2FBWB

Avian respiratory complex ii with carboxin bound
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title 3-nitropropionic acid is a suicide inhibitor of mitochondrial respiration that, upon oxidation by complex II, forms a covalent adduct with a catalytic base arginine in the active site of the enzyme.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 69
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2fbwB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2fbwB01
2DBYA 1JROA 3CWIA 3HUIA 3AEGB 2PVGC 4N6EB 1JQ4A 1JRPA 4IDIA 4FXCA 5H92C 4N59A 2MJEA 3RPFC 3NS1A 1GTHA 3CIRB 2QJLA 3W5UB 4ZHOA 2AX5A 1FXAA 1V8CA 1YQ4B 3AE9B 2Q5WD 4US9A 1L0VB 3W5VB 3AECB 1FIQA 1XLOA 4JX1C 1L5PA 3B2FA 4ITKA 3NVYA 4JWUC 1PFDA 1OQQA 1IUEA 1N5XA 2W3SA 3VR9B 1JW9D 3P4QB 1KF6B 1FM0D 1SF0A 2M56B 4YSYB 2PIAA 1QOBA 1NI3A 1RFKA 1WRIA 3AN1A 1DOXA 2K22A 1N62A 3NVVA 1NYRA 3AH7A 1FRRA 2B76B 3P4RB 3VRBB 1FRDA 1I7HA 3PO0A 3DWMA 3AE1B 3B9JA 1QLBB 1QOFA 1T3QA 1DGJA 1PUTA 2PVOD 1KFYB 3DWGC 3KWLA 1GPXA 2Y5CA 3AE8B 3AEDB 2CJNA 3NVWA 1FMAD 4HROA 4WQMA 1QF6A 1TKEA 1WWTA 5G5GA 2N0SB 1SB3C 1WGKA 3P1MA 3P63A 2BS2B 2W55A 2LEKA 5AUIA 1FO4A 3EUB2 1E0ZA 1OFFA 2JQRB 3L4PA 5GXGB 2FBWB 3AE2B 1N60A 3B2GA 1DOIA 2WU2B 1YJIA 4YT0B 1AYFA 1RM6C 1E7PB 1V97A 2MJDA 2E3TA 3CF4A 1E6EB 4YTMB 3P4SB 1EWYC 2L52A 2WQYB 3AV8A 3LB8C 1ZOYB 4YTPB 1TKGA 2PKOA 4JWSC 4US8A 2CU3A 1AWDA 3VRAB 2OHFA 3FC4A 4YSXB 1N5WA 1QOGA 2BS4B 1WXQA 2M19A 4ZOHC 2MJ3A 5EE3A 1A70A 3AE4B 1RYJA 1VLBA 1YJJA 4A9AA 2QIEB 1N61A 1FFUA 2ACZB 2BS3B 3AE5B 1NVID 3SFEB 3VR8B 1XO3A 1YQ3B 2BT6A 2EKIA 3AE7B 3NRZA 1GAQB 1NYQA 2K9XA 4P6VF 1SIJA 1TKYA 3BIID 3FAHA 4ZHPA 4WWMA 1XLNA 3ZYYX 1QOAA 1H7XA 4YSZB 2DWQA 1N63A 4USAA 5EE9A 1B9RA 2WP9B 2K5PA 4C7ZA 5EE1A 3AEFB 2W3RA 1RWSA 4HRSA 1JWBD 1VDVA 1FFVA 5AUKA 2CJOA 1E9MA 3WCQA 3AEAB 1UWMA 1VJKA 1XLQA 2WS3B 1PDXA 4KX6B 1J7CA 2G1EA 3AM9A 2W54A 3AEEB 2L83A 1CZPA 5C2TB 1GT8A 1XLPA 5G5HA 1GTEA 3W9CB 2JX5A 3HVZA 4LTUA 1J7AA 3AE3B 2WU5B 4N58A 4YXDB 1JWAD 2WDQB 3ETRA 1R7SA 1J7BA 1WYGA 4C80A 1E10A 3AMZA 1DOYA 5MPOA 2H88B 3SR6A 1ROEA 1H7WA 1NENB 3ABVB 3AEBB 1L6VA 1ZXIA 1ZP0B 3LXFA 3AB5A 4YTNB 1KRHA 1TJEA 2WDRB 2WLBA 3HRDD 1L6UA 3AE6B 1OQRA 3NVZA 2MH7A 4C7YA 3SFDB 2WDVB 2H89B 3P4PB 5H8YE 1NEKB 1FXIA 1F0ZA 5C3JB 1TYGB 1QT9A 2HTME 1JALA 2KAJA 2KMMA 1ZUD2 5EE0A 1CJEA
chains in the Genus database with same CATH superfamily
3TEXA 1K50A 1P98A 4ASWC 4US9A 2GBKA 3AXCA 1L5PA 3ZTCA 2W3SA 4Q2JA 1FCCC 1QOBA 3SD5A 4TSSA 3E56A 4RH6A 3PO0A 4LJOB 4F7ZA 1WX7A 1QOFA 1DGJA 3VUYA 3A1QB 3UIOB 2L32A 1L0XB 4M02A 2V4LA 3A9JB 3HM6X 1BT0A 3B2GA 3A4RA 2MA9B 2MJDA 1E7PB 2PJHA 4B95A 1WYWB 3EGRA 2LD9A 1PGBA 2KWDA 3RUIB 2PKOA 2V4IB 2CU3A 2K25A 3ZIMA 2WXRA 3EHVA 2X8XX 4ZHPA 1FFUA 1SE3A 2DYMA 4BBNF 2IDYA 3I63C 2JRIB 4JL9A 3ZLZA 1WXSA 2O6VD 4DXAB 1E8YA 4HPPA 3AEAB 3DBRI 4K1RB 1MG4A 2MP2A 4KKJA 4KSKC 3P42A 5C2TB 1WGRA 4NJCA 2AWTA 3Q8CA 4WWNA 1E7VA 4II2B 2LASA 4YL8A 1H7WA 3QIJA 4HXDA 2Z0DB 1IYFA 1HEZE 3H8HA 1V1PB 3Q14C 2WDRB 2RDHA 3AE6B 4IWOA 1ET6A 2KOXA 3AEGB 2KC1A 3PS6A 4DDGD 4I6NB 3OWEB 4L1BA 3DVNU 2KZRA 4RGMA 2MCNB 2BKFA 1KF6B 2VZKD 2MLBA 3VUWA 3AH7A 2D2QA 1FRDA 4DXGA 4XX5A 2GLSA 1OQYA 3DWGC 3N1ZC 2KACA 3PRPB 1SEBD 1FO4A 2N9LA 2BWFA 1ZE3D 3BVGA 2MW5A 2BVCA 3RYTA 3M3JA 3M63B 1ESFA 2NTSA 2KQ7A 2KJHB 1C79A 2I38A 3AV8A 4XDDA 5E6NA 4W9DA 5EE3A 1VLBA 1I4GA 4HDOA 3GOEA 2ON8A 4EKUA 4HKQA 4IUMB 2KDFB 3Q8EA 1E7UA 5E6JA 3N3KB 1XXGA 2FNJB 1PGAA 3PT2B 3RZWC 1D5ZC 2WXLA 2W3RA 3ZXRA 2MP2B 1JWBD 5AUKA 2N9KA 2J42A 4GMVA 2IBIB 3RMKC 2I1JA 3O65B 1K53A 4N58A 3ETRA 4E71A 4A6QA 4M0WA 3VTUA 2IZVB 1I4RA 1L7YA 3DPDA 4BKTA 3IT4B 3RNFC 2KDEB 3I5JC 5H8YE 2RGFA 2CR5A 5C3JB 1ZUD2 2MBBB 2RR9A 1VCBA 2AL6A 2Z0EB 1EO6A 2FAZA 1UZXB 5LNK1 3QA8A 1C4PA 1HA5A 5J17A 2MBHA 2KDBA 5FR6A 3VVWB 3VR9B 2WXQA 1YJ1A 1G6JA 4LNNA 5HG2A 1MPEA 5JHAA 2OOBB 2PVOD 2ZNVB 1IGCA 3HK0A 4GXBA 1QF6A 1WWTA 3B08A 3DBLI 2KDIA 2MRPA 2LEKA 5GXGB 2FBWB 3AE2B 3KH0A 1GJZA 1YJIA 4IM3A 3PRZA 2WXJA 3KWVA 5T8IA 3ZW3A 4UDUC 1C3TA 4MGKE 4MGIE 4PS8A 3WAOA 1MI0A 1BXTA 4IWQA 3RFZB 4IWPA 2JWZA 4XWWA 3AE5B 1MHXA 3PRMB 3KW5B 5KHQA 1A5RA 1D3ZA 4P6VF 3ZNGC 4OVUA 3TEZA 3TBLD 4WH4A 4C4VA 2V3PA 1TS3A 4HRSA 1V1OA 4XZ4A 5D3IB 2G1EA 4ZYSA 2FE8A 4M0WB 4BAXA 3A9KB 2Y5PA 4RM9A 1JWAD 1J7BA 3AMZA 4XDCA 2RSUA 3C8YA 3WAPA 2BYVE 4NNJB 3AB5A 1SJHD 1TS2A 3BINA 2KLGA 3HRDD 2GRIA 2QILA 2H89B 2ZJDA 4A55A 1TY2A 1GUAB 1JALA 1YQBA 1CJEA 3AU4A 4N6EB 1P0RA 2J0KA 3DOWA 4N59A 5H92C 3DDCB 3MP9A 4EFOA 4IG7B 3I9V1 4ITKA 4EEWA 2M56B 3DQVA 2LI5A 3IG3A 4MACA 2N9EB 1T0RC 4JQWC 2D3AA 1LXDA 4I6LB 1FMAD 3VHTC 2N0SB 2X38A 3QHTA 2Z8LA 1QILA 2K0PA 4TQ0A 2HD5B 4WJNA 4RGOS 2IO2B 4GN1A 5L95C 4NZLB 2DLBA 3ZRCA 1E8ZA 4DHZB 2D07B 1YJJA 1N61A 1VD2A 2UYZB 1SE9A 1YQ3B 3T3OA 2KFKA 1YNTE 2JZ3B 4C4VB 4WJOA 1F2RI 2KXJA 1WJNA 1R4MI 3H1UA 1E90A 2NBWB 3DVNV 4C7ZA 3AEFB 1YN5A 2WX0A 1VRAB 2EELA 2CJOA 4BKSA 3UI3A 1TGZB 2PLPA 4KZ0A 3L54A 2KJ6A 2BWES 2BYEA 2LGDA 1ET9A 3ENEA 1GTEA 2JX5A 1UBIA 1N6ZA 4C80A 2WXHA 3DHHC 1JWMD 4BKGA 4LJPB 2PMVA 2KYWA 3KYCD 4MGYE 3RNAC 5DPWA 2WLBA 1L6UA 4LNIA 1XCQL 4HVBA 1C77A 2JXXA 2BBCA 3DBHI 3AULA 5EE0A 1UELA 4IDIA 1PYWD 3ECIA 4GDLA 1VR9A 2DZIA 1FIQA 4JX1C 3TEWA 1V5OA 2DZJA 4MJSA 4ANVA 1OQQA 1FM0D 2DX5B 4YSYB 4MM3A 3ZKJC 4F8CB 2N1WA 4DDID 2V3SA 1EM7A 3VRBB 4X57B 4W9FA 1UGMA 5CHVC 3MC0B 5HFYA 1TKEA 2AQ2B 3ZRFA 3VFKA 1WGKA 4W9LA 2W55A 3SHQA 3SDLC 2IY0B 4KDLB 5CX3A 3L4PA 4ZRKA 2WU2B 4GOCA 3OJ3A 3U30A 4YWGG 5TSSA 1TTNA 2GI9A 4XWTA 4OZAA 4LNFA 4RMAA 2L0FA 4G0NB 3EECA 3UINB 3BYYB 2J4XA 1FEHA 2KFKB 2DNFA 3V62A 5JXVA 2QEJC 4JIOU 4A3PA 5E6PA 4AJYB 1WFYA 3GZNB 