2Q A;  3VQ9 A;  4E7I A;  2ZWH A;  1NK6 A;  1VQ6 N;  2BUP A;  3A5O C;  3PIO L;  3MEE A;  1EQY A;  3QEX A;  4B08 A;  4PL8 A;  3MN7 A;  4DSL A;  2OPS A;  2VQE K;  3VQA A;  4KHP K;  3SMS A;  2F7T A;  4H5T A;  3RVC A;  2ZGZ A;  3D2F B;  3NF7 A;  4AHS A;  4K0K K;  1NGI A;  5BN8 A;  2P9P A;  2HNY A;  3KVG A;  3M6G A;  3HPO A;  1ATR A;  2FC0 A;  3HVT A;  4NCG A;  3T3F A;  3NGZ A;  4CF0 A;  3A5N C;  3ZT1 A;  5HRR A;  2NRW A;  1Q7Y O;  3AVI A;  2VWB A;  4G1Q A;  4B3M K;  5BRF A;  3UKR B;  1WSE A;  3HPG A;  3M8P A;  1XUP O;  3KTQ A;  3AVC A;  4KH6 A;  1Y64 A;  1B9D A;  3V81 A;  1K8K B;  4OX9 K;  1WBB A;  2QTD A;  3CC4 N;  2Q0R A;  1HYV A;  1MU2 A;  4M7X A;  3VET A;  1JLB A;  1Z26 A;  3OYL A;  2X78 A;  4F4K A;  3LPT A;  4JRP A;  3VQ6 A;  2VG6 A;  4JI5 K;  2BAN A;  4GVM A;  2LSN A;  1D9D A;  3N4Q A;  2E2P A;  4CZM A;  3AVB A;  3HSC A;  4B9L A;  4GV3 A;  4JKF A;  1VQ7 N;  4DLE A;  3OYE A;  4HWI A;  2AJQ A;  4B3S K;  2I5J A;  3KWG A;  3P4I A;  2Y1J A;  2DTU A;  4ZHR A;  2QW9 A;  3CCV N;  4ELU A;  4ELV A;  2HBM A;  1NGE A;  5BR8 K;  4IOC L;  3VQP A;  2HHQ A;  4LFC K;  1XMO K;  3AA4 A;  3ZSO A;  5AFU A;  2RHK A;  3ZSX A;  3W0L A;  5DMR A;  1OKJ A;  3WQU A;  3K57 A;  4FJN A;  3ID8 A;  3GBT A;  2HHT A;  3OW2 M;  3QEV A;  1KAX A;  1EXQ A;  2QM1 A;  1WAJ A;  4A5A A;  3O9R A;  2D0O A;  4M3R A;  1NMD A;  2ZJP L;  4LF8 K;  1HKC A;  3ZSW A;  3LL3 A;  2XY6 A;  2KW4 A;  1RT3 A;  3MWT A;  3SBT A;  1W97 L;  3SV3 A;  2HW3 A;  2JGU A;  3ZET A;  1HKG A;  2FBY A;  5CY4 A;  4E1J A;  2RE2 A;  2PAV A;  3EZ5 A;  4ICL A;  2O8E A;  1BHL A;  4CD1 A;  3R6M A;  2Q31 A;  1S22 A;  3MCP A;  1NGJ A;  4E3S A;  2Q36 A;  1MDU B;  4CF8 A;  1YAG A;  2Z1I A;  2W42 A;  5BPM A;  1YTU A;  3KK3 A;  3DLR A;  1RTJ A;  3BP8 A;  4BC3 A;  3GL1 A;  3H1Q A;  2I7N A;  4BC2 A;  3CFP A;  3ZX0 A;  4JI6 K;  2O8C A;  1VSL A;  5BPL A;  4F3O A;  4DQS A;  4CZI A;  4HCC A;  2ASM A;  2NRH A;  4O55 A;  1RT7 A;  3E1Y A;  4ZTJ A;  3U9Z A;  4FW2 A;  1RCH A;  1XI1 A;  4DR4 K;  4FWK A;  2G8U A;  3SAH A;  3NVM A;  4JI2 K;  4J2A A;  1W0H A;  4R5P A;  1I94 K;  4BE1 A;  2UUC K;  4A62 A;  3TAB A;  4DHY A;  3LDS A;  3QBX A;  3HL8 A;  1KXP A;  4RCH A;  3BY5 A;  1IBM K;  1DTT A;  3C94 A;  4CGH A;  1C0G A;  3MMV A;  3OS1 A;  3K9K A;  4O0J A;  3SQ1 A;  1JXE A;  1TUY A;  5J2N A;  4AHC A;  1N32 K;  4H0T B;  3EEQ A;  1CZB A;  1RDW X;  2Z1G