2FBVA

Wrn exonuclease, mn complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
HSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
molecule keywords Werner syndrome helicase
molecule tags Transferase
source organism Homo sapiens
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbvA00
4W5OA 4Y1DA 1TL3A 4IFVA 4BACA 4FXDA 3KD1E 2DTUA 4DQQA 3AVIA 2DFEA 1LWFA 1UOCA 2X74A 4M3XA 4PUOA 3M8RA 4IKFA 4DTSA 1QHTA 3AVGA 4Z4GA 2ZE2A 4Z4HA 1C0TA 2HHQA 2WONA 4RW9A 4CHOA 3CM5A 4W5TA 4BDZA 3RMDA 1NK0A 1F21A 1JXEA 4KREA 3WNFA 3CFRA 4FJNA 4N41A 4E89A 3TI0A 3SCXA 4CGFA 2F8TA 1VRTA 2KW4A 4CHNA 3V4IA 1Q9YA 3OYIA 3NF7A 1KVBA 3H08A 3QEWA 4NCGA 1WN7A 3OYFA 1HNVA 3K59A 4O44A 3S3NA 4I2PA 4DSJA 4FLWA 4IG0A 4M41A 1NJZA 3I0SA 4CGJA 2PYJA 3WNGA 1ASVA 2IOCA 3HYFA 3TAQA 3B6OA 5HRSA 1J5OA 1RDBA 3MEGA 3T19A 4HHTA 4K8XA 4ZTJA 2G8UA 2ZQBA 1LAVA 3G10A 3L3VA 3OYBA 3QETA 3ZT3A 1BGXT 3HVTA 5I42A 1NKCA 3TABA 5D3GA 4LSLA 3V9ZA 3OYCA 3AVKA 4KO0A 3OS1A 3S3OA 4B9LA 3RRHA 1L5UA 4LY7A 4E1MA 2QKBA 1CLQA 3C94A 3SPYA 3CG7A 1NK5A 3AVNA 2Y1JA 4Q5VA 3HXMA 2IAJA 4CFBA 3VQ6A 1Z25A 4CESA 3NGYA 1YTAA 3PUFA 2ZD1A 1KFDA 4ZHRA 2XO7A 3D0PA 4K8ZA 2FBTA 2G8WA 1RT2A 2OZSA 3K5OA 2KQ2A 4OGEA 1SKRA 4DSLA 4BWMA 3SUOA 3AA2A 2XY5A 1S1UA 1QE1A 3KJVA 2B5JA 3IAYA 1VSHA 3NF6A 5DK5A 1Z26A 3BGRA 5SZTA 3MAQA 4AILC 1XHZA 4CHPA 4FJMA 1BQNA 1B9DA 4CK2A 4CK3A 3CFOA 4HUGA 3HP6A 1TKDA 4PY5A 3V1OA 1RDDA 3OYLA 3RTVA 1N5YA 3S3MA 2VG6A 2HMIA 5K14A 4CJFA 4E7LA 4DS4A 1T05A 1UA1A 4F4KA 2Z1HA 3T3FA 2OYQA 4DLGA 1D9DA 1X9SA 3CM6A 1BCMA 1QSSA 2RPIA 3AVLA 2HB5A 3DRPA 4FCYA 4N76A 4CJVA 2HVIA 4M3YA 2Z1IA 3ITHA 1WAFA 3AO3A 1EXQA 4CF0A 3TAPA 1T03A 3CQ8A 4FM2A 3NBPA 4FJLA 1D8YA 3OYMA 3I0RA 4I7FA 1Q8IA 5HLFA 3HK2A 1QQCA 3FFIA 3KLEA 1C6VA 4FW2A 4FVMA 2BANA 4B8AB 3DLKA 3L2UA 1YT3A 2XY7A 1I39A 3QEIA 2D5RA 4M3RA 3OYHA 1DTQA 3TARA 4KRFA 2EX3A 1NJWA 1JLFA 4DU1A 4E0DA 4NCAA 3VQEA 4R5PA 1SL1A 4O4GA 4WE1A 2PYLA 3OYKA 1XC9A 1HMVA 3L3UA 2XY6A 4OPJA 3LP0A 4JRQA 2XY8A 1HNIA 3HP9A 4FM1A 1S1VA 4KKOA 3NH1A 2RF2A 2PY5A 2HNZA 1G15A 4ELVA 3NH2A 1ASUA 3ZT4A 4OLBA 5KRSA 2HW3A 3NF8A 4CECA 3ZSRA 4KHUA 1RBUA 1B92A 4FW1A 3L2VA 3JYTA 1U04A 1S5JA 3SJJA 2DY4A 3KK1A 1NK9A 3VQCA 1TGOA 3AVJA 3K2PA 1BCOA 1VRUA 4CF8A 1A5WA 1YVUA 1TKZA 4DQSA 2D0AA 3EZ5A 2WOMA 3SQ1A 4KAZA 3ZSZA 3V1QA 1WNSA 2Z1GA 2I5JA 4CIGA 2GBZA 4E3SA 1EP4A 1J54A 4L8RB 3HPGA 2P5GA 2IS3A 1IO2A 2DFHA 3UIQA 3ISNC 3O4QA 5KI6A 2YHAA 4HCCA 5FRMA 3AO2A 1IG9A 2Y1IA 4LSNA 4B9VA 3QINA 1REVA 1XHXA 4DTOA 3DRRA 4B3OA 2JLEA 4LH4A 3HT3A 3ZSXA 4O0JA 4OGCA 4CGIA 4E7HA 5C25A 1ASWA 1O1WA 3I8DA 3SZ2A 4CF1A 1HQEA 2IGIA 3AVCA 4CEAA 3SUPA 5JS2A 5KTQA 3MEEA 3LWLA 3VA0A 4DWIA 3V9XA 4F8RA 3NF9A 3RMCA 3VQQA 2AJQA 3QNOA 3AVHA 4AHRA 3U6FA 4O0IA 3TAMA 3OYEA 3AA3A 2RN2A 3CFPA 4HUEA 4CJKA 1SL0A 1WLJA 5SWMA 2HNDA 3L2QA 1JL2A 3KD5E 1VSEA 4EZ9A 4BE1A 3E01A 1X1PA 3LAMA 1X9WA 4MQ3A 4O5BA 4QAGA 3U3GA 3OYNA 3NHGA 4CHZA 3OYJA 3AO1A 1L3VA 2O4IA 3QEPA 2ATQA 4GMJB 4CEQA 3V9WA 3VQ7A 3PO4A 1BISA 4DFKA 4AHUA 1JLAA 2YKMA 1TK5A 3LP3A 4CJUA 4M3ZA 3U3YA 2DFFA 4DSIA 1RDAA 1VSFA 5CYMA 3P5JA 4CJ5A 4OLAA 3B6PA 1C1CA 4EP4A 3IRXA 3KK3A 2JGUA 4AH9A 3HO1A 3KTQA 3L2RA 4DTUA 1JXBA 5KGWA 4FZZA 4OJRA 2OPPA 4DTRA 2NUBA 1A5VA 1S6PA 4FLUA 3QEXA 1NOYA 4B9NA 4C8KA 3P83D 1TKXA 4CF9A 4HVJA 4DF4A 2G8IA 4W5NA 2HHTA 3TAEA 3O3FA 5HRNA 2KFZA 2E6LA 4LD0A 4FK4A 3M8PA 3MEDA 2YHBA 4OKKA 3PY8A 4RW4A 1DLOA 1NKBA 1S9EA 3SUQA 4B9MA 1SUQA 2E6MA 4CJQA 1CZ9A 2R7YA 4I9LA 3THVA 3KKSA 1ZBIA 2P5OA 1NOZA 4CEDA 3NGIA 4CGDA 2FC0A 2QKKA 3TWHA 4Y1CA 4YFUA 3K57A 1WSGA 3HL8A 3VQBA 4BDPA 4CJLA 3KLIA 3ZSYA 4CFAA 3PX0A 4DFPA 4M3WA 3ZSOA 2Q3SA 4AHTA 3OYGA 3DLHA 2D0CA 1NKEA 3QNNA 4Z4FA 1HQUA 1W0HA 2W42A 3NGZA 1JLGA 3KK2A 1L3TA 5J2MA 1Q9XA 2EHGA 4M3TA 4ELUA 5FDLA 2YNHA 4IFYA 3PX6A 1U47A 1ZBUA 4CJEA 1HYZA 3KKRA 3LWMA 4QOZB 4OKJA 1KVAA 1L3UA 4DQIA 4RW7A 3DYAA 3NCIA 4H8KA 1CXUA 1RTHA 1HYSA 1WSIA 1HYVA 4CIFA 1BHLA 2GV9A 4C8MA 4CFDA 4CHQA 1VSLA 1WSHA 2X6NA 4AHCA 4C8OA 2KFNA 3AO5A 2G8HA 4ICLA 1KLMA 1U45A 3RRGA 2HHUA 4KFBA 4CF2A 4N5SA 4GW6A 1I3AA 5E41A 1TAQA 4CE9A 3RWUA 1ITGA 2QXFA 3DM2A 3IG1A 2HHWA 3DRSA 4FLTA 1EX4A 1WAJA 5KGXA 3O3GA 2G8KA 2B6AA 5CYQA 1B9FA 4CFCA 5I3UA 3V1RA 3NE6A 1J9AA 4W5RA 1NJXA 4UQGA 3RR7A 4FLYA 1VSDA 2D0BA 1TVRA 4DF8A 4NYFA 3TAFA 1SKSA 4CERA 1NK8A 1UA0A 1KSPA 3ZT0A 4KHQA 3M8QA 3AV9A 2YKNA 4M45A 1JLEA 4F2SA 3LPTA 3RMBA 3BDPA 2RKIA 4FJ8A 5HBMA 1FKPA 3VQAA 3DOLA 3LALA 3OJUA 4DTNA 3PX4A 1NK4A 3DMJA 1JLCA 1IKVA 3KLGA 4CCHA 4KHNA 4DMNA 1BIUA 3SQ0A 4J2DA 3HM9A 1HJRA 1RT4A 2GUIA 4YNQA 1X9MA 1KTQA 3SYZA 1J53A 1WSJA 4FJJA 2G8FA 3SI6A 4F3TA 4PA1A 4CEFA 4DG1A 1KFSA 4B8CA 3K5LA 2HVHA 1VSMA 4DQRA 3TR8A 1BI4A 4FJXA 1BL3A 4CJTA 4CJ3A 3RR8A 1RT6A 1U4BA 5C42A 4KTQA 2XHBA 4FJ5A 2F96A 3O4NA 4KTZA 4HTUA 1RT5A 4NCBA 3OVNA 1IKYA 3AO4A 4J2AA 2YV0X 4RW8A 4ELTA 1IKXA 4BE0A 4KTWA 2IC3A 4CJSA 3G0ZA 3L2WA 3WNEA 3SUNA 4HUFA 3VQ9A 3IS9A 2A1SA 5HRRA 1C1AA 1MU2A 1C1BA 4G1QA 3OS2A 1S9GA 2X78A 1EKEA 2PZSA 2A1RA 1YTUA 1RT3A 4OKEA 4DTXA 3SQ2A 1CZBA 4XIUA 3MXIA 3AVBA 4N56A 3LANA 2FBYA 3DLEA 4F2RA 2IDOA 3LAKA 1KCFA 4ID5A 5J2QA 1ZBFA 4CK1A 4CJPA 3LDSA 3VQ4A 4FM0A 1GOCA 1BIZA 3QIOA 3NDKA 1R0AA 1TL1A 3DLBA 1UWBA 3OJSA 1U49A 5DMRA 4DFJA 2LSNA 3AVFA 3A2FA 1RTDA 2F8SA 1WSEA 1JLQA 1WSFA 3HPHA 3KLFA 3NFAA 4CEZA 4AHSA 3SV3A 4ID1A 1RBVA 1VSKA 3VQ8A 5C24A 4DTJA 4DTPA 4E7KA 1LWEA 4HCBA 4RG8A 4CJWA 2P1JA 2Z1JA 2YNIA 3F73A 1FKOA 4DQPA 4FK2A 1ZBLA 1XI1A 4CEBA 1D5AA 1RTJA 4BE2A 3V6DA 2BGGA 2HNYA 5T7BA 4BDYA 4DLEA 4B9UA 2O4GA 2VWJA 4KI4A 3ZSVA 4B08A 1QSLA 3C6UA 2ITGA 1T8EA 2VG5A 4JLHA 2HHSA 3O3HA 1QSYA 1VK0A 2OA8A 1EETA 1RTIA 3KIOA 3HPOA 4FZYA 3QLHA 2KZMA 1JLBA 3ZCMA 4CHYA 4CJRA 1KRPA 3SQ4A 4CEEA 4Z4IA 3D45A 5KRTA 4CJ4A 1IH7A 1RDCA 3DOKA 4CGGA 4B9SA 4B9TA 1TAUA 3S9HA 3NH0A 3K58A 1K6YA 1TKTA 3ZT2A 5FRNA 1IKWA 1KVCA 3AA5X 4FYDA 1C0MA 4GVMA 1N6QA 4IG3A 3QESA 4FJKA 3TAGA 3QEVA 4ZTFA 3NAEA 3V81A 3ALYA 1RCHA 3LZIA 3EY1A 4DSEA 1CXQA 1DTTA 1SV5A 1W9HA 3MECA 1GOAA 4Z4CA 1SKWA 4KB1A 4TSXA 3MXJA 5FROA 3KLHA 3AA4A 4I2QA 4FLZA 4AHVA 3F9KA 1U48A 3M8SA 5CY4A 4FLVA 1T7PA 3VQ5A 2VWKA 1JL1A 3HJFA 2QK9A 1L3SA 1FK9A 4QCLA 1KLNA 4KV8A 4KHYA 3DLRA 1TV6A 4NYNA 3MXMA 1S1TA 4OPKA 4FLXA 1XWLA 4E7JA 3DI6A 2OZMA 3LP1A 2HHXA 1NJYA 3DLGA 4W5QA 4KHWA 4Z4EA 4J2BA 4LH5A 4CIEA 2FBXA 3L8BA 1ZBHA 4KI6A 3QERA 1LW2A 1S1XA 2YNGA 2BE2A 2X6SA 3T1AA 4M42A 3PV8A 1RT1A 1UAXA 4E1NA 2YNFA 4BWJA 4Q0BA 1VSJA 1HRHA 1GOBA 3WNHA 4M3UA 1RNHA 3OY9A 3VA3A 1S6QA 3VQPA 2FBVA 1TK0A 1C0UA 4KHSA 3V9UA 5J2PA 1Y97A 4N47A 3TANA 3ZT1A 4KPYA 3QIPA 4DFMA 1FXXA 4FZXC 3OS0A 4J2EA 2OPSA 1BQMA 4C8NA 4RW6A 4DU4A 2ETJA 3RMAA 2G8VA 3HVRA 3ASMA 4E19A 5CZ2A 5J1EA 1BI4B 2B4JA 4O55A 3PO5A 4FJ7A 3V9SA 3P1GA 1RBTA 4DU3A 3HSTB 5HROA 3SPZA 3EYZA 3JSMA 1A5XA 3QO9A 4FJIA 1HPZA 4E7IA 2BDPA 3ZSQA 5CZ1A 2HHVA 4FJ9A 1RBRA 1LV5A 2KTQA 1NK6A 5JS1A 2KZZA 1JKHA 4Z0UA 1LWCA 1RILA 4JRPA 4DSKA 4KB0A 3CYMA 4JS5A 4EP5A 1D9FA 1QS4A 4MFBA 1RBSA 5HRPA 3OYDA 4FJHA 4DTMA 3K5MA 1TK8A 3K5NA 4CEOA 3AVMA 3VN5A 1LAWA 1ZYQA 4PQUA 4OVLA 3VQDA 3LZJA 4I9QA 4C8LA 2OPRA 1QTMA 4IBNA 3SNNA 4EZ6A 4FK0A 4F3OA 2E4LA 4IDKA 4PWDA 3OYAA 1VSIA 2P51A 3ULDA 3SV4A 1SL2A 5EU7A 1RT7A 3AVAA 3LP2A 4FJGA 3ZSWA 4CGHA 5HP1A 1S1WA 4H4OA 4JS4A 3C95A 1LW0A 2VG7A 3C6TA 3LPUA 4DS5A 5J2NA 2XRIA 4H4MA 4DSFA 1NK7A 2OPQA
chains in the Genus database with same CATH superfamily
4W5OA 4FXDA 2QWMA 4DTSA 1QHTA 3IKMA 3R3LA 4Z4HA 4HWIA 1NK0A 3SMPA 1NNEA 3SCXA 3BEXA 2KW4A 2H3GX 4PL8A 4WYBA 3OYIA 4IFEA 4DHYA 3QEWA 1WN7A 3OYFA 5M1OA 3C65A 4I2PA 2Q0RA 3WXJA 4DSJA 4FLWA 4JKFA 5AQWA 3WNGA 3HYFA 1QHAA 3THYB 3MEGA 3T19A 2G8UA 1LAVA 3KHYA 3ZT3A 3CCMN 1VQ5N 4LSLA 3AVKA 4KO0A 3OS1A 3KWIA 2QKBA 3RRHA 1CLQA 4E1MA 3CC4N 3C94A 2HF3A 3CG7A 1XNRK 1IG8A 4Q5VA 3L6QA 4CFBA 5EVZA 1Z25A 2GX9A 2QXLA 4LF9K 1H1VA 3ZYYX 3ULEB 1SAZA 2D1KA 2KQ2A 4OGEA 1SKRA 4DSLA 3O9TA 2XY5A 1QE1A 3KJVA 3NF6A 1EO1A 4AILC 1GLBG 4CK3A 4HUGA 4PY5A 3HP6A 1RDDA 4A2AA 4A59A 4IJNA 3UKRB 4DS4A 1NBWA 4DLGA 3I56N 1N8RO 4H0XB 4IEIA 2Z1IA 2P9NB 1TUYA 3ENOA 4CZFA 3OYMA 1D8YA 1Q8IA 4YOUA 3FFIA 2JWLA 3DLKA 3L2UA 3OYHA 3TARA 5GAGP 3FZLA 4DU1A 5LL6Z 4DV5K 5BR8K 4R5PA 4WE1A 3BP8A 1HMVA 3L3UA 4BRPA 4BREA 2PY5A 3KK7A 1QZ5A 1E4FT 4CBWA 3ZT4A 4OLBA 4CECA 3CC7N 2DY4A 3KK1A 1NK9A 3AVJA 1A5WA 1YVUA 3IFRA 4DQSA 2D0AA 4KAZA 3O5BA 3V1QA 4CIGA 2ASOA 1EP4A 1XMQK 4DR7K 3O4QA 4LSNA 1HNZK 3MK6A 5LJVA 2JLEA 3HT3A 4O0JA 3TTCA 5C25A 5AQQA 3I8DA 4MDAA 1Y64A 1HQEA 1ZXOA 3VOVA 4DWIA 4F8RA 4PKGA 1QQMA 3VQQA 4DV6K 3QNOA 4O0IA 3OYEA 4DR6K 3AA3A 3HTVA 2HNDA 1JL2A 3ENHA 3LAMA 4QAGA 3OYJA 4WQ5C 3QEPA 3EN9A 4CEQA 1YAGA 2W41A 1T6CA 3GOIA 3BF3A 1WBBA 2HSTA 5AJ3K 2E2QA 4DSIA 2AA4A 2V51B 5AQJA 4EP4A 5JLFA 5AZJB 3HO1A 1IBLK 3QBWA 1JXBA 4EHTA 4FZZA 3CQXA 3TTDA 3SBGA 4WFAL 4FLUA 4B9NA 2VWBA 2NLXA 4HVJA 3HOTA 4DF4A 3TAEA 3O3FA 3VENA 5HRNA 2E6LA 4FK4A 3A5LC 3M8PA 