2FBWB

Avian respiratory complex ii with carboxin bound
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title 3-nitropropionic acid is a suicide inhibitor of mitochondrial respiration that, upon oxidation by complex II, forms a covalent adduct with a catalytic base arginine in the active site of the enzyme.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 69
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2fbwB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2fbwB01
1SB3C 3BIID 1YJIA 3VRAB 1NEKB 1DGJA 1OQQA 2K9XA 2Q5WD 3AE4B 1NENB 2B76B 1ZUD2 2W54A 4ITKA 2W3SA 1J7BA 1DOXA 1KFYB 2KMMA 2WS3B 4ZHPA 4YSXB 2ACZB 1E0ZA 1QLBB 3AN1A 1QOAA 1TKEA 1VDVA 5G5HA 5H92C 3CIRB 1FRRA 3NVVA 4HRSA 4YSYB 1L6VA 1WXQA 3ABVB 1JW9D 1ZXIA 2W3RA 1JWAD 1PDXA 4WQMA 1E10A 1FXAA 3SR6A 1JQ4A 4YTMB 1CZPA 1N5WA 1GPXA 2DWQA 4C80A 1E7PB 4JX1C 3AE9B 2E3TA 2CU3A 1IUEA 3VR8B 2WQYB 1RYJA 1UWMA 2PVOD 3L4PA 1FFVA 2L83A 1WRIA 2BS3B 2LEKA 4N6EB 2OHFA 5MPOA 3DWGC 1YQ3B 1N62A 1N61A 1SF0A 1JRPA 1T3QA 3FC4A 2MJ3A 1WGKA 1VJKA 2AX5A 3AE1B 2PKOA 3AEEB 2CJNA 3NVYA 1PFDA 2G1EA 4N58A 2WDQB 3W9CB 1QOFA 3B2FA 3AE8B 2M56B 2WDRB 1FRDA 1QT9A 3KWLA 2WP9B 4LTUA 3AECB 3AEFB 3FAHA 3W5VB 3CF4A 1V97A 2HTME 1ZP0B 1J7AA 1XO3A 2H88B 5C2TB 4YTPB 1H7XA 1YJJA 4YXDB 2MH7A 3LXFA 4FXCA 1RWSA 3SFEB 1DOIA 1VLBA 4USAA 1JALA 3AE3B 3WCQA 3ZYYX 2DBYA 3NVZA 1QOGA 1OQRA 3VR9B 1XLQA 3W5UB 1F0ZA 4US8A 1FIQA 5EE3A 1N60A 1A70A 1E6EB 4WWMA 1EWYC 3AE6B 1L0VB 4P6VF 1TKYA 3AE2B 1WWTA 2WU5B 2MJEA 1FO4A 2WLBA 1B9RA 1J7CA 1L5PA 1NYRA 2EKIA 2KAJA 2M19A 3DWMA 3HVZA 3P1MA 5AUIA 5GXGB 1GTEA 1NVID 2K5PA 3LB8C 4JWUC 1ZOYB 3AH7A 1FXIA 2JX5A 1V8CA 2JQRB 3B9JA 3ETRA 2FBWB 1XLPA 3SFDB 1N5XA 4JWSC 1XLNA 2BS4B 2L52A 1TKGA 4C7ZA 2PVGC 2W55A 3AE7B 1PUTA 2K22A 3AMZA 1N63A 1AWDA 1CJEA 3B2GA 1TYGB 2QJLA 1I7HA 3CWIA 1GTHA 1NI3A 5EE9A 4ZHOA 1AYFA 4US9A 1YQ4B 5EE1A 2CJOA 3P4PB 3P63A 3P4QB 2WU2B 3AB5A 1WYGA 1FMAD 