A;  3LP3 A;  1A5W A;  2QWN A;  4DTN A;  4BWM A;  4CFB A;  2E2N A;  3B6P A;  1HLU A;  1X3N A;  3K58 A;  1SV5 A;  4DU3 A;  4IJN A;  2GV9 A;  5C15 A;  1MA9 B;  3OYH A;  1P8Z A;  2Q97 A;  3VEZ A;  1BIS A;  3TAE A;  3JYT A;  5AQZ A;  3VN5 A;  4CJF A;  5KPR A;  1XNQ K;  4DV5 K;  5C0Y A;  4DF4 A;  3G25 A;  3NF8 A;  3THV A;  4WFN L;  4YFU A;  2O8E B;  4E7J A;  5BN9 A;  4CBU A;  4MLE A;  3AVG A;  4DTX A;  3L2V A;  2NRZ A;  3WXM B;  3H3N O;  3ISN C;  3F5T A;  4HTU A;  4CZK A;  4NLB A;  2QKB A;  3QNN A;  2WUS A;  1HYZ A;  3O3H A;  4CBW A;  3SQ4 A;  1DT9 A;  3DLH A;  2IVO A;  3O6W A;  1IBL K;  3F9M A;  1S1W A;  4RW4 A;  2R7Y A;  1W2B M;  1UAX A;  3HK2 A;  5JS2 A;  4O8U A;  4C8N A;  4DV7 K;  4JKE A;  3J7Y P;  5M1P A;  3EYZ A;  4NO7 A;  3CYM A;  1KLM A;  3G4S N;  4LF6 K;  1RBS A;  2D0B A;  4JN4 A;  2O4G A;  2OPP A;  3DOK A;  4EFH A;  3PIP L;  3SCX A;  5CYQ A;  2YKN A;  4OKK A;  3DYA A;  1JCF A;  4PUO A;  3NH0 A;  2IAJ A;  1YJN N;  4FWN A;  5HRN A;  1OH6 A;  1KLN A;  4OLA A;  2G8I A;  4WYB A;  1JCG A;  4GVE A;  4MDB A;  4PKG A;  4W5N A;  4WFB L;  4N5S A;  2IIR A;  3L6Q A;  2HB5 A;  2Q1N A;  3ZSQ A;  2D0C A;  3O9Q A;  1TKT A;  4K42 A;  4BR0 A;  4KI4 A;  1GLC G;  5KGW A;  3SQ2 A;  1XC9 A;  4OO1 J;  3WQT A;  3OJU A;  2E8A A;  1SKW A;  4YOX A;  4IOX A;  4RW8 A;  1ITG A;  1RT5 A;  3RR8 A;  4QS7 A;  4B9N A;  4ISF A;  3ZLJ A;  2F9T A;  2YHA A;  3ZYY X;  5BRE A;  5I42 A;  4JKG A;  5F1X A;  4O44 A;  3I33 A;  3D6R A;  4JK9 A;  3L0Q A;  5SZT A;  5AQG A;  1ASW A;  3EY1 A;  4CFD A;  2O8D A;  1KTQ A;  3NCI A;  4YOR A;  3VMF B;  1A5X A;  1B92 A;  1N33 K;  4CGF A;  4FJH A;  1VSE A;  3DRR A;  1YTA A;  2HHX A;  2EHG A;  5GIO A;  3ZX3 A;  1YXQ A;  3J8A A;  1RBT A;  2DY4 A;  2Q2R A;  1A5V A;  1C1B A;  1GLF O;  1C0F A;  4H5W A;  4FW1 A;  4CBX A;  2XY7 A;  1L3T A;  3HO1 A;  4AHU A;  5KRT A;  3D0P A;  3TU5 A;  4KHQ A;  3CC7 N;  5DM6 L;  3CJ7 A;  4R79 A;  3MEG A;  2NLX A;  1HPZ A;  3VEY A;  3OTO K;  3VQE A;  1VQ8 N;  1TAQ A;  1SKS A;  3ASM A;  3PX4 A;  1WSF A;  3ULE A;  3VER A;  3KLG A;  4I9Q A;  1BO5 O;  4CZH A;  3IDH A;  2PY5 A;  3NHG A;  3QEW A;  1U4B A;  1Q8I A;  4PKH A;  1WSH A;  4BR5 A;  3QBW A;  3OYJ A;  3QLH A;  3PO4 A;  4BE0 A;  4DF8 A;  3GE1 A;  3CM6 A;  1EP4 A;  4CEO A;  1CLQ A;  2IS3 A;  4IKF A;  1WSG A;  3SAF A;  1ZYQ A;  1HJO A;  1NKE A;  1T7P A;  4FJ5 A;  4FWL A;  3NH2 A;  4LF4 