3BY5A 4YORA 3SUQA 3E9OA 1SUQA 4CJQA 3CCVN 1CZ9A 2R7YA 4H5VA 2D0OA 4NLBA 4JKDA 2GEMA 2GWJA 1ZBIA 3VESA 1HPMA 4BR2A 4Y1CA 3VQBA 1OKJA 1YI2N 4DFPA 4PL7A 5KPRA 5FPMA 1X3MA 3E9PA 2W42A 4FSVA 1TYQA 4IFYA 3C6AA 4CJEA 4OKJA 4X62K 4H8KA 1YF5L 4CIFA 1BHLA 4CHQA 4C8OA 2KFNA 1HKCA 1DEJA 4CF2A 1TAQA 4CE9A 3RWUA 1ITGA 1M90O 3T7ZA 4X65K 4JKGA 3H3OB 2W6LA 3SAHA 2RE2A 5CYQA 1B9FA 5F1XA 5LY3A 3CCUN 2QWQA 3NE6A 4BR7A 4UQGA 3RR7A 1VSDA 3I55N 4CERA 1NK8A 1KSPA 3AV9A 4M45A 2O8DB 2P9IA 3OJUA 4X64K 3O9QA 1JLCA 2O8CA 2WBNA 4DMNA 4J2DA 5CHIA 4DB3A 1RT4A 2GUIA 5AR0A 3SYZA 4BRAA 2Q31A 4CEFA 3A5MC 1XNQK 4B8CA 1C0FA 4DQRA 3MX5A 3DXKA 4IDHA 1KC8O 3EE9A 5C42A 4HTUA 4KTZA 1W7AA 3S41A 3L2WA 3G0ZA 3SUNA 3IS9A 2A1SA 3VF6A 3CETA 4LF5K 1S9GA 2PZSA 4XIUA 3DLEA 4F2RA 4ID5A 3O8MA 1ZBFA 4CK1A 4BGAA 3LDSA 3DLBA 1RGIA 3OJSA 1RTDA 1VSKA 3M6GA 3E66A 4HCBA 5IT9O 4FWRA 2YNIA 3F73A 4FK2A 3O80A 1VQLN 3HI0A 1XI1A 3F5TA 3ID6A 1D5AA 2DPNA 5T7BA 4DLEA 3ZSVA 3T1HK 5KPZA 2A3ZA 5AQVA 3O3HA 1EETA 5AQOA 2KHOA 4CJRA 2IVPA 4GV9A 3SQ4A 3THYA 3VF2A 1K8AO 4ILJA 3NH0A 1TKTA 5F2RA 4FWPA 4FYDA 4GVMA 5FPEA 2P9KA 4FJKA 4BRMA 3NAEA 3EY1A 3NMUA 4JD2A 1SKWA 1MWKA 3ULEA 3AA4A 1U48A 3KTQA 3BZCA 4AHVA 5CY4A 3MN5A 1JL1A 3HJFA 1FK9A 3TSUA 2YHYA 4JI4K 4KHYA 4DR5K 4OPKA 2HHXA 3LP1A 3DLGA 4KHWA 4J2BA 4CIEA 3UKRA 1S1XA 4M42A 2BE2A 4CZLA 3R6MA 4DV2K 4Q0BA 1HRHA 2P9NA 4GV6A 1BOTO 4JI5K 1TK0A 4KHSA 2O8EB 1NMNA 3V9UA 5J2PA 3ZT1A 3QIPA 1FXXA 2NRRA 4FZXC 3OS0A 4LF4K 1BQMA 4XH5A 4CZKA 3PO5A 3HVRA 4FJ7A 5CZ2A 4UY8O 3SPZA 3EYZA 1EWRA 2F9WA 3QO9A 1HPZA 4DUZK 3VEVA 2BDPA 2HHVA 1LV5A 1JKHA 2Q2RA 1YVNA 3LDNA 4JRPA 2I7NA 3O1BA 1S3XA 1D9FA 4MFBA 5HRPA 3AARA 1TK8A 4CW7B 4BG8A 4JYAK 1ZYQA 3HRGA 3J80O 4DUYK 1JCGA 4X66K 4FK0A 3HZ6A 3LM9A 2E4LA 3VEYA 4IDKA 1VSIA 2ZM6K 2P51A 3E9LA 3ULDA 3SV4A 1RT7A 2P9UB 1N36K 3LP2A 1GLAG 5JICA 3C95A 1LW0A 3C6TA 4DS5A 4IOXA 1TL3A 3B8AX 3W3DA 3AVIA 4A61A 3D2EB 4IOCL 1UOCA 2X74A 4M3XA 3DLLL 3CHWA 1NGFA 4Z4GA 1C0TA 4CHOA 3CM5A 1F21A 4KREA 3SJHA 1VRTA 4CHNA 3V4IA 3H08A 1YXQA 4RWTA 1HNVA 2UUCK 4O44A 2WFBA 2PYJA 3ZLJA 2Q36A 2ZJQL 3P31A 1RDBA 4JKBA 4HHTA 3VEZA 3CJ1A 3AAPA 3G10A 3OYBA 3P39A 4BY9C 5AZJA 4B3SK 3ENBA 3H6EA 4B9LA 3SPYA 1FW6A 4RCHA 1NK5A 1O13A 4CESA 3PUFA 4ZHRA 1KFDA 4K8ZA 3CCLN 1ILYA 5GAHP 4GY2B 3LDLA 1NLVA 4NLCA 1KXPA 2CGJA 3SLCA 1VSHA 5DK5A 1XHZA 1GLDG 4CHPA 4CK2A 4KH5A 4CZHA 4FL9A 1N5YA 3WEEB 2VG6A 4CJFA 1T05A 4F4KA 2OYQA 3SK3A 3THWB 2HB5A 4FCYA 4N76A 3Q7BA 4CJVA 1T03A 3U4LA 3OA9A 4FM2A 2ITMA 3VEOA 4WCEL 3ZX0A 1QQCA 2AP1A 2V52B 4FVMA 1X9JA 3FZMA 5BN8A 2D0PA 3QEIA 2D5RA 2VQEK 4BC4A 2P9SA 2EX3A 1JLFA 4E0DA 4L3QA 3O1WA 4O4GA 3K0SA 4OPJA 4KBOA 1HNIA 2E1ZA 3HP9A 4KKOA 3OW2M 2RF2A 3U9DA 3NH2A 3NF8A 4BRLA 4FW1A 3L2VA 3SJJA 3K2PA 5DM7L 1VRUA 3D6RA 4U7BA 4JNEA 2O8DA 1E4GT 4E3SA 5BPNA 4L8RB 2WC9A 3HPGA 2DFHA 3UIQA 4PKIA 4B9VA 3QINA 4DR4K 2QWPA 4DTOA 3DRRA 4B3OA 1EQYA 3I33A 1R59O 2FXUA 3ZEUB 3R1XA 4CEAA 5KTQA 3LWLA 3V9XA 4YDUC 3U8XA 1BU6O 3N4QA 3NF9A 3RMCA 4CJ7A 4AHRA 3TAMA 4HUEA 3LM2A 1K8KB 4YOYA 2E2PA 3L2QA 1Q81O 3KD5E 4EZ9A 3WXLA 1X1PA 3U3GA 3O4WA 3OYNA 2QWRA 1MDUB 3G25A 3AO1A 3MWTA 3QFPA 3V9WA 4DFKA 4AHUA 5AQPA 3CC2N 3THXB 4CJUA 5JVHL 1RDAA 5CYMA 3P5JA 1N32K 3B6PA 1C1CA 1P90A 3KK3A 3IRXA 2JGUA 5JLHA 4DTUA 3H1QA 3HOSA 1A5VA 3QEXA 4C8KA 3P83D 3C7NB 1NGIA 5C0YA 4AM6A 2KFZA 5AQUA 3MEDA 3PY8A 2P9PB 4RW4A 1DLOA 1NKBA 2OCEA 4OX9K 5AQLA 1Z05A 3KKSA 2O8FB 2VQFK 3CQYA 1QVGM 2GTDA 4YDUA 2QKKA 2FC0A 3C6HA 3TWHA 5AFUA 4YFUA 5KPTA 3WXMB 2NRTA 2Q3SA 4AHTA 3L4IA 3DLHA 3UKUB 3QNNA 4Z4FA 2WTUA 1HQUA 3NGZA 4JI0K 3KK2A 1L3TA 5J2MA 4M3TA 5FDLA 3PX6A 1KVAA 4JHDB 4DQIA 3J81O 4RW7A 3DYAA 3ZETB 4C1NI 3RVCA 4CD1A 1HYVA 3IUCA 4BRDA 2GV9A 4C8MA 4CFDA 1VSLA 1WSHA 2X6NA 4BROA 4ICLA 1KLMA 3RRGA 1OH7A 2ZGZA 1I3AA 4ISGA 1ZBSA 4WQ4C 2QXFA 2HHWA 3DRSA 4FLTA 1EX4A 3SBTA 3L0QA 4DV7K 2G8KA 2B6AA 3K9JA 4CFCA 5I3UA 1J9AA 1SKSA 4MDBA 1UA0A 3ZT0A 5GAEP 2RKIA 5AQTA 3CXCM 5HBMA 1FKPA 3VQAA 3ZX3A 3PX4A 5GINA 4O5FA 4KHNA 3SQ0A 1BIUA 1E3MA 3SAGA 1X9MA 4I6MA 2O8EA 1WSJA 2G8FA 1KFSA 5BPLA 3AGRA 4H5TA 3TR8A 4FJXA 1YITN 1XQSC 3ATUA 4CJTA 1RT6A 1VQ9N 1SS6A 3O4NA 1RT5A 4NCBA 2HOEA 3AO4A 4ELTA 2NZTA 1Q7YO 4CZIA 4KTWA 2IC3A 4CJSA 1OH8A 4M63C 4WQ4A 3WNEA 3VQ9A 3T1YK 3F2KA 4G1QA 5IWAK 1HJOA 1DKGD 3OS2A 1EKEA 1P8ZA 1YTUA 4OKEA 3MXIA 3JAMO 1BA0A 2IDOA 1Q86O 5BPMA 5J2QA 2VYPA 4CJPA 2D4WA 4EAHD 4R79A 1BIZA 3H46O 3QIOA 4LF6K 5DMRA 2F8SA 1JLQA 3NFAA 2JWKA 4E7KA 1LWEA 2Q0UA 3FFKB 3D2EA 2P1JA 2YHXA 4B3MK 4DQPA 4DV1K 2GUPA 4CEBA 1C0GA 1DGKN 3V6DA 1YJWN 2BGGA 2HNYA 4FWNA 4H5WA 5DM6L 4EHUA 3C6UA 3UE5A 2YX6A 4JLHA 1MWMA 3FR0A 2IVNA 2OA8A 1QQOA 4H0PA 1RTIA 3KIOA 4FZYA 3QLHA 4CI6A 4IWVA 2UXBK 4JKAA 3D45A 3J7ZO 1HNXK 4GV3A 1TAUA 3S9HA 3BF1A 3K58A 1K6YA 3GL1A 4JI8K 2PBDA 5AZIB 2YJFA 3TAGA 5EOYA 3TSQA 3V81A 1RCHA 1CXQA 4Z4CA 4TSXA 4EFHA 1NMDA 4H0YB 1HR0K 2QK9A 4B3TK 1NGGA 1L3SA 5C2FA 4OPHA 3D2FB 4NYNA 1S1TA 4E7JA 3CPEA 4B1UB 1NJYA 4Z4EA 5AQZA 3P38A 3L8BA 3QERA 5M1NA 1LW2A 2X6SA 3T1AA 5FPDA 1RT1A 3PV8A 5LMNK 3CCJN 4BWJA 3THWA 1QZ6A 1GOBA 1RNHA 3VA3A 2FBVA 1Y97A 3TANA 1WUAA 5M1PA 3VEXA 4C8NA 4RW6A 4DU4A 2G8VA 2FSNA 1QVFM 2UXDK 1BI4B 2B4JA 2QA4N 5HROA 1RBTA 1GLLO 3A5NC 4FJIA 4DR2K 4XH1A 4K42A 5CZ1A 4CVNE 3KZBA 1NK6A 4Z0UA 4DSKA 3CYMA 4BVOA 1QS4A 4DTMA 3K5MA 3K5NA 3AVMA 4OPAA 4BC2A 4OVLA 4C8LA 2FSKA 3IMXA 5AQKA 4BQLA 4EZ6A 3MN6A 3OYAA 4JK7A 4JI7K 4XH4A 1SL2A 4M7YA 4FWQA 1M1KO 4FJGA 3MN9A 3AY9A 5HP1A 1S1WA 4H4OA 3VEWA 4DR1K 1WBDA 4YOWA 4YOXA 1NK7A 2FSJA 1EWQA 2ASPA 3VTIA 2OPQA 4Y1DA 4KHQA 4BACA 2DTUA 4DQQA 1KAXA 2DFEA 3ZEUA 1LWFA 4LFBK 3M8RA 1S22A 2ZE2A 5AFUH 2HHQA 2WONA 4W5TA 3RMDA 1JXEA 4CZEA 3EE8A 3CFRA 4N41A 4E89A 3EKUA 3BZKA 3TI0A 2F8TA 3SMSA 3BUZB 1KVBA 5BRFA 4G9ZA 1S72N 3K59A 4CZJA 4BQZA 2F7TA 4IG0A 4NO7A 2ZF5O 4CGJA 3TAQA 3B6OA 5HRSA 1J5OA 3CJCA 4BRFA 3THXA 3CD6N 3L3VA 4CZGA 3LL3A 5ELZA 1ZC6A 3QETA 3HVTA 1NKCA 5I42A 3V9ZA 4ISFA 4YOTA 3OYCA 1L5UA 4LY7A 3R8EA 2Y1JA 1VQNN 2IAJA 1J6ZA 3C7NA 1U2VB 3NGYA 3LDPA 2FBTA 2G8WA 5F0XA 3U9ZA 3AA2A 1NGJA 4MO5A 1S1UA 1YJNN 3BGRA 5SZTA 3MDQA 1B9DA 1TKDA 3OYLA 1BWFO 3S3MA 4BR5A 2HMIA 1UA1A 2Z1HA 1XMOK 2A5XA 3CM6A 1BCMA 1VQMN 3DRPA 2HVIA 4O8UA 3WXIA 4M3YA 1EXQA 4CF0A 4MLEA 4FJLA 3I0RA 5AQNA 3M5RA 3VGLA 4I7FA 3KVGA 3LDQA 3KLEA 4FW2A 2BANA 2BH1A 5AQSA 3ZETA 1VQ7N 1VQPN 3IDHA 3PIPL 1I39A 4PKHA 4LFAK 2EWSA 4NCAA 4M7XA 2BUPA 3EO3A 4A2BA 5HOOA 2PYLA 3TPQA 3LP0A 4JRQA 2XY8A 2YJEA 4FM1A 1S1VA 3NH1A 2HNZA 1G15A 4ELVA 1WOQA 1OH5A 5KRSA 2HW3A 3ZSRA 1RBUA 1U04A 3VQCA 1TGOA 3L4QA 1BCOA 4CF8A 3EZ5A 3SQ1A 2YHWA 1WNSA 2Z1GA 2I5JA 4C1NK 2P5GA 2IS3A 1IO2A 1CZAN 3FE1A 4H03B 5FRMA 2YHAA 4QS7A 2Y1IA 4IO8A 3GDQA 1KQSM 1XHXA 4QS9A 1IJJA 4LH4A 4OGCA 3AAQA 3LDOA 5C10A 1ASWA 1O1WA 3QB0A 3SUPA 3MEEA 1Q82O 2WUSA 5ADXA 5M1FA 2AJQA 4CJKA 4B3RK 1WLJA 5AQFA 4H0OA 4FWKA 1VSEA 4BRNA 4BE1A 3E01A 2A41A 1X9WA 4MQ3A 1D4XA 3WQUA 4QS8A 3HSCA 3NHGA 2GWKA 3H45C 4CHZA 3EKSA 5AQYA 4GMJB 1BISA 4JK8A 3WT0A 4LF8K 5AQXA 3PLAA 4M3ZA 3QFUA 2DFFA 4GKJK 1VSFA 5AQRA 1K73O 2CH6A 5KGWA 3TU5A 2NUBA 1S6PA 1TKXA 2G8IA 2HHTA 3FLCO 1QQNA 4JN4A 4B9MA 3EEQA 2E6MA 2W40A 3GG4A 2P5OA 2GELA 4BDPA 4CJLA 3KLIA 2F4VK 3ZSYA 3G6EN 3ZSOA 1TYQB 3PSIA 2EHGA 4JI3K 2NRZA 1ZBUA 3LWMA 3KKRA 4BR0A 4QOZB 4LFCK 3CJ7A 4MO4A 3O6WA 5AZIA 4DR3K 1CXUA 1HYSA 1BUPA 4AHCA 3SAFA 2G8HA 2HHUA 1U45A 5CR4A 3O9RA 4JKGB 4KFBA 4N5SA 1IV0A 4GW6A 5E41A 3MN7A 3DM2A 1NJIO 1WAJA 4ILHA 5KGXA 2E8AA 3O3GA 5TKWA 4C23A 3V1RA 1NGBA 3WXKA 4FLYA 2D0BA 4NYFA 3TTFA 3M8QA 2O8CB 2YKNA 1JLEA 4F2SA 3BDPA 5EXWA 4FJ8A 4J8FA 2UUBK 3DOLA 3LALA 3FZHA 3DMJA 1ATNA 2V7ZA 3KLGA 3HM9A 3FGUA 3CJ9A 1KTQA 1NGEA 2QWOA 3DXKB 4IO9L 3SI6A 4PA1A 4DG1A 3K5LA 2HVHA 1VSMA 1BI4A 4CJ3A 3CI5A 4BC3A 2XHBA 4FJ5A 2F96A 4DV4K 4IOAL 3OVNA 1T3VA 4FWOA 4B1VA 5TKYA 4RW8A 1IKXA 4BE0A 2W6KA 1J5EK 3P4IA 4HUFA 1U6ZA 2BTFA 1MU2A 5AQHA 1HLUA 5C12A 2X78A 2KKZA 1BG3A 2A1RA 1RT3A 3AVBA 5M1KA 3LANA 2FBYA 4PHTX 1SZ2A 3LAKA 2F9TA 4FVUA 4FM0A 3NDKA 1TL1A 1UWBA 4LF7K 4DFJA 3AVFA 3A2FA 1WSFA 3HPHA 3KLFA 4CEZA 5KQDA 4AHSA 4ID1A 5C24A 4RG8A 2E88A 4FWLA 1OH6A 1ZBLA 3H1VX 1RTJA 3O9UA 4FOEA 1K9MO 2O4GA 5BREA 1QSLA 1T8EA 2ZWHA 4AQYK 2HHSA 1VK0A 3QICA 2NNWA 2KZMA 1KRPA 1XUPO 3PIOL 2A6AA 4YHHK 1RDCA 3DOKA 4JI2K 4B9TA 2P9KB 5FRNA 1KVCA 3AA5X 4JD2B 4IG3A 4JI6K 3QEVA 4ZTFA 3H3NO 3ALYA 2HF4A 1NM1A 1SV5A 1W9HA 1VQ4N 1GOAA 1U2VA 1IBKK 1HKBA 1NGCA 3OHRA 1T7PA 3VGMA 2VWKA 1HX1A 1KLNA 4OO1J 1MA9B 4Z94A 2OZMA 3DI6A 4LH5A 2FBXA 3FZFA 4KI6A 1UAXA 2YNFA 1VSJA 5LJWA 1BA1A 3WNHA 4M3UA 5AQMA 5GIOA 3VGKA 1S6QA 4B9QA 5ADXH 4K25A 4N47A 4KPYA 3AGKA 4DFMA 2HBJA 3CMEN 3CF5L 3G4SN 3RMAA 4E19A 5J1EA 2CH5A 3V9SA 4KHPK 4FWSA 3HSTB 1A5XA 4E7IA 4MLHA 1VQKN 3ZSQA 1NGHA 4IXCA 4FJ9A 1RBRA 4E1JA 3WUHA 3R9PA 4JK9A 1RILA 3CIPA 4KB0A 2QWNA 4ISEA 4JS5A 4EP5A 3OYDA 4FJHA 4CEOA 2ZJRL 3VN5A 1YJ9N 1QTMA 3SNNA 4PWDA 4Y0WA 3CPWM 1OVYA 