1JROA 5EE0A 1GAQB 3AE5B 1L6UA 2MJDA 3P4SB 3RPFC 2WDVB 1SIJA 2BT6A 4KX6B 5G5GA 1DOYA 4A9AA 3NRZA 4YSZB 4YTNB 3HUIA 1RFKA 2H89B 2Y5CA 3AEGB 3HRDD 1NYQA 1R7SA 3AEAB 3NS1A 1E9MA 3AEDB 1QF6A 1QOBA 5H8YE 2N0SB 3PO0A 1ROEA 4HROA 4N59A 4ZOHC 1OFFA 1KRHA 1H7WA 2QIEB 2BS2B 3P4RB 5AUKA 1XLOA 3AV8A 1RM6C 2PIAA 3EUB2 1TJEA 5C3JB 3NVWA 3AM9A 4IDIA 1JWBD 3VRBB 1GT8A 1KF6B 3AEBB 1FM0D 1FFUA 4C7YA 4YT0B
chains in the Genus database with same CATH superfamily
1RLFA 1PYWD 1YJIA 5FR3A 4MGKE 2JVCA 4MGZE 4ASWC 3PLUA 1KLGD 2LVOA 2W3SA 2GBMA 3J9CA 1UWXA 4JLCA 4EE2A 5H92C 1VZ6A 3OG5A 2L7RA 2V0GA 5D94A 2YEPF 3ZIMA 4N6EB 4ARCA 1YQ3B 4BAXA 2BB6A 1K52A 1Z5SB 3DVNU 1TGZB 1UZXB 2MJ3A 1IYFA 2N9XA 2PKOA 2WDQB 2ZW0A 4XE0A 2WXMA 1V97A 1ZP0B 2ZEQA 1YJJA 1H7XA 4NJ7A 1GC7A 3HM3A 2TSSA 2GLSA 1FD6A 1XLQA 5LLIA 1FIQA 4FADA 1A70A 5IAAC 3DHIC 2M0XA 1WJ4A 1WE6A 1J7CA 2KAJA 3ZDMC 1P0RA 3A33B 2CR5A 2JQRB 2JXTA 3ETRA 4ZRJA 1XLPA 4JWSC 4M8NA 2I2YA 4L2YA 4ANXA 2W82A 1MPEA 5FR6A 1I7HA 1Q0WB 2D3GA 3A4SC 1AYFA 1WGDA 4TQ0A 2JRHA 5L95C 3P4QB 1UF0A 2C60A 2NBWB 2DZKA 2QSDA 1R4MI 1UBIA 2WXOA 4LCDE 4F8CB 1GG3A 3WAPA 1QOBA 3PO0A 1OTRB 3V3XA 3I3TB 4B0MA 2BS2B 5BO4B 4B0EA 1RM6C 4DDID 4I6LB 2NR2A 1KF6B 2J7QB 2KLCA 2NS5A 1LGRA 2XK5A 3HVDA 2K9XA 1WXSA 1HTQA 3CIRB 5LNK1 1P7FA 1YN5A 1JW9D 4BBNF 3N9YC 4ICVA 3P42A 3GE3C 4JQWC 1A5RA 5AEKB 5IN7A 2LD9A 2L83A 1FEHA 2CHWA 3VVWB 2MBOA 2V3NA 2CJNA 1K51A 3T9LA 4FBJB 4L23A 1D5MC 5HFYA 2FUG1 2KVZA 3QX1A 5D6JB 3JSVB 1GC6A 1WSPA 2WXRA 4KSLC 3DHGC 3ZGZA 2N9PC 2RD0A 1XCQL 4JE3B 4ZRPA 5D7GA 2O6VB 2WXHA 3PHXB 1WWTA 5JH5C 1LM8B 2G3QB 2WLBA 5AUIA 1IP9A 3RZWC 1ET6A 4BBNC 2FNJB 4DXFA 3Q14C 4WJPA 2JY6A 2ZNVC 3VAWA 1N63A 1OEYJ 3NZSA 4A3OA 1QKZA 4AWJA 1I35A 4DBGA 2WU2B 3PRMB 4RCOA 4DK5A 2MJDA 3NJTA 2Z59B 3LJ3A 4KX6B 4YTNB 2UYZB 2DZMA 4HKZE 1EO6A 3ZDTA 2BYFA 3GP7A 2QIEB 3AV8A 2N9KA 3EUB2 1T0QC 2KFKA 2D07B 4C7YA 2G9HD 1EWCA 3AU4A 2D3AA 5T8IA 1L0YB 1HEZE 1TS2A 2KT7A 