K;  4CE9 A;  4ILG B;  3MED A;  1RNH A;  5FPN A;  5C2D A;  4N47 A;  4BVP A;  3CF5 L;  1GLJ O;  3VQD A;  1VQ4 N;  4CIG A;  5AQO A;  1G15 A;  5FPE A;  4H5V A;  2FBV A;  2VGN A;  4BC5 A;  1NNE A;  2RF2 A;  4K25 A;  2JLE A;  1BIU A;  3IKM A;  1YJ9 N;  3VGK A;  4CFA A;  2Y1I A;  4JKG B;  5LL6 Z;  4GV9 A;  1GLL O;  1I3A A;  1RBR A;  3NFA A;  5AR0 A;  1VQ9 N;  2ZJR L;  2O8D B;  2E2Q A;  1HNZ K;  1T05 A;  1TGO A;  4W5R A;  3PSF A;  3RSE A;  4JKA A;  4YHH K;  2O8F B;  4CGD A;  2ZE2 A;  4FJI A;  2CH5 A;  1K8A O;  1M90 O;  3CCE N;  3C6H A;  1KAZ A;  4OPA A;  2FXU A;  2KZM A;  1H1V A;  1KRP A;  1S1V A;  3H46 O;  4JI8 K;  4X66 K;  3K5O A;  3DLL L;  3PX6 A;  3UB5 A;  4J2D A;  3THY A;  5AQU A;  4KB0 A;  3C6U A;  2F4V K;  4B1W B;  5KTQ A;  3ENB A;  1RDU A;  4OGC A;  2A42 A;  1SS6 A;  2RN2 A;  3VQ8 A;  2HOE A;  5HP1 A;  1RT1 A;  3ID6 A;  4Z94 A;  4CGI A;  5C2F A;  4DTJ A;  3AVN A;  1NGB A;  3U4L A;  1VQ5 N;  4DTP A;  4GV6 A;  5AQR A;  1RBU A;  4CEQ A;  5M1F A;  3ZSV A;  4JV5 K;  1WNS A;  2HHS A;  4H0Y B;  3HOT A;  3C7N A;  4KKO A;  3K5L A;  2P9K B;  3M8S A;  5AQS A;  4DFM A;  3FZH A;  4AHR A;  3VF2 A;  3WNH A;  2B4J A;  3Q7C A;  1T44 A;  1VHX A;  3E01 A;  3KZB A;  4Y1D A;  3HRG A;  1NU0 A;  3ATU A;  1WOQ A;  4WF9 L;  4FJ9 A;  3SQ0 A;  2P9U A;  1YJW N;  1QZ6 A;  1X9M A;  4FLW A;  4I6M B;  1KVC A;  3KWI A;  4U67 L;  3SLC A;  3VOV A;  1IO2 A;  3CCR N;  3IMX A;  3LAL A;  5HOO A;  2OTL N;  1BQM A;  4YOY A;  1X1P A;  4HHT A;  4KV8 A;  4XIU A;  2YNF A;  5I9E B;  4FK4 A;  2HNZ A;  4OKE A;  5EXW A;  3O4Q A;  2V52 B;  3RSE B;  3TAN A;  1VQM N;  4Z4G A;  2E1Z A;  2P9S B;  4MO4 A;  3WNE A;  1D8Y A;  2KHO A;  3LPU A;  2NRR A;  3FR0 A;  1JLA A;  1EWR A;  3C95 A;  2KZZ A;  3VEV A;  5M1N A;  4BRI A;  3QET A;  3SI6 A;  2WC9 A;  5AJ3 K;  3ULD A;  4ISG A;  1XWL A;  4M3U A;  1U48 A;  3RTV A;  5AZI A;  2NZT A;  1CZ9 A;  3HOS A;  3BDP A;  3CQY A;  4CIF A;  2Q3S A;  4CJQ A;  4XH5 A;  4NCA A;  4J8F A;  4I2Q A;  1HNI A;  3CMA N;  1G99 A;  2YHW A;  3TAF A;  2J4R A;  3U9D A;  3WUH A;  3KJV A;  4N41 A;  3PY8 A;  1IKW A;  2D0P A;  2ATQ A;  1NJI O;  1QE1 A;  1LWC A;  2P5O A;  1JL2 A;  5KPT A;  1U04 A;  1U2V B;  1U49 A;  1NGC A;  1IV0 A;  4RW6 A;  4KHY A;  1Q18 A;  5AZJ B;  4BGB A;  3QO9 A;  2X6N A;  1I39 A;  4JK8 A;  5KPZ A;  2YHY A;  1DEJ A;  3GOI A;  3MN5 A;  1BG3 A;  4M3Z A;  4BE2 A;  4CF2 A;  