4BRIA 2P9LB 3AVAA 3K9KA 3EL2A 5I9EB 3ZSWA 5J2NA 3LPUA 3U6FA 4H4MA 2J4RA 4DSFA 5D3GA 2NRVA 4IFVA 2P9UA 3KD1E 4LC9B 4PUOA 4IKFA 4ILGB 3AVGA 4RW9A 3RSEB 4BDZA 1RDWX 5AQIA 3WNFA 4FJNA 1T44A 3A5OC 4AM7A 3JXUA 4CGFA 1Q9YA 3NF7A 4NCGA 2UYTA 2O8BB 4BC5A 1BDGA 5M1QA 3S3NA 1VQ8N 4FPBA 4M41A 1NJZA 5A2QO 3I0SA 1ASVA 2IOCA 1BO5O 2QI2A 3GE1A 3M1FA 4K8XA 3J7YP 4ZTJA 1ATRA 2ZQBA 1BGXT 3TABA 1SQKA 4B1XB 3S3OA 4BRKA 1JJ2M 3AVNA 3UB5A 3HXMA 3VQ6A 1ESVA 1YTAA 2ZD1A 4WFBL 2XO7A 3D0PA 1RT2A 2OZSA 3K5OA 4IJAA 4A5AA 4XEIA 4BWMA 3SUOA 3Q7CA 5C15A 2B5JA 3IAYA 3CERA 1Z26A 5BRDA 3MAQA 4FJMA 1BQNA 3CFOA 3V1OA 3RTVA 3DXMB 1N34K 4IZ9A 4EIAA 2CGKA 5FLXO 5K14A 4E7LA 3T3FA 4WQ5A 3E1YA 3O9SA 1X9SA 1D9DA 4H5RA 1QSSA 2RPIA 3AVLA 3WEEA 1NG9A 1NU0A 3ITHA 1WAFA 3AO3A 1DT9A 2OANA 3TAPA 3CQ8A 3NBPA 5H1SQ 3HBTA 5HLFA 3HK2A 2P9SB 4NB4A 1C6VA 2NRHA 4K41A 1ATSA 4B8AB 4DCHA 4GKKK 2YCHA 3N4PA 1T6DA 1YT3A 2XY7A 4M3RA 1DTQA 4KRFA 4A57A 4BR4A 1NJWA 3MWPA 2HMPA 3VQEA 1SL1A 3OYKA 1XC9A 2XY6A 4KH4A 2E20A 1ASUA 3VF4A 3W0LA 4KHUA 1KD1O 1B92A 3JYTA 1S5JA 3KWGA 3HM8A 1TKZA 1IBMK 2WOMA 4V19S 3ZSZA 2GBZA 2CGLA 1J54A 5BR9A 3ISNC 5KI6A 4CBXA 5GIPA 1YHQN 4HCCA 3AO2A 1IG9A 5JMVA 1REVA 4GNIA 4E7HA 1V4SA 3ZSXA 3QDKA 4CGIA 3CCEN 1OVQA 4CD3A 3SZ2A 4CF1A 5BRHA 4DV3K 2IGIA 3AVCA 1GLJO 5JS2A 3VA0A 1YIJN 3G71N 3MCPA 4BG9A 3AVHA 3CFPA 2RN2A 3CCRN 1SL0A 5SWMA 2E5LK 4H0VB 4NXNK 4O5BA 1HNWK 1L3VA 3ZX2A 2O4IA 2ATQA 1K8KA 3VQ7A 3PO4A 3DAWA 3DWLA 1JLAA 2YKMA 1TK5A 3LP3A 3U3YA 1Q18A 2IVOA 4CJ5A 4OLAA 1GLEG 2I7PA 2QWLA 4AH9A 5AQGA 4O8KA 2ASMA 3L2RA 4OJRA 2OPPA 4DTRA 1NOYA 5EY4A 4CF9A 4BRQA 4CZMA 4W5NA 1I94K 4LD0A 3NVKA 2YHBA 4OKKA 5E26A 1S9EA 4I9LA 3THVA 5B8HA 2HBKA 3WQTA 5HL7L 1VQON 3VETA 1NOZA 2P9PA 4CEDA 3OBYA 5FPNA 1NGAA 3NGIA 4CGDA 2RHKA 1VQ6N 1RFQA 5CE3A 3K57A 4BRCA 4CBUA 1WSGA 3HL8A 4K0KK 3MMVA 4CFAA 3PX0A 2O8FA 1Z6RA 4M3WA 1VAZA 3OYGA 4U67L 4K43A 2D0CA 1NKEA 1W0HA 4JV5K 1JLGA 4FPAA 1WB9A 1Q9XA 2QM1A 4ELUA 3C0BA 2YNHA 1U47A 2HHHK 3UKUA 1HYZA 3OBWA 5C2DA 1L3UA 2Q97A 3M3ZA 3NCIA 1YUWA 4GVEA 3A8YA 1RTHA 1WSIA 3A0IX 4NXMK 4JKCA 3AO5A 4JHDA 1NWKA 5EX5A 4DQ8A 1W97L 1G99A 3IG1A 4W5RA 1NJXA 4DF8A 3TAFA 1TVRA 4YY3K 4B1WB 3JS6A 3LPTA 5BN9A 3RMBA 4H5NA 4I6MB 4DV0K 4DTNA 1NK4A 1IKVA 1KAZA 4CCHA 1HJRA 4YNQA 2UU9K 1J53A 3QBXA 3TSPA 4WFNL 3VERA 4FJJA 4F3TA 1N33K 1BL3A 5JVGL 3RR8A 3J8AA 4YOVA 1U4BA 4KTQA 1NGDA 2PAVA 1IKYA 1GLCG 3DJCA 4J2AA 2YV0X 3FZKA 4B1YB 2ZGYA 5HRRA 1C1AA 2FF3B 1C1BA 2QW9A 4DTXA 3SQ2A 1CZBA 4N56A 5E84A 2A42A 1KCFA 4HTLA 1HUXA 3D7EO 4BRGA 3VQ4A 1GOCA 2KLAA 2P9LA 1R0AA 4FOIA 1U49A 4JKHA 2LSNA 1WSEA 3ATVA 3VMFB 4RTFD 3J7AP 3SV3A 2OTJN 1RBVA 3VQ8A 4DTPA 4DTJA 3F9MA 4FWMA 2QEXN 2FF6A 4CJWA 2Z1JA 1FKOA 2YI1A 2E1YA 3VPZA 2UUAK 4JI1K 4BE2A 3RSEA 4B9UA 4BDYA 3O08A 1LCUA 5LMUK 3CMAN 2VWJA 4KI4A 2QTDA 4A62A 4B08A 2ITGA 1V4TA 2VG5A 4KH6A 2Q1NA 1QSYA 2E2NA 3HPOA 2OTLN 2O8BA 1JLBA 3ZCMA 4CHYA 4CEEA 4Z4IA 2FLOA 5KRTA 1JCEA 4CJ4A 1IH7A 4CGGA 4B9SA 1JCFA 1HKGA 4AF1A 2IIRA 3MCAB 3ZT2A 1IKWA 3ID8A 4FO0A 1GLFO 1XC3A 1C0MA 1N6QA 2V7YA 3QESA 3OTOK 3I8BA 3QMLA 4BR9A 3LZIA 4DSEA 3MECA 1DTTA 2NRWA 4KB1A 2NRXA 3MXJA 5FROA 3KLHA 3CJBA 4I2QA 4BRHA 4FLZA 3F9KA 3M8SA 4FLVA 2VGMA 3VQ5A 1LOTB 4QCLA 4KV8A 3DLRA 1TV6A 4B1ZA 3MXMA 4JKEA 4FLXA 1XWLA 2E2OA 4W5QA 2UXCK 3DXMA 3MX2A 2HBMA 3D2FA 1ZBHA 1FJGK 5KQ8A 2YNGA 2P9IB 3VTHA 4IEEA 4E1NA 5GADP 1X3NA 2VGNA 3PSFA 3CCQN 3OY9A 4A5BA 3VQPA 1C0UA 3T69A 2HBLA 3NVMA 4DKWA 3CJAA 2ZJPL 4J2EA 2OPSA 3CCSN 2ETJA 3ASMA 4O55A 2A40A 3P1GA 4DU3A 3JSMA 1VHXA 2VCPA 4JAXA 1TUUA 2KTQA 5JS1A 2KZZA 1LWCA 4BGBA 1RBSA 1W2BM 2PFUA 1LAWA 4PQUA 3EZWA 3VQDA 3LZJA 4I9QA 5MLCQ 1KAYA 2OPRA 4IBNA 4F9OA 4JEPA 4F3OA 4H0TB 4WF9L 5EU7A 4BVPA 3GBTA 4CGHA 4JS4A 2VG7A 2XRIA 1RDUA
chains in the Genus database with same CATH topology
4W5OA 4Y1DA 1TL3A 4IFVA 4BACA 4FXDA 3KD1E 2DTUA 4DQQA 3AVIA 2DFEA 1LWFA 1UOCA 2X74A 4M3XA 4PUOA 3M8RA 4IKFA 4DTSA 1QHTA 3AVGA 4Z4GA 2ZE2A 4Z4HA 1C0TA 2HHQA 2WONA 4RW9A 4CHOA 3CM5A 4W5TA 4BDZA 3RMDA 1NK0A 1F21A 1JXEA 4KREA 3WNFA 3CFRA 4FJNA 4N41A 4E89A 3TI0A 3SCXA 4CGFA 2F8TA 1VRTA 2KW4A 4CHNA 3V4IA 1Q9YA 3OYIA 3NF7A 1KVBA 3H08A 3QEWA 4NCGA 1WN7A 3OYFA 1HNVA 3K59A 4O44A 3S3NA 4I2PA 4DSJA 4FLWA 4IG0A 4M41A 1NJZA 3I0SA 4CGJA 2PYJA 3WNGA 1ASVA 2IOCA 3HYFA 3TAQA 3B6OA 5HRSA 1J5OA 1RDBA 3MEGA 3T19A 4HHTA 4K8XA 4ZTJA 2G8UA 2ZQBA 1LAVA 3G10A 3L3VA 3OYBA 3QETA 3ZT3A 1BGXT 3HVTA 5I42A 1NKCA 3TABA 5D3GA 4LSLA 3V9ZA 3OYCA 3AVKA 4KO0A 3OS1A 3S3OA 4B9LA 3RRHA 1L5UA 4LY7A 4E1MA 2QKBA 1CLQA 3C94A 3SPYA 3CG7A 1NK5A 3AVNA 2Y1JA 4Q5VA 3HXMA 2IAJA 4CFBA 3VQ6A 1Z25A 4CESA 3NGYA 1YTAA 3PUFA 2ZD1A 1KFDA 4ZHRA 2XO7A 3D0PA 4K8ZA 2FBTA 2G8WA 1RT2A 2OZSA 3K5OA 2KQ2A 4OGEA 1SKRA 4DSLA 4BWMA 3SUOA 3AA2A 2XY5A 1S1UA 1QE1A 3KJVA 2B5JA 3IAYA 1VSHA 3NF6A 5DK5A 1Z26A 3BGRA 5SZTA 3MAQA 4AILC 1XHZA 4CHPA 4FJMA 1BQNA 1B9DA 4CK2A 4CK3A 3CFOA 4HUGA 3HP6A 1TKDA 4PY5A 3V1OA 1RDDA 3OYLA 3RTVA 1N5YA 3S3MA 2VG6A 2HMIA 5K14A 4CJFA 4E7LA 4DS4A 1T05A 1UA1A 4F4KA 2Z1HA 3T3FA 2OYQA 4DLGA 1D9DA 1X9SA 3CM6A 1BCMA 1QSSA 2RPIA 3AVLA 2HB5A 3DRPA 4FCYA 4N76A 4CJVA 2HVIA 4M3YA 2Z1IA 3ITHA 1WAFA 3AO3A 1EXQA 4CF0A 3TAPA 1T03A 3CQ8A 4FM2A 3NBPA 4FJLA 1D8YA 3OYMA 3I0RA 4I7FA 1Q8IA 5HLFA 3HK2A 1QQCA 3FFIA 3KLEA 1C6VA 4FW2A 4FVMA 2BANA 4B8AB 3DLKA 3L2UA 1YT3A 2XY7A 1I39A 3QEIA 2D5RA 4M3RA 3OYHA 1DTQA 3TARA 4KRFA 2EX3A 1NJWA 1JLFA 4DU1A 4E0DA 4NCAA 3VQEA 4R5PA 1SL1A 4O4GA 4WE1A 2PYLA 3OYKA 1XC9A 1HMVA 3L3UA 2XY6A 4OPJA 3LP0A 4JRQA 2XY8A 1HNIA 3HP9A 4FM1A 1S1VA 4KKOA 3NH1A 2RF2A 2PY5A 2HNZA 1G15A 4ELVA 3NH2A 1ASUA 3ZT4A 4OLBA 5KRSA 2HW3A 3NF8A 4CECA 3ZSRA 4KHUA 1RBUA 1B92A 4FW1A 3L2VA 3JYTA 1U04A 1S5JA 3SJJA 2DY4A 3KK1A 1NK9A 3VQCA 1TGOA 3AVJA 3K2PA 1BCOA 1VRUA 4CF8A 1A5WA 1YVUA 1TKZA 4DQSA 2D0AA 3EZ5A 2WOMA 3SQ1A 4KAZA 3ZSZA 3V1QA 1WNSA 2Z1GA 2I5JA 4CIGA 2GBZA 4E3SA 1EP4A 1J54A 4L8RB 3HPGA 2P5GA 2IS3A 1IO2A 2DFHA 3UIQA 3ISNC 3O4QA 5KI6A 2YHAA 4HCCA 5FRMA 3AO2A 1IG9A 2Y1IA 4LSNA 4B9VA 3QINA 1REVA 1XHXA 4DTOA 3DRRA 4B3OA 2JLEA 4LH4A 3HT3A 3ZSXA 4O0JA 4OGCA 4CGIA 4E7HA 5C25A 1ASWA 1O1WA 3I8DA 3SZ2A 4CF1A 1HQEA 2IGIA 3AVCA 4CEAA 3SUPA 5JS2A 5KTQA 3MEEA 3LWLA 3VA0A 4DWIA 3V9XA 4F8RA 3NF9A 3RMCA 3VQQA 2AJQA 3QNOA 3AVHA 4AHRA 3U6FA 4O0IA 3TAMA 3OYEA 3AA3A 2RN2A 3CFPA 4HUEA 4CJKA 1SL0A 1WLJA 5SWMA 2HNDA 3L2QA 1JL2A 3KD5E 1VSEA 4EZ9A 4BE1A 3E01A 1X1PA 3LAMA 1X9WA 4MQ3A 4O5BA 4QAGA 3U3GA 3OYNA 3NHGA 4CHZA 3OYJA 3AO1A 1L3VA 2O4IA 3QEPA 2ATQA 4GMJB 4CEQA 3V9WA 3VQ7A 3PO4A 1BISA 4DFKA 4AHUA 1JLAA 2YKMA 1TK5A 3LP3A 4CJUA 4M3ZA 3U3YA 2DFFA 4DSIA 1RDAA 1VSFA 5CYMA 3P5JA 4CJ5A 4OLAA 3B6PA 1C1CA 4EP4A 3IRXA 3KK3A 2JGUA 4AH9A 3HO1A 3KTQA 3L2RA 4DTUA 1JXBA 5KGWA 4FZZA 4OJRA 2OPPA 4DTRA 2NUBA 1A5VA 1S6PA 4FLUA 3QEXA 1NOYA 4B9NA 4C8KA 3P83D 1TKXA 4CF9A 4HVJA 4DF4A 2G8IA 4W5NA 2HHTA 3TAEA 3O3FA 5HRNA 2KFZA 2E6LA 4LD0A 4FK4A 3M8PA 3MEDA 2YHBA 4OKKA 3PY8A 4RW4A 1DLOA 1NKBA 1S9EA 3SUQA 4B9MA 1SUQA 2E6MA 4CJQA 1CZ9A 2R7YA 4I9LA 3THVA 3KKSA 1ZBIA 2P5OA 1NOZA 4CEDA 3NGIA 4CGDA 2FC0A 2QKKA 3TWHA 4Y1CA 4YFUA 3K57A 1WSGA 3HL8A 3VQBA 4BDPA 4CJLA 3KLIA 3ZSYA 4CFAA 3PX0A 4DFPA 4M3WA 3ZSOA 2Q3SA 4AHTA 3OYGA 3DLHA 2D0CA 1NKEA 3QNNA 4Z4FA 1HQUA 1W0HA 2W42A 3NGZA 1JLGA 3KK2A 1L3TA 5J2MA 1Q9XA 2EHGA 4M3TA 4ELUA 5FDLA 2YNHA 4IFYA 3PX6A 1U47A 1ZBUA 4CJEA 1HYZA 3KKRA 3LWMA 4QOZB 4OKJA 1KVAA 1L3UA 4DQIA 4RW7A 3DYAA 3NCIA 4H8KA 1CXUA 1RTHA 1HYSA 1WSIA 1HYVA 4CIFA 1BHLA 2GV9A 4C8MA 4CFDA 4CHQA 1VSLA 1WSHA 2X6NA 4AHCA 4C8OA 2KFNA 3AO5A 2G8HA 4ICLA 1KLMA 1U45A 3RRGA 2HHUA 4KFBA 4CF2A 4N5SA 4GW6A 1I3AA 5E41A 1TAQA 4CE9A 3RWUA 1ITGA 2QXFA 3DM2A 3IG1A 2HHWA 3DRSA 4FLTA 1EX4A 1WAJA 5KGXA 3O3GA 2G8KA 2B6AA 5CYQA 1B9FA 4CFCA 5I3UA 3V1RA 3NE6A 1J9AA 4W5RA 1NJXA 4UQGA 3RR7A 4FLYA 1VSDA 2D0BA 1TVRA 4DF8A 4NYFA 3TAFA 1SKSA 4CERA 1NK8A 1UA0A 1KSPA 3ZT0A 4KHQA 3M8QA 3AV9A 2YKNA 4M45A 1JLEA 4F2SA 3LPTA 3RMBA 3BDPA 2RKIA 4FJ8A 5HBMA 1FKPA 3VQAA 3DOLA 3LALA 3OJUA 4DTNA 3PX4A 1NK4A 3DMJA 1JLCA 1IKVA 3KLGA 4CCHA 4KHNA 4DMNA 1BIUA 3SQ0A 4J2DA 3HM9A 1HJRA 1RT4A 2GUIA 4YNQA 1X9MA 1KTQA 3SYZA 1J53A 1WSJA 4FJJA 2G8FA 3SI6A 4F3TA 4PA1A 4CEFA 4DG1A 1KFSA 4B8CA 3K5LA 2HVHA 1VSMA 4DQRA 3TR8A 1BI4A 4FJXA 1BL3A 4CJTA 4CJ3A 3RR8A 1RT6A 1U4BA 5C42A 4KTQA 2XHBA 4FJ5A 2F96A 3O4NA 4KTZA 4HTUA 1RT5A 4NCBA 3OVNA 1IKYA 3AO4A 4J2AA 2YV0X 4RW8A 4ELTA 1IKXA 4BE0A 4KTWA 2IC3A 4CJSA 3G0ZA 3L2WA 3WNEA 3SUNA 4HUFA 3VQ9A 3IS9A 2A1SA 5HRRA 1C1AA 1MU2A 1C1BA 4G1QA 3OS2A 1S9GA 2X78A 1EKEA 2PZSA 2A1RA 1YTUA 1RT3A 4OKEA 4DTXA 3SQ2A 1CZBA 4XIUA 3MXIA 3AVBA 4N56A 3LANA 2FBYA 3DLEA 4F2RA 2IDOA 3LAKA 1KCFA 4ID5A 5J2QA 1ZBFA 4CK1A 4CJPA 3LDSA 3VQ4A 4FM0A 1GOCA 1BIZA 3QIOA 3NDKA 1R0AA 1TL1A 3DLBA 1UWBA 3OJSA 1U49A 5DMRA 4DFJA 2LSNA 3AVFA 3A2FA 1RTDA 2F8SA 1WSEA 1JLQA 1WSFA 3HPHA 3KLFA 3NFAA 4CEZA 4AHSA 3SV3A 4ID1A 1RBVA 1VSKA 3VQ8A 5C24A 4DTJA 4DTPA 4E7KA 