2FBWB

Avian respiratory complex ii with carboxin bound
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
b'TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title 3-nitropropionic acid is a suicide inhibitor of mitochondrial respiration that, upon oxidation by complex II, forms a covalent adduct with a catalytic base arginine in the active site of the enzyme.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 69
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2fbwB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2fbwB01
2N0SB 3CWIA 3FC4A 3SR6A 4YTMB 2BS2B 2AX5A 1QF6A 3AMZA 1V8CA 2QJLA 2B76B 1QOFA 1DOYA 1T3QA 1XO3A 1XLPA 5H8YE 1RFKA 2WS3B 3VRAB 1QOAA 1YJIA 2CJNA 3LXFA 3NVWA 1OFFA 1JALA 1E6EB 3P1MA 3SFEB 1FRRA 2G1EA 2WQYB 1E9MA 1RM6C 1J7AA 1ZOYB 1GAQB 4YSXB 2PVOD 2L52A 3PO0A 4KX6B 1NEKB 3VR8B 1FM0D 1KFYB 3CIRB 2MJ3A 2WU5B 1JW9D 3NRZA 5C3JB 1F0ZA 1XLNA 3AE6B 4JWSC 1CJEA 2WU2B 4YT0B 2MJEA 4WWMA 3AEDB 3AE5B 4FXCA 3AEAB 3SFDB 4HROA 1YQ4B 3AH7A 1FO4A 3AV8A 5EE0A 2MJDA 3P4PB 1AYFA 3KWLA 3ZYYX 1TKEA 2KMMA 1H7WA 1ZXIA 3B9JA 3AE3B 1JWBD 5C2TB 4N6EB 1N63A 1L6UA 3AE4B 3AE7B 3VRBB 3HRDD 1QT9A 1NVID 1XLOA 1TJEA 2E3TA 4US8A 3ABVB 3DWMA 2MH7A 2WP9B 1TKYA 1JROA 3B2FA 4US9A 5EE3A 5AUKA 2WDVB 1OQRA 3P63A 4WQMA 2ACZB 1L5PA 1WRIA 2M19A 2JX5A 1GPXA 3AN1A 3ETRA 3CF4A 2CJOA 3AEBB 1SF0A 3AB5A 1L0VB 2WLBA 1AWDA 1PDXA 1PFDA 2EKIA 1B9RA 1XLQA 1R7SA 1ZUD2 2CU3A 3FAHA 4YSYB 1CZPA 4YXDB 1NYRA 1N60A 2W3RA 1FMAD 1DGJA 1J7BA 1GT8A 1JRPA 2DBYA 1N61A 2WDQB 3RPFC 2Y5CA 2OHFA 4C7ZA 2K22A 1A70A 4C80A 1OQQA 3AE1B 2LEKA 3NVYA 1ZP0B 3NVVA 3AECB 3W5VB 1NENB 1RWSA 5GXGB 1VLBA 2Q5WD 4A9AA 1YJJA 3P4QB 3EUB2 1FXIA 3AEEB 1YQ3B 3NVZA 1J7CA 1QOBA 1WXQA 5G5HA 4JX1C 2K9XA 1FXAA 1I7HA 3LB8C 2DWQA 1EWYC 1H7XA 4YTNB 2W3SA 2PVGC 3AM9A 4IDIA 4ZHPA 3B2GA 4YTPB 3BIID 4N58A 1N62A 1IUEA 3AE9B 2BS3B 2H88B 1TKGA 4ZHOA 4HRSA 3HUIA 2H89B 2K5PA 4C7YA 5EE1A 1DOIA 1QLBB 1ROEA 5AUIA 3AE2B 3P4SB 1N5WA 1PUTA 1WWTA 3L4PA 5H92C 3P4RB 1RYJA 3NS1A 1V97A 4YSZB 2W54A 4USAA 2BT6A 1E7PB 3AE8B 3AEFB 1E10A 3VR9B 1FRDA 1TYGB 1UWMA 2FBWB 2PIAA 1QOGA 2W55A 4JWUC 4LTUA 4N59A 1E0ZA 1JQ4A 1JWAD 1SB3C 1GTHA 3HVZA 1KF6B 3WCQA 1FFUA 1VJKA 2JQRB 3W9CB 1WGKA 2BS4B 2WDRB 1FIQA 2PKOA 5MPOA 1VDVA 1N5XA 4P6VF 5EE9A 1FFVA 1DOXA 1SIJA 1KRHA 5G5GA 1WYGA 2L83A 3DWGC 3AEGB 4ITKA 1NI3A 2QIEB 1NYQA 1GTEA 2HTME 2KAJA 3W5UB 1L6VA 2M56B 4ZOHC
chains in the Genus database with same CATH superfamily
3PHXB 3CWIA 4KIKA 2O2VB 2VZKB 4JE3B 2WXRA 2D3GA 2M8SA 4XC2A 1OFFA 3C19A 5D6JB 2I38A 3RN9C 3ZXVA 3MFGA 1WI0A 1KFYB 2MA9B 4JWSC 4YT0B 4HXDA 3TSSA 3ZRCA 3A9KB 1I4XA 2KK8A 3A1QA 3BVMA 4MGKE 3N1XC 2WXPA 4W9KA 2KC1A 2KLGA 3KUZA 3HVDA 4BZAA 1GPXA 1R4NB 2GBKA 3CF4A 3DDCB 3Q8BA 1PQSA 4ZRPA 4B0EA 1KM7A 1CZPA 3VVWB 5L95C 1RRBA 2W3RA 4BFRA 2REXA 2KFKA 4BOSC 3AE1B 3KUCB 1C4PA 1FXIA 3PT2B 2N4FA 4IDIA 1JWSD 3B2GA 2KJHB 4YTPB 4N58A 2WXHA 2BS3B 4LNFA 5BYRA 4ZRQA 3P4SB 1J19A 1RYJA 5IN7A 4S17A 1E7PB 3DCGA 2EMSA 4BOZB 1KLVA 1E0ZA 1Y8RC 1JWAD 1SB3C 1WX7A 4REZA 3O65B 5D3IB 1SGHA 1LGRA 2CKHB 2DZJA 1V1PA 2DZKA 3U7DA 2GBMA 3TUOA 3IVFA 4PS7A 3P42A 2LASA 4OZAA 2NTSA 2KXJA 4GIVA 2L7RA 4G0NB 3ZLZA 1UZXB 3L10B 4MACA 5IP4D 3NVWA 1U4AA 4AOFA 3V6EB 3KVFB 3DBRB 1FXTB 3EHVA 3RYTA 1S3SG 2MQJA 5D3DA 3AE6B 4NJ7A 3AEAB 1FPYA 3Q3MC 2JWUA 3ZYYX 2J53A 4N6EB 4BKSD 1PGAA 1XLOA 2MBOA 2ON8A 5CHFA 4US8A 1MG8A 4NQLB 3WAOA 3T8MA 3Q8CA 4NY0A 3RCZA 2ZEQA 2G4SA 3QX1A 3RZFA 4HPPA 3U7ZA 4JGHB 3V05A 4BKGA 2OHFA 1V6EA 2XNAC 3WANA 4K7WA 1WGRA 3EUB2 1GJZA 2FNJB 3AULA 1WXQA 1V81A 4M0WA 4WWOA 1MFWA 2J4XA 3RNGC 1D5MC 2LFIA 2PTLA 4JPSA 5TSSA 1UWXA 2MSED 2HJ8A 1Y56A 5CTRC 1XCTL 3PPAA 1L4DB 2DX5B 1VRAB 3L4PA 1E8XA 3VFKA 2W54A 1WR6E 4FJZA 1IBXA 1VCBA 2K8HA 2IGGA 4P1BC 2LVPA 3ZRFA 3U2SC 4M8NA 3BY4B 4TMAB 4K3CA 1C78A 4PT5A 2WGSA 3ZJVA 4RM9A 4F7ZA 1GTEA 5JXVA 2Y5BB 4B95A 1OTRB 1T3QA 4ANUA 3BZDB 4GXBA 1T6BX 2G1EA 1XF5L 4KVGB 5TR5A 3ZTCA 1YD8U 1UGJA 2N7EA 4GDLA 1YX6B 3DHIC 3AE5B 2VH2A 4HROA 3UQAA 4WH4A 1GG3A 2ZCBA 5LXIB 4WJOA 1L6UA 2ZCCA 3JW0X 3ECIA 3Q3JA 3ABVB 1PGXA 2KKCA 3WA0A 2BYFA 3A9KA 3P63A 1WH3A 3PRZA 3AN1A 4HJKA 1K53A 3DPDA 1IYFA 4C7ZA 3Q2AC 2MLBA 1V2YA 1GB1A 3QCAA 1VD2A 2IY1B 3WAPA 3OG5A 1P98A 4TQ0A 2FIFA 2DWQA 1EWYC 4YTNB 1M94A 2W3SA 3B08A 1FNWA 2ZPYA 3C8YA 3ZW3A 2AL6A 4DK5A 1V1OA 3AE9B 2KANA 1TKGA 4FN2A 1E7UA 1I4QA 2WXGA 3W2DA 2IO2B 5JH5C 1M4VA 4I6NB 2KMAA 2LI5A 3ZGZA 3AE2B 5KHOA 4W9IA 3TMPB 2W55A 4UDUC 3P2BA 3EECA 4NNJB 1RAXA 3A4SC 3EA6A 1N5XA 1Q10A 1FFVA 1SIJA 2GRIA 3IHPC 2BW2A 3NOBA 2WX0A 5DPRA 4JL9A 1E8ZA 2N0SB 4YTMB 4RFBA 4WWPA 3ZNID 3HIZA 2ICIA 4K1RB 1E6EB 1VZ7A 2WQYB 4RGTA 4AJWA 1NEKB 3CF6E 3IT4B 4LNKA 4HDQA 4HDOA 1WE6A 2K8CA 2KD0A 3IG3A 1TT5B 3QHTA 3L13A 3TCAA 2NMQA 1D6EC 1NVID 2WXQA 3ZO5B 1UBIA 4C00A 4AJYB 3DBHI 3NG0A 3A1QB 2WLBA 3GE3C 2LXCA 1CQVA 4W9DA 3ZTDA 2JZZA 1FMAD 2IPKD 2LWPA 3C0RB 2K8BA 1A70A 2NS5A 3BYTB 5HHDG 2LEKA 1WSPA 3GZNI 1GC7A 2RDHA 3AEEB 4ZDVA 2SAKA 4FADA 2MBQA 2FAZA 2KFKB 1SIFA 1T0RC 2KN4A 4ZHPA 1HA5A 2JUOA 3Q8AA 2WXKA 1SE2A 5JHAA 2K5PA 2MWSB 1QLBB 2BF8B 1E10A 4X57B 2WXMA 4GSWA 3N30A 1LXDA 4CHKA 1D5XC 3RNAC 5I4DA 3RZWC 1EU4A 3VTWA 1QILA 2D5GA 3ML8A 4P6VF 2RDGA 2QIEB 2HJ1A 2KTFA 1UUPA 1LO5D 1SEBD 1KLUD 2MCNB 5AEKB 3ZJUA 2KLCA 4KGRA 2DNFA 1V1PB 2KNBA 5H8YE 2BTEA 3LXFA 3VDZA 1JALA 1RLFA 2YLMA 1ACCA 4YSXB 1BMLC 2MJ3A 4RH6A 3U8ZA 1GNUA 3NRZA 3DVGX 1C79A 1JMLA 4IWOA 2QDFA 3SU8X 2DLBA 1TGZB 3AE3B 4KSKC 2D10A 1ISNA 2BKRB 2MBHA 1BXTA 2BYEA 2M1MA 2KX3A 1LQBA 2IO0B 1UNSA 1B9RA 3VUYA 4YSYB 1NYRA 1I4HA 1L0XB 2K22A 2K6QA 1GB4A 3NVVA 5HFYA 2Q5WD 4WWNA 1WMHA 1L0YB 1KJTA 2NBWB 3ZVVA 3OWEB 