4IXC A;  3LP2 A;  4QOZ B;  4PQU A;  5TKW A;  3CJ9 A;  3KK2 A;  4M3T A;  1N5Y A;  3LDP A;  4DKW A;  4X65 K;  1XHX A;  2I7P A;  3OYC A;  4F2S A;  2P9L B;  3VQB A;  3CC2 N;  4JI3 K;  2BE2 A;  1S1X A;  4BC4 A;  3QEP A;  1NGD A;  3HP6 A;  1X9S A;  2IGI A;  3MCA B;  3AY9 A;  3KLF A;  4C8K A;  4B8A B;  1L3U A;  2FF6 A;  1SKR A;  1S5J A;  4FJ8 A;  5AQN A;  1KCF A;  3RRH A;  3SZ2 A;  4XH1 A;  5KGX A;  4CJW A;  5J2M A;  3P5J A;  2D1K A;  3DXK B;  4OVL A;  2A5X A;  3THW A;  2Z1J A;  3SJH A;  2ZM6 K;  5FLX O;  4FVU A;  1SZ2 A;  1J6Z A;  1V4S A;  1S9G A;  1TK8 A;  3TWH A;  3O9T A;  3LDQ A;  3JXU A;  5GAD P;  4IEE A;  5HRP A;  3OS2 A;  4CEC A;  1WN7 A;  1HMV A;  2FSK A;  4DTR A;  1VSJ A;  1WUA A;  4H5R A;  4M3X A;  3WXI A;  4CJP A;  1NK8 A;  3T1A A;  4DUZ K;  3P31 A;  2WOM A;  3M8R A;  3LM9 A;  1BWF O;  4AF1 A;  3QIO A;  5AZI B;  2P9I A;  3I55 N;  2ASO A;  1Q81 O;  2WFB A;  4UQG A;  3OS0 A;  4IO9 L;  1Q9Y A;  3NH1 A;  1YIJ N;  4BGA A;  1KFD A;  4FWQ A;  2CGK A;  2KKZ A;  2DFE A;  3M5R A;  1ZBL A;  4BR9 A;  4JD2 A;  1KQS M;  4A61 A;  3DWL A;  4FM1 A;  2A6A A;  3SUQ A;  2O8B A;  4JHD A;  1HPM A;  5HL7 L;  4CK1 A;  4CGJ A;  2P9P B;  4X64 K;  4AM6 A;  4BRP A;  5MLC Q;  4FWP A;  4GW6 A;  1ZBS A;  3VTI A;  4QS9 A;  1Q9X A;  3U8X A;  1VQP N;  5T7B A;  4CW7 B;  2PZS A;  4EZ6 A;  3I0R A;  3WNF A;  4CJV A;  4A2A A;  3AVF A;  1W9H A;  2GWK A;  1S1U A;  3H1V X;  3CQ8 A;  4KI6 A;  3O3G A;  2OAN A;  3AVH A;  1VQL N; 
#chains in the Genus database with same CATH homology
 4FJM A;  5DK5 A;  5C25 A;  3EYZ A;  5C24 A;  2XY5 A;  3O4N A;  3TAP A;  2IOC A;  3CYM A;  2G8W A;  4CJT A;  3LWL A;  1NK4 A;  1B9F A;  1KLM A;  3MXJ A;  1RBS A;  2D0B A;  3QNO A;  3OYI A;  4Q0B A;  2OZS A;  2O4G A;  2QK9 A;  5J2P A;  1EET A;  1ZBF A;  2OPP A;  3DOK A;  2VWJ A;  1LW0 A;  3KK1 A;  1RDB A;  3LAM A;  1SL1 A;  4CEZ A;  3VA3 A;  3SCX A;  5CYQ A;  2YKN A;  4OKK A;  4DMN A;  3DYA A;  4F8R A;  3KD1 E;  3AO1 A;  4PUO A;  3NH0 A;  2IAJ A;  3KKS A;  2G8K A;  4J2B A;  3NF9 A;  4M3W A;  1HNV A;  1QSY A;  1J5O A;  1Y97 A;  3DLB A;  5HRN A;  1RT4 A;  3PUF A;  4QCL A;  3AA5 X;  1KLN A;  1S6Q A;  4OLA A;  3S3O A;  2ZQB A;  4B3O A;  4ID5 A;  2G8I A;  1BL3 A;  1TL1 A;  3DOL A;  4W5N A;  4N5S A;  4DG1 A;  1LWE A;  4HUG A;  3LZJ A;  3JSM A;  2HB5 A;  4RG8 A;  3ZSQ A;  2D0C A;  3O3F A;  1TKT A;  4TSX A;  4JLH A;  3AO4 