1NYQA 1HXYD 4LCDE 4WWMA 1WM3A 1MHHE 5LXHA 2NTTA 2K5PA 1ZDVA 3VTVA 4MH0E 2IGDA 1FFVA 1I4PA 3NJTA 3MC8A 2HE7A 1IP9A 3EA6A 2K8BA 2WXPA 4RCOA 2WDQB 1E8WA 1SE4A 3R2TA 2L0TA 4HEA1 3SEBA 3O13A 2EMTA 4ARIA 2XN9C 4GDLB 3P2BA 2PPHA 4P16A 2JYTA 2MSED 2GMIC 3PREA 4MJSB 4P1BC 4MM3B 4II3B 3QC8B 1PFDA 1BMLC 1V9JA 5D6JB 1JW9D 3P4QB 3RN9C 1NI3A 5J2RA 3M95A 1L2NA 1GB1A 5G2NA 1FCLA 2HTHA 4GB9A 4AP4C 4WQMA 1T0SC 2BS2B 1UUPA 2KWCA 1OFFA 1VZ8A 1MJDA 1WE7A 2BYTA 4CQNA 2LFIA 3ZJUA 2FIDA 1E5WA 1Q5WB 3T9LA 3L0WB 3I3TB 2SEBD 3RT3B 4ZOHC 3V60A 4AS1A 3BY4B 1R4NI 3AE4B 1RYJA 1F52A 1H8CA 3SFEB 4DHJB 3IAS1 3T3NA 4IKGA 4RF1A 3NG0A 3PVLA 2IPKD 1WY8A 3HM3A 4KGRA 4KGTA 4USAA 2WP9B 3ML8A 1F2RC 3QQ8B 1V86A 1WMHB 1YN4A 2INPE 1J7CA 2XK5A 4MSQB 4ZDVA 5CHWA 1SBBB 1CZPA 3H9DA 4TKNA 4EZJA 1EWCA 2AL3A 2LJIA 4LTUA 1I42A 1WYGA 3ONSA 2H88B 4A3OA 2GBMA 3L13A 3P4PB 2OJWA 3DVGY 1TYGB 1QT9A 2KMMA 3DBRB 2JRHA 1P9DU 4WQOB 1I35A 1JQ4A 3TEYA 1BUIC 2INCC 2QJLA 3RNCC 3AE9B 1XF5L 1FD6A 4IM2A 1L0YB 3GS2A 2ONQA 2WXFA 3N1YC 4FBJB 1L4ZB 1WRIA 2KK8A 4FJYA 4LK0M 2IGGA 1XT9B 2DZMA 3H7SA 4R3DA 3R8BA 2DAJA 5JHBA 3P63A 1S1QB 2G45B 4M8NA 2ZEQA 3BK2A 4W9CA 3T8MA 1WXMA 1L4DB 3BZDB 1P1AA 2N1VA 1WZ0A 4BOZB 1KOTA 2JF5A 2KVZA 3WANA 1Z2MA 2KD0A 2REXA 3Q3JA 3DCGA 2YLMA 1GG3A 4BKSD 2BS3B 4GU2A 1C1YB 2CHZA 2K9XA 2RDBC 2LUEA 1NDDA 2ZPYA 1J8CA 2FCSA 3RI7C 2VH2A 4L23A 2R61A 3K9PB 3PZ8A 1KTKA 5DPSA 1GNUA 4WJPA 3IT6B 4NAWA 4B9KA 4NJ7A 2LGXA 3JVZX 1K51A 4ZRJA 5FR3A 2WU5B 2C7HA 2M17A 3Q69A 2L8JA 2TSSA 2WXMA 1DOYA 1OEYA 1L6VA 2HDEA 5BMGA 2FCQA 2V1YA 1OEYJ 5BMIA 2ZCBA 4C7YA 2KVRA 4HCNB 1C4AA 1QKZA 5LXIB 2EMSA 1JRPA 2BW2A 4GLSC 3RPFC 3MFGA 2AX5A 5IP4D 1PQSA 2KHWB 2LGIA 3V61A 1ISNA 2HJ8A 1IUEA 2K1FA 3QWZB 4K3BA 2K6DB 2KFJA 2Y5BB 3ZQ4A 2WGSA 1P3QU 1WI0A 4BVUC 3AE1B 1TT5B 1PUTA 5IKCM 1I4XA 3AE8B 2CJNA 2KMAA 5LLIA 4A90A 1EU3A 1XEEA 3FKYA 2R2QA 1AN8A 4PS7A 5KHOA 2JPHA 4S0RA 3V6EB 1QZEA 4ANWA 2D5GA 4ICVA 4YTMB 1EWYC 2N9XA 3Q8BA 4DHJD 2OJRA 1TKGA 4JPSA 4I6PA 4JWSC 2MBEA 2BGFA 2LGSA 3DVGX 1AW7A 3ZTDA 1K52A 3SU8X 2FUG1 3A33B 3RCZA 3HVDA 3V3XA 3N30A 2M4NA 4AJWA 1HZ5A 4WJQA 1XQQA 2ZW1A 2M8SA 5EE1A 4NAWB 1SJED 1LO5D 2WS3B 4KX6B 2RPQA 5D7GA 2KDMA 1SIFA 3AEEB 2ZVOA 2AQ3B 3PPAA 3W9CB 1TZOA 1KJTA 2LXAA 4C00A 2VH1A 2L1AA 5MPOA 3SR6A 1WSPA 2J52A 4ANXA 5EDSA 2QHOA 4J6IA 3NZSA 4MH8A 2CHXA 1FXIA 2D10A 2KAJA 2M0AA 2LHDA 3HUIA 1D5MC 2KTRA 1P7FA 4KVGB 4DBGA 2AYOB 5DPRA 2LJ5A 2J7QB 3B2FA 2WXGA 3BVMA 4BFRA 3EFUA 2OEDA 4ZRPA 2PIAA 1SF0A 3H6NA 1DOXA 4XGAB 1ZPSA 2PTLA 5AZHA 3X23A 2LZ6A 3ZUNA 3OLMD 1HE8A 3B9JA 1OGWA 3KWLA 1DYQA 4P1CC 3U7DA 1SB3C 3Q3MC 3D32A 4TMAB 5AZFA 1N60A 4GIVA 1JCKB 2E3TA 5IA7A 1U4AA 5IN7A 2WQYB 3NS8A 3VRAB 1GB4A 4K3CA 1NVID 1JWSD 3VR8B 2LUMA 1YMHE 2QCZA 2JWUA 3DHIC 1MFWA 2O6VA 4FULA 2YVCA 1TS4A 2LVQA 2D3CA 2C7MB 1Q10A 4OZBA 1WJ4A 1IPGA 3WALA 4W9JA 4LNOA 4M8MA 1VJKA 3LDZE 4B0MA 4KDIC 3WAMA 2KX3A 3NY5A 4ZRIA 3N20C 2JSVX 2KTFA 1XLPA 2L7RA 5G5HA 1J7AA 1LGRA 3EFCA 1V2YA 1R7SA 4NY0A 4WAAA 1J19A 5TR5A 1R4MB 4YTNB 1D6EC 1E8XA 4WIPA 1H4RA 1OQRA 2J0JA 3NVZA 1ZDXA 3AI5A 2V3NA 2KWVB 1JRUA 1YX6B 1M94A 1V6EA 2IYDB 4L2YA 4REZA 4FLHA 3UIPB 1TY0A 1ZGUB 4ZHOA 1FXAA 1TZ1A 3ZVVA 2LRWA 4W9KA 5HI1A 2BKRB 4KSLC 2BF8B 2WDTB 4GDKA 4EZKA 3R3MA 3WA0A 1MVKA 2MHJA 3PLVA 2K22A 3NUHB 3P4RB 4E3CA 2LXCA 3DWMA 1IBXA 5AZGA 1HZ6A 3C0RB 4A20A 4URKA 3DBHB 4ACFA 4W9GA 2AEHA 3JYUA 1EU4A 3PHWB 2K8CA 1QQRA 3ZNID 4F1SA 1V80A 2FIFA 2J0MA 3P4SB 1TIFA 2WXKA 3LB8C 5C23A 3PV1A 4YTPB 1KLUD 4FHJA 2ZZPB 4M01A 2BS4B 2O6VB 2ACZB 2G3QB 3V05A 4HDQA 2EKIA 3AE7B 2MEKA 4RGNA 1UWXA 2NBUA 2RMMA 3FAHA 1XCTL 1QOAA 4KV2A 2BQQA 1F1HA 3Q8FA 4AWJA 3RNGC 2LMCA 1RWSA 1VDVA 3Q6BA 3LYYA 5BYSA 1PDXA 1WXAA 4IM0A 2L83A 3IVFA 1GT8A 4OVVA 2NMQA 2JXTA 4TQ1A 1UBQA 1WZ3A 3Q3FA 4WAFA 3BWUD 1ZP0B 3LXFA 3M62B 1OTRB 5J18A 2ZVNA 5DCNA 4WURA 3PZ7A 4ZRQA 4ZYNA 1F0ZA 3UF8A 3RZFA 3KQ4A 1P7EA 3ZO5B 2NS5A 1UH6A 3K9OB 2N7EA 3MHSD 1TS5A 3H7PA 3NS1A 5BYQA 4GDKB 2PE6B 3X0WA 2Q5WD 2UU7A 4PYZA 1IBXB 3IXSA 1SGHA 4FJVB 2DHZA 3B1LX 3NVVA 2XNAC 2DENB 4W9IA 3HIZA 2FCNA 1V49A 4EOYA 1EUVB 4KZCA 3BK1A 3VTWA 2LGYA 1DOIA 4K7WA 1HTQA 5E6OA 2KMCA 4IC7B 2N9PC 1C78A 1WGGA 1Z5SB 1KH0A 3FC4A 1FPYA 2MJ3A 1XD3B 3PSEB 4A8XC 2Y3AA 1C9FA 2JU6X 3B0AA 1FNVA 3V6CB 1UNSA 2XEWA 4KKIA 4K7SA 1N63A 1SE2A 1B9RA 2R2OA 4E74A 3ZJVA 2WXIA 3VH4B 4DQOC 3JW0X 4M00A 5L83A 3URYA 3QARA 1R4NB 2MWSB 3VAWA 2BPSA 2KX0A 2K3UA 2PW9A 1YOVB 4NPNA 1HTOA 3J9CA 2G4SA 3QX1A 1JWUD 4IW0A 4MEMA 4HKZE 2DZKA 4W9EA 2WDVB 1FNUA 3PHXB 1GC6A 1V81A 3H7PB 4N9F4 3AM9A 4S17A 3MC9A 2PVGC 4KIKA 5IOIA 4FXCA 4CO7A 4WWPA 2WXNA 3W5UB 1YQ4B 1NBFC 4G11A 1AARA 1FXTB 3NVYA 3MHZA 1WR6E 3PGEA 3R7RA 1N5XA 4HJGE 1SXTA 1RFKA 2V0GA 3TJPA 3W1SC 1N62A 1WGDA 2B76B 1C76A 5FK9C 1J0GA 1GPXA 4P7IA 3KYDD 4MDKE 5AUIA 1Q0WB 1WJUA 1AYFA 2I2YA 3QK0A 4EZLA 2NBVB 2JZZA 2B3AA 1WRDB 2K39A 1QOGA 2WWZA 3QJZA 3APCA 4PK1A 3KUCB 3WIMA 3ML9A 2INDC 3DBSA 1TKYA 4B6WA 3GE8C 3ZYYX 1H7XA 5EE9A 2QC8A 1KLVA 1K8RB 4GGQA 3N9YC 2M0XA 2BB5A 4LDTB 1LM8B 2KWUB 1E9MA 3PTFC 1UWMA 2KT7A 2XBBC 3HHMA 3HVZA 3AE3B 3VDZA 4TUUA 4HJKA 3ZNHB 2ZW0A 3CSTA 3APFA 1UF0A 1KRHA 3Q8AA 1YIWA 1ZXHA 4EUTA 1LQBA 4ICUA 5BMHA 2XK5B 4KIKB 2UWQA 1NEKB 4CYEA 4XYCA 2PEAA 4FJZA 3KUDB 3ZJTA 1TBEA 2DBYA 5IO9A 1WE6A 2LHEA 1CK1A 2MJEA 3L16A 1KLGD 3CIRB 1YN3A 1L0VB 3W5VB 1XLOA 3RNBC 1I4QA 4JGHB 3I57A 2JYEA 4MELA 1WJ6A 4FHKA 2Z59B 1I4HA 2YEPF 3APDA 3R2IA 1QLBB 4W9HA 1KFYB 3UQAA 4XE0A 2N7JA 5G55A 3GP7A 1E0ZA 3FILA 2IJ0A 1GC7A 3R66C 3Q2AC 2NR2A 3ZNZB 2L05A 3CF4A 5HKHA 1E6EB 2L52A 2EKEC 2MBOA 2JZPA 1AWDA 4J3OD 4JLCA 3IFWB 3JSVA 3U4EG 1A70A 3KLSX 4MGZE 1T5XD 2SAKA 3U8ZA 3L10B 2IGHA 