1K52A 2CHXA 4BAXA 1K8RB 2IY0B 3SDLC 2N9XA 2OOBB 3RMKC 3KLSX 4FBJB 2N7JA 2JPHA 4DHJD 3APDA 2JY6A 2KHWB 1TYGB 1JQ4A 4LTUA 5CHWA 3T3NA 2K39A 1WGKA 3UF8A 3GZNB 3R7QA 4DDGD 3HK0A 3AEGB 2KWDA 2HTME 4LK0M 2RR9A 3W5UB 4DQOC 1WM2A 1KLGD 1DOYA 1XLPA 1B1ZA 4D2KA 1YJIA 1IGCA 1J0GA 3L54A 5EDSA 4BBNC 1E9MA 1P7FA 1J7AA 4BKSA 2GB1A 2LGIA 1XLNA 2JT4B 2INCC 2NPTB 1ZE3D 4K7UA 4KDLB 3QC8B 1AYFA 1H7WA 4F8CB 4AQ7A 1WXSA 2DAFA 1HXYD 3DVNU 4GDLB 4J6IA 4L2YA 3LYYA 2E3TA 3UGBB 3V6CB 3MHSD 3A9JB 3CMMB 4IWPA 5EE3A 4EE2A 2ACZB 1L5PA 5G2NA 2G45B 4ACFA 4ZRIA 5AZGA 4KDIC 1C4AA 3QQ8B 3FAHA 1NI2A 2DBYA 2BPSA 2WDQB 1RFAA 3GE8C 3KUDB 1YOVB 2LGXA 2KWVB 4NZLB 4WAFA 1HTQA 1WGYA 2KVZA 4MSMB 3EFCA 3R7RA 3M3JA 4LLGM 2WXIA 5JZEB 2KQ4X 2V9HA 1QKZA 5BMGA 1JRUA 5EE1A 4ICVA 1DOIA 1TS2A 3RUIB 4HWIB 4XWWA 3DHHC 2KDFB 3Q8FA 3P4RB 1FRDA 2QSDA 5J2RA 2FBWB 2PIAA 4JWUC 3I9V1 4N59A 1XEEA 2X8XX 1SE4A 3N1ZC 4K3BA 4DXFA 1L7YA 1NI3A 2N1WA 1YN5A 2TSSA 1L6VA 4ZOHC 5FR3A 2KQ7A 2VRRB 2AX5A 3AMZA 2NBUA 1WXMA 5IO9A 2HDEA 1F77A 3N32A 5DCNA 1MHHE 3BK1A 2PE9A 4L1BA 3DBLI 4FXCA 3MJ5A 4FJYA 3L16A 1ZXHA 4NQKE 5EE0A 2K6DB 2QC8A 2L05A 4PS8A 1C9FA 1TS4A 2N1VA 3SHQA 1OEYJ 3QARA 3AE4B 4FA6A 5IOIA 4GGQA 3TJPA 1I4RA 4ANXA 2BWES 1ENFA 1SE9A 4JLCA 5FK9C 1EF5A 1WGHA 2ZVOA 1N60A 1MVKA 4MJSB 3PTFC 4FLHA 2LMCA 1SJHD 3W5VB 5GXGB 3TEWA 1VLBA 5L83A 4FULA 4OZCA 2C5LC 1L2NA 4HCPB 4IG7B 4XE0A 4LDTD 3M63B 3VTVA 2J7QB 1ZGUB 2H88B 2N9KA 2CU1A 5J17A 2M0XA 2CHZA 2INPE 2J42A 2PW9A 4ICUA 5H92C 3AEFB 1TTNA 1EWCA 2EKEC 2N9PC 3I3TB 4KSLC 4KGSA 1KF6B 3WCQA 2J0JA 5LLIA 2WDRB 1FIQA 2PKOA 2Y3AA 5EE9A 2KDMA 3X0WA 1OQYA 2I1KA 3ZDMC 2FIDA 2WDTB 1KRHA 4XGAB 2C7NB 1NYQA 3RNFC 4C56C 2ZW0A 3ML9A 4I6PA 2J52A 2QJLA 1F1HA 1QOFA 5IA7A 1L4ZB 4DXAB 4DHZB 2V4IB 4NAWA 2QMTA 4IM3A 3EFUA 4P1CC 1FM0D 3CIRB 1LM8B 2KMCA 1F0ZA 2WU2B 2RMMA 3SFDB 1MHXA 4S0RA 3J9CA 2IZVB 1ZXIA 2R61A 1C76A 2JVCA 1E90A 1UELA 1YMHE 1IGDA 4II2B 2NPTA 2GOWA 1JROA 5AUKA 2KT7A 2M19A 4L23A 4HEA1 1L0VB 4E3CA 3PVLA 1PFDA 1MG4A 5C1ZA 1D3ZA 3E56A 3HHMA 3A9JA 5AZFA 1J7BA 3RNCC 1PYWD 3ZJTA 2IBIB 4WAAA 3H7PB 2V1YA 3DBLB 2MRPA 2V3SA 1QOBA 4ANWA 4A6QA 4CO7A 1YNTE 2WNMA 3ZNHB 3ZNGC 1SBBB 2D11A 4EFOA 2L76A 1HZ5A 3BINA 3IT6B 1WMHB 4AS1A 3UI3A 2Y5PA 2KTRA 4W9HA 1C3TA 3HM6X 4BBNF 1MPEA 2FE8A 1SXTA 3Q14C 2N7DA 1T0YA 4FHKA 4A55A 2LHEA 4GN1A 2KOXA 2PPHA 5D94A 4ASWC 2JXXA 3QWZB 5HKHA 2RDBC 2C7HA 4RGMA 4DXGA 3MTNB 3OLMD 2BB5A 3ZIMA 2QHOA 1P0RA 1Z2MA 1WJNA 2XBBC 3JSVB 2PJHA 3ZUNA 2MBBB 2LXAA 2SEBD 1KTKA 1YJ1A 3MC0B 2D3CA 4E74A 1YN3A 2L8JA 4ZRKA 4CQNA 4LCDE 2IGDA 4O1NA 5BYSA 2WXNA 2DENB 4XWTA 1R4MI 2JXTA 5LXHA 3KYCD 4AUQC 3Q3OC 2L52A 4GB9A 2K3UA 2ZNVC 1F2RI 2CHWA 1YQ4B 1WF9A 3AH7A 3AV8A 1PGBA 4Q2JA 4RCOA 1SSNA 4J3OD 3PLUA 1JCKB 2V0GA 2LRUA 1TY2A 2O6VD 1K51A 1Q0WB 3QA8A 2YEPB 3R2IA 4II3B 1EF1A 3VH4B 2OEDA 3KYDD 2CJOA 3AB5A 2FCNA 5DPSA 1X1MA 3IBEA 4B9KA 4YXDB 2AL3A 3NY5A 2XEWA 2BWFA 1UBQA 3NVYA 2ZNVB 3AU4A 4G3XB 1D4BA 5E6NA 4KGTA 4MJSA 3LDZE 4H2AA 3RNBC 2GBJA 3U4EG 3CSFA 3VHTC 1EO6A 1IPGA 4IOIE 3ENEA 4RF1A 2C60A 4MDKE 1WRDB 1WWTA 4OHJA 4EZLA 2ZJDA 4YSZB 4K7SA 4NJ6A 3ONSA 2KZRA 3SEBA 3OJ4B 2BBCA 2LUMA 4HPMB 2JQRB 1A5RA 2KQSA 1WJ6A 3L17A 3GOEA 3NJTA 4MGZE 3HM3A 1WX8A 2LUEA 2V4LA 3VUWA 1ZPSA 4MELA 2X38A 3Q8EA 4OVVA 2CS4A 4MEMA 1WM3A 2VZKD 2ZVNA 4YL8A 1FRRA 1EM7A 2M17A 1RM6C 3IAS1 2KX0A 4KX6B 1HE8A 2ZZPB 5J18A 1KH0A 2JRIB 2KDIA 3KWLA 3PRMB 4A20A 1TKEA 2KMMA 5G55A 1I35A 2C9WB 3L0WB 1QT9A 2NBVB 3UIPB 1E5WA 3DWMA 1HQRD 4HPLB 4KZCA 5BYQA 4WQMA 1WRIA 3TEYA 2G3QB 4GMVA 3TL5A 4OVZA 4N9F4 3H1UA 2W9NA 4IWQA 1GT8A 2MHJA 3I57A 1OQQA 3AI5A 1AARA 3AECB 2NVUI 2BYTA 2QCZA 1I4GA 3TBLD 4RNAA 2WXLA 3LB8C 4MSQB 3RD2A 5DPWA 1F52A 3E9SA 3H7PA 3SD5A 1UGMA 1CK1A 4IKGA 4FHJA 4HRSA 4XYCA 2JZPA 3R8BA 3O13A 1P1AA 3KH0A 3M62B 1WE7A 3AE8B 2V3PA 4WJPA 5D2MB 3ZDTA 2WWZA 1SE3A 1FD6A 1G6JA 1UWMA 5E6PA 1V80A 1WGDA 3HVZA 1NDDA 3W9CB 4HVBA 4OW0A 2K25A 3WALA 2FCQA 1E8YA 4I6LB 2OJWA 2LVQA 3NZSA 4E71A 3RI7C 2I1JA 2LVOA 3SR6A 1H4RA 3DBHB 4EOYA 2NCNA 3PZDA 1H8CA 5D7GA 5E6JA 3ZQ4A 1OEYA 3DVNV 1RFKA 3VRAB 4KKJA 2N9LA 3JSVA 1YIWA 2KFJA 1T5XD 2A5UA 3A33B 2PVOD 3PZ8A 4ZYSA 2DHZA 5AZHA 4NAWB 3N9YC 2KACA 2L0TA 3IFWB 3Q3FA 1TJEA 5CHVC 2MH7A 2AQ2B 3S2AA 1OQRA 1V5TA 2IYDB 3ETRA 4XDCA 1AWDA 2BGFA 1ESFA 1TIFA 1YN4A 4GDKB 5HI1A 3VXWA 1JRPA 3DBRI 1UH6A 2Y5CA 1VR9A 2XK5A 4PYUA 4KKIA 1YJJA 1MI0A 4RGOS 1FXAA 4BKTA 3N1YC 2YEPF 2B3AA 3TEXA 2LZ6A 2PVGC 3DVGY 2UWQA 1WGGA 2DYOA 5IAAC 3JVZX 4MH0E 2XN9C 4RMAA 4HK2A 4ZHOA 3HUIA 5BMIA 2Z0EB 1QQRA 2YVCA 1ZDVA 2BT6A 3RNEC 3VR9B 4EEWA 1QOGA 4HCNB 4W9LA 3FILA 2KTRB 3APFA 2A4ZA 2HE7A 3M95A 1T0SC 2LD9A 5MPOA 2LGSA 3BVGA 3H7SA 4MH8A 4EZJA 2AQ3B 2KDBA 2B76B 3EC8A 1EUVB 3JYUA 1K50A 4B6WA 2NTTA 5C3JB 4QAYA 1XCQL 3Q69A 3N20C 4WWMA 3BK2A 4C4VB 1KOTA 2JF5A 4YWGG 4K81A 3FKYA 2RPQA 4TKNA 1BT0A 1N63A 2M0AA 2DAJA 3RULA 1I42A 4BVUC 3PRPB 2DZMA 4P7IA 1C77A 1XLQA 1V5OA 3EGRA 2K1FA 4F1SA 3RPFC 2WX1A 4LNOA 4MGYE 2LJIA 5FKAC 1JWUD 3NVZA 1J7CA 3BYYB 2IDYA 2VH1A 1H7XA 4ANVA 4EKUA 1WY8A 3AM9A 3VTUA 2RD0A 4EUTA 1N6ZA 3K9PB 1GUAB 1HZ6A 5C23A 4PYZA 3PHWB 4DHJB 4GLSC 1MJDA 3QAQA 3MHZA 2GMIC 4M8MA 1TBEA 3NS1A 1V97A 1FNVA 5JHBA 4DBGA 5GMVA 1FCLA 2N9EB 4AP4C 2LGYA 1WYGA 4ITKA 2DYBA 1ZDXA 4W9CA 2KAJA 1WJ4A 2M56B 3K9OB 3GB1A 3FC4A 1WX9A 3MP9A 4G50A 2BS2B 2PMVA 2WXJA 4IC7B 4OZBA 2R2OA 3H8HA 3P1MA 3SFEB 4TSSA 2R2QA 1XQQA 4OVUA 3PSEB 2O6VA 4IW0A 4R3DA 4XX5A 1JWMD 1CJEA 1WIAA 3AEDB 4KV2A 1TY0A 2UYZB 3U30A 2OJRA 2BVCA 4JIOU 4HJGE 4RM8A 4ZYNA 3B9JA 4LJPB 3KW5B 4WJQA 4A3PA 3B0AA 3D32A 4W9JA 2MP2A 3W1YA 3KQ4A 4A90A 2WP9B 3OAWA 3H6NA 4MM3B 3VAWA 4ZRJA 4HKZE 1PDXA 3I63C 3H9DA 5E6OA 2K0PA 