1LWEA 4HCBA 4RG8A 4CJWA 2P1JA 2Z1JA 2YNIA 3F73A 1FKOA 4DQPA 4FK2A 1ZBLA 1XI1A 4CEBA 1D5AA 1RTJA 4BE2A 3V6DA 2BGGA 2HNYA 5T7BA 4BDYA 4DLEA 4B9UA 2O4GA 2VWJA 4KI4A 3ZSVA 4B08A 1QSLA 3C6UA 2ITGA 1T8EA 2VG5A 4JLHA 2HHSA 3O3HA 1QSYA 1VK0A 2OA8A 1EETA 1RTIA 3KIOA 3HPOA 4FZYA 3QLHA 2KZMA 1JLBA 3ZCMA 4CHYA 4CJRA 1KRPA 3SQ4A 4CEEA 4Z4IA 3D45A 5KRTA 4CJ4A 1IH7A 1RDCA 3DOKA 4CGGA 4B9SA 4B9TA 1TAUA 3S9HA 3NH0A 3K58A 1K6YA 1TKTA 3ZT2A 5FRNA 1IKWA 1KVCA 3AA5X 4FYDA 1C0MA 4GVMA 1N6QA 4IG3A 3QESA 4FJKA 3TAGA 3QEVA 4ZTFA 3NAEA 3V81A 3ALYA 1RCHA 3LZIA 3EY1A 4DSEA 1CXQA 1DTTA 1SV5A 1W9HA 3MECA 1GOAA 4Z4CA 1SKWA 4KB1A 4TSXA 3MXJA 5FROA 3KLHA 3AA4A 4I2QA 4FLZA 4AHVA 3F9KA 1U48A 3M8SA 5CY4A 4FLVA 1T7PA 3VQ5A 2VWKA 1JL1A 3HJFA 2QK9A 1L3SA 1FK9A 4QCLA 1KLNA 4KV8A 4KHYA 3DLRA 1TV6A 4NYNA 3MXMA 1S1TA 4OPKA 4FLXA 1XWLA 4E7JA 3DI6A 2OZMA 3LP1A 2HHXA 1NJYA 3DLGA 4W5QA 4KHWA 4Z4EA 4J2BA 4LH5A 4CIEA 2FBXA 3L8BA 1ZBHA 4KI6A 3QERA 1LW2A 1S1XA 2YNGA 2BE2A 2X6SA 3T1AA 4M42A 3PV8A 1RT1A 1UAXA 4E1NA 2YNFA 4BWJA 4Q0BA 1VSJA 1HRHA 1GOBA 3WNHA 4M3UA 1RNHA 3OY9A 3VA3A 1S6QA 3VQPA 2FBVA 1TK0A 1C0UA 4KHSA 3V9UA 5J2PA 1Y97A 4N47A 3TANA 3ZT1A 4KPYA 3QIPA 4DFMA 1FXXA 4FZXC 3OS0A 4J2EA 2OPSA 1BQMA 4C8NA 4RW6A 4DU4A 2ETJA 3RMAA 2G8VA 3HVRA 3ASMA 4E19A 5CZ2A 5J1EA 1BI4B 2B4JA 4O55A 3PO5A 4FJ7A 3V9SA 3P1GA 1RBTA 4DU3A 3HSTB 5HROA 3SPZA 3EYZA 3JSMA 1A5XA 3QO9A 4FJIA 1HPZA 4E7IA 2BDPA 3ZSQA 5CZ1A 2HHVA 4FJ9A 1RBRA 1LV5A 2KTQA 1NK6A 5JS1A 2KZZA 1JKHA 4Z0UA 1LWCA 1RILA 4JRPA 4DSKA 4KB0A 3CYMA 4JS5A 4EP5A 1D9FA 1QS4A 4MFBA 1RBSA 5HRPA 3OYDA 4FJHA 4DTMA 3K5MA 1TK8A 3K5NA 4CEOA 3AVMA 3VN5A 1LAWA 1ZYQA 4PQUA 4OVLA 3VQDA 3LZJA 4I9QA 4C8LA 2OPRA 1QTMA 4IBNA 3SNNA 4EZ6A 4FK0A 4F3OA 2E4LA 4IDKA 4PWDA 3OYAA 1VSIA 2P51A 3ULDA 3SV4A 1SL2A 5EU7A 1RT7A 3AVAA 3LP2A 4FJGA 3ZSWA 4CGHA 5HP1A 1S1WA 4H4OA 4JS4A 3C95A 1LW0A 2VG7A 3C6TA 3LPUA 4DS5A 5J2NA 2XRIA 4H4MA 4DSFA 1NK7A 2OPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5O A;  4Y1D A;  1TL3 A;  4IFV A;  4BAC A;  4FXD A;  3KD1 E;  2DTU A;  4DQQ A;  3AVI A;  2DFE A;  1LWF A;  1UOC A;  2X74 A;  4M3X A;  4PUO A;  3M8R A;  4IKF A;  4DTS A;  1QHT A;  3AVG A;  4Z4G A;  2ZE2 A;  4Z4H A;  1C0T A;  2HHQ A;  2WON A;  4RW9 A;  4CHO A;  3CM5 A;  4W5T A;  4BDZ A;  3RMD A;  1NK0 A;  1F21 A;  1JXE A;  4KRE A;  3WNF A;  3CFR A;  4FJN A;  4N41 A;  4E89 A;  3TI0 A;  3SCX A;  4CGF A;  2F8T A;  1VRT A;  2KW4 A;  4CHN A;  3V4I A;  1Q9Y A;  3OYI A;  3NF7 A;  1KVB A;  3H08 A;  3QEW A;  4NCG A;  1WN7 A;  3OYF A;  1HNV A;  3K59 A;  4O44 A;  3S3N A;  4I2P A;  4DSJ A;  4FLW A;  4IG0 A;  4M41 A;  1NJZ A;  3I0S A;  4CGJ A;  2PYJ A;  3WNG A;  1ASV A;  2IOC A;  3HYF A;  3TAQ A;  3B6O A;  5HRS A;  1J5O A;  1RDB A;  3MEG A;  3T19 A;  4HHT A;  4K8X A;  4ZTJ A;  2G8U A;  2ZQB A;  1LAV A;  3G10 A;  3L3V A;  3OYB A;  3QET A;  3ZT3 A;  1BGX T;  3HVT A;  5I42 A;  1NKC A;  3TAB A;  5D3G A;  4LSL A;  3V9Z A;  3OYC A;  3AVK A;  4KO0 A;  3OS1 A;  3S3O A;  4B9L A;  3RRH A;  1L5U A;  4LY7 A;  4E1M A;  2QKB A;  1CLQ A;  3C94 A;  3SPY A;  3CG7 A;  1NK5 A;  3AVN A;  2Y1J A;  4Q5V A;  3HXM A;  2IAJ A;  4CFB A;  3VQ6 A;  1Z25 A;  4CES A;  3NGY A;  1YTA A;  3PUF A;  2ZD1 A;  1KFD A;  4ZHR A;  2XO7 A;  3D0P A;  4K8Z A;  2FBT A;  2G8W A;  1RT2 A;  2OZS A;  3K5O A;  2KQ2 A;  4OGE A;  1SKR A;  4DSL A;  4BWM A;  3SUO A;  3AA2 A;  2XY5 A;  1S1U A;  1QE1 A;  3KJV A;  2B5J A;  3IAY A;  1VSH A;  3NF6 A;  5DK5 A;  1Z26 A;  3BGR A;  5SZT A;  3MAQ A;  4AIL C;  1XHZ A;  4CHP A;  4FJM A;  1BQN A;  1B9D A;  4CK2 A;  4CK3 A;  3CFO A;  4HUG A;  3HP6 A;  1TKD A;  4PY5 A;  3V1O A;  1RDD A;  3OYL A;  3RTV A;  1N5Y A;  3S3M A;  2VG6 A;  2HMI A;  5K14 A;  4CJF A;  4E7L A;  4DS4 A;  1T05 A;  1UA1 A;  4F4K A;  2Z1H A;  3T3F A;  2OYQ A;  4DLG A;  1D9D A;  1X9S A;  3CM6 A;  1BCM A;  1QSS A;  2RPI A;  3AVL A;  2HB5 A;  3DRP A;  4FCY A;  4N76 A;  4CJV A;  2HVI A;  4M3Y A;  2Z1I A;  3ITH A;  1WAF A;  3AO3 A;  1EXQ A;  4CF0 A;  3TAP A;  1T03 A;  3CQ8 A;  4FM2 A;  3NBP A;  4FJL A;  1D8Y A;  3OYM A;  3I0R A;  4I7F A;  1Q8I A;  5HLF A;  3HK2 A;  1QQC A;  3FFI A;  3KLE A;  1C6V A;  4FW2 A;  4FVM A;  2BAN A;  4B8A B;  3DLK A;  3L2U A;  1YT3 A;  2XY7 A;  1I39 A;  3QEI A;  2D5R A;  4M3R A;  3OYH A;  1DTQ A;  3TAR A;  4KRF A;  2EX3 A;  1NJW A;  1JLF A;  4DU1 A;  4E0D A;  4NCA A;  3VQE A;  4R5P A;  1SL1 A;  4O4G A;  4WE1 A;  2PYL A;  3OYK A;  1XC9 A;  1HMV A;  3L3U A;  2XY6 A;  4OPJ A;  3LP0 A;  4JRQ A;  2XY8 A;  1HNI A;  3HP9 A;  4FM1 A;  1S1V A;  4KKO A;  3NH1 A;  2RF2 A;  2PY5 A;  2HNZ A;  1G15 A;  4ELV A;  3NH2 A;  1ASU A;  3ZT4 A;  4OLB A;  5KRS A;  2HW3 A;  3NF8 A;  4CEC A;  3ZSR A;  4KHU A;  1RBU A;  1B92 A;  4FW1 A;  3L2V A;  3JYT A;  1U04 A;  1S5J A;  3SJJ A;  2DY4 A;  3KK1 A;  1NK9 A;  3VQC A;  1TGO A;  3AVJ A;  3K2P A;  1BCO A;  1VRU A;  4CF8 A;  1A5W A;  1YVU A;  1TKZ A;  4DQS A;  2D0A A;  3EZ5 A;  2WOM A;  3SQ1 A;  4KAZ A;  3ZSZ A;  3V1Q A;  1WNS A;  2Z1G A;  2I5J A;  4CIG A;  2GBZ A;  4E3S A;  1EP4 A;  1J54 A;  4L8R B;  3HPG A;  2P5G A;  2IS3 A;  1IO2 A;  2DFH A;  3UIQ A;  3ISN C;  3O4Q A;  5KI6 A;  2YHA A;  4HCC A;  5FRM A;  3AO2 A;  1IG9 A;  2Y1I A;  4LSN A;  4B9V A;  3QIN A;  1REV A;  1XHX A;  4DTO A;  3DRR A;  4B3O A;  2JLE A;  4LH4 A;  3HT3 A;  3ZSX A;  4O0J A;  4OGC A;  4CGI A;  4E7H A;  5C25 A;  1ASW A;  1O1W A;  3I8D A;  3SZ2 A;  4CF1 A;  1HQE A;  2IGI A;  3AVC A;  4CEA A;  3SUP A;  5JS2 A;  5KTQ A;  3MEE A;  3LWL A;  3VA0 A;  4DWI A;  3V9X A;  4F8R A;  3NF9 A;  3RMC A;  3VQQ A;  2AJQ A;  3QNO A;  3AVH A;  4AHR A;  3U6F A;  4O0I A;  3TAM A;  3OYE A;  3AA3 A;  2RN2 A;  3CFP A;  4HUE A;  4CJK A;  1SL0 A;  1WLJ A;  5SWM A;  2HND A;  3L2Q A;  1JL2 A;  3KD5 E;  1VSE A;  4EZ9 A;  4BE1 A;  3E01 A;  1X1P A;  3LAM A;  1X9W A;  4MQ3 A;  4O5B A;  4QAG A;  3U3G A;  3OYN A;  3NHG A;  4CHZ A;  3OYJ A;  3AO1 A;  1L3V A;  2O4I A;  3QEP A;  2ATQ A;  4GMJ B;  4CEQ A;  3V9W A;  3VQ7 A;  3PO4 A;  1BIS A;  4DFK A;  4AHU A;  1JLA A;  2YKM A;  1TK5 A;  3LP3 A;  4CJU A;  4M3Z A;  3U3Y A;  2DFF A;  4DSI A;  1RDA A;  1VSF A;  5CYM A;  3P5J A;  4CJ5 A;  4OLA A;  3B6P A;  1C1C A;  4EP4 A;  3IRX A;  3KK3 A;  2JGU A;  4AH9 A;  3HO1 A;  3KTQ A;  3L2R A;  4DTU A;  1JXB A;  5KGW A;  4FZZ A;  4OJR A;  2OPP A;  4DTR A;  2NUB A;  1A5V A;  1S6P A;  4FLU A;  3QEX A;  1NOY A;  4B9N A;  4C8K A;  3P83 D;  1TKX A;  4CF9 A;  4HVJ A;  4DF4 A;  2G8I A;  4W5N A;  2HHT A;  3TAE A;  3O3F A;  5HRN A;  2KFZ A;  2E6L A;  4LD0 A;  4FK4 A;  3M8P A;  3MED A;  2YHB A;  4OKK A;  3PY8 A;  4RW4 A;  1DLO A;  1NKB A;  1S9E A;  3SUQ A;  4B9M A;  1SUQ A;  2E6M A;  4CJQ A;  1CZ9 A;  2R7Y A;  4I9L A;  3THV A;  3KKS A;  1ZBI A;  2P5O A;  1NOZ A;  4CED A;  3NGI A;  4CGD A;  2FC0 A;  2QKK A;  3TWH A;  4Y1C A;  4YFU A;  3K57 A;  1WSG A;  3HL8 A;  3VQB A;  4BDP A;  4CJL A;  3KLI A;  3ZSY A;  4CFA A;  3PX0 A;  4DFP A;  4M3W A;  3ZSO A;  2Q3S A;  4AHT A;  3OYG A;  3DLH A;  2D0C A;  1NKE A;  3QNN A;  4Z4F A;  1HQU A;  1W0H A;  2W42 A;  3NGZ A;  1JLG A;  3KK2 A;  1L3T A;  5J2M A;  1Q9X A;  2EHG A;  4M3T A;  4ELU A;  5FDL A;  2YNH A;  4IFY A;  3PX6 A;  1U47 A;  1ZBU A;  4CJE A;  1HYZ A;  3KKR A;  3LWM A;  4QOZ B;  4OKJ A;  1KVA A;  1L3U A;  4DQI A;  4RW7 A;  3DYA A;  3NCI A;  4H8K A;  1CXU A;  1RTH A;  1HYS A;  1WSI A;  1HYV A;  4CIF A;  1BHL A;  2GV9 A;  4C8M A;  4CFD A;  4CHQ A;  1VSL A;  1WSH A;  2X6N A;  4AHC A;  4C8O A;  2KFN A;  3AO5 A;  2G8H A;  4ICL A;  1KLM A;  1U45 A;  3RRG A;  2HHU A;  4KFB A;  4CF2 A;  4N5S A;  4GW6 A;  1I3A A;  5E41 A;  1TAQ A;  4CE9 A;  3RWU A;  1ITG A;  2QXF A;  3DM2 A;  3IG1 A;  2HHW A;  3DRS A;  4FLT A;  1EX4 A;  1WAJ A;  5KGX A;  3O3G A;  2G8K A;  2B6A A;  5CYQ A;  1B9F A;  4CFC A;  5I3U A;  3V1R A;  3NE6 A;  1J9A A;  4W5R A;  1NJX A;  4UQG A;  3RR7 A;  4FLY A;  1VSD A;  2D0B A;  1TVR A;  4DF8 A;  4NYF A;  3TAF A;  1SKS A;  4CER A;  1NK8 A;  1UA0 A;  1KSP A;  3ZT0 A;  4KHQ A;  3M8Q A;  3AV9 A;  2YKN A;  4M45 A;  1JLE A;  4F2S A;  3LPT A;  3RMB A;  3BDP A;  2RKI A;  4FJ8 A;  5HBM A;  1FKP A;  3VQA A;  3DOL A;  3LAL A;  3OJU A;  4DTN A;  3PX4 A;  1NK4 A;  3DMJ A;  1JLC A;  1IKV A;  3KLG A;  4CCH A;  4KHN A;  4DMN A;  1BIU A;  3SQ0 A;  4J2D A;  3HM9 A;  1HJR A;  1RT4 A;  2GUI A;  4YNQ A;  1X9M A;  1KTQ A;  3SYZ A;  1J53 A;  1WSJ A;  4FJJ A;  2G8F A;  3SI6 A;  4F3T A;  4PA1 A;  4CEF A;  4DG1 A;  1KFS A;  4B8C A;  3K5L A;  2HVH A;  1VSM A;  4DQR A;  3TR8 A;  1BI4 A;  4FJX A;  1BL3 A;  4CJT A;  4CJ3 A;  3RR8 A;  1RT6 A;  1U4B A;  5C42 A;  4KTQ A;  2XHB A;  4FJ5 A;  2F96 A;  3O4N A;  4KTZ A;  4HTU A;  1RT5 A;  4NCB A;  3OVN A;  1IKY A;  3AO4 A;  4J2A A;  2YV0 X;  4RW8 A;  4ELT A;  1IKX A;  4BE0 A;  4KTW A;  2IC3 A;  4CJS A;  3G0Z A;  3L2W A;  3WNE A;  