4HCPB 3A9KA 1HQRD 2A4ZA 2C9WB 1T0QC 3QCAA 2DWQA 3W1YA 1Y8RC 3TIXA 3IAM1 2WXOA 2K8HA 1WGYA 4RNAA 3E9SA 5DPTA 4DXFA 3NHEB 1ENFA 2C7NB 3NZUA 2YEPB 2CU1A 1WXVA 2ASQA 4YXDB 2V9HA 3DBLB 5D94A 3TMPB 3UQBA 2KQSA 1ROEA 2BB6A 5IAAC 4NQKE 4FN2A 3W2DA 1ACCA 2WHIA 4KGSA 1D4BA 4K7UA 3PZDA 3MJ5A 1M4VA 2WYQA 3TUOA 2HTME 4NAMA 3CWIA 1X1MA 4HLEA 5FKAC 1GTHA 2I1KA 4JE3B 2PE9A 1V8CA 3N32A 4DK5A 3AECB 3C19A 4JWUC 3ALBA 4G3XB 4ARCA 2RPVA 1RAXA 2WX1A 3Q3NC 5D2MB 2WNMA 1NYRA 2LVPA 1FRRA 1UGJA 3VUXA 1I7HA 2IO1B 2ZCCA 2KN5A 2QMTA 3TSSA 2KO3A 1T3QA 4RFBA 4RF0A 4WWOA 2KNBA 2G4DB 3FILB 4HROA 3AEDB 3BYTB 5G5GA 4PT5A 3ZXVA 2DAFA 4DWFA 1WX9A 2QSDA 1Q1OA 5D3DA 2N7DA 2HJ1A 3W1SA 3JSVB 3BVZA 3LJ3A 1ZOYB 4MSMB 5JH5C 4US8A 1KM7A 5I4DA 3CF6E 1N5WA 2M19A 4G50A 4A9AA 3U52E 4LDTD 1XO3A 3TL5A 4HK2A 1SIJA 2ICIA 3QAQA 2L00B 3BIID 1PGXA 2CS4A 1XLNA 2DYBA 1WX8A 1NI2A 2W82A 4K81A 3CSFA 3IBEA 2GBRA 1JMLA 1CQVA 1WM2A 4LNKA 4FADA 1XLQA 2A5UA 2D3BA 4OW0A 2W54A 5CHFA 1S3SG 1C4CA 3AU5A 1E10A 2KANA 3ZGZA 3AEBB 1TJEA 2NVUI 2NPTA 4BBNC 3OJ4B 4OZCA 2CHWA 5CTRC 2J53A 1STEA 3KVFB 4BOSC 4RM8A 2RDGA 1F77A 1EF1A 4RGTA 3MTNB 3AN1A 1ZW7A 1RLFA 2KTRB 2BYFA 2GB1A 2GBNA 2JT4B 3R7QA 4PS3A 3P1MA 4B0EA 3MJWA 2JQRB 2M1MA 3OAWA 3NOBA 2O2VA 1RM6C 1YX5B 1V97A 4AUQC 2LWPA 2GBJA 4NJ6A 2JY6A 2D3GA 4GSWA 4YSXB 1RFAA 2KKCA 4HPLB 1IGDA 4AQ7A 3A4SC 3TCAA 2K6QA 3U2SC 3NRZA 4IOIE 5AEKB 2KLCA 3S2AA 4AOFA 2AQ1B 4QAYA 2JVCA 3EC8A 3WCQA 1WGHA 3L08A 2W9NA 1UD7A 3NZ3A 3DHGC 2LVOA 5BO4B 3ZDTA 3VXWA 4H2AA 5JZEB 2MX2A 2JUOA 2KQ4X 1T6BX 2E6XA 2NPTB 3IHPC 3PLUA 3ZDMC 5GMVA 2L3ZA 4HPMB 2CKHB 1JROA 4DHZE 2ZNVC 4O1NA 1D5XC 2KC2A 2GOWA 4C56C 1V5TA 3L17A 3RD2A 1WR1A 3VQIA 4D2KA 2KJRA 2QDFA 3VH3B 3Q3OC 2KN4A 3GE3C 1B1ZA 2N4FA 4OVZA 2DYOA 1GOZA 4TV3A 2Y5CA 1YD8U 3NVWA 2O2VB 1WH3A 2L76A 2VZKB 3GZNI 2MQJA 3EUB2 3A1QA 2MBQA 2D11A 2BTEA 3A9JA 1CMXB 4YT0B 1F9JA 2C60A 2NCNA 1VZ7A 1Y56A 3RNEC 3OG5A 1LFDA 2C5LC 5HHDG 2OHFA 1EF5A 2G9HD 1WXQA 2IY1B 1SSNA 1WMHA 2QIEB 2BT6A 5C1ZA 1GAQB 3N1XC 1WF9A 5BYRA 4CHKA 4HWIB 1MG8A 1ZKHA 4YSZB 4BZAA 2IO3B 4ANUA 2LRUA 4MT5A 4OHJA 1VZ6A 2FUHB 4NQLB 1T0YA 3KUZA 4PYUA 3CMMB 1NENB 3RULA 3ABVB 1ZXIA 1RRBA 3UGBB 4FA6A 2INNE 1WIAA 4LLGM 2MH7A 2VRRB 3SFDB 2RD0A 4EE2A 4XC2A 2ZPNA 1V1PA 2FCMA 1FNWA 3U7ZA 3GB1A 2IO0B
chains in the Genus database with same CATH topology
2DBYA 3TEXA 3HUIA 1D5MC 4IDIA 1P7FA 1PYWD 2LHEA 1CK1A 2MJEA 1KLGD 1K50A 1VR9A 3CIRB 1YN3A 4US9A 1L0VB 3W5VB 1XLOA 1FIQA 4JX1C 3TEWA 1I4QA 1L5PA 2WXGA 3B2FA 3BVMA 1OQQA 2W3SA 3I57A 4Q2JA 2OEDA 4ZRPA 2PIAA 1FM0D 1SF0A 4YSYB 1FCCC 1QOBA 2JYEA 1DOXA 1EM7A 3VRBB 1ZPSA 1I4HA 2PTLA 2YEPF 4TSSA 3E56A 4RH6A 3PO0A 3R2IA 3B9JA 1QLBB 1QOFA 1DGJA 1KFYB 3KWLA 3MC0B 2L32A 1L0XB 1DYQA 4XE0A 5HFYA 1TKEA 2AQ2B 1SB3C 1WGKA 2N7JA 2W55A 3GP7A 1E0ZA 4TMAB 3FILA 3L4PA 3B2GA 1N60A 2IJ0A 1JCKB 2WU2B 2MJDA 1E7PB 2E3TA 4YWGG 5TSSA 3CF4A 1E6EB 2GI9A 2L52A 4XWTA 4OZAA 3EGRA 2WQYB 1PGBA 2JZPA 2KWDA 2PKOA 2V4IB 2CU3A 1AWDA 3VRAB 3BYYB 4J3OD 2J4XA 1FEHA 2WXRA 1GB4A 3U4EG 1A70A 3KLSX 5JXVA 1NVID 1FFUA 1JWSD 4ZHPA 1SE3A 2DYMA 3VR8B 2LUMA 1YMHE 2QEJC 1T5XD 2JWUA 2SAKA 2IDYA 1NYQA 2IGHA 1TS4A 1HQRD 1HXYD 4WWMA 1Q10A 4OZBA 2DWQA 1MHHE 2NTTA 2K5PA 1ZDVA 3IAM1 2WXOA 2IGDA 1FFVA 3AEAB 1VJKA 4B0MA 1I4PA 4RNAA 4KKJA 3P42A 3E9SA 5C2TB 4DXFA 2JSVX 1ENFA 1XLPA 3EA6A 5G5HA 2WXPA 2YEPB 4NJCA 1J7AA 4RCOA 3Q8CA 4YXDB 2WDQB 1R7SA 1SE4A 3R2TA 1ROEA 1H7WA 4HEA1 3SEBA 2BB6A 3O13A 1HEZE 4YTNB 1D6EC 3H8HA 1V1PB 2WDRB 3W2DA 4WIPA 2RDHA 4ARIA 1OQRA 3AE6B 1ACCA 1ZDXA 3NVZA 4KGSA 2XN9C 1D4BA 2V3NA 3MJ5A 1M4VA 4GDLB 3TUOA 1ET6A 2HTME 4NAMA 4L2YA 4REZA 3CWIA 3AEGB 4P16A 2JYTA 5FKAC 1TY0A 1GTHA 3OWEB 4JE3B 4L1BA 4ZHOA 1FXAA 1V8CA 4MM3B 5HI1A 3AECB 4RGMA 4JWUC 1PFDA 1BMLC 4ARCA 2RPVA 1JW9D 3P4QB 1KF6B 2VZKD 1MVKA 1NI3A 2K22A 3NUHB 2WNMA 1NYRA 3AH7A 1FRRA 3P4RB 1UGJA 1FRDA 1I7HA 2QMTA 4DXGA 3DWMA 1IBXA 3TSSA 1GB1A 1HZ6A 1T3QA 4RFBA 4RF0A 1FCLA 3DWGC 3FILB 4HROA 3AEDB 3BYTB 4WQMA 5G5GA 1EU4A 4PT5A 2KACA 1FO4A 1SEBD 2BS2B 1UUPA 2N9LA 1ZE3D 3BVGA 1OFFA 1VZ8A 1QQRA 2QSDA 5D3DA 1ESFA 2NTSA 4CQNA 2BYTA 2LFIA 3ZJUA 3P4SB 1C79A 2WXKA 2I38A 3U7ZA 3W1SA 3AV8A 3BVZA 3LB8C 1ZOYB 4YTPB 4XDDA 1KLUD 4US8A 2SEBD 5I4DA 1N5WA 4ZOHC 2BS4B 2M19A 4AS1A 4A9AA 5EE3A 1RYJA 3AE4B 1VLBA 1I4GA 3U52E 2ACZB 3SFEB 3V05A 1XO3A 2ON8A 2EKIA 3AE7B 2MEKA 3IAS1 4HKQA 4RGNA 1UWXA 4IKGA 3T3NA 1SIJA 2ICIA 4RF1A 3BIID 3Q8EA 2RMMA 3FAHA 2IPKD 5E6JA 1XCTL 1PGXA 1XXGA 1XLNA 4KGRA 1PGAA 1QOAA 3Q8FA 4KGTA 4USAA 2WP9B 2W82A 1D5ZC 2LMCA 2WXLA 2W3RA 1RWSA 1F2RC 1JMLA 1JWBD 1VDVA 5AUKA 1CQVA 2N9KA 1YN4A 2J42A 3LYYA 5BYSA 1XLQA 2INPE 1PDXA 1J7CA 4OW0A 2W54A 1SBBB 2L83A 1CZPA 1GT8A 1K53A 1C4CA 1EWCA 2LJIA 4LTUA 4N58A 2NMQA 3ETRA 4A6QA 1WYGA 4M0WA 2JXTA 1E10A 4TQ1A 4WAFA 2H88B 3ZGZA 3AEBB 1I4RA 3BWUD 1ZP0B 3LXFA 1TJEA 3IT4B 4WURA 3PZ7A 4ZRQA 3P4PB 5H8YE 1F0ZA 5C3JB 1TYGB 3KQ4A 1QT9A 1P7EA 2KMMA 1ZUD2 4OZCA 1JQ4A 2J53A 1TS5A 1STEA 3NS1A 5LNK1 3TEYA 1BUIC 1C4PA 2QJLA 1HA5A 5BYQA 4GDKB 3AE9B 1XF5L 2Q5WD 1FD6A 1L0YB 3GS2A 2ONQA 2WXFA 3VR9B 2RDGA 1F77A 2WXQA 4RGTA 1IBXB 3IXSA 1L4ZB 1WRIA 3AN1A 5HG2A 4LK0M 3NVVA 2M0AA 2IGGA 1MPEA 2XNAC 4R3DA 2PVOD 3R8BA 2GB1A 1IGCA 1QF6A 1WWTA 3BK1A 3P63A 3P1MA 2LEKA 4B0EA 2JQRB 3BK2A 5GXGB 2FBWB 3AE2B 1DOIA 1L4DB 1YJIA 3BZDB 1RM6C 1V97A 2WXJA 3KWVA 5T8IA 4UDUC 1C78A 1KH0A 1MI0A 1BXTA 4YSXB 3FC4A 3RFZB 2MJ3A 1IGDA 4XWWA 4AQ7A 2BS3B 3AE5B 1MHXA 3U2SC 4A8XC 3NRZA 2K9XA 2Y3AA 4P6VF 4IOIE 1C9FA 2JU6X 1FNVA 3TEZA 1UNSA 4KKIA 4WH4A 1N63A 1SE2A 1B9RA 2V3PA 2AQ1B 4L23A 1TS3A 4HRSA 2R61A 3ZJVA 3PZ8A 1V1OA 1KTKA 2WXIA 4DQOC 3WCQA 3IT6B 3URYA 5D3IB 2G1EA 3NZ3A 