3U52E 1GJZA 3ML9A 2KNBA 3TIXA 2WYQA 1F2RC 4P1CC 3A9KB 1D5XC 2IO1B 2LXCA 1E10A 4W9HA 3ZO5B 1V5OA 3I5JC 4C80A 3M95A 5CX3A 4HDQA 3R66C 2WQYB 3RZFA 1SF0A 2KZRA 4LNKA 3AE1B 4IG7B 3NVYA 1I4PA 4EFOA 4M0WA 1WGHA 4GIVA 2HTME 1JCKB 2PE9A 4AJWA 2MHJA 2LUMA 4JL9A 3AE6B 3E9SA 5E6NA 2KTFA 1AN8A 3EGRA 1P9DU 3P1MA 4BKSA 1ENFA 1ZOYB 2QDFA 3U8ZA 2FBWB 3BVGA 4J6IA 4M02A 2LFIA 2BBCA 1TY2A 1T0RC 3H1UA 2A5UA 4BKSD 1TS3A 5KHQA 2INCC 4HPMB 3WAMA 5EE0A 1L6UA 3P4SB 2BYTA 4MM3B 4MGYE 3DOWA 5C1ZA 3TEYA 1JWSD 1SIJA 4A9AA 5BMHA 1F52A 2FCNA 1R7SA 1FNVA 1YN4A 3LYYA 3IG3A 2L05A 1E7VA 4IKGA 3T3NA 1TS5A 4WWPA 2AL3A 4KZCA 4IDIA 2IZVB 4R3DA 2MBHA 3Q8CA 4B9KA 1HE8A 3KWVA 1Q1OA 1SJHD 2MBEA 1KFYB 2WS3B 2D10A 2KTRB 3MJ5A 3BK1A 1I4XA 2WXGA 2D2QA 2DWQA 3X0WA 1VZ8A 2CU3A 4MJSA 2OHFA 3QC8B 4MSMB 3QCAA 3DBHI 3I63C 5J18A 1RAXA 3OAWA 1MFWA 3PZ8A 2L32A 3FAHA 4HRSA 5FKAC 2WXPA 1TY0A 3IAS1 4CYEA 4N9F4 1H4RA 3APFA 4HJGE 5BMIA 1WJNA 3N32A 2JZPA 3DVNV 1HZ5A 3ZKJC 2MLBA 3IFWB 3U7ZA 2N7DA 5CHWA 2L52A 2EKEC 3OJ3A 5EE9A 4K7SA 3MHZA 3RUIB 5IO9A 2KX0A 1WYGA 4CO7A 2M17A 2WDVB 2Z0DB 3JSVA 3FKYA 3NRZA 4G0NB 2KLGA 1HZ6A 2Y5BB 3PHWB 1TZOA 1T0YA 4NNJB 3RI7C 5DPTA 3ZRCA 4EZLA 2KC2A 1VRAB 2O6VA 1D4BA 2RMMA 4JIOU 2I1KA 1SB3C 1TIFA 4TSSA 1NEKB 1L0XB 2K25A 1QZEA 4XWWA 3W1SC 1DOXA 4ANVA 2KMMA 2DENB 4XC2A 1SBBB 2O6VD 1E7UA 1QOAA 4M00A 2N1VA 3ZUNA 3N3KB 3NVVA 3ZRFA 2W3RA 1PDXA 2LXAA 2LGXA 4BKGA 3VUXA 3QWZB 2NTSA 2G4SA 5AZGA 4BKTA 5FK9C 3M3JA 1T3QA 2ZPYA 5D3IB 2K8BA 1HA5A 4C00A 1QOFA 4GB9A 3AECB 3E56A 4E74A 4TV3A 3DQVA 3A9JB 4USAA 2QEJC 2RDGA 2EMTA 3ZQ4A 1TBEA 1VD2A 4RFBA 1F0ZA 2BWFA 4BZAA 2WXLA 3ZNID 3RNCC 2WU5B 3Q8AA 2WWZA 1D5ZC 4KVGB 4K81A 1KJTA 2Z8LA 3A9KA 5GXGB 1FNUA 3VTWA 1KLUD 1ZDVA 2LGIA 2M1MA 3QARA 4RGNA 2J4XA 2JYEA 4KGRA 1UGJA 4B95A 4C4VB 1MHXA 3B2GA 4FJZA 2UWQA 1E90A 1WYWB 2VH2A 2PEAA 5JXVA 1ZE3D 2KFJA 3HHMA 3RPFC 1RFAA 1KLVA 1WGGA 2HE7A 4MT5A 1YX6B 4KSKC 1DOYA 4AOFA 3V6EB 1C3TA 4HROA 