3SUN A;  4HUF A;  3VQ9 A;  3IS9 A;  2A1S A;  5HRR A;  1C1A A;  1MU2 A;  1C1B A;  4G1Q A;  3OS2 A;  1S9G A;  2X78 A;  1EKE A;  2PZS A;  2A1R A;  1YTU A;  1RT3 A;  4OKE A;  4DTX A;  3SQ2 A;  1CZB A;  4XIU A;  3MXI A;  3AVB A;  4N56 A;  3LAN A;  2FBY A;  3DLE A;  4F2R A;  2IDO A;  3LAK A;  1KCF A;  4ID5 A;  5J2Q A;  1ZBF A;  4CK1 A;  4CJP A;  3LDS A;  3VQ4 A;  4FM0 A;  1GOC A;  1BIZ A;  3QIO A;  3NDK A;  1R0A A;  1TL1 A;  3DLB A;  1UWB A;  3OJS A;  1U49 A;  5DMR A;  4DFJ A;  2LSN A;  3AVF A;  3A2F A;  1RTD A;  2F8S A;  1WSE A;  1JLQ A;  1WSF A;  3HPH A;  3KLF A;  3NFA A;  4CEZ A;  4AHS A;  3SV3 A;  4ID1 A;  1RBV A;  1VSK A;  3VQ8 A;  5C24 A;  4DTJ A;  4DTP A;  4E7K A;  1LWE A;  4HCB A;  4RG8 A;  4CJW A;  2P1J A;  2Z1J A;  2YNI A;  3F73 A;  1FKO A;  4DQP A;  4FK2 A;  1ZBL A;  1XI1 A;  4CEB A;  1D5A A;  1RTJ A;  4BE2 A;  3V6D A;  2BGG A;  2HNY A;  5T7B A;  4BDY A;  4DLE A;  4B9U A;  2O4G A;  2VWJ A;  4KI4 A;  3ZSV A;  4B08 A;  1QSL A;  3C6U A;  2ITG A;  1T8E A;  2VG5 A;  4JLH A;  2HHS A;  3O3H A;  1QSY A;  1VK0 A;  2OA8 A;  1EET A;  1RTI A;  3KIO A;  3HPO A;  4FZY A;  3QLH A;  2KZM A;  1JLB A;  3ZCM A;  4CHY A;  4CJR A;  1KRP A;  3SQ4 A;  4CEE A;  4Z4I A;  3D45 A;  5KRT A;  4CJ4 A;  1IH7 A;  1RDC A;  3DOK A;  4CGG A;  4B9S A;  4B9T A;  1TAU A;  3S9H A;  3NH0 A;  3K58 A;  1K6Y A;  1TKT A;  3ZT2 A;  5FRN A;  1IKW A;  1KVC A;  3AA5 X;  4FYD A;  1C0M A;  4GVM A;  1N6Q A;  4IG3 A;  3QES A;  4FJK A;  3TAG A;  3QEV A;  4ZTF A;  3NAE A;  3V81 A;  3ALY A;  1RCH A;  3LZI A;  3EY1 A;  4DSE A;  1CXQ A;  1DTT A;  1SV5 A;  1W9H A;  3MEC A;  1GOA A;  4Z4C A;  1SKW A;  4KB1 A;  4TSX A;  3MXJ A;  5FRO A;  3KLH A;  3AA4 A;  4I2Q A;  4FLZ A;  4AHV A;  3F9K A;  1U48 A;  3M8S A;  5CY4 A;  4FLV A;  1T7P A;  3VQ5 A;  2VWK A;  1JL1 A;  3HJF A;  2QK9 A;  1L3S A;  1FK9 A;  4QCL A;  1KLN A;  4KV8 A;  4KHY A;  3DLR A;  1TV6 A;  4NYN A;  3MXM A;  1S1T A;  4OPK A;  4FLX A;  1XWL A;  4E7J A;  3DI6 A;  2OZM A;  3LP1 A;  2HHX A;  1NJY A;  3DLG A;  4W5Q A;  4KHW A;  4Z4E A;  4J2B A;  4LH5 A;  4CIE A;  2FBX A;  3L8B A;  1ZBH A;  4KI6 A;  3QER A;  1LW2 A;  1S1X A;  2YNG A;  2BE2 A;  2X6S A;  3T1A A;  4M42 A;  3PV8 A;  1RT1 A;  1UAX A;  4E1N A;  2YNF A;  4BWJ A;  4Q0B A;  1VSJ A;  1HRH A;  1GOB A;  3WNH A;  4M3U A;  1RNH A;  3OY9 A;  3VA3 A;  1S6Q A;  3VQP A;  2FBV A;  1TK0 A;  1C0U A;  4KHS A;  3V9U A;  5J2P A;  1Y97 A;  4N47 A;  3TAN A;  3ZT1 A;  4KPY A;  3QIP A;  4DFM A;  1FXX A;  4FZX C;  3OS0 A;  4J2E A;  2OPS A;  1BQM A;  4C8N A;  4RW6 A;  4DU4 A;  2ETJ A;  3RMA A;  2G8V A;  3HVR A;  3ASM A;  4E19 A;  5CZ2 A;  5J1E A;  1BI4 B;  2B4J A;  4O55 A;  3PO5 A;  4FJ7 A;  3V9S A;  3P1G A;  1RBT A;  4DU3 A;  3HST B;  5HRO A;  3SPZ A;  3EYZ A;  3JSM A;  1A5X A;  3QO9 A;  4FJI A;  1HPZ A;  4E7I A;  2BDP A;  3ZSQ A;  5CZ1 A;  2HHV A;  4FJ9 A;  1RBR A;  1LV5 A;  2KTQ A;  1NK6 A;  5JS1 A;  2KZZ A;  1JKH A;  4Z0U A;  1LWC A;  1RIL A;  4JRP A;  4DSK A;  4KB0 A;  3CYM A;  4JS5 A;  4EP5 A;  1D9F A;  1QS4 A;  4MFB A;  1RBS A;  5HRP A;  3OYD A;  4FJH A;  4DTM A;  3K5M A;  1TK8 A;  3K5N A;  4CEO A;  3AVM A;  3VN5 A;  1LAW A;  1ZYQ A;  4PQU A;  4OVL A;  3VQD A;  3LZJ A;  4I9Q A;  4C8L A;  2OPR A;  1QTM A;  4IBN A;  3SNN A;  4EZ6 A;  4FK0 A;  4F3O A;  2E4L A;  4IDK A;  4PWD A;  3OYA A;  1VSI A;  2P51 A;  3ULD A;  3SV4 A;  1SL2 A;  5EU7 A;  1RT7 A;  3AVA A;  3LP2 A;  4FJG A;  3ZSW A;  4CGH A;  5HP1 A;  1S1W A;  4H4O A;  4JS4 A;  3C95 A;  1LW0 A;  2VG7 A;  3C6T A;  3LPU A;  4DS5 A;  5J2N A;  2XRI A;  4H4M A;  4DSF A;  1NK7 A;  2OPQ A; 
#chains in the Genus database with same CATH topology
 4W5O A;  4FXD A;  2QWM A;  4DTS A;  1QHT A;  3IKM A;  3R3L A;  4Z4H A;  4HWI A;  1NK0 A;  3SMP A;  1NNE A;  3SCX A;  3BEX A;  2KW4 A;  2H3G X;  4PL8 A;  4WYB A;  3OYI A;  4IFE A;  4DHY A;  3QEW A;  1WN7 A;  3OYF A;  5M1O A;  3C65 A;  4I2P A;  2Q0R A;  3WXJ A;  4DSJ A;  4FLW A;  4JKF A;  5AQW A;  3WNG A;  3HYF A;  1QHA A;  3THY B;  3MEG A;  3T19 A;  2G8U A;  1LAV A;  3KHY A;  3ZT3 A;  3CCM N;  1VQ5 N;  4LSL A;  3AVK A;  4KO0 A;  3OS1 A;  3KWI A;  2QKB A;  3RRH A;  1CLQ A;  4E1M A;  3CC4 N;  3C94 A;  2HF3 A;  3CG7 A;  1XNR K;  1IG8 A;  4Q5V A;  3L6Q A;  4CFB A;  5EVZ A;  1Z25 A;  2GX9 A;  2QXL A;  4LF9 K;  1H1V A;  3ZYY X;  3ULE B;  1SAZ A;  2D1K A;  2KQ2 A;  4OGE A;  1SKR A;  4DSL A;  3O9T A;  2XY5 A;  1QE1 A;  3KJV A;  3NF6 A;  1EO1 A;  4AIL C;  1GLB G;  4CK3 A;  4HUG A;  4PY5 A;  3HP6 A;  1RDD A;  4A2A A;  4A59 A;  4IJN A;  3UKR B;  4DS4 A;  1NBW A;  4DLG A;  3I56 N;  1N8R O;  4H0X B;  4IEI A;  2Z1I A;  2P9N B;  1TUY A;  3ENO A;  4CZF A;  3OYM A;  1D8Y A;  1Q8I A;  4YOU A;  3FFI A;  2JWL A;  3DLK A;  3L2U A;  3OYH A;  3TAR A;  5GAG P;  3FZL A;  4DU1 A;  5LL6 Z;  4DV5 K;  5BR8 K;  4R5P A;  4WE1 A;  3BP8 A;  1HMV A;  3L3U A;  4BRP A;  4BRE A;  2PY5 A;  3KK7 A;  1QZ5 A;  1E4F T;  4CBW A;  3ZT4 A;  4OLB A;  4CEC A;  3CC7 N;  2DY4 A;  3KK1 A;  1NK9 A;  3AVJ A;  1A5W A;  1YVU A;  3IFR A;  4DQS A;  2D0A A;  4KAZ A;  3O5B A;  3V1Q A;  4CIG A;  2ASO A;  1EP4 A;  1XMQ K;  4DR7 K;  3O4Q A;  4LSN A;  1HNZ K;  3MK6 A;  5LJV A;  2JLE A;  3HT3 A;  4O0J A;  3TTC A;  5C25 A;  5AQQ A;  3I8D A;  4MDA A;  1Y64 A;  1HQE A;  1ZXO A;  3VOV A;  4DWI A;  4F8R A;  4PKG A;  1QQM A;  3VQQ A;  4DV6 K;  3QNO A;  4O0I A;  3OYE A;  4DR6 K;  3AA3 A;  3HTV A;  2HND A;  1JL2 A;  3ENH A;  3LAM A;  4QAG A;  3OYJ A;  4WQ5 C;  3QEP A;  3EN9 A;  4CEQ A;  1YAG A;  2W41 A;  1T6C A;  3GOI A;  3BF3 A;  1WBB A;  2HST A;  5AJ3 K;  2E2Q A;  4DSI A;  2AA4 A;  2V51 B;  5AQJ A;  4EP4 A;  5JLF A;  5AZJ B;  3HO1 A;  1IBL K;  3QBW A;  1JXB A;  4EHT A;  4FZZ A;  3CQX A;  3TTD A;  3SBG A;  4WFA L;  4FLU A;  4B9N A;  2VWB A;  2NLX A;  4HVJ A;  3HOT A;  4DF4 A;  3TAE A;  3O3F A;  3VEN A;  5HRN A;  2E6L A;  4FK4 A;  3A5L C;  3M8P A;  3BY5 A;  4YOR A;  3SUQ A;  3E9O A;  1SUQ A;  4CJQ A;  3CCV N;  1CZ9 A;  2R7Y A;  4H5V A;  2D0O A;  4NLB A;  4JKD A;  2GEM A;  2GWJ A;  1ZBI A;  3VES A;  1HPM A;  4BR2 A;  4Y1C A;  3VQB A;  1OKJ A;  1YI2 N;  4DFP A;  4PL7 A;  5KPR A;  5FPM A;  1X3M A;  3E9P A;  2W42 A;  4FSV A;  1TYQ A;  4IFY A;  3C6A A;  4CJE A;  4OKJ A;  4X62 K;  4H8K A;  1YF5 L;  4CIF A;  1BHL A;  4CHQ A;  4C8O A;  2KFN A;  1HKC A;  1DEJ A;  4CF2 A;  1TAQ A;  4CE9 A;  3RWU A;  1ITG A;  1M90 O;  3T7Z A;  4X65 K;  4JKG A;  3H3O B;  2W6L A;  3SAH A;  2RE2 A;  5CYQ A;  1B9F A;  5F1X A;  5LY3 A;  3CCU N;  2QWQ A;  3NE6 A;  4BR7 A;  4UQG A;  3RR7 A;  1VSD A;  3I55 N;  4CER A;  1NK8 A;  1KSP A;  3AV9 A;  4M45 A;  2O8D B;  2P9I A;  3OJU A;  4X64 K;  3O9Q A;  1JLC A;  2O8C A;  2WBN A;  4DMN A;  4J2D A;  5CHI A;  4DB3 A;  1RT4 A;  2GUI A;  5AR0 A;  3SYZ A;  4BRA A;  2Q31 A;  4CEF A;  3A5M C;  1XNQ K;  4B8C A;  1C0F A;  4DQR A;  3MX5 A;  3DXK A;  4IDH A;  1KC8 O;  3EE9 A;  5C42 A;  4HTU A;  4KTZ A;  1W7A A;  3S41 A;  3L2W A;  3G0Z A;  3SUN A;  3IS9 A;  2A1S A;  3VF6 A;  3CET A;  4LF5 K;  1S9G A;  2PZS A;  4XIU A;  3DLE A;  4F2R A;  4ID5 A;  3O8M A;  1ZBF A;  4CK1 A;  4BGA A;  3LDS A;  3DLB A;  1RGI A;  3OJS A;  1RTD A;  1VSK A;  3M6G A;  3E66 A;  4HCB A;  5IT9 O;  4FWR A;  2YNI A;  3F73 A;  4FK2 A;  3O80 A;  1VQL N;  3HI0 A;  1XI1 A;  3F5T A;  3ID6 A;  1D5A A;  2DPN A;  5T7B A;  4DLE A;  3ZSV A;  3T1H K;  5KPZ A;  2A3Z A;  5AQV A;  3O3H A;  1EET A;  5AQO A;  2KHO A;  4CJR A;  2IVP A;  4GV9 A;  3SQ4 A;  3THY A;  3VF2 A;  1K8A O;  4ILJ A;  3NH0 A;  1TKT A;  5F2R A;  4FWP A;  4FYD A;  4GVM A;  5FPE A;  2P9K A;  4FJK A;  4BRM A;  3NAE A;  3EY1 A;  3NMU A;  4JD2 A;  1SKW A;  1MWK A;  3ULE A;  3AA4 A;  1U48 A;  3KTQ A;  3BZC A;  4AHV A;  5CY4 A;  3MN5 A;  1JL1 A;  3HJF A;  1FK9 A;  3TSU A;  2YHY A;  4JI4 K;  4KHY A;  4DR5 K;  4OPK A;  2HHX A;  3LP1 A;  3DLG A;  4KHW A;  4J2B A;  4CIE A;  3UKR A;  1S1X A;  4M42 A;  2BE2 A;  4CZL A;  3R6M A;  4DV2 K;  4Q0B A;  1HRH A;  2P9N A;  4GV6 A;  1BOT O;  4JI5 K;  1TK0 A;  4KHS A;  2O8E B;  1NMN A;  3V9U A;  5J2P A;  3ZT1 A;  3QIP A;  1FXX A;  2NRR A;  4FZX C;  3OS0 A;  4LF4 K;  1BQM A;  4XH5 A;  4CZK A;  3PO5 A;  3HVR A;  4FJ7 A;  5CZ2 A;  4UY8 O;  3SPZ A;  3EYZ A;  1EWR A;  2F9W A;  3QO9 A;  1HPZ A;  4DUZ K;  3VEV A;  2BDP A;  2HHV A;  1LV5 A;  1JKH A;  2Q2R A;  1YVN A;  3LDN A;  4JRP A;  2I7N A;  3O1B A;  1S3X A;  1D9F A;  4MFB A;  5HRP A;  3AAR A;  1TK8 A;  4CW7 B;  4BG8 A;  4JYA K;  1ZYQ A;  3HRG A;  3J80 O;  4DUY K;  1JCG A;  4X66 K;  4FK0 A;  3HZ6 A;  3LM9 A;  2E4L A;  3VEY A;  4IDK A;  1VSI A;  2ZM6 K;  2P51 A;  3E9L A;  3ULD A;  3SV4 A;  1RT7 A;  2P9U B;  1N36 K;  3LP2 A;  1GLA G;  5JIC A;  3C95 A;  1LW0 A;  3C6T A;  4DS5 A;  4IOX A;  1TL3 A;  3B8A X;  3W3D A;  3AVI A;  4A61 A;  3D2E B;  4IOC L;  1UOC A;  2X74 A;  4M3X A;  3DLL L;  3CHW A;  1NGF A;  4Z4G A;  1C0T A;  4CHO A;  3CM5 A;  1F21 A;  4KRE A;  3SJH A;  1VRT A;  4CHN A;  3V4I A;  3H08 A;  1YXQ A;  4RWT A;  1HNV A;  2UUC K;  4O44 A;  2WFB A;  2PYJ A;  3ZLJ A;  2Q36 A;  2ZJQ L;  3P31 A;  1RDB A;  4JKB A;  4HHT A;  3VEZ A;  3CJ1 A;  3AAP A;  3G10 A;  3OYB A;  3P39 A;  4BY9 C;  5AZJ A;  4B3S K;  3ENB A;  3H6E A;  4B9L A;  3SPY A;  1FW6 A;  4RCH A;  1NK5 A;  1O13 A;  4CES A;  3PUF A;  4ZHR A;  1KFD A;  4K8Z A;  3CCL N;  1ILY A;  5GAH P;  4GY2 B;  3LDL A;  1NLV A;  4NLC A;  1KXP A;  2CGJ A;  3SLC A;  1VSH A;  5DK5 A;  1XHZ A;  1GLD G;  4CHP A;  4CK2 A;  4KH5 A;  4CZH A;  4FL9 A;  1N5Y A;  3WEE B;  2VG6 A;  4CJF A;  1T05 A;  4F4K A;  2OYQ A;  3SK3 A;  3THW B;  2HB5 A;  4FCY A;  4N76 A;  3Q7B A;  4CJV A;  1T03 A;  3U4L A;  3OA9 A;  4FM2 A;  2ITM A;  3VEO A;  4WCE L;  3ZX0 A;  1QQC A;  2AP1 A;  2V52 B;  4FVM A;  1X9J A;  3FZM A;  5BN8 A;  2D0P A;  3QEI A;  2D5R A;  2VQE K;  4BC4 A;  2P9S A;  2EX3 A;  1JLF A;  4E0D A;  4L3Q A;  3O1W A;  4O4G A;  3K0S A;  4OPJ A;  4KBO A;  1HNI A;  2E1Z A;  3HP9 A;  4KKO A;  3OW2 M;  2RF2 A;  3U9D A;  3NH2 A;  3NF8 A;  4BRL A;  4FW1 A;  3L2V A;  3SJJ A;  3K2P A;  5DM7 L;  1VRU A;  3D6R A;  4U7B A;  4JNE A;  2O8D A;  1E4G T;  4E3S A;  5BPN A;  4L8R B;  2WC9 A;  3HPG A;  2DFH A;  3UIQ A;  4PKI A;  4B9V A;  3QIN A;  4DR4 K;  2QWP A;  4DTO A;  3DRR A;  4B3O A;  1EQY A;  3I33 A;  1R59 O;  2FXU A;  3ZEU B;  3R1X A;  4CEA A;  5KTQ A;  3LWL A;  3V9X A;  4YDU C;  3U8X A;  1BU6 O;  3N4Q A;  3NF9 A;  3RMC A;  4CJ7 A;  4AHR A;  3TAM A;  4HUE A;  3LM2 A;  1K8K B;  4YOY A;  2E2P A;  3L2Q A;  1Q81 O;  3KD5 E;  4EZ9 A;  3WXL A;  1X1P A;  3U3G A;  3O4W A;  3OYN A;  2QWR A;  1MDU B;  3G25 A;  3AO1 A;  3MWT A;  3QFP A;  3V9W A;  4DFK A;  4AHU A;  5AQP A;  3CC2 N;  3THX B;  4CJU A;  5JVH L;  1RDA A;  5CYM A;  3P5J A;  1N32 K;  3B6P A;  1C1C A;  1P90 A;  3KK3 A;  3IRX A;  2JGU A;  5JLH A;  4DTU A;  3H1Q A;  3HOS A;  1A5V A;  3QEX A;  4C8K A;  3P83 D;  3C7N B;  1NGI A;  5C0Y A;  4AM6 A;  2KFZ A;  5AQU A;  3MED A;  3PY8 A;  2P9P B;  4RW4 A;  1DLO A;  1NKB A;  2OCE A;  4OX9 K;  5AQL A;  1Z05 A;  3KKS A;  2O8F B;  2VQF K;  3CQY A;  1QVG M;  2GTD A;  4YDU A;  2QKK A;  2FC0 A;  3C6H A;  3TWH A;  5AFU A;  4YFU A;  5KPT A;  3WXM B;  2NRT A;  2Q3S A;  4AHT A;  3L4I A;  3DLH A;  3UKU B;  3QNN A;  4Z4F A;  2WTU A;  1HQU A;  3NGZ A;  4JI0 K;  3KK2 A;  1L3T A;  5J2M A;  4M3T A;  5FDL A;  3PX6 A;  1KVA A;  4JHD B;  4DQI A;  3J81 O;  4RW7 A;  3DYA A;  3ZET B;  4C1N I;  3RVC A;  4CD1 A;  1HYV A;  3IUC A;  4BRD A;  2GV9 A;  4C8M A;  4CFD A;  1VSL A;  1WSH A;  2X6N A;  4BRO A;  4ICL A;  1KLM A;  3RRG A;  1OH7 A;  2ZGZ A;  1I3A A;  4ISG A;  1ZBS A;  4WQ4 C;  2QXF A;  2HHW A;  3DRS A;  4FLT A;  1EX4 A;  3SBT A;  3L0Q A;  4DV7 K;  2G8K A;  2B6A A;  3K9J A;  4CFC A;  5I3U A;  1J9A A;  1SKS A;  4MDB A;  1UA0 A;  3ZT0 A;  5GAE P;  2RKI A;  5AQT A;  3CXC M;  5HBM A;  1FKP A;  3VQA A;  3ZX3 A;  3PX4 A;  5GIN A;  4O5F A;  4KHN A;  3SQ0 A;  1BIU A;  1E3M A;  3SAG A;  1X9M A;  4I6M A;  2O8E A;  1WSJ A;  2G8F A;  1KFS A;  5BPL A;  3AGR A;  4H5T A;  3TR8 A;  4FJX A;  1YIT N;  1XQS C;  3ATU A;  4CJT A;  1RT6 A;  1VQ9 N;  1SS6 A;  3O4N A;  1RT5 A;  4NCB A;  2HOE A;  3AO4 A;  4ELT A;  2NZT A;  1Q7Y O;  4CZI A;  4KTW A;  2IC3 A;  4CJS A;  1OH8 A;  4M63 C;  4WQ4 A;  3WNE A;  3VQ9 A;  3T1Y K;  3F2K A;  4G1Q A;  5IWA K;  1HJO A;  1DKG D;  3OS2 A;  1EKE A;  1P8Z A;  1YTU A;  4OKE A;  3MXI A;  3JAM O;  1BA0 A;  2IDO A;  1Q86 O;  5BPM A;  5J2Q A;  2VYP A;  4CJP A;  2D4W A;  4EAH D;  4R79 A;  1BIZ A;  3H46 O;  3QIO A;  4LF6 K;  5DMR A;  2F8S A;  1JLQ A;  3NFA A;  2JWK A;  4E7K A;  1LWE A;  2Q0U A;  3FFK B;  3D2E A;  2P1J A;  2YHX A;  4B3M K;  4DQP A;  4DV1 K;  2GUP A;  4CEB A;  1C0G A;  1DGK N;  3V6D A;  1YJW N;  2BGG A;  2HNY A;  4FWN A;  4H5W A;  5DM6 L;  4EHU A;  3C6U A;  3UE5 A;  2YX6 A;  4JLH A;  1MWM A;  3FR0 A;  2IVN A;  2OA8 A;  1QQO A;  4H0P A;  1RTI A;  3KIO A;  4FZY A;  3QLH A;  4CI6 A;  4IWV A;  2UXB K;  4JKA A;  3D45 A;  3J7Z O;  1HNX K;  4GV3 A;  1TAU A;  3S9H A;  3BF1 A;  3K58 A;  1K6Y A;  3GL1 A;  4JI8 K;  2PBD A;  5AZI B;  2YJF A;  3TAG A;  5EOY A;  3TSQ A;  3V81 A;  1RCH A;  1CXQ A;  4Z4C A;  4TSX A;  4EFH A;  1NMD A;  4H0Y B;  1HR0 K;  2QK9 A;  4B3T K;  1NGG A;  1L3S A;  5C2F A;  4OPH A;  3D2F B;  4NYN A;  1S1T A;  4E7J A;  3CPE A;  4B1U B;  1NJY A;  4Z4E A;  5AQZ A;  3P38 A;  3L8B A;  3QER A;  5M1N A;  1LW2 A;  2X6S A;  3T1A A;  5FPD A;  1RT1 A;  3PV8 A;  5LMN K;  3CCJ N;  4BWJ A;  3THW A;  1QZ6 A;  1GOB A;  1RNH A;  3VA3 A;  2FBV A;  1Y97 A;  3TAN A;  1WUA A;  5M1P A;  3VEX A;  4C8N A;  4RW6 A;  4DU4 A;  2G8V A;  2FSN A;  1QVF M;  2UXD K;  1BI4 B;  2B4J A;  2QA4 N;  5HRO A;  1RBT A;  1GLL O;  3A5N C;  4FJI A;  4DR2 K;  4XH1 A;  4K42 A;  5CZ1 A;  4CVN E;  3KZB A;  1NK6 A;  4Z0U A;  4DSK A;  3CYM A;  4BVO A;  1QS4 A;  4DTM A;  3K5M A;  3K5N A;  3AVM A;  4OPA A;  4BC2 A;  4OVL A;  4C8L A;  2FSK A;  3IMX A;  5AQK A;  4BQL A;  4EZ6 A;  3MN6 A;  3OYA A;  4JK7 A;  4JI7 K;  4XH4 A;  1SL2 A;  4M7Y A;  4FWQ A;  1M1K O;  4FJG A;  3MN9 A;  3AY9 A;  5HP1 A;  1S1W A;  4H4O A;  3VEW A;  4DR1 K;  1WBD A;  4YOW A;  4YOX A;  1NK7 A;  2FSJ A;  1EWQ A;  2ASP A;  3VTI A;  2OPQ A;  4Y1D A;  4KHQ A;  4BAC A;  2DTU A;  4DQQ A;  1KAX A;  2DFE A;  3ZEU A;  1LWF A;  4LFB K;  3M8R A;  1S22 A;  2ZE2 A;  5AFU H;  2HHQ A;  2WON A;  4W5T A;  3RMD A;  1JXE A;  4CZE A;  3EE8 A;  3CFR A;  4N41 A;  4E89 A;  3EKU A;  3BZK A;  3TI0 A;  2F8T A;  3SMS A;  3BUZ B;  1KVB A;  5BRF A;  4G9Z A;  1S72 N;  3K59 A;  4CZJ A;  4BQZ A;  2F7T A;  4IG0 A;  4NO7 A;  2ZF5 O;  4CGJ A;  3TAQ A;  3B6O A;  5HRS A;  1J5O A;  3CJC A;  4BRF A;  3THX A;  3CD6 N;  3L3V A;  4CZG A;  3LL3 A;  5ELZ A;  1ZC6 A;  3QET A;  3HVT A;  1NKC A;  5I42 A;  3V9Z A;  4ISF A;  4YOT A;  3OYC A;  1L5U A;  4LY7 A;  3R8E A;  2Y1J A;  1VQN N;  2IAJ A;  1J6Z A;  3C7N A;  1U2V B;  3NGY A;  3LDP A;  2FBT A;  2G8W A;  5F0X A;  3U9Z A;  3AA2 A;  1NGJ A;  4MO5 A;  1S1U A;  1YJN N;  3BGR A;  5SZT A;  3MDQ A;  1B9D A;  1TKD A;  3OYL A;  1BWF O;  3S3M A;  4BR5 A;  2HMI A;  1UA1 A;  2Z1H A;  1XMO K;  2A5X A;  3CM6 A;  1BCM A;  1VQM N;  3DRP A;  2HVI A;  4O8U A;  3WXI A;  4M3Y A;  1EXQ A;  4CF0 A;  4MLE A;  4FJL A;  3I0R A;  5AQN A;  3M5R A;  3VGL A;  4I7F A;  3KVG A;  3LDQ A;  3KLE A;  4FW2 A;  2BAN A;  2BH1 A;  5AQS A;  3ZET A;  1VQ7 N;  1VQP N;  3IDH A;  3PIP L;  1I39 A;  4PKH A;  4LFA K;  2EWS A;  4NCA A;  4M7X A;  2BUP A;  3EO3 A;  4A2B A;  5HOO A;  2PYL A;  3TPQ A;  3LP0 A;  4JRQ A;  2XY8 A;  2YJE A;  4FM1 A;  1S1V A;  3NH1 A;  2HNZ A;  1G15 A;  4ELV A;  1WOQ A;  1OH5 A;  5KRS A;  2HW3 A;  3ZSR A;  1RBU A;  1U04 A;  3VQC A;  1TGO A;  3L4Q A;  1BCO A;  4CF8 A;  3EZ5 A;  3SQ1 A;  2YHW A;  1WNS A;  2Z1G A;  2I5J A;  4C1N K;  2P5G A;  2IS3 A;  1IO2 A;  1CZA N;  3FE1 A;  4H03 B;  5FRM A;  2YHA A;  4QS7 A;  2Y1I A;  4IO8 A;  3GDQ A;  1KQS M;  1XHX A;  4QS9 A;  1IJJ A;  4LH4 A;  4OGC A;  3AAQ A;  3LDO A;  5C10 A;  1ASW A;  1O1W A;  3QB0 A;  3SUP A;  3MEE A;  1Q82 O;  2WUS A;  5ADX A;  5M1F A;  2AJQ A;  4CJK A;  4B3R K;  1WLJ A;  5AQF A;  4H0O A;  4FWK A;  1VSE A;  4BRN A;  4BE1 A;  3E01 A;  2A41 A;  1X9W A;  4MQ3 A;  1D4X A;  3WQU A;  4QS8 A;  3HSC A;  3NHG A;  2GWK A;  3H45 C;  4CHZ A;  3EKS A;  5AQY A;  4GMJ B;  1BIS A;  4JK8 A;  3WT0 A;  4LF8 K;  5AQX A;  3PLA A;  4M3Z A;  3QFU A;  2DFF A;  4GKJ K;  1VSF A;  5AQR A;  1K73 O;  2CH6 A;  5KGW A;  3TU5 A;  2NUB A;  1S6P A;  1TKX A;  2G8I A;  2HHT A;  3FLC O;  1QQN A;  4JN4 A;  4B9M A;  3EEQ A;  2E6M A;  2W40 A;  3GG4 A;  2P5O A;  2GEL A;  4BDP A;  4CJL A;  3KLI A;  2F4V K;  3ZSY A;  3G6E N;  3ZSO A;  1TYQ B;  3PSI A;  2EHG A;  4JI3 K;  2NRZ A;  1ZBU A;  3LWM A;  3KKR A;  4BR0 A;  4QOZ B;  4LFC K;  3CJ7 A;  4MO4 A;  3O6W A;  5AZI A;  4DR3 K;  1CXU A;  1HYS A;  1BUP A;  4AHC A;  3SAF A;  2G8H A;  2HHU A;  1U45 A;  5CR4 A;  3O9R A;  4JKG B;  4KFB A;  4N5S A;  1IV0 A;  4GW6 A;  5E41 A;  3MN7 A;  3DM2 A;  1NJI O;  1WAJ A;  4ILH A;  5KGX A;  2E8A A;  3O3G A;  5TKW A;  4C23 A;  3V1R A;  1NGB A;  3WXK A;  4FLY A;  2D0B A;  4NYF A;  3TTF A;  3M8Q A;  2O8C B;  2YKN A;  1JLE A;  4F2S A;  3BDP A;  5EXW A;  4FJ8 A;  4J8F A;  2UUB K;  3DOL A;  3LAL A;  3FZH A;  3DMJ A;  1ATN A;  2V7Z A;  3KLG A;  3HM9 A;  3FGU A;  3CJ9 A;  1KTQ A;  1NGE A;  2QWO A;  3DXK B;  4IO9 L;  3SI6 A;  4PA1 A;  4DG1 A;  3K5L A;  2HVH A;  1VSM A;  1BI4 A;  4CJ3 A;  3CI5 A;  4BC3 A;  2XHB A;  4FJ5 A;  2F96 A;  4DV4 K;  4IOA L;  3OVN A;  1T3V A;  4FWO A;  4B1V A;  5TKY A;  4RW8 A;  1IKX A;  4BE0 A;  2W6K A;  1J5E K;  3P4I A;  4HUF A;  1U6Z A;  2BTF A;  1MU2 A;  5AQH A;  1HLU A;  5C12 A;  2X78 A;  2KKZ A;  