4DHZE 3TIXA 4WURA 3AU5A 2LRWA 5DPTA 2PLPA 1I4PA 3P4QB 4W9GA 4M02A 4GDKA 4G11A 1YQ3B 4JX1C 4P16A 1I7HA 2JSVX 3NZUA 4WIPA 2FUG1 3TEZA 1N62A 1WZ0A 3DQVA 1CMXB 2GBNA 2KC2A 2ZPNA 2LGDA 2G9HD 2PEAA 2L00B 2L3ZA 1PUTA 1TZOA 4WQOB 2HD5B 4USAA 1F9JA 1GOZA 2INDC 4HKQA 4LNIA 1FFUA 1AW7A 3APCA 2BQQA 2O2VA 1TZ1A 1GC6A 1ZW7A 2BB6A 2J0MA 2KVRA 2L1AA 3DWGC 4W9EA 4JQWC 5T8IA 2JYTA 2KYWA 1WJUA 3VUXA 2Z59B 3B1LX 4RF0A 2W82A 1FCCC 2GBRA 4GOCA 1P7EA 3WAMA 2NR2A 4W9FA 3NUHB 2UU7A 3W1SA 2WU5B 1AN8A 3PGEA 1ET6A 3MC9A 2MJEA 1T0QC 1FO4A 2ZW1A 3PV1A 3NZ3A 1QZEA 1C4CA 1JWBD 3T3OA 3NS8A 1WZ3A 3BWUD 4ARCA 3LJ3A 1Z5SB 3VRBB 2RGFA 4EZKA 3UQBA 5LNK1 3RFZB 4NPNA 4C4VA 4PS3A 2KO3A 2JX5A 3X23A 3AEBB 1SF0A 2AEHA 3QJZA 2AQ1B 2EKIA 1ZUD2 3PS6A 3V60A 1XXGA 1RWSA 4GU2A 4MT5A 5G5HA 2FUHB 3V3XA 4M01A 4LDTB 3N3KB 4HLEA 1ZKHA 3L08A 2AYOB 1XD3B 2LJ5A 2XK5B 4NJCA 1IUEA 1WXAA 3PREA 3T9LA 2G4DB 2IO3B 3ZKJC 1WYWB 4WJNA 2KWCA 4XZ4A 2RPVA 3Q6BA 3DHGC 1WFYA 2KJRA 1S1QB 4KIKB 2D3AA 1LFDA 1VDVA 3V62A 3PLVA 2INNE 1DOXA 5G5GA 3FILB 1UF0A 1TS5A 4ARIA 3VQIA 1V8CA 4IUMB 2EMTA 2WS3B 1QOAA 1IP9A 2JRHA 4URKA 1NBFC 1YX5B 3DBSA 1ZOYB 2HTHA 3PO0A 3VR8B 1JW9D 3PZ7A 2Z0DB 2MBEA 2DYMA 3R2TA 4DWFA 1ET9A 2MJDA 3P4PB 2GI9A 1UD7A 1C1YB 2JYEA 1E8WA 3AE7B 3HRDD 3URYA 1TKYA 4US9A 2WDVB 1P3QU 1VZ8A 1V9JA 2JWZA 4LJOB 4RGNA 2KN5A 2BKFA 2CU3A 1XT9B 4CYEA 3IXSA 1F2RC 1DGJA 3UIOB 3ZXRA 2D2QA 4MM3A 2V3NA 4C80A 1YQBA 4IM0A 4TV3A 2WHIA 3GP7A 1D5ZC 5HG2A 3Q3NC 5BMHA 5CX3A 2D3BA 1J8CA 2Z8LA 2MW5A 3VH3B 2C7MB 4KZ0A 5IKCM 4C7YA 1ROEA 1R4MB 2BYVE 1N5WA 2D07B 2LHDA 2M4NA 3R3MA 3MJWA 3I5JC 1Q1OA 1GTHA 2DZIA 2IO1B 4M00A 2BS4B 2JZ3B 5BO4B 2I2YA 2L83A 4TQ1A 1HTOA 2ONQA 3V61A 3ALBA 1R4NI 1QF6A 3UINB 1XO3A 2MX2A 2KDEB 2CJNA 4FJVB 4PK1A 2MEKA 1TS3A 2JU6X 1FNUA 1GAQB 1V49A 3OJ3A 3MC8A 1EU3A 4TUUA 3ZNZB 2CR5A 2RSUA 5KHQA 2IJ0A 3R66C 3RT3B 1OGWA 2ASQA 4LNNA 1Q5WB 2WXFA 2WXOA 3AXCA 5C2TB 2O6VB 3U52E 1WR1A 4A8XC 3B2FA 1HEZE 2IGHA 3QIJA 1FEHA 3QK0A 2E6XA 1P9DU 1R7SA 2MP2B 4AWJA 3BVZA 2KWUB 4M0WB 1N61A 1ZP0B 1NENB 4XDDA 4A9AA 2FCSA 2PE6B 1VZ6A 5FR6A 2K9XA 2QEJC 2QILA 2EELA 4DDID 1WXVA 4MGIE 1IBXB 3BIID 1DYQA 1SJED 2FCMA 2L0FA 3NHEB 3GS2A 2H89B 4A3OA 1STEA 1BUIC 5AUIA 3WIMA 1E7VA 3A4RA 1V86A 4B0MA 2WYQA 1VJKA 3KWVA 4IM2A 3DOWA 2L32A 3CSTA 4NAMA 3W1SC 2J0KA 2KJ6A 3IAM1 2AWTA 2GLSA
chains in the Genus database with same CATH topology
1SEBD 1KLUD 3GB1A 3CWIA 3FC4A 1KTKA 3MP9A 2BS2B 2VZKB 4JE3B 2PMVA 2WXJA 3MC0B 1YN3A 3ZJUA 2WXRA 4KGRA 1V1PB 5H8YE 4CQNA 2IGDA 4OZBA 3LXFA 2BTEA 1OFFA 4O1NA 1JALA 5BYSA 3H8HA 2I38A 2WXNA 3P1MA 3SFEB 4TSSA 4XWTA 2JXTA 1ACCA 4YSXB 3MFGA 1BMLC 2L52A 2K3UA 2MJ3A 1KFYB 4RH6A 4R3DA 3NRZA 1JWMD 1C79A 4JWSC 1CJEA 4YT0B 1JMLA 3AEDB 1F2RI 3TSSA 1TY0A 1YQ4B 3AH7A 1I4XA 2DLBA 3AV8A 1PGBA 4Q2JA 4RCOA 4HJGE 3B9JA 3AE3B 1SSNA 4J3OD 3BVMA 1JCKB 2V0GA 2WXPA 3KQ4A 1TY2A 4A90A 1K51A 2WP9B 1BXTA 2YEPB 3R2IA 4MM3B 2OEDA 3HVDA 1GPXA 3CF4A 2CJOA 3AB5A 4HKZE 3Q8BA 1PDXA 1UNSA 4ZRPA 4B0EA 1B9RA 4YSYB 1CZPA 4YXDB 1NYRA 1I4HA 1L0XB 2W3RA 2K0PA 4WURA 2K22A 1GB4A 3AE1B 3NVYA 3NVVA 5HFYA 2PLPA 2Q5WD 1I4PA 1L0YB 1C4PA 3P4QB 1FXIA 1D4BA 1YQ3B 4JX1C 4P16A 4KGTA 1I7HA 4H2AA 2JSVX 4WIPA 2FUG1 4IDIA 1JWSD 3TEZA 3B2GA 3U4EG 3OWEB 4YTPB 1K52A 4N58A 1N62A 2WXHA 2BS3B 4IOIE 5BYRA 4ZRQA 4RF1A 2G9HD 3P4SB 1PUTA 1WWTA 4OHJA 1TZOA 3KLSX 1RYJA 2N7JA 4YSZB 4USAA 1E7PB 1GOZA 1TYGB 3SEBA 1JQ4A 4LTUA 1E0ZA 3T3NA 1JWAD 1SB3C 2BBCA 2LUMA 4HKQA 1FFUA 2JQRB 1AW7A 4REZA 1WGKA 5D3IB 1V1PA 2BB6A 3TUOA 2L1AA 3DWGC 3AEGB 3P42A 2KWDA 4OZAA 2HTME 4LK0M 1ZPSA 5T8IA 3W5UB 2NTSA 4DQOC 2X38A 2JYTA 3Q8EA 1KLGD 1DOYA 4RF0A 1XLPA 1B1ZA 4MACA 2W82A 4D2KA 1FCCC 1YJIA 1IGCA 2VZKD 3NVWA 1FRRA 1P7EA 1EM7A 1E9MA 1P7FA 1RM6C 3IAS1 1J7AA 3NUHB 2GB1A 3W1SA 4KX6B 2WU5B 1AN8A 2LGIA 1XLNA 1ET6A 5D3DA 3AE6B 2MJEA 3AEAB 1KH0A 2JWUA 1ZE3D 2ZW1A 1FO4A 3NZ3A 1AYFA 3KWLA 3ZYYX 1TKEA 2KMMA 1H7WA 1C4CA 1JWBD 2J53A 4N6EB 4AQ7A 3T3OA 3BWUD 4ARCA 1HXYD 3VRBB 4GDLB 1QT9A 1PGAA 1XLOA 3LYYA 2E3TA 2ON8A 4L2YA 4US8A 5LNK1 3DWMA 1HQRD 3RFZB 5EE3A 5BYQA 4WQMA 4EE2A 2ACZB 1L5PA 1WRIA 2JX5A 3TEYA 3Q8CA 3AEBB 1SF0A 4OVZA 2AQ1B 2EKIA 1C4AA 1ZUD2 3FAHA 3U7ZA 1XXGA 2DBYA 1GT8A 3V05A 2WDQB 2OHFA 3I57A 1OQQA 3AECB 1RWSA 2XNAC 4MT5A 2BYTA 1I4GA 3EUB2 5G5HA 3V3XA 1WXQA 4NZLB 4RNAA 4M0WA 2WXLA 3LB8C 4WAFA 2J4XA 3E9SA 1D5MC 1CK1A 4NJCA 2LFIA 2PTLA 4LLGM 4IKGA 1IUEA 2WXIA 4JPSA 2KQ4X 5TSSA 1QKZA 1UWXA 4HRSA 5BMGA 5EE1A 1DOIA 1TS2A 1Y56A 2JZPA 1XCTL 3R8BA 3O13A 1L4DB 3Q8FA 4XWWA 1VRAB 3L4PA 3P4RB 2W54A 1IBXA 3AE8B 2V3PA 1FD6A 1FRDA 2QSDA 1SE3A 2RPVA 1UWMA 2IGGA 2FBWB 2PIAA 4JWUC 3I9V1 4N59A 1XEEA 3U2SC 3HVZA 3W9CB 4TMAB 4OW0A 1SE4A 1VDVA 1C78A 2INNE 1DOXA 4DXFA 4PT5A 5G5GA 3ZJVA 1NI3A 5JXVA 1GTEA 3FILB 1YN5A 2TSSA 1TS5A 1L6VA 4ZOHC 4ARIA 5FR3A 3SR6A 2AX5A 5D7GA 3AMZA 1V8CA 5E6JA 3VQIA 3ZQ4A 1T3QA 1RFKA 2WS3B 3VRAB 1QOAA 2N9LA 4KKJA 2HDEA 1F77A 3BZDB 1T6BX 2G1EA 1MHHE 3BK1A 1XF5L 1T5XD 1ZOYB 2PVOD 3PZ8A 3PO0A 3VR8B 4L1BA 4ZYSA 1JW9D 3PZ7A 1UGJA 4FXCA 3AE5B 3MJ5A 2DYMA 1ZXHA 4HROA 4NAWB 3R2TA 1ET9A 5EE0A 4WH4A 3N9YC 2MJDA 3P4PB 2KACA 2GI9A 1C9FA 1TS4A 2JYEA 1L6UA 3AE4B 3AE7B 3HRDD 1TJEA 3ABVB 1PGXA 2MH7A 2AQ2B 3URYA 1TKYA 4US9A 2WDVB 1I4RA 1OQRA 3P63A 1VZ8A 1ENFA 4RGNA 3AN1A 3ETRA 4XDCA 1AWDA 5FK9C 1ESFA 4GDKB 1YN4A 2CU3A 5HI1A 1K53A 3IXSA 1N60A 1F2RC 1DGJA 1JRPA 1MVKA 2Y5CA 2V3NA 4C7ZA 4C80A 2LMCA 1SJHD 1VR9A 3W5VB 3GP7A 5GXGB 1VLBA 4KKIA 3TEWA 1GB1A 1D5ZC 5HG2A 1YJJA 4OZCA 1MI0A 5BMHA 4RGOS 1FXAA 4TQ0A 2DWQA 2YEPF 1EWYC 3TEXA 4YTNB 2W3SA 4XE0A 1FNWA 2PVGC 2Z8LA 3C8YA 1V1OA 2DYOA 3AE9B 2XN9C 2H88B 1TKGA 1I4QA 2N9KA 4ZHOA 2WXGA 3HUIA 3W2DA 