A;  4FLZ A;  1NOZ A;  1TV6 A;  3NBP A;  4KB1 A;  3PO5 A;  4N56 A;  2FBX A;  4CF1 A;  4KI4 A;  2YNG A;  1WSJ A;  2E6M A;  2PYJ A;  5KGW A;  3OY9 A;  1EKE A;  3S3M A;  2ETJ A;  1LAW A;  4FLY A;  4C8O A;  3SQ2 A;  1XC9 A;  4E89 A;  3OJU A;  1JLF A;  4E0D A;  4FJ7 A;  1SKW A;  1ZBH A;  1QQC A;  4H4M A;  4RW8 A;  1ITG A;  3HPH A;  2HHV A;  1RT5 A;  3DM2 A;  3RR8 A;  4B9N A;  1J54 A;  2OPQ A;  1BIZ A;  4CHP A;  3RMB A;  3SPY A;  4E1N A;  2YHA A;  3SPZ A;  3IAY A;  4CJK A;  2BDP A;  5I42 A;  4J2E A;  1NJZ A;  1IKV A;  1SL2 A;  4LH4 A;  4O44 A;  1JL1 A;  2BGG A;  1JLC A;  5SZT A;  3OYK A;  3KLE A;  3HYF A;  4W5Q A;  4EZ9 A;  1ASW A;  2GUI A;  2NUB A;  1S6P A;  3ZCM A;  2HMI A;  3ZSZ A;  3P83 D;  3EY1 A;  5HBM A;  4CFD A;  4NYF A;  5D3G A;  1KTQ A;  1LW2 A;  3NCI A;  1A5X A;  1B92 A;  4CEF A;  4CGF A;  4FJH A;  1RIL A;  1VSE A;  3DRR A;  5I3U A;  4DTS A;  1YTA A;  2HHX A;  1VSH A;  2EHG A;  4DTU A;  4CJ3 A;  4FM0 A;  4DFJ A;  1RBT A;  2P51 A;  4MQ3 A;  3CFO A;  2DY4 A;  1A5V A;  1C1B A;  1NK0 A;  4FW1 A;  3TR8 A;  3V1O A;  4E7L A;  3KKR A;  1SUQ A;  4YNQ A;  2XY7 A;  3TI0 A;  1RDC A;  2G8V A;  1L3T A;  3HO1 A;  3OJS A;  4OLB A;  4AHU A;  5KRT A;  4AH9 A;  4FLT A;  4DU1 A;  4JS4 A;  2GBZ A;  4BDP A;  3D0P A;  3M8Q A;  1C0M A;  2OPR A;  1VSM A;  4B9M A;  1O1W A;  1C0U A;  4KHQ A;  3OVN A;  3MEG A;  4M41 A;  4Z4C A;  3NDK A;  3C6T A;  1HPZ A;  3OYM A;  4DLG A;  4KRE A;  3AVJ A;  3D45 A;  4KRF A;  3VQE A;  5K14 A;  4KHW A;  1TAQ A;  4DQQ A;  1SKS A;  1F21 A;  4LD0 A;  3L2R A;  3ASM A;  3PX4 A;  1WSF A;  1TK5 A;  4AHT A;  3KLG A;  1NKB A;  3K2P A;  3F9K A;  4WE1 A;  4I9Q A;  1BGX T;  1ASU A;  4CEE A;  1X9W A;  3HXM A;  3K5M A;  4CJ5 A;  2PY5 A;  4CK3 A;  3NHG A;  3DLE A;  4FK0 A;  1CXQ A;  3QEW A;  1U4B A;  1HJR A;  1Q8I A;  3RMD A;  1RTI A;  1LV5 A;  3AVA A;  1LWF A;  3VQC A;  4PA1 A;  1VSK A;  2KTQ A;  1UWB A;  2HVH A;  1WSH A;  4Y1C A;  3V6D A;  3L2U A;  3OYJ A;  3RMA A;  3QLH A;  4FK2 A;  3PO4 A;  4DSF A;  4BE0 A;  4DF8 A;  4KPY A;  1RT2 A;  4H4O A;  3SYZ A;  3CM6 A;  3AVK A;  3P1G A;  1EP4 A;  4QAG A;  4CEO A;  3QES A;  1K6Y A;  3ALY A;  1NK9 A;  3CFR A;  4M45 A;  3K59 A;  1CLQ A;  2IS3 A;  1JXB A;  3AVL A;  4IKF A;  3OYN A;  1WSG A;  1L5U A;  1ZYQ A;  1JKH A;  4I7F A;  3TAM A;  4W5T A;  1NKE A;  1T7P A;  4FJ5 A;  3AA3 A;  3V9S A;  3V9X A;  4H8K A;  4CJS A;  