4ZYSA 2FE8A 2Y5PA 1K51A 5FR3A 2WU5B 2K3UA 2PW9A 1JWAD 4H2AA 3Q69A 1J7BA 3J9CA 2TSSA 2WXMA 2KQ4X 1T6BX 2E6XA 3AMZA 4XDCA 1DOYA 3C8YA 1L6VA 1JWUD 2HDEA 3AB5A 1SJHD 1TS2A 5BMGA 3HRDD 4HKZE 2GRIA 2QILA 5BMIA 4C7YA 2WDVB 2H89B 1FNUA 4A55A 1C4AA 1TY2A 1QKZA 1JALA 3AM9A 1CJEA 1JROA 4N6EB 2PVGC 1JRPA 2BW2A 4FXCA 4GLSC 5H92C 4N59A 3RPFC 3MFGA 2WXNA 3W5UB 3MP9A 2AX5A 2LGIA 1YQ4B 4O1NA 1D5XC 3I9V1 4ITKA 4C56C 3NVYA 3MHZA 1IUEA 1N5XA 4HJGE 1SXTA 2M56B 3VQIA 1RFKA 4D2KA 2V0GA 3ZQ4A 1N62A 4MACA 2KN4A 2B76B 1B1ZA 4OVZA 1C76A 5FK9C 3AE1B 2DYOA 1GOZA 1PUTA 1GPXA 1I4XA 2Y5CA 3AE8B 2CJNA 3NVWA 1FMAD 4A90A 1EU3A 2N0SB 1XEEA 2VZKB 2X38A 5AUIA 3EUB2 1AN8A 2Z8LA 2BTEA 1QILA 2K0PA 4TQ0A 4YT0B 1AYFA 4RGOS 2D5GA 2I2YA 4YTMB 1EWYC 3Q8BA 4NZLB 1VZ7A 1Y56A 2DLBA 1TKGA 4JPSA 4JWSC 5HHDG 2OHFA 2G9HD 1QOGA 1WXQA 1YJJA 1SSNA 2QIEB 1N61A 1AW7A 1YQ3B 1K52A 2BT6A 3T3OA 2FUG1 1YNTE 1GAQB 3HVDA 1F2RI 3V3XA 1TKYA 1HZ5A 5BYRA 3ZYYX 1H7XA 4YSZB 5EE9A 3N9YC 2ZW1A 2BB5A 5EE1A 4C7ZA 3AEFB 4NAWB 1YN5A 1VRAB 2EELA 2CJOA 1E9MA 1SJED 3UI3A 1UWMA 1LO5D 2PLPA 2WS3B 4KX6B 5D7GA 2KDMA 4MT5A 3AEEB 2AQ3B 1ET9A 1GTEA 3W9CB 2JX5A 3HVZA 1TZOA 4OHJA 3AE3B 1VZ6A 2L1AA 2WXHA 4C80A 1JWMD 5MPOA 3SR6A 1WSPA 1NENB 2J52A 3ABVB 2PMVA 2ZW0A 1ZXIA 1KRHA 2INNE 3Q8AA 2WLBA 1L6UA 1ZXHA 4LLGM 5BMHA 1XCQL 2MH7A 3SFDB 1C77A 4EE2A 4MH8A 1NEKB 1FXIA 1V1PA 2BBCA 1FNWA 2KAJA 2LHDA 3ZJTA 5EE0A 3GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBY A;  1JRO A;  3CWI A;  3HUI A;  3AEG B;  2PVG C;  4N6E B;  1JQ4 A;  1JRP A;  4IDI A;  4FXC A;  5H92 C;  4N59 A;  2MJE A;  3RPF C;  3NS1 A;  1GTH A;  3CIR B;  2QJL A;  3W5U B;  4ZHO A;  2AX5 A;  1FXA A;  1V8C A;  1YQ4 B;  3AE9 B;  2Q5W D;  4US9 A;  1L0V B;  3W5V B;  3AEC B;  1FIQ A;  1XLO A;  4JX1 C;  1L5P A;  3B2F A;  4ITK A;  3NVY A;  4JWU C;  1PFD A;  1OQQ A;  1IUE A;  1N5X A;  2W3S A;  3VR9 B;  1JW9 D;  3P4Q B;  1KF6 B;  1FM0 D;  1SF0 A;  2M56 B;  4YSY B;  2PIA A;  1QOB A;  1NI3 A;  1RFK A;  1WRI A;  3AN1 A;  1DOX A;  2K22 A;  1N62 A;  3NVV A;  1NYR A;  3AH7 A;  1FRR A;  2B76 B;  3P4R B;  3VRB B;  1FRD A;  1I7H A;  3PO0 A;  3DWM A;  3AE1 B;  3B9J A;  1QLB B;  1QOF A;  1T3Q A;  1DGJ A;  1PUT A;  2PVO D;  1KFY B;  3DWG C;  3KWL A;  1GPX A;  2Y5C A;  3AE8 B;  3AED B;  2CJN A;  3NVW A;  1FMA D;  4HRO A;  4WQM A;  1QF6 A;  1TKE A;  1WWT A;  5G5G A;  2N0S B;  1SB3 C;  1WGK A;  3P1M A;  3P63 A;  2BS2 B;  2W55 A;  2LEK A;  5AUI A;  1FO4 A;  3EUB 2;  1E0Z A;  1OFF A;  2JQR B;  3L4P A;  5GXG B;  2FBW B;  3AE2 B;  1N60 A;  3B2G A;  1DOI A;  2WU2 B;  1YJI A;  4YT0 B;  1AYF A;  1RM6 C;  1E7P B;  1V97 A;  2MJD A;  2E3T A;  3CF4 A;  1E6E B;  4YTM B;  3P4S B;  1EWY C;  2L52 A;  2WQY B;  3AV8 A;  3LB8 C;  1ZOY B;  4YTP B;  1TKG A;  2PKO A;  4JWS C;  4US8 A;  2CU3 A;  1AWD A;  3VRA B;  2OHF A;  3FC4 A;  4YSX B;  1N5W A;  1QOG A;  2BS4 B;  1WXQ A;  2M19 A;  4ZOH C;  2MJ3 A;  5EE3 A;  1A70 A;  3AE4 B;  1RYJ A;  1VLB A;  1YJJ A;  4A9A A;  2QIE B;  1N61 A;  1FFU A;  2ACZ B;  2BS3 B;  3AE5 B;  1NVI D;  3SFE B;  3VR8 B;  1XO3 A;  1YQ3 B;  2BT6 A;  2EKI A;  3AE7 B;  3NRZ A;  1GAQ B;  1NYQ A;  2K9X A;  4P6V F;  1SIJ A;  1TKY A;  3BII D;  3FAH A;  4ZHP A;  4WWM A;  1XLN A;  3ZYY X;  1QOA A;  1H7X A;  4YSZ B;  2DWQ A;  1N63 A;  4USA A;  5EE9 A;  1B9R A;  2WP9 B;  2K5P A;  4C7Z A;  5EE1 A;  3AEF B;  2W3R A;  1RWS A;  4HRS A;  1JWB D;  1VDV A;  1FFV A;  5AUK A;  2CJO A;  1E9M A;  3WCQ A;  3AEA B;  1UWM A;  1VJK A;  1XLQ A;  2WS3 B;  1PDX A;  4KX6 B;  1J7C A;  2G1E A;  3AM9 A;  2W54 A;  3AEE B;  2L83 A;  1CZP A;  5C2T B;  1GT8 A;  1XLP A;  5G5H A;  1GTE A;  3W9C B;  2JX5 A;  3HVZ A;  4LTU A;  1J7A A;  3AE3 B;  2WU5 B;  4N58 A;  4YXD B;  1JWA D;  2WDQ B;  3ETR A;  1R7S A;  1J7B A;  1WYG A;  4C80 A;  1E10 A;  3AMZ A;  1DOY A;  5MPO A;  2H88 B;  3SR6 A;  1ROE A;  1H7W A;  1NEN B;  3ABV B;  3AEB B;  1L6V A;  1ZXI A;  1ZP0 B;  3LXF A;  3AB5 A;  4YTN B;  1KRH A;  1TJE A;  2WDR B;  2WLB A;  3HRD D;  1L6U A;  3AE6 B;  1OQR A;  3NVZ A;  2MH7 A;  4C7Y A;  3SFD B;  2WDV B;  2H89 B;  3P4P B;  5H8Y E;  1NEK B;  1FXI A;  1F0Z A;  5C3J B;  1TYG B;  1QT9 A;  2HTM E;  1JAL A;  2KAJ A;  2KMM A;  1ZUD 2;  5EE0 A;  1CJE A; 
#chains in the Genus database with same CATH topology
 3TEX A;  1K50 A;  1P98 A;  4ASW C;  4US9 A;  2GBK A;  3AXC A;  1L5P A;  3ZTC A;  2W3S A;  4Q2J A;  1FCC C;  1QOB A;  3SD5 A;  4TSS A;  3E56 A;  4RH6 A;  3PO0 A;  4LJO B;  4F7Z A;  1WX7 A;  1QOF A;  1DGJ A;  3VUY A;  3A1Q B;  3UIO B;  2L32 A;  1L0X B;  4M02 A;  2V4L A;  3A9J B;  3HM6 X;  1BT0 A;  3B2G A;  3A4R A;  2MA9 B;  2MJD A;  1E7P B;  2PJH A;  4B95 A;  1WYW B;  3EGR A;  2LD9 A;  1PGB A;  2KWD A;  3RUI B;  2PKO A;  2V4I B;  2CU3 A;  2K25 A;  3ZIM A;  2WXR A;  3EHV A;  2X8X X;  4ZHP A;  1FFU A;  1SE3 A;  2DYM A;  4BBN F;  2IDY A;  3I63 C;  2JRI B;  4JL9 A;  3ZLZ A;  1WXS A;  2O6V D;  4DXA B;  1E8Y A;  4HPP A;  3AEA B;  3DBR I;  4K1R B;  1MG4 A;  2MP2 A;  4KKJ A;  4KSK C;  3P42 A;  5C2T B;  1WGR A;  4NJC A;  2AWT A;  3Q8C A;  4WWN A;  1E7V A;  4II2 B;  2LAS A;  4YL8 A;  1H7W A;  3QIJ A;  4HXD A;  2Z0D B;  1IYF A;  1HEZ E;  3H8H A;  1V1P B;  3Q14 C;  2WDR B;  2RDH A;  3AE6 B;  4IWO A;  1ET6 A;  2KOX A;  3AEG B;  2KC1 A;  3PS6 A;  4DDG D;  4I6N B;  3OWE B;  4L1B A;  3DVN U;  2KZR A;  4RGM A;  2MCN B;  2BKF A;  1KF6 B;  2VZK D;  2MLB A;  3VUW A;  3AH7 A;  2D2Q A;  1FRD A;  4DXG A;  4XX5 A;  2GLS A;  1OQY A;  3DWG C;  3N1Z C;  2KAC A;  3PRP B;  1SEB D;  1FO4 A;  2N9L A;  2BWF A;  1ZE3 D;  3BVG A;  2MW5 A;  2BVC A;  3RYT A;  3M3J A;  3M63 B;  1ESF A;  