4C7YA 2INPE 5BMIA 2J42A 2PW9A 1M4VA 1ROEA 1QQRA 3ZGZA 3AE2B 1N5WA 2LHDA 5H92C 1ZDVA 2BT6A 3AEFB 1EWCA 3VR9B 1QOGA 2W55A 4KGSA 3FILA 1GTHA 4UDUC 1KF6B 3WCQA 2BS4B 2WDRB 1FIQA 2PKOA 3EA6A 5MPOA 2Y3AA 5EE9A 1N5XA 2KDMA 1Q10A 1FFVA 2I2YA 1SIJA 1KRHA 2GRIA 2L83A 4TQ1A 1NYQA 4C56C 2ZW0A 2BW2A 3BVGA 2ONQA 2J52A 2N0SB 4MH8A 4YTMB 2AQ3B 1QF6A 4RFBA 2QJLA 2B76B 1QOFA 1XO3A 1L4ZB 2CJNA 2ICIA 2V4IB 2QMTA 1E6EB 2MEKA 1VZ7A 1TS3A 2JU6X 2WQYB 1FNUA 4RGTA 1GAQB 1K50A 1NEKB 1FM0D 2NTTA 3CIRB 3IT4B 5C3JB 1EU3A 1XCQL 1F0ZA 3Q69A 2WU2B 4WWMA 2RMMA 3SFDB 1MHXA 2IJ0A 3BK2A 3J9CA 4YWGG 1ZXIA 2R61A 1C76A 2WXOA 5C2TB 2WXFA 3U52E 1N63A 2M0AA 2NMQA 4A8XC 1D6EC 1NVID 1YMHE 2WXQA 1IGDA 3B2FA 1JROA 1HEZE 5AUKA 2IGHA 2M19A 4L23A 4HEA1 1FEHA 1L0VB 2WLBA 2E6XA 1PFDA 1CQVA 1C77A 1XLQA 1R7SA 3E56A 3BVZA 1FMAD 2IPKD 1J7BA 3EGRA 1N61A 1PYWD 3RPFC 3ZJTA 1A70A 3BYTB 5HHDG 2LEKA 2LJIA 1WSPA 1ZP0B 1NENB 5FKAC 4XDDA 2RDHA 4A9AA 1JWUD 3AEEB 3NVZA 2SAKA 1J7CA 1QOBA 1VZ6A 3BYYB 4A6QA 1YNTE 2K9XA 2WNMA 2QEJC 2QILA 1SBBB 2IDYA 2EELA 1H7XA 3AM9A 1HZ5A 2KN4A 4ZHPA 1HA5A 1IBXB 3Q8AA 3BIID 2WXKA 1DYQA 1SJED 3IT6B 1SE2A 1HZ6A 4AS1A 3UI3A 2Y5PA 3GS2A 2H89B 2K5PA 1QLBB 1MPEA 4GLSC 1STEA 1BUIC 5AUIA 3MHZA 2FE8A 1SXTA 3NS1A 1V97A 1E10A 4A55A 2LHEA 2WXMA 4B0MA 1D5XC 1FNVA 5I4DA 1EU4A 1VJKA 3KWVA 1QILA 4RGMA 4DXGA 1FCLA 2D5GA 2L32A 2BB5A 4NAMA 4P6VF 1WYGA 2RDGA 4ITKA 2QIEB 3IAM1 1ZDXA 2KAJA 1UUPA 1LO5D 2M56B 2SEBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N0S B;  3CWI A;  3FC4 A;  3SR6 A;  4YTM B;  2BS2 B;  2AX5 A;  1QF6 A;  3AMZ A;  1V8C A;  2QJL A;  2B76 B;  1QOF A;  1DOY A;  1T3Q A;  1XO3 A;  1XLP A;  5H8Y E;  1RFK A;  2WS3 B;  3VRA B;  1QOA A;  1YJI A;  2CJN A;  3LXF A;  3NVW A;  1OFF A;  1JAL A;  1E6E B;  3P1M A;  3SFE B;  1FRR A;  2G1E A;  2WQY B;  1E9M A;  1RM6 C;  1J7A A;  1ZOY B;  1GAQ B;  4YSX B;  2PVO D;  2L52 A;  3PO0 A;  4KX6 B;  1NEK B;  3VR8 B;  1FM0 D;  1KFY B;  3CIR B;  2MJ3 A;  2WU5 B;  1JW9 D;  3NRZ A;  5C3J B;  1F0Z A;  1XLN A;  3AE6 B;  4JWS C;  1CJE A;  2WU2 B;  4YT0 B;  2MJE A;  4WWM A;  3AED B;  3AE5 B;  4FXC A;  3AEA B;  3SFD B;  4HRO A;  1YQ4 B;  3AH7 A;  1FO4 A;  3AV8 A;  5EE0 A;  2MJD A;  3P4P B;  1AYF A;  3KWL A;  3ZYY X;  1TKE A;  2KMM A;  1H7W A;  1ZXI A;  3B9J A;  3AE3 B;  1JWB D;  5C2T B;  4N6E B;  1N63 A;  1L6U A;  3AE4 B;  3AE7 B;  3VRB B;  3HRD D;  1QT9 A;  1NVI D;  1XLO A;  1TJE A;  2E3T A;  4US8 A;  3ABV B;  3DWM A;  2MH7 A;  2WP9 B;  1TKY A;  1JRO A;  3B2F A;  4US9 A;  5EE3 A;  5AUK A;  2WDV B;  1OQR A;  3P63 A;  4WQM A;  2ACZ B;  1L5P A;  1WRI A;  2M19 A;  2JX5 A;  1GPX A;  3AN1 A;  3ETR A;  3CF4 A;  2CJO A;  3AEB B;  1SF0 A;  3AB5 A;  1L0V B;  2WLB A;  1AWD A;  1PDX A;  1PFD A;  2EKI A;  1B9R A;  1XLQ A;  1R7S A;  1ZUD 2;  2CU3 A;  3FAH A;  4YSY B;  1CZP A;  4YXD B;  1NYR A;  1N60 A;  2W3R A;  1FMA D;  1DGJ A;  1J7B A;  1GT8 A;  1JRP A;  2DBY A;  1N61 A;  2WDQ B;  3RPF C;  2Y5C A;  2OHF A;  4C7Z A;  2K22 A;  1A70 A;  4C80 A;  1OQQ A;  3AE1 B;  2LEK A;  3NVY A;  1ZP0 B;  3NVV A;  3AEC B;  3W5V B;  1NEN B;  1RWS A;  5GXG B;  1VLB A;  2Q5W D;  4A9A A;  1YJJ A;  3P4Q B;  3EUB 2;  1FXI A;  3AEE B;  1YQ3 B;  3NVZ A;  1J7C A;  1QOB A;  1WXQ A;  5G5H A;  4JX1 C;  2K9X A;  1FXA A;  1I7H A;  3LB8 C;  2DWQ A;  1EWY C;  1H7X A;  4YTN B;  2W3S A;  2PVG C;  3AM9 A;  4IDI A;  4ZHP A;  3B2G A;  4YTP B;  3BII D;  4N58 A;  1N62 A;  1IUE A;  3AE9 B;  2BS3 B;  2H88 B;  1TKG A;  4ZHO A;  4HRS A;  3HUI A;  2H89 B;  2K5P A;  4C7Y A;  5EE1 A;  1DOI A;  1QLB B;  1ROE A;  5AUI A;  3AE2 B;  3P4S B;  1N5W A;  1PUT A;  1WWT A;  3L4P A;  5H92 C;  3P4R B;  1RYJ A;  3NS1 A;  1V97 A;  4YSZ B;  2W54 A;  4USA A;  2BT6 A;  1E7P B;  3AE8 B;  3AEF B;  1E10 A;  3VR9 B;  1FRD A;  1TYG B;  1UWM A;  2FBW B;  2PIA A;  1QOG A;  2W55 A;  4JWU C;  4LTU A;  4N59 A;  1E0Z A;  1JQ4 A;  1JWA D;  1SB3 C;  1GTH A;  3HVZ A;  1KF6 B;  3WCQ A;  1FFU A;  1VJK A;  2JQR B;  3W9C B;  1WGK A;  2BS4 B;  2WDR B;  1FIQ A;  2PKO A;  5MPO A;  1VDV A;  1N5X A;  4P6V F;  5EE9 A;  1FFV A;  1DOX A;  1SIJ A;  1KRH A;  5G5G A;  1WYG A;  2L83 A;  3DWG C;  3AEG B;  4ITK A;  1NI3 A;  2QIE B;  1NYQ A;  1GTE A;  2HTM E;  2KAJ A;  3W5U B;  1L6V A;  2M56 B;  4ZOH C; 
#chains in the Genus database with same CATH topology
 3PHX B;  3CWI A;  4KIK A;  2O2V B;  2VZK B;  4JE3 B;  2WXR A;  2D3G A;  2M8S A;  4XC2 A;  1OFF A;  3C19 A;  5D6J B;  2I38 A;  3RN9 C;  3ZXV A;  3MFG A;  1WI0 A;  1KFY B;  2MA9 B;  4JWS C;  4YT0 B;  4HXD A;  3TSS A;  3ZRC A;  3A9K B;  1I4X A;  2KK8 A;  3A1Q A;  3BVM A;  4MGK E;  3N1X C;  2WXP A;  4W9K A;  2KC1 A;  2KLG A;  3KUZ A;  3HVD A;  4BZA A;  1GPX A;  1R4N B;  2GBK A;  3CF4 A;  3DDC B;  3Q8B A;  1PQS A;  4ZRP A;  4B0E A;  1KM7 A;  1CZP A;  3VVW B;  5L95 C;  1RRB A;  2W3R A;  4BFR A;  2REX A;  2KFK A;  4BOS C;  3AE1 B;  3KUC B;  1C4P A;  1FXI A;  3PT2 B;  2N4F A;  4IDI A;  1JWS D;  3B2G A;  2KJH B;  4YTP B;  4N58 A;  2WXH A;  2BS3 B;  4LNF A;  5BYR A;  4ZRQ A;  3P4S B;  1J19 A;  1RYJ A;  5IN7 A;  4S17 A;  1E7P B;  3DCG A;  2EMS A;  4BOZ B;  1KLV A;  1E0Z A;  1Y8R C;  1JWA D;  1SB3 C;  1WX7 A;  4REZ A;  3O65 B;  5D3I B;  1SGH A;  1LGR A;  2CKH B;  2DZJ A;  1V1P A;  2DZK A;  3U7D A;  2GBM A;  3TUO A;  3IVF A;  4PS7 A;  3P42 A;  2LAS A;  4OZA A;  2NTS A;  2KXJ A;  4GIV A;  2L7R A;  4G0N B;  3ZLZ A;  1UZX B;  3L10 B;  4MAC A;  5IP4 D;  3NVW A;  1U4A A;  4AOF A;  3V6E B;  3KVF B;  3DBR B;  1FXT B;  3EHV A;  3RYT A;  1S3S G;  2MQJ A;  5D3D A;  3AE6 B;  4NJ7 A;  3AEA B;  1FPY A;  3Q3M C;  2JWU A;  3ZYY X;  2J53 A;  4N6E