3OYG A;  4FJK A;  2F8T A;  1NJY A;  3NH2 A;  4B9V A;  3KLI A;  1TKD A;  1BCM A;  4CE9 A;  4DQP A;  3MED A;  2YV0 X;  4CED A;  1RNH A;  4CJU A;  4N47 A;  3DI6 A;  4DFK A;  2QKK A;  2YHB A;  1VSI A;  3VQD A;  4F3T A;  4KHN A;  4IFV A;  4CIG A;  4PY5 A;  4RW7 A;  3ZT2 A;  3IRX A;  3OYD A;  3LWM A;  3U6F A;  1G15 A;  2FBV A;  3SJJ A;  4IFY A;  3NE6 A;  4AHV A;  2RF2 A;  3TAR A;  4ZTF A;  2JLE A;  4DU4 A;  1C0T A;  2IDO A;  1BIU A;  1UOC A;  3TAQ A;  4FXD A;  5CZ2 A;  1CXU A;  3AO3 A;  3B6O A;  1C1A A;  3WNG A;  2VWK A;  2OA8 A;  4CFA A;  2Y1I A;  1GOC A;  1TVR A;  1S9E A;  4KTZ A;  3L2Q A;  3MXI A;  2PYL A;  3VQ9 A;  1I3A A;  4E7I A;  1NK6 A;  4K8X A;  1REV A;  1RBR A;  3NFA A;  3VQQ A;  1NOY A;  1HQE A;  3MEE A;  3T19 A;  4CEA A;  3QEX A;  4B08 A;  1T05 A;  1TGO A;  5FRO A;  4W5R A;  1QSS A;  4KFB A;  4OKJ A;  4CGD A;  2OPS A;  2ZE2 A;  1HQU A;  3OYB A;  3K5N A;  4DSL A;  4FJI A;  3VQA A;  4FZX C;  4EZ6 A;  2O4I A;  3BGR A;  4CFC A;  2F8S A;  3S3N A;  4KAZ A;  3PV8 A;  3NF7 A;  4AHS A;  4CHZ A;  3HT3 A;  1KSP A;  3LAN A;  3NGI A;  2KZM A;  2HNY A;  1KRP A;  5JS1 A;  1FK9 A;  1S1V A;  2VG7 A;  3HPO A;  2FC0 A;  3HVT A;  4NCG A;  3T3F A;  3NGZ A;  4CF0 A;  3ZT1 A;  3CG7 A;  3K5O A;  1FKO A;  5HRR A;  5E41 A;  3PX6 A;  3AVI A;  4J2D A;  4BDY A;  4G1Q A;  3SUO A;  4KB0 A;  4C8L A;  4RW9 A;  1WSE A;  3LZI A;  3C6U A;  1RDD A;  3HPG A;  3V4I A;  1WAF A;  5KTQ A;  3HM9 A;  3M8P A;  4E19 A;  3KTQ A;  2YNI A;  3AVC A;  4OGC A;  1B9D A;  3PX0 A;  2RN2 A;  3VQ8 A;  3V81 A;  4CJ4 A;  3OYF A;  5HP1 A;  4HVJ A;  1NK7 A;  1RT1 A;  1QSL A;  1VK0 A;  2ZD1 A;  1HYV A;  4CGI A;  5KRS A;  1MU2 A;  4DTJ A;  3VQ4 A;  1IKY A;  1QHT A;  2WON A;  3AVN A;  4LSN A;  5C42 A;  4FM2 A;  3LP1 A;  1YVU A;  4BAC A;  1JLB A;  4DTP A;  1Z26 A;  2A1S A;  1RBU A;  3OYL A;  4CEQ A;  2KFN A;  3ZSV A;  3DRS A;  4Z4F A;  4FYD A;  1WNS A;  2HHS A;  1HRH A;  3ZT0 A;  2X78 A;  4F4K A;  4KKO A;  3UIQ A;  3LPT A;  4JRP A;  3VQ6 A;  3KLH A;  1VSF A;  2DFH A;  4FLU A;  2VG6 A;  5FDL A;  3K5L A;  1C6V A;  2BAN A;  2YNH A;  4GVM A;  4CF9 A;  3M8S A;  2LSN A;  4DFM A;  1D9D A;  1N6Q A;  4Z4I A;  3SUP A;  4AHR A;  4CGG A;  3WNH A;  3AVB A;  2B4J A;  3L3U A;  2YKM A;  4Y1D A;  3E01 A;  4CJL A;  1UA0 A;  1D9F A;  4B9L A;  2F96 A;  3TAG A;  3HST B;  1TKX A;  4DLE A;  2OZM A;  2XRI A;  4CHO A;  2QXF A;  3OYE