2DNFA 2EELA 1NI2A 2INPE 4FA6A 1TJEA 4OVUA 4ZYSA 3VDZA 1HTOA 3BIID 1OGWA 1KM7A 1JRUA 4BOZB 4OVVA 1WE7A 3H7PB 1F9JA 3W2DA 3AN1A 1WF9A 2KANA 3GS2A 1EU4A 3Q3FA 4M0WB 1YN3A 3DBHB 1E7PB 3Q3JA 2E3TA 3PRZA 1V1PB 1WR6E 2GBKA 4WJQA 4MM3A 3SU8X 1JRPA 4HKQA 1MHHE 2N1WA 1LQBA 2GRIA 3D32A 3RFZB 3B2FA 3DPDA 2L76A 2WDRB 2KD0A 4WWOA 4CQNA 4TUUA 3Q3OC 1WIAA 2XN9C 3GZNI 3VR9B 1N60A 3T3OA 3UQBA 2KTRA 5JHBA 3URYA 1GTEA 1XT9B 2CU1A 2BKFA 1V8CA 3KLSX 3BY4B 2BS4B 3JYUA 2O2VB 2PVGC 4LLGM 3C19A 3AMZA 3PS6A 3U4EG 3PRPB 4US9A 3BZDB 4M01A 1FMAD 3PREA 2GB1A 1GAQB 3MC0B 4HXDA 1TTNA 4KKJA 3PZ7A 1L4ZB 4RM8A 1WM3A 2LVPA 2FIFA 1UBQA 2G45B 1KH0A 5C3JB 2IGHA 1JWBD 3WIMA 2JT4B 4YT0B 2MP2B 2C7MB 3PSEB 3HIZA 4MJSB 2Q5WD 2D3BA 2KQSA 2PLPA 1WFYA 5L83A 3SEBA 4GOCA 4NZLB 3GB1A 2BWES 2JF5A 4IWQA 1FCLA 2JUOA 2XBBC 4LJPB 1WY8A 3A1QB 2Z0EB 2KWUB 1WJUA 2XEWA 4D2KA 2NTTA 1VJKA 3DDCB 3W9CB 3W1YA 2JU6X 4LK0M 3W5VB 2ZPNA 2H88B 1RWSA 3ECIA 3BWUD 2LGYA 3ZYYX 1FPYA 3V6CB 1MVKA 3TEXA 3N1ZC 2KC1A 2C9WB 2J42A 2WXJA 3EFCA 2MBBB 5IOIA 2W55A 3AE7B 4HWIB 4FHKA 2JXXA 1LXDA 3TEWA 3U2SC 4NJ6A 4ZHOA 4E3CA 1AARA 2RDHA 4TKNA 2PJHA 1TS4A 4IM0A 2RPVA 2SEBD 3Q6BA 4LNIA 2KQ4X 2QCZA 2BT6A 2RDBC 4ZDVA 3QJZA 3A9JA 3NS1A 2A4ZA 3VTUA 1QF6A 1IPGA 2BKRB 2HJ8A 2AQ1B 2DLBA 2KO3A 4QAYA 2WX1A 2WXFA 2KJ6A 3VRAB 4LNFA 3AE4B 1ZUD2 2B76B 4IC7B 5J2RA 3L16A 4BVUC 4K7WA 3PV1A 1LO5D 4WWNA 4KIKB 4C4VA 1C4PA 1TT5B 2RPQA 1SE3A 3IHPC 3QQ8B 3BVZA 3ZXRA 1I4RA 2MA9B 3VR8B 2PVOD 4IM3A 1UWMA 1CQVA 4GDLB 2KDMA 4WAAA 4L1BA 1C77A 2FUHB 2KVRA 1P7EA 4A55A 2WXNA 3OJ4B 3GZNB 2YLMA 2JSVX 5C2TB 1HXYD 1ZPSA 2C5LC 3RNEC 3EC8A 1WI0A 1X1MA 5CTRC 3H7PA 1ESFA 3DWMA 3KUDB 3Q3NC 2KX3A 1GUAB 2K3UA 4IWOA 3B9JA 2N9EB 3B0AA 2K1FA 3N1XC 4PS8A 3MTNB 1V1PA 1CJEA 1TYGB 3B08A 3CWIA 1GTHA 1JWMD 4AQ7A 4G11A 1NBFC 4W9KA 3MFGA 3MHSD 1V9JA 3N30A 1KTKA 1EF1A 2X8XX 4KGTA 3NG0A 4NAWB 4TMAB 4A90A 1KRHA 2DAJA 4URKA 4BOSC 1FM0D 1IUEA 3Q8EA 2ZCBA 1J0GA 