2NTS A;  2KQ7 A;  2KJH B;  1C79 A;  2I38 A;  3AV8 A;  4XDD A;  5E6N A;  4W9D A;  5EE3 A;  1VLB A;  1I4G A;  4HDO A;  3GOE A;  2ON8 A;  4EKU A;  4HKQ A;  4IUM B;  2KDF B;  3Q8E A;  1E7U A;  5E6J A;  3N3K B;  1XXG A;  2FNJ B;  1PGA A;  3PT2 B;  3RZW C;  1D5Z C;  2WXL A;  2W3R A;  3ZXR A;  2MP2 B;  1JWB D;  5AUK A;  2N9K A;  2J42 A;  4GMV A;  2IBI B;  3RMK C;  2I1J A;  3O65 B;  1K53 A;  4N58 A;  3ETR A;  4E71 A;  4A6Q A;  4M0W A;  3VTU A;  2IZV B;  1I4R A;  1L7Y A;  3DPD A;  4BKT A;  3IT4 B;  3RNF C;  2KDE B;  3I5J C;  5H8Y E;  2RGF A;  2CR5 A;  5C3J B;  1ZUD 2;  2MBB B;  2RR9 A;  1VCB A;  2AL6 A;  2Z0E B;  1EO6 A;  2FAZ A;  1UZX B;  5LNK 1;  3QA8 A;  1C4P A;  1HA5 A;  5J17 A;  2MBH A;  2KDB A;  5FR6 A;  3VVW B;  3VR9 B;  2WXQ A;  1YJ1 A;  1G6J A;  4LNN A;  5HG2 A;  1MPE A;  5JHA A;  2OOB B;  2PVO D;  2ZNV B;  1IGC A;  3HK0 A;  4GXB A;  1QF6 A;  1WWT A;  3B08 A;  3DBL I;  2KDI A;  2MRP A;  2LEK A;  5GXG B;  2FBW B;  3AE2 B;  3KH0 A;  1GJZ A;  1YJI A;  4IM3 A;  3PRZ A;  2WXJ A;  3KWV A;  5T8I A;  3ZW3 A;  4UDU C;  1C3T A;  4MGK E;  4MGI E;  4PS8 A;  3WAO A;  1MI0 A;  1BXT A;  4IWQ A;  3RFZ B;  4IWP A;  2JWZ A;  4XWW A;  3AE5 B;  1MHX A;  3PRM B;  3KW5 B;  5KHQ A;  1A5R A;  1D3Z A;  4P6V F;  3ZNG C;  4OVU A;  3TEZ A;  3TBL D;  4WH4 A;  4C4V A;  2V3P A;  1TS3 A;  4HRS A;  1V1O A;  4XZ4 A;  5D3I B;  2G1E A;  4ZYS A;  2FE8 A;  4M0W B;  4BAX A;  3A9K B;  2Y5P A;  4RM9 A;  1JWA D;  1J7B A;  3AMZ A;  4XDC A;  2RSU A;  3C8Y A;  3WAP A;  2BYV E;  4NNJ B;  3AB5 A;  1SJH D;  1TS2 A;  3BIN A;  2KLG A;  3HRD D;  2GRI A;  2QIL A;  2H89 B;  2ZJD A;  4A55 A;  1TY2 A;  1GUA B;  1JAL A;  1YQB A;  1CJE A;  3AU4 A;  4N6E B;  1P0R A;  2J0K A;  3DOW A;  4N59 A;  5H92 C;  3DDC B;  3MP9 A;  4EFO A;  4IG7 B;  3I9V 1;  4ITK A;  4EEW A;  2M56 B;  3DQV A;  2LI5 A;  3IG3 A;  4MAC A;  2N9E B;  1T0R C;  4JQW C;  2D3A A;  1LXD A;  4I6L B;  1FMA D;  3VHT C;  2N0S B;  2X38 A;  3QHT A;  2Z8L A;  1QIL A;  2K0P A;  4TQ0 A;  2HD5 B;  4WJN A;  4RGO S;  2IO2 B;  4GN1 A;  5L95 C;  4NZL B;  2DLB A;  3ZRC A;  1E8Z A;  4DHZ B;  2D07 B;  1YJJ A;  1N61 A;  1VD2 A;  2UYZ B;  1SE9 A;  1YQ3 B;  3T3O A;  2KFK A;  1YNT E;  2JZ3 B;  4C4V B;  4WJO A;  1F2R I;  2KXJ A;  1WJN A;  1R4M I;  3H1U A;  1E90 A;  2NBW B;  3DVN V;  4C7Z A;  3AEF B;  1YN5 A;  2WX0 A;  1VRA B;  2EEL A;  2CJO A;  4BKS A;  3UI3 A;  1TGZ B;  2PLP A;  4KZ0 A;  3L54 A;  2KJ6 A;  2BWE S;  2BYE A;  2LGD A;  1ET9 A;  3ENE A;  1GTE A;  2JX5 A;  1UBI A;  1N6Z A;  4C80 A;  2WXH A;  3DHH C;  1JWM D;  4BKG A;  4LJP B;  2PMV A;  2KYW A;  3KYC D;  4MGY E;  3RNA C;  5DPW A;  2WLB A;  1L6U A;  4LNI A;  1XCQ L;  4HVB A;  1C77 A;  2JXX A;  2BBC A;  3DBH I;  3AUL A;  5EE0 A;  1UEL A;  4IDI A;  1PYW D;  3ECI A;  4GDL A;  1VR9 A;  2DZI A;  1FIQ A;  4JX1 C;  3TEW A;  1V5O A;  2DZJ A;  4MJS A;  4ANV A;  1OQQ A;  1FM0 D;  2DX5 B;  4YSY B;  4MM3 A;  3ZKJ C;  4F8C B;  2N1W A;  4DDI D;  2V3S A;  1EM7 A;  3VRB B;  4X57 B;  4W9F A;  1UGM A;  5CHV C;  3MC0 B;  5HFY A;  1TKE A;  2AQ2 B;  3ZRF A;  3VFK A;  1WGK A;  4W9L A;  2W55 A;  3SHQ A;  3SDL C;  2IY0 B;  4KDL B;  5CX3 A;  3L4P A;  4ZRK A;  2WU2 B;  4GOC A;  3OJ3 A;  3U30 A;  4YWG G;  5TSS A;  1TTN A;  2GI9 A;  4XWT A;  4OZA A;  4LNF A;  4RMA A;  2L0F A;  4G0N B;  3EEC A;  3UIN B;  3BYY B;  2J4X A;  1FEH A;  2KFK B;  2DNF A;  3V62 A;  5JXV A;  2QEJ C;  4JIO U;  4A3P A;  5E6P A;  4AJY B;  1WFY A;  3GZN B;  1NYQ A;  1HXY D;  4LCD E;  4WWM A;  1WM3 A;  1MHH E;  5LXH A;  2NTT A;  2K5P A;  1ZDV A;  3VTV A;  4MH0 E;  2IGD A;  1FFV A;  1I4P A;  3NJT A;  3MC8 A;  2HE7 A;  1IP9 A;  3EA6 A;  2K8B A;  2WXP A;  4RCO A;  2WDQ B;  1E8W A;  1SE4 A;  3R2T A;  2L0T A;  4HEA 1;  3SEB A;  3O13 A;  2EMT A;  4ARI A;  2XN9 C;  4GDL B;  3P2B A;  2PPH A;  4P16 A;  2JYT A;  2MSE D;  2GMI C;  3PRE A;  4MJS B;  4P1B C;  4MM3 B;  4II3 B;  3QC8 B;  1PFD A;  1BML C;  1V9J A;  5D6J B;  1JW9 D;  3P4Q B;  3RN9 C;  1NI3 A;  5J2R A;  3M95 A;  1L2N A;  1GB1 A;  5G2N A;  1FCL A;  2HTH A;  4GB9 A;  4AP4 C;  4WQM A;  1T0S C;  2BS2 B;  1UUP A;  2KWC A;  1OFF A;  1VZ8 A;  1MJD A;  1WE7 A;  2BYT A;  4CQN A;  2LFI A;  3ZJU A;  2FID A;  1E5W A;  1Q5W B;  3T9L A;  3L0W B;  3I3T B;  2SEB D;  3RT3 B;  4ZOH C;  3V60 A;  4AS1 A;  3BY4 B;  1R4N I;  3AE4 B;  1RYJ A;  1F52 A;  1H8C A;  3SFE B;  4DHJ B;  3IAS 1;  3T3N A;  4IKG A;  4RF1 A;  3NG0 A;  3PVL A;  2IPK D;  1WY8 A;  3HM3 A;  4KGR A;  4KGT A;  4USA A;  2WP9 B;  3ML8 A;  1F2R C;  3QQ8 B;  1V86 A;  1WMH B;  1YN4 A;  2INP E;  1J7C A;  2XK5 A;  4MSQ B;  4ZDV A;  5CHW A;  1SBB B;  1CZP A;  3H9D A;  4TKN A;  4EZJ A;  1EWC A;  2AL3 A;  2LJI A;  4LTU A;  1I42 A;  1WYG A;  3ONS A;  2H88 B;  4A3O A;  2GBM A;  3L13 A;  3P4P B;  2OJW A;  3DVG Y;  1TYG B;  1QT9 A;  2KMM A;  3DBR B;  2JRH A;  1P9D U;  4WQO B;  1I35 A;  1JQ4 A;  3TEY A;  1BUI C;  2INC C;  2QJL A;  3RNC C;  3AE9 B;  1XF5 L;  1FD6 A;  4IM2 A;  1L0Y B;  3GS2 A;  2ONQ A;  2WXF A;  3N1Y C;  4FBJ B;  1L4Z B;  1WRI A;  2KK8 A;  4FJY A;  4LK0 M;  2IGG A;  1XT9 B;  2DZM A;  3H7S A;  4R3D A;  3R8B A;  2DAJ A;  5JHB A;  3P63 A;  1S1Q B;  2G45 B;  4M8N A;  2ZEQ A;  3BK2 A;  4W9C A;  3T8M A;  1WXM A;  1L4D B;  3BZD B;  1P1A A;  2N1V A;  1WZ0 A;  4BOZ B;  1KOT A;  2JF5 A;  2KVZ A;  3WAN A;  1Z2M A;  2KD0 A;  2REX A;  3Q3J A;  3DCG A;  2YLM A;  1GG3 A;  4BKS D;  2BS3 B;  4GU2 A;  1C1Y B;  2CHZ A;  2K9X A;  2RDB C;  2LUE A;  1NDD A;  2ZPY A;  1J8C A;  2FCS A;  3RI7 C;  2VH2 A;  4L23 A;  2R61 A;  3K9P B;  3PZ8 A;  1KTK A;  5DPS A;  1GNU A;  4WJP A;  3IT6 B;  4NAW