1BG3 A;  2A1R A;  1RT3 A;  3AVB A;  5M1K A;  3LAN A;  2FBY A;  4PHT X;  1SZ2 A;  3LAK A;  2F9T A;  4FVU A;  4FM0 A;  3NDK A;  1TL1 A;  1UWB A;  4LF7 K;  4DFJ A;  3AVF A;  3A2F A;  1WSF A;  3HPH A;  3KLF A;  4CEZ A;  5KQD A;  4AHS A;  4ID1 A;  5C24 A;  4RG8 A;  2E88 A;  4FWL A;  1OH6 A;  1ZBL A;  3H1V X;  1RTJ A;  3O9U A;  4FOE A;  1K9M O;  2O4G A;  5BRE A;  1QSL A;  1T8E A;  2ZWH A;  4AQY K;  2HHS A;  1VK0 A;  3QIC A;  2NNW A;  2KZM A;  1KRP A;  1XUP O;  3PIO L;  2A6A A;  4YHH K;  1RDC A;  3DOK A;  4JI2 K;  4B9T A;  2P9K B;  5FRN A;  1KVC A;  3AA5 X;  4JD2 B;  4IG3 A;  4JI6 K;  3QEV A;  4ZTF A;  3H3N O;  3ALY A;  2HF4 A;  1NM1 A;  1SV5 A;  1W9H A;  1VQ4 N;  1GOA A;  1U2V A;  1IBK K;  1HKB A;  1NGC A;  3OHR A;  1T7P A;  3VGM A;  2VWK A;  1HX1 A;  1KLN A;  4OO1 J;  1MA9 B;  4Z94 A;  2OZM A;  3DI6 A;  4LH5 A;  2FBX A;  3FZF A;  4KI6 A;  1UAX A;  2YNF A;  1VSJ A;  5LJW A;  1BA1 A;  3WNH A;  4M3U A;  5AQM A;  5GIO A;  3VGK A;  1S6Q A;  4B9Q A;  5ADX H;  4K25 A;  4N47 A;  4KPY A;  3AGK A;  4DFM A;  2HBJ A;  3CME N;  3CF5 L;  3G4S N;  3RMA A;  4E19 A;  5J1E A;  2CH5 A;  3V9S A;  4KHP K;  4FWS A;  3HST B;  1A5X A;  4E7I A;  4MLH A;  1VQK N;  3ZSQ A;  1NGH A;  4IXC A;  4FJ9 A;  1RBR A;  4E1J A;  3WUH A;  3R9P A;  4JK9 A;  1RIL A;  3CIP A;  4KB0 A;  2QWN A;  4ISE A;  4JS5 A;  4EP5 A;  3OYD A;  4FJH A;  4CEO A;  2ZJR L;  3VN5 A;  1YJ9 N;  1QTM A;  3SNN A;  4PWD A;  4Y0W A;  3CPW M;  1OVY A;  4BRI A;  2P9L B;  3AVA A;  3K9K A;  3EL2 A;  5I9E B;  3ZSW A;  5J2N A;  3LPU A;  3U6F A;  4H4M A;  2J4R A;  4DSF A;  5D3G A;  2NRV A;  4IFV A;  2P9U A;  3KD1 E;  4LC9 B;  4PUO A;  4IKF A;  4ILG B;  3AVG A;  4RW9 A;  3RSE B;  4BDZ A;  1RDW X;  5AQI A;  3WNF A;  4FJN A;  1T44 A;  3A5O C;  4AM7 A;  3JXU A;  4CGF A;  1Q9Y A;  3NF7 A;  4NCG A;  2UYT A;  2O8B B;  4BC5 A;  1BDG A;  5M1Q A;  3S3N A;  1VQ8 N;  4FPB A;  4M41 A;  1NJZ A;  5A2Q O;  3I0S A;  1ASV A;  2IOC A;  1BO5 O;  2QI2 A;  3GE1 A;  3M1F A;  4K8X A;  3J7Y P;  4ZTJ A;  1ATR A;  2ZQB A;  1BGX T;  3TAB A;  1SQK A;  4B1X B;  3S3O A;  4BRK A;  1JJ2 M;  3AVN A;  3UB5 A;  3HXM A;  3VQ6 A;  1ESV A;  1YTA A;  2ZD1 A;  4WFB L;  2XO7 A;  3D0P A;  1RT2 A;  2OZS A;  3K5O A;  4IJA A;  4A5A A;  4XEI A;  4BWM A;  3SUO A;  3Q7C A;  5C15 A;  2B5J A;  3IAY A;  3CER A;  1Z26 A;  5BRD A;  3MAQ A;  4FJM A;  1BQN A;  3CFO A;  3V1O A;  3RTV A;  3DXM B;  1N34 K;  4IZ9 A;  4EIA A;  2CGK A;  5FLX O;  5K14 A;  4E7L A;  3T3F A;  4WQ5 A;  3E1Y A;  3O9S A;  1X9S A;  1D9D A;  4H5R A;  1QSS A;  2RPI A;  3AVL A;  3WEE A;  1NG9 A;  1NU0 A;  3ITH A;  1WAF A;  3AO3 A;  1DT9 A;  2OAN A;  3TAP A;  3CQ8 A;  3NBP A;  5H1S Q;  3HBT A;  5HLF A;  3HK2 A;  2P9S B;  4NB4 A;  1C6V A;  2NRH A;  4K41 A;  1ATS A;  4B8A B;  4DCH A;  4GKK K;  2YCH A;  3N4P A;  1T6D A;  1YT3 A;  2XY7 A;  4M3R A;  1DTQ A;  4KRF A;  4A57 A;  4BR4 A;  1NJW A;  3MWP A;  2HMP A;  3VQE A;  1SL1 A;  3OYK A;  1XC9 A;  2XY6 A;  4KH4 A;  2E20 A;  1ASU A;  3VF4 A;  3W0L A;  4KHU A;  1KD1 O;  1B92 A;  3JYT A;  1S5J A;  3KWG A;  3HM8 A;  1TKZ A;  1IBM K;  2WOM A;  4V19 S;  3ZSZ A;  2GBZ A;  2CGL A;  1J54 A;  5BR9 A;  3ISN C;  5KI6 A;  4CBX A;  5GIP A;  1YHQ N;  4HCC A;  3AO2 A;  1IG9 A;  5JMV A;  1REV A;  4GNI A;  4E7H A;  1V4S A;  3ZSX A;  3QDK A;  4CGI A;  3CCE N;  1OVQ A;  4CD3 A;  3SZ2 A;  4CF1 A;  5BRH A;  4DV3 K;  2IGI A;  3AVC A;  1GLJ O;  5JS2 A;  3VA0 A;  1YIJ N;  3G71 N;  3MCP A;  4BG9 A;  3AVH A;  3CFP A;  2RN2 A;  3CCR N;  1SL0 A;  5SWM A;  2E5L K;  4H0V B;  4NXN K;  4O5B A;  1HNW K;  1L3V A;  3ZX2 A;  2O4I A;  2ATQ A;  1K8K A;  3VQ7 A;  3PO4 A;  3DAW A;  3DWL A;  1JLA A;  2YKM A;  1TK5 A;  3LP3 A;  3U3Y A;  1Q18 A;  2IVO A;  4CJ5 A;  4OLA A;  1GLE G;  2I7P A;  2QWL A;  4AH9 A;  5AQG A;  4O8K A;  2ASM A;  3L2R A;  4OJR A;  2OPP A;  4DTR A;  1NOY A;  5EY4 A;  4CF9 A;  4BRQ A;  4CZM A;  4W5N A;  1I94 K;  4LD0 A;  3NVK A;  2YHB A;  4OKK A;  5E26 A;  1S9E A;  4I9L A;  3THV A;  5B8H A;  2HBK A;  3WQT A;  5HL7 L;  1VQO N;  3VET A;  1NOZ A;  2P9P A;  4CED A;  3OBY A;  5FPN A;  1NGA A;  3NGI A;  4CGD A;  2RHK A;  1VQ6 N;  1RFQ A;  5CE3 A;  3K57 A;  4BRC A;  4CBU A;  1WSG A;  3HL8 A;  4K0K K;  3MMV A;  4CFA A;  3PX0 A;  2O8F A;  1Z6R A;  4M3W A;  1VAZ A;  3OYG A;  4U67 L;  4K43 A;  2D0C A;  1NKE A;  1W0H A;  4JV5 K;  1JLG A;  4FPA A;  1WB9 A;  1Q9X A;  2QM1 A;  4ELU A;  3C0B A;  2YNH A;  1U47 A;  2HHH K;  3UKU A;  1HYZ A;  3OBW A;  5C2D A;  1L3U A;  2Q97 A;  3M3Z A;  3NCI A;  1YUW A;  4GVE A;  3A8Y A;  1RTH A;  1WSI A;  3A0I X;  4NXM K;  4JKC A;  3AO5 A;  4JHD A;  1NWK A;  5EX5 A;  4DQ8 A;  1W97 L;  1G99 A;  3IG1 A;  4W5R A;  1NJX A;  4DF8 A;  3TAF A;  1TVR A;  4YY3 K;  4B1W B;  3JS6 A;  3LPT A;  5BN9 A;  3RMB A;  4H5N A;  4I6M B;  4DV0 K;  4DTN A;  1NK4 A;  1IKV A;  1KAZ A;  4CCH A;  1HJR A;  4YNQ A;  2UU9 K;  1J53 A;  3QBX A;  3TSP A;  4WFN L;  3VER A;  4FJJ A;  4F3T A;  1N33 K;  1BL3 A;  5JVG L;  3RR8 A;  3J8A A;  4YOV A;  1U4B A;  4KTQ A;  1NGD A;  2PAV A;  1IKY A;  1GLC G;  3DJC A;  4J2A A;  2YV0 X;  3FZK A;  4B1Y B;  2ZGY A;  5HRR A;  1C1A A;  2FF3 B;  1C1B A;  2QW9 A;  4DTX A;  3SQ2 A;  1CZB A;  4N56 A;  5E84 A;  2A42 A;  1KCF A;  4HTL A;  1HUX A;  3D7E O;  4BRG A;  3VQ4 A;  1GOC A;  2KLA A;  2P9L A;  1R0A A;  4FOI A;  1U49 A;  4JKH A;  2LSN A;  1WSE A;  3ATV A;  3VMF B;  4RTF D;  3J7A P;  3SV3 A;  2OTJ N;  1RBV A;  3VQ8 A;  4DTP A;  4DTJ A;  3F9M A;  4FWM A;  2QEX N;  2FF6 A;  4CJW A;  2Z1J A;  1FKO A;  2YI1 A;  2E1Y A;  3VPZ A;  2UUA K;  4JI1 K;  4BE2 A;  3RSE A;  4B9U A;  4BDY A;  3O08 A;  1LCU A;  5LMU K;  3CMA N;  2VWJ A;  4KI4 A;  2QTD A;  4A62 A;  4B08 A;  2ITG A;  1V4T A;  2VG5 A;  4KH6 A;  2Q1N A;  1QSY A;  2E2N A;  3HPO A;  2OTL N;  2O8B A;  1JLB A;  3ZCM A;  4CHY A;  4CEE A;  4Z4I A;  2FLO A;  5KRT A;  1JCE A;  4CJ4 A;  1IH7 A;  4CGG A;  4B9S A;  1JCF A;  1HKG A;  4AF1 A;  2IIR A;  3MCA B;  3ZT2 A;  1IKW A;  3ID8 A;  4FO0 A;  1GLF O;  1XC3 A;  1C0M A;  1N6Q A;  2V7Y A;  3QES A;  3OTO K;  3I8B A;  3QML A;  4BR9 A;  3LZI A;  4DSE A;  3MEC A;  1DTT A;  2NRW A;  4KB1 A;  2NRX A;  3MXJ A;  5FRO A;  3KLH A;  3CJB A;  4I2Q A;  4BRH A;  4FLZ A;  3F9K A;  3M8S A;  4FLV A;  2VGM A;  3VQ5 A;  1LOT B;  4QCL A;  4KV8 A;  3DLR A;  1TV6 A;  4B1Z A;  3MXM A;  4JKE A;  4FLX A;  1XWL A;  2E2O A;  4W5Q A;  2UXC K;  3DXM A;  3MX2 A;  2HBM A;  3D2F A;  1ZBH A;  1FJG K;  5KQ8 A;  2YNG A;  2P9I B;  3VTH A;  4IEE A;  4E1N A;  5GAD P;  1X3N A;  2VGN A;  3PSF A;  3CCQ N;  3OY9 A;  4A5B A;  3VQP A;  1C0U A;  3T69 A;  2HBL A;  3NVM A;  4DKW A;  3CJA A;  2ZJP L;  4J2E A;  2OPS A;  3CCS N;  2ETJ A;  3ASM A;  4O55 A;  2A40 A;  3P1G A;  4DU3 A;  3JSM A;  1VHX A;  2VCP A;  4JAX A;  1TUU A;  2KTQ A;  5JS1 A;  2KZZ A;  1LWC A;  4BGB A;  1RBS A;  1W2B M;  2PFU A;  1LAW A;  4PQU A;  3EZW A;  3VQD A;  3LZJ A;  4I9Q A;  5MLC Q;  1KAY A;  2OPR A;  4IBN A;  4F9O A;  4JEP A;  4F3O A;  4H0T B;  4WF9 L;  5EU7 A;  4BVP A;  3GBT A;  4CGH A;  4JS4 A;  2VG7 A;  2XRI A;  1RDU A; 
#chains in the Genus database with same CATH homology
 4W5O A;  4Y1D A;  1TL3 A;  4IFV A;  4BAC A;  4FXD A;  3KD1 E;  2DTU A;  4DQQ A;  3AVI A;  2DFE A;  1LWF A;  1UOC A;  2X74 A;  4M3X A;  4PUO A;  3M8R A;  4IKF A;  4DTS A;  1QHT A;  3AVG A;  4Z4G A;  2ZE2 A;  4Z4H A;  1C0T A;  2HHQ A;  2WON A;  4RW9 A;  4CHO A;  3CM5 A;  4W5T A;  4BDZ A;  3RMD A;  1NK0 A;  1F21 A;  1JXE A;  4KRE A;  3WNF A;  3CFR A;  4FJN A;  4N41 A;  4E89 A;  3TI0 A;  3SCX A;  4CGF A;  2F8T A;  1VRT A;  2KW4 A;  4CHN A;  3V4I A;  1Q9Y A;  3OYI A;  3NF7 A;  1KVB A;  3H08 A;  3QEW A;  4NCG A;  1WN7 A;  3OYF A;  1HNV A;  3K59 A;  4O44 A;  3S3N A;  4I2P A;  4DSJ A;  4FLW A;  4IG0 A;  4M41 A;  1NJZ A;  3I0S A;  4CGJ A;  2PYJ A;  3WNG A;  1ASV A;  2IOC A;  3HYF A;  3TAQ A;  3B6O A;  5HRS A;  1J5O A;  1RDB A;  3MEG A;  3T19 A;  4HHT A;  4K8X A;  4ZTJ A;  2G8U A;  2ZQB A;  1LAV A;  3G10 A;  3L3V A;  3OYB A;  3QET A;  3ZT3 A;  1BGX T;  3HVT A;  5I42 A;  1NKC A;  3TAB A;  5D3G A;  4LSL A;  3V9Z A;  3OYC A;  3AVK A;  4KO0 A;  3OS1 A;  3S3O A;  4B9L A;  3RRH A;  1L5U A;  4LY7 A;  4E1M A;  2QKB A;  1CLQ A;  3C94 A;  3SPY A;  3CG7 A;  1NK5 A;  3AVN A;  2Y1J A;  4Q5V A;  3HXM A;  2IAJ A;  4CFB A;  3VQ6 A;  1Z25 A;  4CES A;  3NGY A;  1YTA A;  3PUF A;  2ZD1 A;  1KFD A;  4ZHR A;  2XO7 A;  3D0P A;  4K8Z A;  2FBT A;  2G8W A;  1RT2 A;  2OZS A;  3K5O A;  2KQ2 A;  4OGE A;  1SKR A;  4DSL A;  4BWM A;  3SUO A;  3AA2 A;  2XY5 A;  1S1U A;  1QE1 A;  3KJV A;  2B5J A;  3IAY A;  1VSH A;  3NF6 A;  5DK5 A;  1Z26 A;  3BGR A;  5SZT A;  3MAQ A;  4AIL C;  1XHZ A;  4CHP A;  4FJM A;  1BQN A;  1B9D A;  4CK2 A;  4CK3 A;  3CFO A;  4HUG A;  3HP6 A;  1TKD A;  4PY5 A;  3V1O A;  1RDD A;  3OYL A;  3RTV