3UI3A 1DGJA 1OQQA 3ZNZB 4ITKA 1NENB 4XDDA 1Y56A 1WZ0A 2O2VA 1E0ZA 1L6VA 2BF8B 4IW0A 3IAM1 1JWAD 3EA6A 2K6DB 3NY5A 1TZ1A 4HPPA 2NCNA 4S17A 3VUYA 1RRBA 3CSFA 4HVBA 1RYJA 3ML8A 3L4PA 1FFVA 1WRIA 3IBEA 2M0AA 1GOZA 5LXHA 3K9OB 2I38A 3MP9A 4XX5A 2FIDA 4OZBA 4RM9A 1WGKA 3U30A 4HCNB 2AEHA 3M62B 3AE8B 3BYYB 1J8CA 1FNWA 1QT9A 1WGRA 4RGMA 1J7AA 1C4AA 4YXDB 3VUWA 3QHTA 1XCTL 1IGDA 2MP2A 1OQRA 2INDC 1MI0A 4GGQA 2KN4A 1WR1A 4EUTA 3V62A 1NYRA 2N7EA 4MSQB 3KW5B 4K1RB 4PK1A 2VH1A 3WA0A 3I57A 2KWVB 3NZUA 4DXGA 1WX8A 1WX9A 2QILA 3A1QA 5D2MB 1GB1A 4LJOB 1LFDA 1GB4A 4LNOA 1I4GA 3ZNGC 2WGSA 3AE5B 4ZRKA 3ZJTA 3IVFA 2BQQA 1WZ3A 4K7UA 5GMVA 1RFKA 4FULA 3GE8C 2D3CA 3KH0A 1ZXHA 5H8YE 5HI1A 1N6ZA 3TL5A 3ALBA 1GT8A 5I4DA 1H8CA 4W9IA 3RCZA 2W54A 2AWTA 1J7BA 2FE8A 4MEMA 4E71A 3DBLI 1QLBB 1VDVA 1TKEA 1G6JA 5AZFA 2MEKA 4WQMA 2JYTA 3TBLD 1Z2MA 1N5WA 4JPSA 1WGYA 2DYMA 2KMAA 5IKCM 2MWSB 2QC8A 1MG8A 2JZZA 1N61A 4PS7A 2MW5A 2ZNVB 3ZTCA 5JHAA 1YX5B 1I4QA 1SGHA 1CMXB 1XXGA 3H9DA 3KWLA 5TSSA 2ZVNA 4ACFA 4HCPB 4CHKA 3NHEB 4FXCA 2MH7A 3BK2A 3RYTA 4II3B 3AE3B 2R2QA 1QOGA 1NDDA 1L0VB 1J19A 3TEZA 2JWZA 5AZHA 4AUQC 4OHJA 1B9RA 3PPAA 4KIKA 3HVZA 1BUIC 1EF5A 2IGDA 1K50A 4I6PA 3AU5A 3FILB 1XLNA 2L0FA 4REZA 5DPRA 4GDLA 2L1AA 2V1YA 4I6NB 2DAFA 2IGGA 3IXSA 1PGAA 3R7QA 1U4AA 2LWPA 2Y5CA 1XD3B 1VCBA 3NS8A 2KWCA 2KJRA 1H7WA 1XEEA 3P4RB 4XGAB 3R2TA 1I42A 1SXTA 3ZNHB 4AJYB 5CHVC 2BYVE 1V81A 5IA7A 2BPSA 2ZCCA 3MC9A 2REXA 2OEDA 3RD2A 2LGDA 3KYDD 1UELA 1WXVA 5KHOA 4IWPA 2LZ6A 3ZLZA 5HKHA 1D6EC 3ABVB 1IGCA 1ZXIA 1S1QB 2GOWA 2ZJDA 3X23A 2AX5A 3L08A 3R2IA 4NJCA 1K53A 2GBRA 1EM7A 3RMKC 2BYEA 4EZJA 4NAWA 2HDEA 2WXIA 1STEA 4RF1A 1YQBA 4LTUA 3TUOA 1ZW7A 3EECA 3PGEA 2NBUA 1E8YA 3T8MA 2DBYA 4RMAA 2LASA 1E8WA 4K3BA 4K3CA 4WWMA 1TKYA 2W9NA 4LNNA 4GDKB 1WJ6A 5BYQA 2MJEA 3WANA 4GU2A 4F7ZA 1UGMA 2N9LA 3LB8C 4JWUC 2NMQA 3AH7A 1M94A 2D5GA 2Y3AA 3O13A 3SFDB 2BGFA 1WXAA 1T6BX 4LDTB 3R3MA 2QJLA 2OJWA 