A;  4B9K A;  4NJ7 A;  2LGX A;  3JVZ X;  1K51 A;  4ZRJ A;  5FR3 A;  2WU5 B;  2C7H A;  2M17 A;  3Q69 A;  2L8J A;  2TSS A;  2WXM A;  1DOY A;  1OEY A;  1L6V A;  2HDE A;  5BMG A;  2FCQ A;  2V1Y A;  1OEY J;  5BMI A;  2ZCB A;  4C7Y A;  2KVR A;  4HCN B;  1C4A A;  1QKZ A;  5LXI B;  2EMS A;  1JRP A;  2BW2 A;  4GLS C;  3RPF C;  3MFG A;  2AX5 A;  5IP4 D;  1PQS A;  2KHW B;  2LGI A;  3V61 A;  1ISN A;  2HJ8 A;  1IUE A;  2K1F A;  3QWZ B;  4K3B A;  2K6D B;  2KFJ A;  2Y5B B;  3ZQ4 A;  2WGS A;  1P3Q U;  1WI0 A;  4BVU C;  3AE1 B;  1TT5 B;  1PUT A;  5IKC M;  1I4X A;  3AE8 B;  2CJN A;  2KMA A;  5LLI A;  4A90 A;  1EU3 A;  1XEE A;  3FKY A;  2R2Q A;  1AN8 A;  4PS7 A;  5KHO A;  2JPH A;  4S0R A;  3V6E B;  1QZE A;  4ANW A;  2D5G A;  4ICV A;  4YTM B;  1EWY C;  2N9X A;  3Q8B A;  4DHJ D;  2OJR A;  1TKG A;  4JPS A;  4I6P A;  4JWS C;  2MBE A;  2BGF A;  2LGS A;  3DVG X;  1AW7 A;  3ZTD A;  1K52 A;  3SU8 X;  2FUG 1;  3A33 B;  3RCZ A;  3HVD A;  3V3X A;  3N30 A;  2M4N A;  4AJW A;  1HZ5 A;  4WJQ A;  1XQQ A;  2ZW1 A;  2M8S A;  5EE1 A;  4NAW B;  1SJE D;  1LO5 D;  2WS3 B;  4KX6 B;  2RPQ A;  5D7G A;  2KDM A;  1SIF A;  3AEE B;  2ZVO A;  2AQ3 B;  3PPA A;  3W9C B;  1TZO A;  1KJT A;  2LXA A;  4C00 A;  2VH1 A;  2L1A A;  5MPO A;  3SR6 A;  1WSP A;  2J52 A;  4ANX A;  5EDS A;  2QHO A;  4J6I A;  3NZS A;  4MH8 A;  2CHX A;  1FXI A;  2D10 A;  2KAJ A;  2M0A A;  2LHD A;  3HUI A;  1D5M C;  2KTR A;  1P7F A;  4KVG B;  4DBG A;  2AYO B;  5DPR A;  2LJ5 A;  2J7Q B;  3B2F A;  2WXG A;  3BVM A;  4BFR A;  3EFU A;  2OED A;  4ZRP A;  2PIA A;  1SF0 A;  3H6N A;  1DOX A;  4XGA B;  1ZPS A;  2PTL A;  5AZH A;  3X23 A;  2LZ6 A;  3ZUN A;  3OLM D;  1HE8 A;  3B9J A;  1OGW A;  3KWL A;  1DYQ A;  4P1C C;  3U7D A;  1SB3 C;  3Q3M C;  3D32 A;  4TMA B;  5AZF A;  1N60 A;  4GIV A;  1JCK B;  2E3T A;  5IA7 A;  1U4A A;  5IN7 A;  2WQY B;  3NS8 A;  3VRA B;  1GB4 A;  4K3C A;  1NVI D;  1JWS D;  3VR8 B;  2LUM A;  1YMH E;  2QCZ A;  2JWU A;  3DHI C;  1MFW A;  2O6V A;  4FUL A;  2YVC A;  1TS4 A;  2LVQ A;  2D3C A;  2C7M B;  1Q10 A;  4OZB A;  1WJ4 A;  1IPG A;  3WAL A;  4W9J A;  4LNO A;  4M8M A;  1VJK A;  3LDZ E;  4B0M A;  4KDI C;  3WAM A;  2KX3 A;  3NY5 A;  4ZRI A;  3N20 C;  2JSV X;  2KTF A;  1XLP A;  2L7R A;  5G5H A;  1J7A A;  1LGR A;  3EFC A;  1V2Y A;  1R7S A;  4NY0 A;  4WAA A;  1J19 A;  5TR5 A;  1R4M B;  4YTN B;  1D6E C;  1E8X A;  4WIP A;  1H4R A;  1OQR A;  2J0J A;  3NVZ A;  1ZDX A;  3AI5 A;  2V3N A;  2KWV B;  1JRU A;  1YX6 B;  1M94 A;  1V6E A;  2IYD B;  4L2Y A;  4REZ A;  4FLH A;  3UIP B;  1TY0 A;  1ZGU B;  4ZHO A;  1FXA A;  1TZ1 A;  3ZVV A;  2LRW A;  4W9K A;  5HI1 A;  2BKR B;  4KSL C;  2BF8 B;  2WDT B;  4GDK A;  4EZK A;  3R3M A;  3WA0 A;  1MVK A;  2MHJ A;  3PLV A;  2K22 A;  3NUH B;  3P4R B;  4E3C A;  2LXC A;  3DWM A;  1IBX A;  5AZG A;  1HZ6 A;  3C0R B;  4A20 A;  4URK A;  3DBH B;  4ACF A;  4W9G A;  2AEH A;  3JYU A;  1EU4 A;  3PHW B;  2K8C A;  1QQR A;  3ZNI D;  4F1S A;  1V80 A;  2FIF A;  2J0M A;  3P4S B;  1TIF A;  2WXK A;  3LB8 C;  5C23 A;  3PV1 A;  4YTP B;  1KLU D;  4FHJ A;  2ZZP B;  4M01 A;  2BS4 B;  2O6V B;  2ACZ B;  2G3Q B;  3V05 A;  4HDQ A;  2EKI A;  3AE7 B;  2MEK A;  4RGN A;  1UWX A;  2NBU A;  2RMM A;  3FAH A;  1XCT L;  1QOA A;  4KV2 A;  2BQQ A;  1F1H A;  3Q8F A;  4AWJ A;  3RNG C;  2LMC A;  1RWS A;  1VDV A;  3Q6B A;  3LYY A;  5BYS A;  1PDX A;  1WXA A;  4IM0 A;  2L83 A;  3IVF A;  1GT8 A;  4OVV A;  2NMQ A;  2JXT A;  4TQ1 A;  1UBQ A;  1WZ3 A;  3Q3F A;  4WAF A;  3BWU D;  1ZP0 B;  3LXF A;  3M62 B;  1OTR B;  5J18 A;  2ZVN A;  5DCN A;  4WUR A;  3PZ7 A;  4ZRQ A;  4ZYN A;  1F0Z A;  3UF8 A;  3RZF A;  3KQ4 A;  1P7E A;  3ZO5 B;  2NS5 A;  1UH6 A;  3K9O B;  2N7E A;  3MHS D;  1TS5 A;  3H7P A;  3NS1 A;  5BYQ A;  4GDK B;  2PE6 B;  3X0W A;  2Q5W D;  2UU7 A;  4PYZ A;  1IBX B;  3IXS A;  1SGH A;  4FJV B;  2DHZ A;  3B1L X;  3NVV A;  2XNA C;  2DEN B;  4W9I A;  3HIZ A;  2FCN A;  1V49 A;  4EOY A;  1EUV B;  4KZC A;  3BK1 A;  3VTW A;  2LGY A;  1DOI A;  4K7W A;  1HTQ A;  5E6O A;  2KMC A;  4IC7 B;  2N9P C;  1C78 A;  1WGG A;  1Z5S B;  1KH0 A;  3FC4 A;  1FPY A;  2MJ3 A;  1XD3 B;  3PSE B;  4A8X C;  2Y3A A;  1C9F A;  2JU6 X;  3B0A A;  1FNV A;  3V6C B;  1UNS A;  2XEW A;  4KKI A;  4K7S A;  1N63 A;  1SE2 A;  1B9R A;  2R2O A;  4E74 A;  3ZJV A;  2WXI A;  3VH4 B;  4DQO C;  3JW0 X;  4M00 A;  5L83 A;  3URY A;  3QAR A;  1R4N B;  2MWS B;  3VAW A;  2BPS A;  2KX0 A;  2K3U A;  2PW9 A;  1YOV B;  4NPN A;  1HTO A;  3J9C A;  2G4S A;  3QX1 A;  1JWU D;  4IW0 A;  4MEM A;  4HKZ E;  2DZK A;  4W9E A;  2WDV B;  1FNU A;  3PHX B;  1GC6 A;  1V81 A;  3H7P B;  4N9F 4;  3AM9 A;  4S17 A;  3MC9 A;  2PVG C;  4KIK A;  5IOI A;  4FXC A;  4CO7 A;  4WWP A;  2WXN A;  3W5U B;  1YQ4 B;  1NBF C;  4G11 A;  1AAR A;  1FXT B;  3NVY A;  3MHZ A;  1WR6 E;  3PGE A;  3R7R A;  1N5X A;  4HJG E;  1SXT A;  1RFK A;  2V0G A;  3TJP A;  3W1S C;  1N62 A;  1WGD A;  2B76 B;  1C76 A;  5FK9 C;  1J0G A;  1GPX A;  4P7I A;  3KYD D;  4MDK E;  5AUI A;  1Q0W B;  1WJU A;  1AYF A;  2I2Y A;  3QK0 A;  4EZL A;  2NBV B;  2JZZ A;  2B3A A;  1WRD B;  2K39 A;  1QOG A;  2WWZ A;  3QJZ A;  3APC A;  4PK1 A;  3KUC B;  3WIM A;  3ML9 A;  2IND C;  3DBS A;  1TKY A;  4B6W A;  3GE8 C;  3ZYY X;  1H7X A;  5EE9 A;  2QC8 A;  1KLV A;  1K8R B;  4GGQ A;  3N9Y C;  2M0X A;  2BB5 A;  4LDT B;  1LM8 B;  2KWU B;  1E9M A;  3PTF C;  1UWM A;  2KT7 A;  2XBB C;  3HHM A;  3HVZ A;  3AE3 B;  3VDZ A;  4TUU A;  4HJK A;  3ZNH B;  2ZW0 A;  3CST A;  3APF A;  1UF0 A;  1KRH A;  3Q8A A;  1YIW A;  1ZXH A;  4EUT A;  1LQB A;  4ICU A;  5BMH A;  2XK5 B;  4KIK B;  2UWQ A;  1NEK B;  4CYE A;  