B;  4BKS D;  1PGA A;  1XLO A;  2MBO A;  2ON8 A;  5CHF A;  4US8 A;  1MG8 A;  4NQL B;  3WAO A;  3T8M A;  3Q8C A;  4NY0 A;  3RCZ A;  2ZEQ A;  2G4S A;  3QX1 A;  3RZF A;  4HPP A;  3U7Z A;  4JGH B;  3V05 A;  4BKG A;  2OHF A;  1V6E A;  2XNA C;  3WAN A;  4K7W A;  1WGR A;  3EUB 2;  1GJZ A;  2FNJ B;  3AUL A;  1WXQ A;  1V81 A;  4M0W A;  4WWO A;  1MFW A;  2J4X A;  3RNG C;  1D5M C;  2LFI A;  2PTL A;  4JPS A;  5TSS A;  1UWX A;  2MSE D;  2HJ8 A;  1Y56 A;  5CTR C;  1XCT L;  3PPA A;  1L4D B;  2DX5 B;  1VRA B;  3L4P A;  1E8X A;  3VFK A;  2W54 A;  1WR6 E;  4FJZ A;  1IBX A;  1VCB A;  2K8H A;  2IGG A;  4P1B C;  2LVP A;  3ZRF A;  3U2S C;  4M8N A;  3BY4 B;  4TMA B;  4K3C A;  1C78 A;  4PT5 A;  2WGS A;  3ZJV A;  4RM9 A;  4F7Z A;  1GTE A;  5JXV A;  2Y5B B;  4B95 A;  1OTR B;  1T3Q A;  4ANU A;  3BZD B;  4GXB A;  1T6B X;  2G1E A;  1XF5 L;  4KVG B;  5TR5 A;  3ZTC A;  1YD8 U;  1UGJ A;  2N7E A;  4GDL A;  1YX6 B;  3DHI C;  3AE5 B;  2VH2 A;  4HRO A;  3UQA A;  4WH4 A;  1GG3 A;  2ZCB A;  5LXI B;  4WJO A;  1L6U A;  2ZCC A;  3JW0 X;  3ECI A;  3Q3J A;  3ABV B;  1PGX A;  2KKC A;  3WA0 A;  2BYF A;  3A9K A;  3P63 A;  1WH3 A;  3PRZ A;  3AN1 A;  4HJK A;  1K53 A;  3DPD A;  1IYF A;  4C7Z A;  3Q2A C;  2MLB A;  1V2Y A;  1GB1 A;  3QCA A;  1VD2 A;  2IY1 B;  3WAP A;  3OG5 A;  1P98 A;  4TQ0 A;  2FIF A;  2DWQ A;  1EWY C;  4YTN B;  1M94 A;  2W3S A;  3B08 A;  1FNW A;  2ZPY A;  3C8Y A;  3ZW3 A;  2AL6 A;  4DK5 A;  1V1O A;  3AE9 B;  2KAN A;  1TKG A;  4FN2 A;  1E7U A;  1I4Q A;  2WXG A;  3W2D A;  2IO2 B;  5JH5 C;  1M4V A;  4I6N B;  2KMA A;  2LI5 A;  3ZGZ A;  3AE2 B;  5KHO A;  4W9I A;  3TMP B;  2W55 A;  4UDU C;  3P2B A;  3EEC A;  4NNJ B;  1RAX A;  3A4S C;  3EA6 A;  1N5X A;  1Q10 A;  1FFV A;  1SIJ A;  2GRI A;  3IHP C;  2BW2 A;  3NOB A;  2WX0 A;  5DPR A;  4JL9 A;  1E8Z A;  2N0S B;  4YTM B;  4RFB A;  4WWP A;  3ZNI D;  3HIZ A;  2ICI A;  4K1R B;  1E6E B;  1VZ7 A;  2WQY B;  4RGT A;  4AJW A;  1NEK B;  3CF6 E;  3IT4 B;  4LNK A;  4HDQ A;  4HDO A;  1WE6 A;  2K8C A;  2KD0 A;  3IG3 A;  1TT5 B;  3QHT A;  3L13 A;  3TCA A;  2NMQ A;  1D6E C;  1NVI D;  2WXQ A;  3ZO5 B;  1UBI A;  4C00 A;  4AJY B;  3DBH I;  3NG0 A;  3A1Q B;  2WLB A;  3GE3 C;  2LXC A;  1CQV A;  4W9D A;  3ZTD A;  2JZZ A;  1FMA D;  2IPK D;  2LWP A;  3C0R B;  2K8B A;  1A70 A;  2NS5 A;  3BYT B;  5HHD G;  2LEK A;  1WSP A;  3GZN I;  1GC7 A;  2RDH A;  3AEE B;  4ZDV A;  2SAK A;  4FAD A;  2MBQ A;  2FAZ A;  2KFK B;  1SIF A;  1T0R C;  2KN4 A;  4ZHP A;  1HA5 A;  2JUO A;  3Q8A A;  2WXK A;  1SE2 A;  5JHA A;  2K5P A;  2MWS B;  1QLB B;  2BF8 B;  1E10 A;  4X57 B;  2WXM A;  4GSW A;  3N30 A;  1LXD A;  4CHK A;  1D5X C;  3RNA C;  5I4D A;  3RZW C;  1EU4 A;  3VTW A;  1QIL A;  2D5G A;  3ML8 A;  4P6V F;  2RDG A;  2QIE B;  2HJ1 A;  2KTF A;  1UUP A;  1LO5 D;  1SEB D;  1KLU D;  2MCN B;  5AEK B;  3ZJU A;  2KLC A;  4KGR A;  2DNF A;  1V1P B;  2KNB A;  5H8Y E;  2BTE A;  3LXF A;  3VDZ A;  1JAL A;  1RLF A;  2YLM A;  1ACC A;  4YSX B;  1BML C;  2MJ3 A;  4RH6 A;  3U8Z A;  1GNU A;  3NRZ A;  3DVG X;  1C79 A;  1JML A;  4IWO A;  2QDF A;  3SU8 X;  2DLB A;  1TGZ B;  3AE3 B;  4KSK C;  2D10 A;  1ISN A;  2BKR B;  2MBH A;  1BXT A;  2BYE A;  2M1M A;  2KX3 A;  1LQB A;  2IO0 B;  1UNS A;  1B9R A;  3VUY A;  4YSY B;  1NYR A;  1I4H A;  1L0X B;  2K22 A;  2K6Q A;  1GB4 A;  3NVV A;  5HFY A;  2Q5W D;  4WWN A;  1WMH A;  1L0Y B;  1KJT A;  2NBW B;  3ZVV A;  3OWE B;  1K52 A;  2CHX A;  4BAX A;  1K8R B;  2IY0 B;  3SDL C;  2N9X A;  2OOB B;  3RMK C;  3KLS X;  4FBJ B;  2N7J A;  2JPH A;  4DHJ D;  3APD A;  2JY6 A;  2KHW B;  1TYG B;  1JQ4 A;  4LTU A;  5CHW A;  3T3N A;  2K39 A;  1WGK A;  3UF8 A;  3GZN B;  3R7Q A;  4DDG D;  3HK0 A;  3AEG B;  2KWD A;  2HTM E;  4LK0 M;  2RR9 A;  3W5U B;  4DQO C;  1WM2 A;  1KLG D;  1DOY A;  1XLP A;  1B1Z A;  4D2K A;  1YJI A;  1IGC A;  1J0G A;  3L54 A;  5EDS A;  4BBN C;  1E9M A;  1P7F A;  1J7A A;  4BKS A;  2GB1 A;  2LGI A;  1XLN A;  2JT4 B;  2INC C;  2NPT B;  1ZE3 D;  4K7U A;  4KDL B;  3QC8 B;  1AYF A;  1H7W A;  4F8C B;  4AQ7 A;  1WXS A;  2DAF A;  1HXY D;  3DVN U;  4GDL B;  4J6I A;  4L2Y A;  3LYY A;  2E3T A;  3UGB B;  3V6C B;  3MHS D;  3A9J B;  3CMM B;  4IWP A;  5EE3 A;  4EE2 A;  2ACZ B;  1L5P A;  5G2N A;  2G45 B;  4ACF A;  4ZRI A;  5AZG A;  4KDI C;  1C4A A;  3QQ8 B;  3FAH A;  1NI2 A;  2DBY A;  2BPS A;  2WDQ B;  1RFA A;  3GE8 C;  3KUD B;  1YOV B;  2LGX A;  2KWV B;  4NZL B;  4WAF A;  1HTQ A;  1WGY A;  2KVZ A;  4MSM B;  3EFC A;  3R7R A;  3M3J A;  4LLG M;  2WXI A;  5JZE B;  2KQ4 X;  2V9H A;  1QKZ A;  5BMG A;  1JRU A;  5EE1 A;  4ICV A;  1DOI A;  1TS2 A;  3RUI B;  4HWI B;  4XWW A;  3DHH C;  2KDF B;  3Q8F A;  3P4R B;  1FRD A;  2QSD A;  5J2R A;  2FBW B;  2PIA A;  4JWU C;  3I9V 1;  4N59 A;  1XEE A;  2X8X X;  1SE4 A;  3N1Z C;  4K3B A;  4DXF A;  1L7Y A;  1NI3 A;  2N1W A;  1YN5 A;  2TSS A;  1L6V A;  4ZOH C;  5FR3 A;  2KQ7 A;  2VRR B;  2AX5 A;  3AMZ A;  2NBU A;  1WXM A;  5IO9 A;  2HDE A;  1F77 A;  3N32 A;  5DCN A;  1MHH E;  3BK1 A;  2PE9 A;  4L1B A;  3DBL I;  4FXC A;  3MJ5 A;  4FJY A;  3L16 A;  1ZXH A;  4NQK E;  5EE0 A;  2K6D B;  2QC8 A;  2L05 A;  4PS8 A;  1C9F A;  1TS4 A;  2N1V A;  3SHQ A;  1OEY J;  3QAR A;  3AE4 B;  4FA6 A;  5IOI A;  4GGQ A;  3TJP A;  1I4R A;  4ANX A;  2BWE S;  1ENF A;  1SE9 A;  4JLC A;  5FK9 C;  1EF5 A;  1WGH A;  2ZVO A;  1N60 A;  1MVK A;  4MJS B;  3PTF C;  4FLH A;  2LMC A;  1SJH D;  3W5V B;  5GXG B;  3TEW A;  1VLB A;  5L83 A;  4FUL A;  4OZC A;  2C5L C;  1L2N A;  4HCP B;  4IG7 B;  4XE0 A;  4LDT D;  3M63 B;  3VTV A;  2J7Q B;  1ZGU B;  2H88 B;  2N9K A;  2CU1 A;  5J17 A;  2M0X A;  2CHZ A;  2INP E;  