A;  1N5Y A;  3S3M A;  2VG6 A;  2HMI A;  5K14 A;  4CJF A;  4E7L A;  4DS4 A;  1T05 A;  1UA1 A;  4F4K A;  2Z1H A;  3T3F A;  2OYQ A;  4DLG A;  1D9D A;  1X9S A;  3CM6 A;  1BCM A;  1QSS A;  2RPI A;  3AVL A;  2HB5 A;  3DRP A;  4FCY A;  4N76 A;  4CJV A;  2HVI A;  4M3Y A;  2Z1I A;  3ITH A;  1WAF A;  3AO3 A;  1EXQ A;  4CF0 A;  3TAP A;  1T03 A;  3CQ8 A;  4FM2 A;  3NBP A;  4FJL A;  1D8Y A;  3OYM A;  3I0R A;  4I7F A;  1Q8I A;  5HLF A;  3HK2 A;  1QQC A;  3FFI A;  3KLE A;  1C6V A;  4FW2 A;  4FVM A;  2BAN A;  4B8A B;  3DLK A;  3L2U A;  1YT3 A;  2XY7 A;  1I39 A;  3QEI A;  2D5R A;  4M3R A;  3OYH A;  1DTQ A;  3TAR A;  4KRF A;  2EX3 A;  1NJW A;  1JLF A;  4DU1 A;  4E0D A;  4NCA A;  3VQE A;  4R5P A;  1SL1 A;  4O4G A;  4WE1 A;  2PYL A;  3OYK A;  1XC9 A;  1HMV A;  3L3U A;  2XY6 A;  4OPJ A;  3LP0 A;  4JRQ A;  2XY8 A;  1HNI A;  3HP9 A;  4FM1 A;  1S1V A;  4KKO A;  3NH1 A;  2RF2 A;  2PY5 A;  2HNZ A;  1G15 A;  4ELV A;  3NH2 A;  1ASU A;  3ZT4 A;  4OLB A;  5KRS A;  2HW3 A;  3NF8 A;  4CEC A;  3ZSR A;  4KHU A;  1RBU A;  1B92 A;  4FW1 A;  3L2V A;  3JYT A;  1U04 A;  1S5J A;  3SJJ A;  2DY4 A;  3KK1 A;  1NK9 A;  3VQC A;  1TGO A;  3AVJ A;  3K2P A;  1BCO A;  1VRU A;  4CF8 A;  1A5W A;  1YVU A;  1TKZ A;  4DQS A;  2D0A A;  3EZ5 A;  2WOM A;  3SQ1 A;  4KAZ A;  3ZSZ A;  3V1Q A;  1WNS A;  2Z1G A;  2I5J A;  4CIG A;  2GBZ A;  4E3S A;  1EP4 A;  1J54 A;  4L8R B;  3HPG A;  2P5G A;  2IS3 A;  1IO2 A;  2DFH A;  3UIQ A;  3ISN C;  3O4Q A;  5KI6 A;  2YHA A;  4HCC A;  5FRM A;  3AO2 A;  1IG9 A;  2Y1I A;  4LSN A;  4B9V A;  3QIN A;  1REV A;  1XHX A;  4DTO A;  3DRR A;  4B3O A;  2JLE A;  4LH4 A;  3HT3 A;  3ZSX A;  4O0J A;  4OGC A;  4CGI A;  4E7H A;  5C25 A;  1ASW A;  1O1W A;  3I8D A;  3SZ2 A;  4CF1 A;  1HQE A;  2IGI A;  3AVC A;  4CEA A;  3SUP A;  5JS2 A;  5KTQ A;  3MEE A;  3LWL A;  3VA0 A;  4DWI A;  3V9X A;  4F8R A;  3NF9 A;  3RMC A;  3VQQ A;  2AJQ A;  3QNO A;  3AVH A;  4AHR A;  3U6F A;  4O0I A;  3TAM A;  3OYE A;  3AA3 A;  2RN2 A;  3CFP A;  4HUE A;  4CJK A;  1SL0 A;  1WLJ A;  5SWM A;  2HND A;  3L2Q A;  1JL2 A;  3KD5 E;  1VSE A;  4EZ9 A;  4BE1 A;  3E01 A;  1X1P A;  3LAM A;  1X9W A;  4MQ3 A;  4O5B A;  4QAG A;  3U3G A;  3OYN A;  3NHG A;  4CHZ A;  3OYJ A;  3AO1 A;  1L3V A;  2O4I A;  3QEP A;  2ATQ A;  4GMJ B;  4CEQ A;  3V9W A;  3VQ7 A;  3PO4 A;  1BIS A;  4DFK A;  4AHU A;  1JLA A;  2YKM A;  1TK5 A;  3LP3 A;  4CJU A;  4M3Z A;  3U3Y A;  2DFF A;  4DSI A;  1RDA A;  1VSF A;  5CYM A;  3P5J A;  4CJ5 A;  4OLA A;  3B6P A;  1C1C A;  4EP4 A;  3IRX A;  3KK3 A;  2JGU A;  4AH9 A;  3HO1 A;  3KTQ A;  3L2R A;  4DTU A;  1JXB A;  5KGW A;  4FZZ A;  4OJR A;  2OPP A;  4DTR A;  2NUB A;  1A5V A;  1S6P A;  4FLU A;  3QEX A;  1NOY A;  4B9N A;  4C8K A;  3P83 D;  1TKX A;  4CF9 A;  4HVJ A;  4DF4 A;  2G8I A;  4W5N A;  2HHT A;  3TAE A;  3O3F A;  5HRN A;  2KFZ A;  2E6L A;  4LD0 A;  4FK4 A;  3M8P A;  3MED A;  2YHB A;  4OKK A;  3PY8 A;  4RW4 A;  1DLO A;  1NKB A;  1S9E A;  3SUQ A;  4B9M A;  1SUQ A;  2E6M A;  4CJQ A;  1CZ9 A;  2R7Y A;  4I9L A;  3THV A;  3KKS A;  1ZBI A;  2P5O A;  1NOZ A;  4CED A;  3NGI A;  4CGD A;  2FC0 A;  2QKK A;  3TWH A;  4Y1C A;  4YFU A;  3K57 A;  1WSG A;  3HL8 A;  3VQB A;  4BDP A;  4CJL A;  3KLI A;  3ZSY A;  4CFA A;  3PX0 A;  4DFP A;  4M3W A;  3ZSO A;  2Q3S A;  4AHT A;  3OYG A;  3DLH A;  2D0C A;  1NKE A;  3QNN A;  4Z4F A;  1HQU A;  1W0H A;  2W42 A;  3NGZ A;  1JLG A;  3KK2 A;  1L3T A;  5J2M A;  1Q9X A;  2EHG A;  4M3T A;  4ELU A;  5FDL A;  2YNH A;  4IFY A;  3PX6 A;  1U47 A;  1ZBU A;  4CJE A;  1HYZ A;  3KKR A;  3LWM A;  4QOZ B;  4OKJ A;  1KVA A;  1L3U A;  4DQI A;  4RW7 A;  3DYA A;  3NCI A;  4H8K A;  1CXU A;  1RTH A;  1HYS A;  1WSI A;  1HYV A;  4CIF A;  1BHL A;  2GV9 A;  4C8M A;  4CFD A;  4CHQ A;  1VSL A;  1WSH A;  2X6N A;  4AHC A;  4C8O A;  2KFN A;  3AO5 A;  2G8H A;  4ICL A;  1KLM A;  1U45 A;  3RRG A;  2HHU A;  4KFB A;  4CF2 A;  4N5S A;  4GW6 A;  1I3A A;  5E41 A;  1TAQ A;  4CE9 A;  3RWU A;  1ITG A;  2QXF A;  3DM2 A;  3IG1 A;  2HHW A;  3DRS A;  4FLT A;  1EX4 A;  1WAJ A;  5KGX A;  3O3G A;  2G8K A;  2B6A A;  5CYQ A;  1B9F A;  4CFC A;  5I3U A;  3V1R A;  3NE6 A;  1J9A A;  4W5R A;  1NJX A;  4UQG A;  3RR7 A;  4FLY A;  1VSD A;  2D0B A;  1TVR A;  4DF8 A;  4NYF A;  3TAF A;  1SKS A;  4CER A;  1NK8 A;  1UA0 A;  1KSP A;  3ZT0 A;  4KHQ A;  3M8Q A;  3AV9 A;  2YKN A;  4M45 A;  1JLE A;  4F2S A;  3LPT A;  3RMB A;  3BDP A;  2RKI A;  4FJ8 A;  5HBM A;  1FKP A;  3VQA A;  3DOL A;  3LAL A;  3OJU A;  4DTN A;  3PX4 A;  1NK4 A;  3DMJ A;  1JLC A;  1IKV A;  3KLG A;  4CCH A;  4KHN A;  4DMN A;  1BIU A;  3SQ0 A;  4J2D A;  3HM9 A;  1HJR A;  1RT4 A;  2GUI A;  4YNQ A;  1X9M A;  1KTQ A;  3SYZ A;  1J53 A;  1WSJ A;  4FJJ A;  2G8F A;  3SI6 A;  4F3T A;  4PA1 A;  4CEF A;  4DG1 A;  1KFS A;  4B8C A;  3K5L A;  2HVH A;  1VSM A;  4DQR A;  3TR8 A;  1BI4 A;  4FJX A;  1BL3 A;  4CJT A;  4CJ3 A;  3RR8 A;  1RT6 A;  1U4B A;  5C42 A;  4KTQ A;  2XHB A;  4FJ5 A;  2F96 A;  3O4N A;  4KTZ A;  4HTU A;  1RT5 A;  4NCB A;  3OVN A;  1IKY A;  3AO4 A;  4J2A A;  2YV0 X;  4RW8 A;  4ELT A;  1IKX A;  4BE0 A;  4KTW A;  2IC3 A;  4CJS A;  3G0Z A;  3L2W A;  3WNE A;  3SUN A;  4HUF A;  3VQ9 A;  3IS9 A;  2A1S A;  5HRR A;  1C1A A;  1MU2 A;  1C1B A;  4G1Q A;  3OS2 A;  1S9G A;  2X78 A;  1EKE A;  2PZS A;  2A1R A;  1YTU A;  1RT3 A;  4OKE A;  4DTX A;  3SQ2 A;  1CZB A;  4XIU A;  3MXI A;  3AVB A;  4N56 A;  3LAN A;  2FBY A;  3DLE A;  4F2R A;  2IDO A;  3LAK A;  1KCF A;  4ID5 A;  5J2Q A;  1ZBF A;  4CK1 A;  4CJP A;  3LDS A;  3VQ4 A;  4FM0 A;  1GOC A;  1BIZ A;  3QIO A;  3NDK A;  1R0A A;  1TL1 A;  3DLB A;  1UWB A;  3OJS A;  1U49 A;  5DMR A;  4DFJ A;  2LSN A;  3AVF A;  3A2F A;  1RTD A;  2F8S A;  1WSE A;  1JLQ A;  1WSF A;  3HPH A;  3KLF A;  3NFA A;  4CEZ A;  4AHS A;  3SV3 A;  4ID1 A;  1RBV A;  1VSK A;  3VQ8 A;  5C24 A;  4DTJ A;  4DTP A;  4E7K A;  1LWE A;  4HCB A;  4RG8 A;  4CJW A;  2P1J A;  2Z1J A;  2YNI A;  3F73 A;  1FKO A;  4DQP A;  4FK2 A;  1ZBL A;  1XI1 A;  4CEB A;  1D5A A;  1RTJ A;  4BE2 A;  3V6D A;  2BGG A;  2HNY A;  5T7B A;  4BDY A;  4DLE A;  4B9U A;  2O4G A;  2VWJ A;  4KI4 A;  3ZSV A;  4B08 A;  1QSL A;  3C6U A;  2ITG A;  1T8E A;  2VG5 A;  4JLH A;  2HHS A;  3O3H A;  1QSY A;  1VK0 A;  2OA8 A;  1EET A;  1RTI A;  3KIO A;  3HPO A;  4FZY A;  3QLH A;  2KZM A;  1JLB A;  3ZCM A;  4CHY A;  4CJR A;  1KRP A;  3SQ4 A;  4CEE A;  4Z4I A;  3D45 A;  5KRT A;  4CJ4 A;  1IH7 A;  1RDC A;  3DOK A;  4CGG A;  4B9S A;  4B9T A;  1TAU A;  3S9H A;  3NH0 A;  3K58 A;  1K6Y A;  1TKT A;  3ZT2 A;  5FRN A;  1IKW A;  1KVC A;  3AA5 X;  4FYD A;  1C0M A;  4GVM A;  1N6Q A;  4IG3 A;  3QES A;  4FJK A;  3TAG A;  3QEV A;  4ZTF A;  3NAE A;  3V81 A;  3ALY A;  1RCH A;  3LZI A;  3EY1 A;  4DSE A;  1CXQ A;  1DTT A;  1SV5 A;  1W9H A;  3MEC A;  1GOA A;  4Z4C A;  1SKW A;  4KB1 A;  4TSX A;  3MXJ A;  5FRO A;  3KLH A;  3AA4 A;  4I2Q A;  4FLZ A;  4AHV A;  3F9K A;  1U48 A;  3M8S A;  5CY4 A;  4FLV A;  1T7P A;  3VQ5 A;  2VWK A;  1JL1 A;  3HJF A;  2QK9 A;  1L3S A;  1FK9 A;  4QCL A;  1KLN A;  4KV8 A;  4KHY A;  3DLR A;  1TV6 A;  4NYN A;  3MXM A;  1S1T A;  4OPK A;  4FLX A;  1XWL A;  4E7J A;  3DI6 A;  2OZM A;  3LP1 A;  2HHX A;  1NJY A;  3DLG A;  4W5Q A;  4KHW A;  4Z4E A;  4J2B A;  4LH5 A;  4CIE A;  2FBX A;  3L8B A;  1ZBH A;  4KI6 A;  3QER A;  1LW2 A;  1S1X A;  2YNG A;  2BE2 A;  2X6S A;  3T1A A;  4M42 A;  3PV8 A;  1RT1 A;  1UAX A;  4E1N A;  2YNF A;  4BWJ A;  4Q0B A;  1VSJ A;  1HRH A;  1GOB A;  3WNH A;  4M3U A;  1RNH A;  3OY9 A;  3VA3 A;  1S6Q A;  3VQP A;  2FBV A;  1TK0 A;  1C0U A;  4KHS A;  3V9U A;  5J2P A;  1Y97 A;  4N47 A;  3TAN A;  3ZT1 A;  4KPY A;  3QIP A;  4DFM A;  1FXX A;  4FZX C;  3OS0 A;  4J2E A;  2OPS A;  1BQM A;  4C8N A;  4RW6 A;  4DU4 A;  2ETJ A;  3RMA A;  2G8V A;  3HVR A;  3ASM A;  4E19 A;  5CZ2 A;  5J1E A;  1BI4 B;  2B4J A;  4O55 A;  3PO5 A;  4FJ7 A;  3V9S A;  3P1G A;  1RBT A;  4DU3 A;  3HST B;  5HRO A;  3SPZ A;  3EYZ A;  3JSM A;  1A5X A;  3QO9 A;  4FJI A;  1HPZ A;  4E7I A;  2BDP A;  3ZSQ A;  5CZ1 A;  2HHV A;  4FJ9 A;  1RBR A;  1LV5 A;  2KTQ A;  1NK6 A;  5JS1 A;  2KZZ A;  1JKH A;  4Z0U A;  1LWC A;  1RIL A;  4JRP A;  4DSK A;  4KB0 A;  3CYM A;  4JS5 A;  4EP5 A;  1D9F A;  1QS4 A;  4MFB A;  1RBS A;  5HRP A;  3OYD A;  4FJH A;  4DTM A;  3K5M A;  1TK8 A;  3K5N A;  4CEO A;  3AVM A;  3VN5 A;  1LAW A;  1ZYQ A;  4PQU A;  4OVL A;  3VQD A;  3LZJ A;  4I9Q A;  4C8L A;  2OPR A;  1QTM A;  4IBN A;  3SNN A;  4EZ6 A;  4FK0 A;  4F3O A;  2E4L A;  4IDK A;  4PWD A;  3OYA A;  1VSI A;  2P51 A;  3ULD A;  3SV4 A;  1SL2 A;  5EU7 A;  1RT7 A;  3AVA A;  3LP2 A;  4FJG A;  3ZSW A;  4CGH A;  5HP1 A;  1S1W A;  4H4O A;  4JS4 A;  3C95 A;  1LW0 A;  2VG7 A;  3C6T A;  3LPU A;  4DS5 A;  5J2N A;  2XRI A;  4H4M A;  4DSF A;  1NK7 A;  2OPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...