4XYC A;  2PEA A;  4FJZ A;  3KUD B;  3ZJT A;  1TBE A;  2DBY A;  5IO9 A;  1WE6 A;  2LHE A;  1CK1 A;  2MJE A;  3L16 A;  1KLG D;  3CIR B;  1YN3 A;  1L0V B;  3W5V B;  1XLO A;  3RNB C;  1I4Q A;  4JGH B;  3I57 A;  2JYE A;  4MEL A;  1WJ6 A;  4FHK A;  2Z59 B;  1I4H A;  2YEP F;  3APD A;  3R2I A;  1QLB B;  4W9H A;  1KFY B;  3UQA A;  4XE0 A;  2N7J A;  5G55 A;  3GP7 A;  1E0Z A;  3FIL A;  2IJ0 A;  1GC7 A;  3R66 C;  3Q2A C;  2NR2 A;  3ZNZ B;  2L05 A;  3CF4 A;  5HKH A;  1E6E B;  2L52 A;  2EKE C;  2MBO A;  2JZP A;  1AWD A;  4J3O D;  4JLC A;  3IFW B;  3JSV A;  3U4E G;  1A70 A;  3KLS X;  4MGZ E;  1T5X D;  2SAK A;  3U8Z A;  3L10 B;  2IGH A;  4HCP B;  3A9K A;  1HQR D;  2A4Z A;  2C9W B;  1T0Q C;  3QCA A;  2DWQ A;  3W1Y A;  1Y8R C;  3TIX A;  3IAM 1;  2WXO A;  2K8H A;  1WGY A;  4RNA A;  3E9S A;  5DPT A;  4DXF A;  3NHE B;  1ENF A;  2C7N B;  3NZU A;  2YEP B;  2CU1 A;  1WXV A;  2ASQ A;  4YXD B;  2V9H A;  3DBL B;  5D94 A;  3TMP B;  3UQB A;  2KQS A;  1ROE A;  2BB6 A;  5IAA C;  4NQK E;  4FN2 A;  3W2D A;  1ACC A;  2WHI A;  4KGS A;  1D4B A;  4K7U A;  3PZD A;  3MJ5 A;  1M4V A;  2WYQ A;  3TUO A;  2HTM E;  4NAM A;  3CWI A;  1X1M A;  4HLE A;  5FKA C;  1GTH A;  2I1K A;  4JE3 B;  2PE9 A;  1V8C A;  3N32 A;  4DK5 A;  3AEC B;  3C19 A;  4JWU C;  3ALB A;  4G3X B;  4ARC A;  2RPV A;  1RAX A;  2WX1 A;  3Q3N C;  5D2M B;  2WNM A;  1NYR A;  2LVP A;  1FRR A;  1UGJ A;  3VUX A;  1I7H A;  2IO1 B;  2ZCC A;  2KN5 A;  2QMT A;  3TSS A;  2KO3 A;  1T3Q A;  4RFB A;  4RF0 A;  4WWO A;  2KNB A;  2G4D B;  3FIL B;  4HRO A;  3AED B;  3BYT B;  5G5G A;  4PT5 A;  3ZXV A;  2DAF A;  4DWF A;  1WX9 A;  2QSD A;  1Q1O A;  5D3D A;  2N7D A;  2HJ1 A;  3W1S A;  3JSV B;  3BVZ A;  3LJ3 A;  1ZOY B;  4MSM B;  5JH5 C;  4US8 A;  1KM7 A;  5I4D A;  3CF6 E;  1N5W A;  2M19 A;  4G50 A;  4A9A A;  3U52 E;  4LDT D;  1XO3 A;  3TL5 A;  4HK2 A;  1SIJ A;  2ICI A;  3QAQ A;  2L00 B;  3BII D;  1PGX A;  2CS4 A;  1XLN A;  2DYB A;  1WX8 A;  1NI2 A;  2W82 A;  4K81 A;  3CSF A;  3IBE A;  2GBR A;  1JML A;  1CQV A;  1WM2 A;  4LNK A;  4FAD A;  1XLQ A;  2A5U A;  2D3B A;  4OW0 A;  2W54 A;  5CHF A;  1S3S G;  1C4C A;  3AU5 A;  1E10 A;  2KAN A;  3ZGZ A;  3AEB B;  1TJE A;  2NVU I;  2NPT A;  4BBN C;  3OJ4 B;  4OZC A;  2CHW A;  5CTR C;  2J53 A;  1STE A;  3KVF B;  4BOS C;  4RM8 A;  2RDG A;  1F77 A;  1EF1 A;  4RGT A;  3MTN B;  3AN1 A;  1ZW7 A;  1RLF A;  2KTR B;  2BYF A;  2GB1 A;  2GBN A;  2JT4 B;  3R7Q A;  4PS3 A;  3P1M A;  4B0E A;  3MJW A;  2JQR B;  2M1M A;  3OAW A;  3NOB A;  2O2V A;  1RM6 C;  1YX5 B;  1V97 A;  4AUQ C;  2LWP A;  2GBJ A;  4NJ6 A;  2JY6 A;  2D3G A;  4GSW A;  4YSX B;  1RFA A;  2KKC A;  4HPL B;  1IGD A;  4AQ7 A;  3A4S C;  3TCA A;  2K6Q A;  3U2S C;  3NRZ A;  4IOI E;  5AEK B;  2KLC A;  3S2A A;  4AOF A;  2AQ1 B;  4QAY A;  2JVC A;  3EC8 A;  3WCQ A;  1WGH A;  3L08 A;  2W9N A;  1UD7 A;  3NZ3 A;  3DHG C;  2LVO A;  5BO4 B;  3ZDT A;  3VXW A;  4H2A A;  5JZE B;  2MX2 A;  2JUO A;  2KQ4 X;  1T6B X;  2E6X A;  2NPT B;  3IHP C;  3PLU A;  3ZDM C;  5GMV A;  2L3Z A;  4HPM B;  2CKH B;  1JRO A;  4DHZ E;  2ZNV C;  4O1N A;  1D5X C;  2KC2 A;  2GOW A;  4C56 C;  1V5T A;  3L17 A;  3RD2 A;  1WR1 A;  3VQI A;  4D2K A;  2KJR A;  2QDF A;  3VH3 B;  3Q3O C;  2KN4 A;  3GE3 C;  1B1Z A;  2N4F A;  4OVZ A;  2DYO A;  1GOZ A;  4TV3 A;  2Y5C A;  1YD8 U;  3NVW A;  2O2V B;  1WH3 A;  2L76 A;  2VZK B;  3GZN I;  2MQJ A;  3EUB 2;  3A1Q A;  2MBQ A;  2D11 A;  2BTE A;  3A9J A;  1CMX B;  4YT0 B;  1F9J A;  2C60 A;  2NCN A;  1VZ7 A;  1Y56 A;  3RNE C;  3OG5 A;  1LFD A;  2C5L C;  5HHD G;  2OHF A;  1EF5 A;  2G9H D;  1WXQ A;  2IY1 B;  1SSN A;  1WMH A;  2QIE B;  2BT6 A;  5C1Z A;  1GAQ B;  3N1X C;  1WF9 A;  5BYR A;  4CHK A;  4HWI B;  1MG8 A;  1ZKH A;  4YSZ B;  4BZA A;  2IO3 B;  4ANU A;  2LRU A;  4MT5 A;  4OHJ A;  1VZ6 A;  2FUH B;  4NQL B;  1T0Y A;  3KUZ A;  4PYU A;  3CMM B;  1NEN B;  3RUL A;  3ABV B;  1ZXI A;  1RRB A;  3UGB B;  4FA6 A;  2INN E;  1WIA A;  4LLG M;  2MH7 A;  2VRR B;  3SFD B;  2RD0 A;  4EE2 A;  4XC2 A;  2ZPN A;  1V1P A;  2FCM A;  1FNW A;  3U7Z A;  3GB1 A;  2IO0 B; 
#chains in the Genus database with same CATH homology
 2DBY A;  3TEX A;  3HUI A;  1D5M C;  4IDI A;  1P7F A;  1PYW D;  2LHE A;  1CK1 A;  2MJE A;  1KLG D;  1K50 A;  1VR9 A;  3CIR B;  1YN3 A;  4US9 A;  1L0V B;  3W5V B;  1XLO A;  1FIQ A;  4JX1 C;  3TEW A;  1I4Q A;  1L5P A;  2WXG A;  3B2F A;  3BVM A;  1OQQ A;  2W3S A;  3I57 A;  4Q2J A;  2OED A;  4ZRP A;  2PIA A;  1FM0 D;  1SF0 A;  4YSY B;  1FCC C;  1QOB A;  2JYE A;  1DOX A;  1EM7 A;  3VRB B;  1ZPS A;  1I4H A;  2PTL A;  2YEP F;  4TSS A;  3E56 A;  4RH6 A;  3PO0 A;  3R2I A;  3B9J A;  1QLB B;  1QOF A;  1DGJ A;  1KFY B;  3KWL A;  3MC0 B;  2L32 A;  1L0X B;  1DYQ A;  4XE0 A;  5HFY A;  1TKE A;  2AQ2 B;  1SB3 C;  1WGK A;  2N7J A;  2W55 A;  3GP7 A;  1E0Z A;  4TMA B;  3FIL A;  3L4P A;  3B2G A;  1N60 A;  2IJ0 A;  1JCK B;  2WU2 B;  2MJD A;  1E7P B;  2E3T A;  4YWG G;  5TSS A;  3CF4 A;  1E6E B;  2GI9 A;  2L52 A;  4XWT A;  4OZA A;  3EGR A;  2WQY B;  1PGB A;  2JZP A;  2KWD A;  2PKO A;  2V4I B;  2CU3 A;  1AWD A;  3VRA B;  3BYY B;  4J3O D;  2J4X A;  1FEH A;  2WXR A;  1GB4 A;  3U4E G;  1A70 A;  3KLS X;  5JXV A;  1NVI D;  1FFU A;  1JWS D;  4ZHP A;  1SE3 A;  2DYM A;  3VR8 B;  2LUM A;  1YMH E;  2QEJ C;  1T5X D;  2JWU A;  2SAK A;  2IDY A;  1NYQ A;  2IGH A;  1TS4 A;  1HQR D;  1HXY D;  4WWM A;  1Q10 A;  4OZB A;  2DWQ A;  1MHH E;  2NTT A;  2K5P A;  1ZDV A;  3IAM 1;  2WXO A;  2IGD A;  1FFV A;  3AEA B;  1VJK A;  4B0M A;  1I4P A;  4RNA A;  4KKJ A;  3P42 A;  3E9S A;  5C2T B;  4DXF A;  2JSV X;  1ENF A;  1XLP A;  3EA6 