2J42 A;  2PW9 A;  4ICU A;  5H92 C;  3AEF B;  1TTN A;  1EWC A;  2EKE C;  2N9P C;  3I3T B;  4KSL C;  4KGS A;  1KF6 B;  3WCQ A;  2J0J A;  5LLI A;  2WDR B;  1FIQ A;  2PKO A;  2Y3A A;  5EE9 A;  2KDM A;  3X0W A;  1OQY A;  2I1K A;  3ZDM C;  2FID A;  2WDT B;  1KRH A;  4XGA B;  2C7N B;  1NYQ A;  3RNF C;  4C56 C;  2ZW0 A;  3ML9 A;  4I6P A;  2J52 A;  2QJL A;  1F1H A;  1QOF A;  5IA7 A;  1L4Z B;  4DXA B;  4DHZ B;  2V4I B;  4NAW A;  2QMT A;  4IM3 A;  3EFU A;  4P1C C;  1FM0 D;  3CIR B;  1LM8 B;  2KMC A;  1F0Z A;  2WU2 B;  2RMM A;  3SFD B;  1MHX A;  4S0R A;  3J9C A;  2IZV B;  1ZXI A;  2R61 A;  1C76 A;  2JVC A;  1E90 A;  1UEL A;  1YMH E;  1IGD A;  4II2 B;  2NPT A;  2GOW A;  1JRO A;  5AUK A;  2KT7 A;  2M19 A;  4L23 A;  4HEA 1;  1L0V B;  4E3C A;  3PVL A;  1PFD A;  1MG4 A;  5C1Z A;  1D3Z A;  3E56 A;  3HHM A;  3A9J A;  5AZF A;  1J7B A;  3RNC C;  1PYW D;  3ZJT A;  2IBI B;  4WAA A;  3H7P B;  2V1Y A;  3DBL B;  2MRP A;  2V3S A;  1QOB A;  4ANW A;  4A6Q A;  4CO7 A;  1YNT E;  2WNM A;  3ZNH B;  3ZNG C;  1SBB B;  2D11 A;  4EFO A;  2L76 A;  1HZ5 A;  3BIN A;  3IT6 B;  1WMH B;  4AS1 A;  3UI3 A;  2Y5P A;  2KTR A;  4W9H A;  1C3T A;  3HM6 X;  4BBN F;  1MPE A;  2FE8 A;  1SXT A;  3Q14 C;  2N7D A;  1T0Y A;  4FHK A;  4A55 A;  2LHE A;  4GN1 A;  2KOX A;  2PPH A;  5D94 A;  4ASW C;  2JXX A;  3QWZ B;  5HKH A;  2RDB C;  2C7H A;  4RGM A;  4DXG A;  3MTN B;  3OLM D;  2BB5 A;  3ZIM A;  2QHO A;  1P0R A;  1Z2M A;  1WJN A;  2XBB C;  3JSV B;  2PJH A;  3ZUN A;  2MBB B;  2LXA A;  2SEB D;  1KTK A;  1YJ1 A;  3MC0 B;  2D3C A;  4E74 A;  1YN3 A;  2L8J A;  4ZRK A;  4CQN A;  4LCD E;  2IGD A;  4O1N A;  5BYS A;  2WXN A;  2DEN B;  4XWT A;  1R4M I;  2JXT A;  5LXH A;  3KYC D;  4AUQ C;  3Q3O C;  2L52 A;  4GB9 A;  2K3U A;  2ZNV C;  1F2R I;  2CHW A;  1YQ4 B;  1WF9 A;  3AH7 A;  3AV8 A;  1PGB A;  4Q2J A;  4RCO A;  1SSN A;  4J3O D;  3PLU A;  1JCK B;  2V0G A;  2LRU A;  1TY2 A;  2O6V D;  1K51 A;  1Q0W B;  3QA8 A;  2YEP B;  3R2I A;  4II3 B;  1EF1 A;  3VH4 B;  2OED A;  3KYD D;  2CJO A;  3AB5 A;  2FCN A;  5DPS A;  1X1M A;  3IBE A;  4B9K A;  4YXD B;  2AL3 A;  3NY5 A;  2XEW A;  2BWF A;  1UBQ A;  3NVY A;  2ZNV B;  3AU4 A;  4G3X B;  1D4B A;  5E6N A;  4KGT A;  4MJS A;  3LDZ E;  4H2A A;  3RNB C;  2GBJ A;  3U4E G;  3CSF A;  3VHT C;  1EO6 A;  1IPG A;  4IOI E;  3ENE A;  4RF1 A;  2C60 A;  4MDK E;  1WRD B;  1WWT A;  4OHJ A;  4EZL A;  2ZJD A;  4YSZ B;  4K7S A;  4NJ6 A;  3ONS A;  2KZR A;  3SEB A;  3OJ4 B;  2BBC A;  2LUM A;  4HPM B;  2JQR B;  1A5R A;  2KQS A;  1WJ6 A;  3L17 A;  3GOE A;  3NJT A;  4MGZ E;  3HM3 A;  1WX8 A;  2LUE A;  2V4L A;  3VUW A;  1ZPS A;  4MEL A;  2X38 A;  3Q8E A;  4OVV A;  2CS4 A;  4MEM A;  1WM3 A;  2VZK D;  2ZVN A;  4YL8 A;  1FRR A;  1EM7 A;  2M17 A;  1RM6 C;  3IAS 1;  2KX0 A;  4KX6 B;  1HE8 A;  2ZZP B;  5J18 A;  1KH0 A;  2JRI B;  2KDI A;  3KWL A;  3PRM B;  4A20 A;  1TKE A;  2KMM A;  5G55 A;  1I35 A;  2C9W B;  3L0W B;  1QT9 A;  2NBV B;  3UIP B;  1E5W A;  3DWM A;  1HQR D;  4HPL B;  4KZC A;  5BYQ A;  4WQM A;  1WRI A;  3TEY A;  2G3Q B;  4GMV A;  3TL5 A;  4OVZ A;  4N9F 4;  3H1U A;  2W9N A;  4IWQ A;  1GT8 A;  2MHJ A;  3I57 A;  1OQQ A;  3AI5 A;  1AAR A;  3AEC B;  2NVU I;  2BYT A;  2QCZ A;  1I4G A;  3TBL D;  4RNA A;  2WXL A;  3LB8 C;  4MSQ B;  3RD2 A;  5DPW A;  1F52 A;  3E9S A;  3H7P A;  3SD5 A;  1UGM A;  1CK1 A;  4IKG A;  4FHJ A;  4HRS A;  4XYC A;  2JZP A;  3R8B A;  3O13 A;  1P1A A;  3KH0 A;  3M62 B;  1WE7 A;  3AE8 B;  2V3P A;  4WJP A;  5D2M B;  3ZDT A;  2WWZ A;  1SE3 A;  1FD6 A;  1G6J A;  1UWM A;  5E6P A;  1V80 A;  1WGD A;  3HVZ A;  1NDD A;  3W9C B;  4HVB A;  4OW0 A;  2K25 A;  3WAL A;  2FCQ A;  1E8Y A;  4I6L B;  2OJW A;  2LVQ A;  3NZS A;  4E71 A;  3RI7 C;  2I1J A;  2LVO A;  3SR6 A;  1H4R A;  3DBH B;  4EOY A;  2NCN A;  3PZD A;  1H8C A;  5D7G A;  5E6J A;  3ZQ4 A;  1OEY A;  3DVN V;  1RFK A;  3VRA B;  4KKJ A;  2N9L A;  3JSV A;  1YIW A;  2KFJ A;  1T5X D;  2A5U A;  3A33 B;  2PVO D;  3PZ8 A;  4ZYS A;  2DHZ A;  5AZH A;  4NAW B;  3N9Y C;  2KAC A;  2L0T A;  3IFW B;  3Q3F A;  1TJE A;  5CHV C;  2MH7 A;  2AQ2 B;  3S2A A;  1OQR A;  1V5T A;  2IYD B;  3ETR A;  4XDC A;  1AWD A;  2BGF A;  1ESF A;  1TIF A;  1YN4 A;  4GDK B;  5HI1 A;  3VXW A;  1JRP A;  3DBR I;  1UH6 A;  2Y5C A;  1VR9 A;  2XK5 A;  4PYU A;  4KKI A;  1YJJ A;  1MI0 A;  4RGO S;  1FXA A;  4BKT A;  3N1Y C;  2YEP F;  2B3A A;  3TEX A;  2LZ6 A;  2PVG C;  3DVG Y;  2UWQ A;  1WGG A;  2DYO A;  5IAA C;  3JVZ X;  4MH0 E;  2XN9 C;  4RMA A;  4HK2 A;  4ZHO A;  3HUI A;  5BMI A;  2Z0E B;  1QQR A;  2YVC A;  1ZDV A;  2BT6 A;  3RNE C;  3VR9 B;  4EEW A;  1QOG A;  4HCN B;  4W9L A;  3FIL A;  2KTR B;  3APF A;  2A4Z A;  2HE7 A;  3M95 A;  1T0S C;  2LD9 A;  5MPO A;  2LGS A;  3BVG A;  3H7S A;  4MH8 A;  4EZJ A;  2AQ3 B;  2KDB A;  2B76 B;  3EC8 A;  1EUV B;  3JYU A;  1K50 A;  4B6W A;  2NTT A;  5C3J B;  4QAY A;  1XCQ L;  3Q69 A;  3N20 C;  4WWM A;  3BK2 A;  4C4V B;  1KOT A;  2JF5 A;  4YWG G;  4K81 A;  3FKY A;  2RPQ A;  4TKN A;  1BT0 A;  1N63 A;  2M0A A;  2DAJ A;  3RUL A;  1I42 A;  4BVU C;  3PRP B;  2DZM A;  4P7I A;  1C77 A;  1XLQ A;  1V5O A;  3EGR A;  2K1F A;  4F1S A;  3RPF C;  2WX1 A;  4LNO A;  4MGY E;  2LJI A;  5FKA C;  1JWU D;  3NVZ A;  1J7C A;  3BYY B;  2IDY A;  2VH1 A;  1H7X A;  4ANV A;  4EKU A;  1WY8 A;  3AM9 A;  3VTU A;  2RD0 A;  4EUT A;  1N6Z A;  3K9P B;  1GUA B;  1HZ6 A;  5C23 A;  4PYZ A;  3PHW B;  4DHJ B;  4GLS C;  1MJD A;  3QAQ A;  3MHZ A;  2GMI C;  4M8M A;  1TBE A;  3NS1 A;  1V97 A;  1FNV A;  5JHB A;  4DBG A;  5GMV A;  1FCL A;  2N9E B;  4AP4 C;  2LGY A;  1WYG A;  4ITK A;  2DYB A;  1ZDX A;  4W9C A;  2KAJ A;  1WJ4 A;  2M56 B;  3K9O B;  3GB1 A;  3FC4 A;  1WX9 A;  3MP9 A;  4G50 A;  2BS2 B;  2PMV A;  2WXJ A;  4IC7 B;  4OZB A;  2R2O A;  3H8H A;  3P1M A;  3SFE B;  4TSS A;  2R2Q A;  1XQQ A;  4OVU A;  3PSE B;  2O6V A;  4IW0 A;  4R3D A;  4XX5 A;  1JWM D;  1CJE A;  1WIA A;  3AED B;  4KV2 A;  1TY0 A;  2UYZ B;  3U30 A;  2OJR A;  2BVC A;  4JIO U;  4HJG E;  4RM8 A;  4ZYN A;  3B9J A;  4LJP B;  3KW5 B;  4WJQ A;  4A3P A;  3B0A A;  3D32 A;  4W9J A;  2MP2 A;  3W1Y A;  3KQ4 A;  4A90 A;  2WP9 B;  3OAW A;  3H6N A;  4MM3 B;  3VAW A;  4ZRJ A;  4HKZ E;  1PDX A;  3I63 C;  3H9D A;  5E6O A;  2K0P A;  4DHZ E;  3TIX A;  4WUR A;  3AU5 A;  2LRW A;  5DPT A;  2PLP A;  1I4P A;  3P4Q B;  4W9G A;  4M02 A;  4GDK A;  4G11 A;  1YQ3 B;  4JX1 C;  4P16 A;  1I7H A;  2JSV X;  3NZU A;  4WIP A;  2FUG 1;  3TEZ A;  1N62 A;  1WZ0 A;  3DQV A;  1CMX B;  2GBN A;  2KC2 A;  2ZPN A;  2LGD A;  2G9H D;  2PEA A;  2L00 B;  2L3Z A;  1PUT A;  1TZO A;  4WQO B;  2HD5 B;  4USA A;  1F9J A;  1GOZ A;  2IND C;  4HKQ A;  4LNI A;  1FFU A;  1AW7 A;  3APC A;  2BQQ A;  2O2V A;  1TZ1 A;  1GC6 A;  1ZW7 A;  2BB6 A;  2J0M A;  2KVR A;  2L1A A;  3DWG C;  4W9E A;  4JQW C;  5T8I A;  2JYT A;  2KYW A;  1WJU A;  3VUX A;  2Z59 B;  3B1L X;  4RF0 A;  2W82 A;  1FCC C;  2GBR A;  4GOC A;  1P7E A;  3WAM A;  2NR2 A;  4W9F A;  3NUH B;  2UU7 A;  3W1S A;  2WU5 B;  1AN8 A;  3PGE A;  1ET6 A;  3MC9 A;  2MJE A;  1T0Q C;  1FO4 A;  2ZW1 A;  3PV1 A;  3NZ3 A;  1QZE A;  1C4C A;  1JWB D;  3T3O A;  3NS8 A;  1WZ3 A;  3BWU D;  4ARC A;  3LJ3 A;  1Z5S B;  3VRB B;  2RGF A;  4EZK A;  3UQB A;  5LNK 1;  3RFZ B;  4NPN A;  4C4V A;  4PS3 A;  2KO3 A;  2JX5 A;  3X23 A;  3AEB B;  1SF0 A;  2AEH A;  3QJZ A;  2AQ1 B;  2EKI A;  1ZUD 2;  3PS6 A;  3V60 A;  1XXG A;  1RWS A;  4GU2 A;  4MT5 A;  5G5H A;  2FUH B;  3V3X A;  4M01 A;  4LDT B;  3N3K B;  4HLE A;  1ZKH A;  3L08 A;  2AYO B;  1XD3 B;  2LJ5 A;  2XK5 B;  4NJC A;  1IUE A;  1WXA A;  3PRE A;  3T9L A;  2G4D B;  2IO3 B;  3ZKJ C;  1WYW B;  4WJN A;  2KWC A;  4XZ4 A;  2RPV A;  3Q6B A;  3DHG C;  1WFY A;  2KJR A;  1S1Q B;  4KIK B;  2D3A A;  1LFD A;  1VDV A;  3V62 A;  3PLV A;  2INN E;  1DOX A;  5G5G A;  3FIL B;  1UF0 A;  1TS5 A;  4ARI A;  3VQI A;  1V8C A;  4IUM B;  2EMT A;  2WS3 B;  1QOA A;  1IP9 A;  2JRH A;  4URK A;  1NBF C;  1YX5 B;  3DBS A;  1ZOY B;  2HTH A;  3PO0 A;  3VR8 B;  1JW9 D;  3PZ7 A;  2Z0D B;  2MBE A;  2DYM A;  3R2T A;  4DWF A;  1ET9 A;  2MJD A;  3P4P B;  2GI9 A;  1UD7 A;  1C1Y B;  2JYE A;  1E8W A;  3AE7 B;  3HRD D;  3URY A;  1TKY A;  4US9 A;  2WDV B;  1P3Q U;  1VZ8 A;  1V9J A;  2JWZ A;  4LJO B;  4RGN A;  2KN5 A;  2BKF A;  2CU3 A;  1XT9 B;  4CYE A;  3IXS A;  1F2R C;  1DGJ A;  3UIO B;  3ZXR A;  2D2Q A;  4MM3 A;  2V3N A;  4C80 A;  1YQB A;  4IM0 A;  4TV3 A;  2WHI A;  3GP7 A;  1D5Z C;  5HG2 A;  3Q3N C;  5BMH A;  5CX3 A;  2D3B A;  1J8C A;  2Z8L A;  2MW5 A;  3VH3 B;  2C7M B;  4KZ0 A;  5IKC M;  4C7Y A;  1ROE A;  1R4M B;  2BYV E;  1N5W A;  2D07 B;  2LHD A;  2M4N A;  3R3M A;  3MJW A;  3I5J C;  1Q1O A;  1GTH A;  2DZI A;  2IO1 B;  4M00 A;  2BS4 B;  2JZ3 B;  5BO4 B;  2I2Y A;  2L83 A;  4TQ1 A;  1HTO A;  2ONQ A;  3V61 A;  3ALB A;  1R4N I;  1QF6 A;  3UIN B;  1XO3 A;  2MX2 A;  2KDE B;  2CJN A;  4FJV B;  4PK1 A;  2MEK A;  1TS3 A;  2JU6 X;  1FNU A;  1GAQ B;  1V49 A;  3OJ3 A;  3MC8 A;  1EU3 A;  4TUU A;  3ZNZ B;  2CR5 A;  2RSU A;  5KHQ A;  2IJ0 A;  3R66 C;  3RT3 B;  1OGW A;  2ASQ A;  4LNN A;  1Q5W B;  2WXF A;  2WXO A;  3AXC A;  5C2T B;  2O6V B;  3U52 E;  1WR1 A;  4A8X C;  3B2F A;  1HEZ E;  2IGH A;  3QIJ A;  1FEH A;  3QK0 A;  2E6X A;  1P9D U;  1R7S A;  2MP2 B;  4AWJ A;  3BVZ A;  2KWU B;  4M0W B;  1N61 A;  1ZP0 B;  1NEN B;  4XDD A;  4A9A A;  2FCS A;  2PE6 B;  1VZ6 A;  5FR6 A;  2K9X A;  2QEJ C;  2QIL A;  2EEL A;  4DDI D;  1WXV A;  4MGI E;  1IBX B;  3BII D;  1DYQ A;  1SJE D;  2FCM A;  2L0F A;  3NHE B;  3GS2 A;  2H89 B;  4A3O A;  1STE A;  1BUI C;  5AUI A;  3WIM A;  1E7V A;  3A4R A;  1V86 A;  4B0M A;  2WYQ A;  1VJK A;  3KWV A;  4IM2 A;  3DOW A;  2L32 A;  3CST A;  4NAM A;  3W1S C;  2J0K A;  2KJ6 A;  3IAM 1;  2AWT A;  2GLS A; 
#chains in the Genus database with same CATH homology
 1SEB D;  1KLU D;  3GB1 A;  3CWI A;  3FC4 A;  1KTK A;  3MP9 A;  2BS2 B;  2VZK B;  4JE3 B;  2PMV A;  2WXJ A;  3MC0 B;  1YN3 A;  3ZJU A;  2WXR A;  4KGR A;  1V1P B;  5H8Y E;  4CQN A;  2IGD A;  4OZB A;  3LXF A;  2BTE A;  1OFF A;  4O1N A;  1JAL A;  5BYS A;  3H8H A;  2I38 A;  2WXN A;  3P1M A;  3SFE B;  4TSS A;  4XWT A;  2JXT A;  1ACC A;  4YSX B;  3MFG A;  1BML C;  2L52 A;  2K3U A;  2MJ3 A;  1KFY B;  4RH6 A;  4R3D A;  3NRZ A;  1JWM D;  1C79 A;  4JWS C;  1CJE A;  4YT0 B;  1JML A;  3AED B;  1F2R I;  3TSS A;  1TY0 A;  1YQ4 B;  3AH7 A;  1I4X A;  2DLB A;  3AV8 A;  1PGB A;  4Q2J A;  4RCO A;  4HJG E;  3B9J A;  3AE3 B;  1SSN A;  4J3O D;  3BVM A;  1JCK B;  2V0G A;  2WXP A;  3KQ4 A;  1TY2 A;  4A90 A;  1K51 A;  2WP9 B;  1BXT A;  2YEP B;  3R2I A;  4MM3 B;  2OED A;  3HVD A;  1GPX A;  3CF4 A;  2CJO A;  3AB5 A;  4HKZ E;  3Q8B A;  1PDX A;  1UNS A;  4ZRP A;  4B0E A;  1B9R A;  4YSY B;  1CZP A;  4YXD B;  1NYR A;  1I4H A;  1L0X B;  2W3R A;  2K0P A;  4WUR A;  2K22 A;  1GB4 A;  3AE1 B;  3NVY A;  3NVV A;  5HFY A;  2PLP A;  2Q5W D;  1I4P A;  1L0Y B;  1C4P A;  3P4Q B;  1FXI A;  1D4B A;  1YQ3 B;  4JX1 C;  4P16 A;  4KGT A;  1I7H A;  4H2A A;  2JSV X;  4WIP A;  2FUG 1;  4IDI A;  1JWS D;  3TEZ A;  3B2G A;  3U4E G;  3OWE B;  4YTP B;  1K52 A;  4N58 A;  1N62 A;  2WXH A;  2BS3 B;  4IOI E;  5BYR A;  4ZRQ A;  4RF1 A;  2G9H D;  3P4S B;  1PUT A;  1WWT A;  4OHJ A;  1TZO A;  3KLS X;  1RYJ A;  2N7J A;  4YSZ B;  4USA A;  