1NI3A 3UGBB 1YMHE 2V3SA 4DWFA 5EDSA 3P2BA 3VFKA 2IY1B 1F1HA 4HEA1 2IO3B 5LXIB 3HUIA 1C78A 2PW9A 5DPSA 3ZVVA 1K8RB 3TCAA 2IDYA 2N0SB 1ROEA 1OFFA 2PMVA 3DBLB 2K8CA 2L3ZA 2DYBA 2LJ5A 1YJ1A 1V5TA 1T5XD 2M4NA 2AL6A 1V6EA 3Q8FA 4KGSA 4YSXB 3ZW3A 3U7DA 4BFRA 5G5HA 3TMPB 1FRRA 2HD5B 2KYWA 1MG4A 2IBIB 2KXJA 2I1JA 1JQ4A 4GMVA 1FXAA 4GN1A 1V2YA 3RNGC 4JX1C 3KUCB 2LHDA 1E5WA 4P1BC 2LEKA 2BS3B 1GNUA 4JGHB 3VH3B 2CHZA 1V49A 4N58A 2CS4A 1C76A 3TSSA 2KDBA 4A6QA 2OOBB 4W9DA 2WNMA 4A8XC 4XYCA 1XO3A 4YTPB 3LXFA 3B1LX 2OJRA 4HK2A 2V4IB 4KDIC 3WALA 4XDCA 5D3DA 1FO4A 4X57B 4GSWA 2MBQA 1SE2A 4KZ0A 4IUMB 3DBSA 3GOEA 3WAOA 3DHHC 4YWGG 2FCMA 2KMCA 3AB5A 2UU7A 4G3XB 1P98A 1ZDXA 4PS3A 2VRRB 1FCCC 3JW0X 4OZCA 3AEGB 1NYQA 3AEAB 3ONSA 3AULA 4WQOB 2LVQA 3QAQA 2BB5A 1SE9A 5BYSA 2MCNB 2J52A 3KVFB 3NVWA 5HG2A 3AEBB 1V1OA 1YIWA 4W9FA 2L00B 2G4DB 4FN2A 1SIFA 3FILA 1ET9A 1ZGUB 1T0SC 4W9GA 3L10B 1WXQA 2BVCA 4EZKA 2FCQA 4B6WA 2MSED 4PYZA 3SHQA 3RN9C 3AE9B 5IP4D 4Q2JA 4MH0E 1M4VA 3N20C 5E6OA 2NBVB 1S3SG 3C8YA 1SEBD 4WAFA 3CSTA 2J0KA 2ZVOA 2RSUA 2M56B 2DZJA 3DVGX 1FRDA 2WP9B 3AEFB 3HK0A 2KACA 1XQQA 2R2OA 3QK0A 2WXQA 4RNAA 5G2NA 2IPKD 1YNTE 2AQ2B 3W5UB 3AXCA 3UINB 4RH6A 1EWYC 3PLVA 3AE2B 2JPHA 2LRUA 1UUPA 1C4CA 1L5PA 1Q10A 1ACCA 4IM2A 2ZW1A 1V86A 3M63B 4NQKE 1FXIA 1AW7A 1EU3A 5HHDG 2NPTB 2AQ3B 1UH6A 1OEYA 4C7ZA 3DVGY 1XF5L 4DXAB 2K22A 3KUZA 3V60A 4G50A 2KN5A 2LMCA 3JVZX 4H2AA 4M8MA 5G55A 1Q5WB 2KDFB 2L0TA 2CHXA 1C9FA 1YD8U 1MJDA 4HDOA 2D11A 4II2B 1WMHB 3AI5A 1P3QU 4MACA 3KQ4A 2CKHB 4AP4C 3VRBB 4FLHA 4GDKA 4OZAA 4MDKE 4FJYA 1HQRD 2J0JA 3SDLC 3VTVA 2PE6B 2PPHA 4ZRIA 1QILA 4RGOS 5BYRA 2ACZB 2MX2A 2N4FA 3L17A 4DHZE 2VZKB 4WIPA 3PVLA 4W9CA 3SR6A 4KKIA 2N7JA 1F2RI 4YTMB 1IBXB 3MC8A 2JZ3B 4EEWA 4DHJB 3IT4B 2J0MA 2JWUA 4ANWA 2ONQA 4P7IA 4ARIA 1C79A 1BXTA 4LDTD 2ZZPB 3APDA 3SD5A 1L4DB 3BINA 2BW2A 1PQSA 2V3PA 1WXMA 3Q3MC 3DBRI 1R4MB 3WCQA 3SFEB 1VLBA 3NZ3A 3RT3B 2KJHB 4O1NA 