A;  5G5H A;  2WXP A;  2YEP B;  4NJC A;  1J7A A;  4RCO A;  3Q8C A;  4YXD B;  2WDQ B;  1R7S A;  1SE4 A;  3R2T A;  1ROE A;  1H7W A;  4HEA 1;  3SEB A;  2BB6 A;  3O13 A;  1HEZ E;  4YTN B;  1D6E C;  3H8H A;  1V1P B;  2WDR B;  3W2D A;  4WIP A;  2RDH A;  4ARI A;  1OQR A;  3AE6 B;  1ACC A;  1ZDX A;  3NVZ A;  4KGS A;  2XN9 C;  1D4B A;  2V3N A;  3MJ5 A;  1M4V A;  4GDL B;  3TUO A;  1ET6 A;  2HTM E;  4NAM A;  4L2Y A;  4REZ A;  3CWI A;  3AEG B;  4P16 A;  2JYT A;  5FKA C;  1TY0 A;  1GTH A;  3OWE B;  4JE3 B;  4L1B A;  4ZHO A;  1FXA A;  1V8C A;  4MM3 B;  5HI1 A;  3AEC B;  4RGM A;  4JWU C;  1PFD A;  1BML C;  4ARC A;  2RPV A;  1JW9 D;  3P4Q B;  1KF6 B;  2VZK D;  1MVK A;  1NI3 A;  2K22 A;  3NUH B;  2WNM A;  1NYR A;  3AH7 A;  1FRR A;  3P4R B;  1UGJ A;  1FRD A;  1I7H A;  2QMT A;  4DXG A;  3DWM A;  1IBX A;  3TSS A;  1GB1 A;  1HZ6 A;  1T3Q A;  4RFB A;  4RF0 A;  1FCL A;  3DWG C;  3FIL B;  4HRO A;  3AED B;  3BYT B;  4WQM A;  5G5G A;  1EU4 A;  4PT5 A;  2KAC A;  1FO4 A;  1SEB D;  2BS2 B;  1UUP A;  2N9L A;  1ZE3 D;  3BVG A;  1OFF A;  1VZ8 A;  1QQR A;  2QSD A;  5D3D A;  1ESF A;  2NTS A;  4CQN A;  2BYT A;  2LFI A;  3ZJU A;  3P4S B;  1C79 A;  2WXK A;  2I38 A;  3U7Z A;  3W1S A;  3AV8 A;  3BVZ A;  3LB8 C;  1ZOY B;  4YTP B;  4XDD A;  1KLU D;  4US8 A;  2SEB D;  5I4D A;  1N5W A;  4ZOH C;  2BS4 B;  2M19 A;  4AS1 A;  4A9A A;  5EE3 A;  1RYJ A;  3AE4 B;  1VLB A;  1I4G A;  3U52 E;  2ACZ B;  3SFE B;  3V05 A;  1XO3 A;  2ON8 A;  2EKI A;  3AE7 B;  2MEK A;  3IAS 1;  4HKQ A;  4RGN A;  1UWX A;  4IKG A;  3T3N A;  1SIJ A;  2ICI A;  4RF1 A;  3BII D;  3Q8E A;  2RMM A;  3FAH A;  2IPK D;  5E6J A;  1XCT L;  1PGX A;  1XXG A;  1XLN A;  4KGR A;  1PGA A;  1QOA A;  3Q8F A;  4KGT A;  4USA A;  2WP9 B;  2W82 A;  1D5Z C;  2LMC A;  2WXL A;  2W3R A;  1RWS A;  1F2R C;  1JML A;  1JWB D;  1VDV A;  5AUK A;  1CQV A;  2N9K A;  1YN4 A;  2J42 A;  3LYY A;  5BYS A;  1XLQ A;  2INP E;  1PDX A;  1J7C A;  4OW0 A;  2W54 A;  1SBB B;  2L83 A;  1CZP A;  1GT8 A;  1K53 A;  1C4C A;  1EWC A;  2LJI A;  4LTU A;  4N58 A;  2NMQ A;  3ETR A;  4A6Q A;  1WYG A;  4M0W A;  2JXT A;  1E10 A;  4TQ1 A;  4WAF A;  2H88 B;  3ZGZ A;  3AEB B;  1I4R A;  3BWU D;  1ZP0 B;  3LXF A;  1TJE A;  3IT4 B;  4WUR A;  3PZ7 A;  4ZRQ A;  3P4P B;  5H8Y E;  1F0Z A;  5C3J B;  1TYG B;  3KQ4 A;  1QT9 A;  1P7E A;  2KMM A;  1ZUD 2;  4OZC A;  1JQ4 A;  2J53 A;  1TS5 A;  1STE A;  3NS1 A;  5LNK 1;  3TEY A;  1BUI C;  1C4P A;  2QJL A;  1HA5 A;  5BYQ A;  4GDK B;  3AE9 B;  1XF5 L;  2Q5W D;  1FD6 A;  1L0Y B;  3GS2 A;  2ONQ A;  2WXF A;  3VR9 B;  2RDG A;  1F77 A;  2WXQ A;  4RGT A;  1IBX B;  3IXS A;  1L4Z B;  1WRI A;  3AN1 A;  5HG2 A;  4LK0 M;  3NVV A;  2M0A A;  2IGG A;  1MPE A;  2XNA C;  4R3D A;  2PVO D;  3R8B A;  2GB1 A;  1IGC A;  1QF6 A;  1WWT A;  3BK1 A;  3P63 A;  3P1M A;  2LEK A;  4B0E A;  2JQR B;  3BK2 A;  5GXG B;  2FBW B;  3AE2 B;  1DOI A;  1L4D B;  1YJI A;  3BZD B;  1RM6 C;  1V97 A;  2WXJ A;  3KWV A;  5T8I A;  4UDU C;  1C78 A;  1KH0 A;  1MI0 A;  1BXT A;  4YSX B;  3FC4 A;  3RFZ B;  2MJ3 A;  1IGD A;  4XWW A;  4AQ7 A;  2BS3 B;  3AE5 B;  1MHX A;  3U2S C;  4A8X C;  3NRZ A;  2K9X A;  2Y3A A;  4P6V F;  4IOI E;  1C9F A;  2JU6 X;  1FNV A;  3TEZ A;  1UNS A;  4KKI A;  4WH4 A;  1N63 A;  1SE2 A;  1B9R A;  2V3P A;  2AQ1 B;  4L23 A;  1TS3 A;  4HRS A;  2R61 A;  3ZJV A;  3PZ8 A;  1V1O A;  1KTK A;  2WXI A;  4DQO C;  3WCQ A;  3IT6 B;  3URY A;  5D3I B;  2G1E A;  3NZ3 A;  4ZYS A;  2FE8 A;  2Y5P A;  1K51 A;  5FR3 A;  2WU5 B;  2K3U A;  2PW9 A;  1JWA D;  4H2A A;  3Q69 A;  1J7B A;  3J9C A;  2TSS A;  2WXM A;  2KQ4 X;  1T6B X;  2E6X A;  3AMZ A;  4XDC A;  1DOY A;  3C8Y A;  1L6V A;  1JWU D;  2HDE A;  3AB5 A;  1SJH D;  1TS2 A;  5BMG A;  3HRD D;  4HKZ E;  2GRI A;  2QIL A;  5BMI A;  4C7Y A;  2WDV B;  2H89 B;  1FNU A;  4A55 A;  1C4A A;  1TY2 A;  1QKZ A;  1JAL A;  3AM9 A;  1CJE A;  1JRO A;  4N6E B;  2PVG C;  1JRP A;  2BW2 A;  4FXC A;  4GLS C;  5H92 C;  4N59 A;  3RPF C;  3MFG A;  2WXN A;  3W5U B;  3MP9 A;  2AX5 A;  2LGI A;  1YQ4 B;  4O1N A;  1D5X C;  3I9V 1;  4ITK A;  4C56 C;  3NVY A;  3MHZ A;  1IUE A;  1N5X A;  4HJG E;  1SXT A;  2M56 B;  3VQI A;  1RFK A;  4D2K A;  2V0G A;  3ZQ4 A;  1N62 A;  4MAC A;  2KN4 A;  2B76 B;  1B1Z A;  4OVZ A;  1C76 A;  5FK9 C;  3AE1 B;  2DYO A;  1GOZ A;  1PUT A;  1GPX A;  1I4X A;  2Y5C A;  3AE8 B;  2CJN A;  3NVW A;  1FMA D;  4A90 A;  1EU3 A;  2N0S B;  1XEE A;  2VZK B;  2X38 A;  5AUI A;  3EUB 2;  1AN8 A;  2Z8L A;  2BTE A;  1QIL A;  2K0P A;  4TQ0 A;  4YT0 B;  1AYF A;  4RGO S;  2D5G A;  2I2Y A;  4YTM B;  1EWY C;  3Q8B A;  4NZL B;  1VZ7 A;  1Y56 A;  2DLB A;  1TKG A;  4JPS A;  4JWS C;  5HHD G;  2OHF A;  2G9H D;  1QOG A;  1WXQ A;  1YJJ A;  1SSN A;  2QIE B;  1N61 A;  1AW7 A;  1YQ3 B;  1K52 A;  2BT6 A;  3T3O A;  2FUG 1;  1YNT E;  1GAQ B;  3HVD A;  1F2R I;  3V3X A;  1TKY A;  1HZ5 A;  5BYR A;  3ZYY X;  1H7X A;  4YSZ B;  5EE9 A;  3N9Y C;  2ZW1 A;  2BB5 A;  5EE1 A;  4C7Z A;  3AEF B;  4NAW B;  1YN5 A;  1VRA B;  2EEL A;  2CJO A;  1E9M A;  1SJE D;  3UI3 A;  1UWM A;  1LO5 D;  2PLP A;  2WS3 B;  4KX6 B;  5D7G A;  2KDM A;  4MT5 A;  3AEE B;  2AQ3 B;  1ET9 A;  1GTE A;  3W9C B;  2JX5 A;  3HVZ A;  1TZO A;  4OHJ A;  3AE3 B;  1VZ6 A;  2L1A A;  2WXH A;  4C80 A;  1JWM D;  5MPO A;  3SR6 A;  1WSP A;  1NEN B;  2J52 A;  3ABV B;  2PMV A;  2ZW0 A;  1ZXI A;  1KRH A;  2INN E;  3Q8A A;  2WLB A;  1L6U A;  1ZXH A;  4LLG M;  5BMH A;  1XCQ L;  2MH7 A;  3SFD B;  1C77 A;  4EE2 A;  4MH8 A;  1NEK B;  1FXI A;  1V1P A;  2BBC A;  1FNW A;  2KAJ A;  2LHD A;  3ZJT A;  5EE0 A;  3GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...