1E7P B;  1GOZ A;  1TYG B;  3SEB A;  1JQ4 A;  4LTU A;  1E0Z A;  3T3N A;  1JWA D;  1SB3 C;  2BBC A;  2LUM A;  4HKQ A;  1FFU A;  2JQR B;  1AW7 A;  4REZ A;  1WGK A;  5D3I B;  1V1P A;  2BB6 A;  3TUO A;  2L1A A;  3DWG C;  3AEG B;  3P42 A;  2KWD A;  4OZA A;  2HTM E;  4LK0 M;  1ZPS A;  5T8I A;  3W5U B;  2NTS A;  4DQO C;  2X38 A;  2JYT A;  3Q8E A;  1KLG D;  1DOY A;  4RF0 A;  1XLP A;  1B1Z A;  4MAC A;  2W82 A;  4D2K A;  1FCC C;  1YJI A;  1IGC A;  2VZK D;  3NVW A;  1FRR A;  1P7E A;  1EM7 A;  1E9M A;  1P7F A;  1RM6 C;  3IAS 1;  1J7A A;  3NUH B;  2GB1 A;  3W1S A;  4KX6 B;  2WU5 B;  1AN8 A;  2LGI A;  1XLN A;  1ET6 A;  5D3D A;  3AE6 B;  2MJE A;  3AEA B;  1KH0 A;  2JWU A;  1ZE3 D;  2ZW1 A;  1FO4 A;  3NZ3 A;  1AYF A;  3KWL A;  3ZYY X;  1TKE A;  2KMM A;  1H7W A;  1C4C A;  1JWB D;  2J53 A;  4N6E B;  4AQ7 A;  3T3O A;  3BWU D;  4ARC A;  1HXY D;  3VRB B;  4GDL B;  1QT9 A;  1PGA A;  1XLO A;  3LYY A;  2E3T A;  2ON8 A;  4L2Y A;  4US8 A;  5LNK 1;  3DWM A;  1HQR D;  3RFZ B;  5EE3 A;  5BYQ A;  4WQM A;  4EE2 A;  2ACZ B;  1L5P A;  1WRI A;  2JX5 A;  3TEY A;  3Q8C A;  3AEB B;  1SF0 A;  4OVZ A;  2AQ1 B;  2EKI A;  1C4A A;  1ZUD 2;  3FAH A;  3U7Z A;  1XXG A;  2DBY A;  1GT8 A;  3V05 A;  2WDQ B;  2OHF A;  3I57 A;  1OQQ A;  3AEC B;  1RWS A;  2XNA C;  4MT5 A;  2BYT A;  1I4G A;  3EUB 2;  5G5H A;  3V3X A;  1WXQ A;  4NZL B;  4RNA A;  4M0W A;  2WXL A;  3LB8 C;  4WAF A;  2J4X A;  3E9S A;  1D5M C;  1CK1 A;  4NJC A;  2LFI A;  2PTL A;  4LLG M;  4IKG A;  1IUE A;  2WXI A;  4JPS A;  2KQ4 X;  5TSS A;  1QKZ A;  1UWX A;  4HRS A;  5BMG A;  5EE1 A;  1DOI A;  1TS2 A;  1Y56 A;  2JZP A;  1XCT L;  3R8B A;  3O13 A;  1L4D B;  3Q8F A;  4XWW A;  1VRA B;  3L4P A;  3P4R B;  2W54 A;  1IBX A;  3AE8 B;  2V3P A;  1FD6 A;  1FRD A;  2QSD A;  1SE3 A;  2RPV A;  1UWM A;  2IGG A;  2FBW B;  2PIA A;  4JWU C;  3I9V 1;  4N59 A;  1XEE A;  3U2S C;  3HVZ A;  3W9C B;  4TMA B;  4OW0 A;  1SE4 A;  1VDV A;  1C78 A;  2INN E;  1DOX A;  4DXF A;  4PT5 A;  5G5G A;  3ZJV A;  1NI3 A;  5JXV A;  1GTE A;  3FIL B;  1YN5 A;  2TSS A;  1TS5 A;  1L6V A;  4ZOH C;  4ARI A;  5FR3 A;  3SR6 A;  2AX5 A;  5D7G A;  3AMZ A;  1V8C A;  5E6J A;  3VQI A;  3ZQ4 A;  1T3Q A;  1RFK A;  2WS3 B;  3VRA B;  1QOA A;  2N9L A;  4KKJ A;  2HDE A;  1F77 A;  3BZD B;  1T6B X;  2G1E A;  1MHH E;  3BK1 A;  1XF5 L;  1T5X D;  1ZOY B;  2PVO D;  3PZ8 A;  3PO0 A;  3VR8 B;  4L1B A;  4ZYS A;  1JW9 D;  3PZ7 A;  1UGJ A;  4FXC A;  3AE5 B;  3MJ5 A;  2DYM A;  1ZXH A;  4HRO A;  4NAW B;  3R2T A;  1ET9 A;  5EE0 A;  4WH4 A;  3N9Y C;  2MJD A;  3P4P B;  2KAC A;  2GI9 A;  1C9F A;  1TS4 A;  2JYE A;  1L6U A;  3AE4 B;  3AE7 B;  3HRD D;  1TJE A;  3ABV B;  1PGX A;  2MH7 A;  2AQ2 B;  3URY A;  1TKY A;  4US9 A;  2WDV B;  1I4R A;  1OQR A;  3P63 A;  1VZ8 A;  1ENF A;  4RGN A;  3AN1 A;  3ETR A;  4XDC A;  1AWD A;  5FK9 C;  1ESF A;  4GDK B;  1YN4 A;  2CU3 A;  5HI1 A;  1K53 A;  3IXS A;  1N60 A;  1F2R C;  1DGJ A;  1JRP A;  1MVK A;  2Y5C A;  2V3N A;  4C7Z A;  4C80 A;  2LMC A;  1SJH D;  1VR9 A;  3W5V B;  3GP7 A;  5GXG B;  1VLB A;  4KKI A;  3TEW A;  1GB1 A;  1D5Z C;  5HG2 A;  1YJJ A;  4OZC A;  1MI0 A;  5BMH A;  4RGO S;  1FXA A;  4TQ0 A;  2DWQ A;  2YEP F;  1EWY C;  3TEX A;  4YTN B;  2W3S A;  4XE0 A;  1FNW A;  2PVG C;  2Z8L A;  3C8Y A;  1V1O A;  2DYO A;  3AE9 B;  2XN9 C;  2H88 B;  1TKG A;  1I4Q A;  2N9K A;  4ZHO A;  2WXG A;  3HUI A;  3W2D A;  4C7Y A;  2INP E;  5BMI A;  2J42 A;  2PW9 A;  1M4V A;  1ROE A;  1QQR A;  3ZGZ A;  3AE2 B;  1N5W A;  2LHD A;  5H92 C;  1ZDV A;  2BT6 A;  3AEF B;  1EWC A;  3VR9 B;  1QOG A;  2W55 A;  4KGS A;  3FIL A;  1GTH A;  4UDU C;  1KF6 B;  3WCQ A;  2BS4 B;  2WDR B;  1FIQ A;  2PKO A;  3EA6 A;  5MPO A;  2Y3A A;  5EE9 A;  1N5X A;  2KDM A;  1Q10 A;  1FFV A;  2I2Y A;  1SIJ A;  1KRH A;  2GRI A;  2L83 A;  4TQ1 A;  1NYQ A;  4C56 C;  2ZW0 A;  2BW2 A;  3BVG A;  2ONQ A;  2J52 A;  2N0S B;  4MH8 A;  4YTM B;  2AQ3 B;  1QF6 A;  4RFB A;  2QJL A;  2B76 B;  1QOF A;  1XO3 A;  1L4Z B;  2CJN A;  2ICI A;  2V4I B;  2QMT A;  1E6E B;  2MEK A;  1VZ7 A;  1TS3 A;  2JU6 X;  2WQY B;  1FNU A;  4RGT A;  1GAQ B;  1K50 A;  1NEK B;  1FM0 D;  2NTT A;  3CIR B;  3IT4 B;  5C3J B;  1EU3 A;  1XCQ L;  1F0Z A;  3Q69 A;  2WU2 B;  4WWM A;  2RMM A;  3SFD B;  1MHX A;  2IJ0 A;  3BK2 A;  3J9C A;  4YWG G;  1ZXI A;  2R61 A;  1C76 A;  2WXO A;  5C2T B;  2WXF A;  3U52 E;  1N63 A;  2M0A A;  2NMQ A;  4A8X C;  1D6E C;  1NVI D;  1YMH E;  2WXQ A;  1IGD A;  3B2F A;  1JRO A;  1HEZ E;  5AUK A;  2IGH A;  2M19 A;  4L23 A;  4HEA 1;  1FEH A;  1L0V B;  2WLB A;  2E6X A;  1PFD A;  1CQV A;  1C77 A;  1XLQ A;  1R7S A;  3E56 A;  3BVZ A;  1FMA D;  2IPK D;  1J7B A;  3EGR A;  1N61 A;  1PYW D;  3RPF C;  3ZJT A;  1A70 A;  3BYT B;  5HHD G;  2LEK A;  2LJI A;  1WSP A;  1ZP0 B;  1NEN B;  5FKA C;  4XDD A;  2RDH A;  4A9A A;  1JWU D;  3AEE B;  3NVZ A;  2SAK A;  1J7C A;  1QOB A;  1VZ6 A;  3BYY B;  4A6Q A;  1YNT E;  2K9X A;  2WNM A;  2QEJ C;  2QIL A;  1SBB B;  2IDY A;  2EEL A;  1H7X A;  3AM9 A;  1HZ5 A;  2KN4 A;  4ZHP A;  1HA5 A;  1IBX B;  3Q8A A;  3BII D;  2WXK A;  1DYQ A;  1SJE D;  3IT6 B;  1SE2 A;  1HZ6 A;  4AS1 A;  3UI3 A;  2Y5P A;  3GS2 A;  2H89 B;  2K5P A;  1QLB B;  1MPE A;  4GLS C;  1STE A;  1BUI C;  5AUI A;  3MHZ A;  2FE8 A;  1SXT A;  3NS1 A;  1V97 A;  1E10 A;  4A55 A;  2LHE A;  2WXM A;  4B0M A;  1D5X C;  1FNV A;  5I4D A;  1EU4 A;  1VJK A;  3KWV A;  1QIL A;  4RGM A;  4DXG A;  1FCL A;  2D5G A;  2L32 A;  2BB5 A;  4NAM A;  4P6V F;  1WYG A;  2RDG A;  4ITK A;  2QIE B;  3IAM 1;  1ZDX A;  2KAJ A;  1UUP A;  1LO5 D;  2M56 B;  2SEB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...