5JZEB 5DPWA 5EE3A 3L0WB 2SAKA 1I4HA 4P6VF 5DCNA 3TJPA 3ZJVA 4S0RA 5CHFA 2YEPB 2KDEB 2K5PA 4EKUA 1E8ZA 3UF8A 4ZYNA 4OW0A 2ICIA 1PUTA 3ZXVA 1AWDA 1CK1A 2J53A 2GBNA 3H7SA 3VHTC 2WHIA 5E6JA 5EE1A 3P4PB 3UIOB 3P63A 1UD7A 5BMGA 2MQJA 4ZRQA 4FHJA 3CF6E 4RGTA 4HLEA 3PT2B 4UDUC 1V80A 4NQLB 3BVMA 4YSZB 2H89B 1E8XA 4ZOHC 3MJWA 3EFUA 3QIJA 5AUKA 1XLOA 1PGBA 3RNFC 1R4NI 5TR5A 2GI9A 1ISNA 2KWDA 3UIPB 4WJNA 2EMSA 4MH8A 3UQAA 2KDIA 3Q69A 3W1SA 4FJVB 1CZPA 2R61A 4P16A 2K0PA 2IYDB 2E6XA 1SE4A 4W9EA 5MPOA 3DWGC 2ASQA 3S2AA 2FAZA 2IO0B 2XNAC 3FC4A 3H6NA 3QA8A 3V05A 1PFDA 2IO2B 2BTEA 3PZDA 3PTFC 1C1YB 4F1SA 3K9PB 4XWTA 4EOYA 4KV2A 2GMIC 3VQIA 3CF4A 1DOIA 3H8HA 2M8SA 4MELA 3NVZA 4NY0A 2PTLA 2JRIB 2K39A 4DHZB 1Y8RC 4US8A 4WH4A 1E6EB 4A20A 1L7YA 4C56C 2AYOB 2KOXA 2C7NB 3CMMB 3OWEB 2XK5B 3BYTB 1NVID 1JWUD 2IY0B 2QMTA 4RF0A 2JX5A 5C23A 1WM2A 1N5XA 4YL8A 1TKGA 4NAMA 4OVZA 4DDGD 3O65B 1B1ZA 3L13A 1F77A 2KQ7A 3HM6X 4NPNA 1YQ4B 2CJOA 5J17A 4MGIE 3L54A 1SJED 4GLSC 1WRDB 2MRPA 2K6QA 4WURA 3HRDD 3V61A 1E9MA 4PT5A 3VH4B 2KKCA 1VR9A 1FXTB 1WH3A 4AS1A 3APCA 4KDLB 1GPXA 2PIAA 3AM9A 1FFUA 3A4RA 3R7RA 1VZ7A 2LJIA 1QQRA 2WXKA 2NPTA 2DYOA 2HTHA 2WX0A 3LDZE 3RULA 4ZHPA 2K8HA 4J3OD 2L8JA 4YSYB 2Y5PA 3KYCD 2LI5A 2LRWA 4IOIE 1P1AA 3RNBC 4PYUA 1WX7A 2GBJA 2YVCA 4ICUA 3R8BA 3DBRB 4XZ4A 4HJKA 1JMLA 1DYQA 3I9V1 1N62A 1SSNA 3NUHB 2QHOA 3VXWA 1WMHA 3AEEB 2C7HA 3C0RB 2G1EA 4WJOA 1YOVB 4TQ1A 1EUVB 4W9JA 2B3AA 3EHVA 4DQOC 3ZTDA 2FCSA 4HPLB 2RR9A 3RNAC 1JALA 3ENEA 3Q8BA 4GXBA 1ZKHA 1BT0A 2KFKB 3DCGA 1OQYA 3N1YC 1BMLC 2EKIA 2M19A 2LGSA 2KHWB 3IT6B 2KK8A 1IBXA 2IJ0A 2DZIA 3Q2AC 2VZKD 3ZJUA 1L2NA 4ANUA 1PGXA 2DX5B 1JROA 2INNE 4DHJD 1D3ZA 2NVUI 1R4NB 5G5GA 3NOBA 1UNSA 2V9HA 2WDTB 3AEDB 1KOTA 4N59A 2DHZA 4W9LA 2V4LA 2LUEA 2X38A 3OLMD 5E6PA 2HJ1A 2LHEA 2ON8A 2RGFA 4A3PA
chains in the Genus database with same CATH topology