A;  2AJQ A;  4FJ9 A;  3SQ0 A;  4Z0U A;  3KD5 E;  4FJG A;  1X9M A;  2FBT A;  4DQR A;  3AA2 A;  4FLW A;  4L8R B;  3U3Y A;  4FJJ A;  4C8M A;  1KVC A;  2I5J A;  4DWI A;  3ZT4 A;  3MAQ A;  2Y1J A;  2DTU A;  4ZHR A;  1IO2 A;  4B9S A;  3LAL A;  1BQM A;  1DTQ A;  1RT6 A;  2B5J A;  3U3G A;  4E7H A;  4ELU A;  4ELV A;  4F2R A;  1X1P A;  3NAE A;  3RMC A;  2XO7 A;  4HHT A;  4FVM A;  5HRS A;  3VQP A;  4KV8 A;  4XIU A;  4HUE A;  5J2Q A;  4DSE A;  4DFP A;  2HHQ A;  1ZBU A;  3VQ7 A;  1UA1 A;  2YNF A;  4FK4 A;  3AA4 A;  1BI4 A;  2HNZ A;  1NK5 A;  2D0A A;  4OKE A;  3ZSO A;  1KFS A;  3O4Q A;  4OGE A;  3ZSX A;  4E7K A;  5DMR A;  3TAN A;  5FRN A;  4JS5 A;  3V9W A;  4Z4G A;  3K57 A;  4FJN A;  3WNE A;  3F73 A;  1D8Y A;  2P5G A;  3LPU A;  3NF6 A;  2HHT A;  3SV4 A;  1WLJ A;  3QEV A;  1IKX A;  1JLE A;  1EXQ A;  1WAJ A;  1JLA A;  1VRT A;  4M3R A;  4B9U A;  2DFF A;  4EP5 A;  2G8H A;  2Z1H A;  3C95 A;  4BWJ A;  3AVM A;  1RTD A;  4CHY A;  2KZZ A;  4FCY A;  3A2F A;  4JRQ A;  2HHU A;  1KVA A;  1HYS A;  3ZSW A;  4IDK A;  4N76 A;  1KVB A;  3QET A;  2XY6 A;  2KW4 A;  5CZ1 A;  1RT3 A;  3SI6 A;  1J9A A;  3SV3 A;  5HLF A;  3RR7 A;  3ULD A;  2HW3 A;  1XWL A;  2JGU A;  4GMJ B;  1S1T A;  4M3U A;  1U48 A;  3RTV A;  4HCB A;  1ZBI A;  1CZ9 A;  3BDP A;  5CY4 A;  2FBY A;  4CIF A;  2G8F A;  3RRG A;  2OYQ A;  2Q3S A;  1TK0 A;  4CJQ A;  3EZ5 A;  1VRU A;  4ICL A;  1BHL A;  1WSI A;  3DRP A;  4Z4H A;  4NCA A;  4I2Q A;  1HNI A;  4E3S A;  4CF8 A;  3TAF A;  4CJE A;  2Z1I A;  1JLG A;  1LAV A;  2W42 A;  3KIO A;  4CHN A;  4OJR A;  3QIN A;  3KJV A;  1NJX A;  4Z4E A;  1YTU A;  3KK3 A;  4KO0 A;  1DLO A;  3DLR A;  4ID1 A;  3PY8 A;  4N41 A;  1IKW A;  1RTJ A;  3ZT3 A;  4FZZ A;  4PWD A;  2A1R A;  4E1M A;  3AV9 A;  3S9H A;  2ATQ A;  5KI6 A;  3CFP A;  4BDZ A;  1QE1 A;  1LWC A;  2P5O A;  4OPK A;  1VSL A;  3I8D A;  2XHB A;  1JL2 A;  4F3O A;  3V1R A;  1U45 A;  1U04 A;  4DQS A;  4HCC A;  3FFI A;  1FXX A;  4FLX A;  4RW6 A;  1U49 A;  4M42 A;  4KHY A;  4O55 A;  4NCB A;  1RT7 A;  1QS4 A;  4ZTJ A;  2RPI A;  3I0S A;  3QO9 A;  2X6N A;  4FW2 A;  1I39 A;  4CCH A;  1RCH A;  2E6L A;  1IH7 A;  1XI1 A;  4FJL A;  4Q5V A;  1XHZ A;  3V9U A;  2B6A A;  4DTM A;  2G8U A;  3DLK A;  4M3Z A;  2EX3 A;  4BE2 A;  4CF2 A;  1RDA A;  3HP9 A;  1TKZ A;  3LP2 A;  4QOZ B;  4PQU A;  1BCO A;  3KK2 A;  3LP0 A;  1N5Y A;  4M3T A;  4J2A A;  4HUF A;  1W0H A;  4R5P A;  1VSD A;  4BE1 A;  5EU7 A;  1XHX A;  2XY8 A;  3OYC A;  4IBN A;  3TAB A;  3QER A;  4F2S A;  3VQB A;  1NKC A;  3LDS A;  3CM5 A;  3MEC A;  2BE2 A;  3HL8 A;  1S1X A;  4I9L A;  3QEP A;  4W5O A;  3SUN A;  4K8Z A;  4CES A;  1RBV A;  4LY7 A;  3HP6 A;  1X9S A;  3QEI A;  3IS9 A;  4CHQ A;  1C1C A;  2IGI A;  3H08 A;  1DTT A;  3C94 A;  3SNN A;  3KLF A;  1YT3 A;  4C8K A;  1D5A A;  4CGH A;  1RTH A;  1U47 A;  4B8A B;  1L3U A;  3OS1 A;  4O0J A;  1S5J A;  3SQ1 A;  5SWM A;  1SKR A;  1BI4 B;  4FJ8 A;  1JXE A;  1KCF A;  3RRH A;  3SZ2 A;  5J2N A;  1ASV A;  4AHC A;  5KGX A;  4CJW A;  1CZB A;  2HND A;  2Z1G A;  3P5J A;  3LP3 A;  4DS5 A;  2KQ2 A;  1A5W A;  5J2M A;  4DTN A;  1L3S A;  4OVL A;  4BWM A;  4CFB A;  2Z1J A;  1JLQ A;  3NGY A;  1NJW A;  3B6P A;  4O5B A;  1GOB A;  1R0A A;  1SL0 A;  1S9G A;  1EX4 A;  3AO5 A;  3AO2 A;  1TK8 A;  1QTM A;  3LAK A;  2ITG A;  4NYN A;  4IG3 A;  3K58 A;  4EP4 A;  1SV5 A;  3TWH A;  3VA0 A;  4DU3 A;  4KHS A;  1BQN A;  4I2P A;  1GOA A;  4LSL A;  4DTO A;  5HRP A;  2GV9 A;  3OS2 A;  3L2W A;  4CEC A;  3OYH A;  1WN7 A;  5HRO A;  1HMV A;  3IG1 A;  4DTR A;  1VSJ A;  4KTQ A;  4CER A;  3HJF A;  4M3X A;  4IG0 A;  4LH5 A;  1BIS A;  4CJP A;  1NK8 A;  3T1A A;  3TAE A;  2WOM A;  3JYT A;  3G0Z A;  2X6S A;  3M8R A;  3RWU A;  3VN5 A;  1T8E A;  3ZSR A;  4CJF A;  3QIO A;  4KTW A;  2D5R A;  4DF4 A;  4O0I A;  1TAU A;  4OPJ A;  4UQG A;  3NF8 A;  1Z25 A;  3OS0 A;  4YFU A;  3THV A;  3MXM A;  3NH1 A;  1Q9Y A;  4CIE A;  4E7J A;  1L3V A;  1IG9 A;  1T03 A;  4ELT A;  3VQ5 A;  3DLG A;  3AVG A;  1TL3 A;  3L3V A;  4CK2 A;  1KFD A;  5CYM A;  4DSJ A;  2KFZ A;  3QIP A;  4DTX A;  2DFE A;  3L2V A;  4DSI A;  3G10 A;  1ZBL A;  3ISN C;  2IC3 A;  4HTU A;  4FZY A;  5J1E A;  2QKB A;  4FM1 A;  4MFB A;  3QNN A;  3SUQ A;  2HVI A;  5FRM A;  1HYZ A;  1FKP A;  2VG5 A;  4CK1 A;  4CGJ A;  3O3H A;  4FLV A;  2X74 A;  3V1Q A;  4DS4 A;  3SQ4 A;  4B9T A;  3L8B A;  4CEB A;  1J53 A;  3DLH A;  4GW6 A;  1Q9X A;  4AIL C;  1S1W A;  5T7B A;  4RW4 A;  2R7Y A;  2HHW A;  2PZS A;  3OYA A;  1UAX A;  3I0R A;  3WNF A;  3ITH A;  4CJV A;  3DMJ A;  3AVF A;  3ZSY A;  3V9Z A;  4M3Y A;  3HK2 A;  5JS2 A;  1W9H A;  1S1U A;  4B8C A;  4CJR A;  4C8N A;  2RKI A;  3CQ8 A;  4KI6 A;  3O3G A;  4DSK A;  4DQI A;  4O4G A;  4FJX A;  3AVH A;  4KHU A;  3HVR A;  2E4L A;  2P1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...