1SB3C 1PYWD 1YJIA 5FR3A 4TSSA 1NEKB 3UI3A 1DGJA 1OQQA 1L0XB 1KLGD 1NENB 4ITKA 4XDDA 4XWWA 1Y56A 2W3SA 3FILA 1ET9A 1DOXA 3J9CA 2KMMA 1UWXA 4EE2A 1SBBB 1E0ZA 1QOAA 5H92C 1VZ6A 3NVVA 1L6VA 1WXQA 2W3RA 3IAM1 1JWAD 1PDXA 3EA6A 2V0GA 2YEPF 2NTSA 3AE9B 4Q2JA 1RYJA 3L4PA 4N6EB 1FFVA 1WRIA 4ARCA 5FK9C 2M0AA 1GOZA 1M4VA 1YQ3B 2I38A 3MP9A 2BB6A 1K52A 1T3QA 2MJ3A 4OZBA 1WGKA 5D3IB 2PKOA 1HA5A 3C8YA 1SEBD 4WAFA 2WDQB 2ZW0A 1QOFA 3AE8B 2M56B 3BYYB 1FRDA 1FNWA 1QT9A 2WP9B 3AECB 3AEFB 2KACA 4XE0A 4RGMA 2WXMA 1V97A 3E56A 1ZP0B 1J7AA 1YJJA 1H7XA 1C4AA 4YXDB 4USAA 2WXQA 2QEJC 1XCTL 1IGDA 2RDGA 4RNAA 3ZQ4A 2IPKD 2TSSA 1OQRA 4RFBA 1YNTE 1FD6A 1XLQA 1MI0A 2AQ2B 3W5UB 1F0ZA 1FIQA 1A70A 4RH6A 1EWYC 2KN4A 2WXLA 3AE2B 2WU5B 3Q8AA 1UUPA 1C4CA 1D5ZC 1J7CA 1L5PA 1NYRA 2KAJA 2Z8LA 1Q10A 1ACCA 1FNUA 5GXGB 2ZW1A 1FXIA 1KLUD 2JQRB 2JXTA 1ZDVA 3ETRA 1AW7A 1XLPA 2LGIA 4JWSC 1EU3A 3I57A 5HHDG 4RGNA 2J4XA 2JYEA 2AQ3B 2I2YA 4C7ZA 4KGRA 4L2YA 1UGJA 4DXGA 1XF5L 2QILA 2K22A 2W82A 1MPEA 1MHXA 3B2GA 1GB1A 1I7HA 2LMCA 1AYFA 4TQ0A 1GB4A 3P4QB 1I4GA 5JXVA 4H2AA 3AE5B 3ZJTA 1ZE3D 2QSDA 3RPFC 1C9FA 4MT5A 1DOYA 1RFKA 2WXOA 1ZXHA 4MACA 1QOBA 5H8YE 3PO0A 4HROA 3KQ4A 2EELA 5HI1A 3V3XA 4B0MA 2BS2B 4B0EA 1RM6C 2INPE 1TJEA 3VRBB 1GT8A 1KF6B 4ZYSA 5I4DA 4OZAA 1HQRD 3BIID 3HVDA 2K9XA 2W54A 1J7BA 2FE8A 1QILA 4RGOS 5BYRA 3W2DA 2ACZB 1QLBB 3AN1A 1VDVA 1TKEA 3CIRB 5LNK1 1P7FA 1YN5A 2VZKB 1EU4A 3GS2A 4WIPA 2MEKA 1JW9D 4WQMA 3N9YC 2JYTA 3P42A 1YN3A 1F2RI 4YTMB 2N7JA 1N5WA 4KKIA 3SR6A 1IBXB 1E7PB 4JPSA 2DYMA 2E3TA 3IT4B 2JWUA 2L83A 1V1PB 1FEHA 1N61A 2ONQA 4ARIA 1C79A 1BXTA 1JRPA 4HKQA 1L4DB 2V3NA 1MHHE 2BW2A 2GRIA 2V3PA 2CJNA 3RFZB 1K51A 1I4QA 3B2FA 2WDRB 4L23A 1D5MC 1XXGA 3KWLA 5TSSA 5HFYA 4CQNA 2FUG1 4FXCA 2MH7A 3WCQA 3BK2A 1WSPA 2WXRA 3SFEB 1VLBA 3NZ3A 3AE3B 3ZGZA 1QOGA 4O1NA 2XN9C 3VR9B 1XCQL 4JE3B 5EE3A 1N60A 2SAKA 1I4HA 1L0VB 5D7GA 4ZRPA 2WXHA 4P6VF 3TEZA 3ZJVA 1WWTA 4OHJA 3T3OA 2WLBA 1B9RA 2YEPB 3HVZA 1BUIC 5AUIA 3URYA 1GTEA 2K5PA 2IGDA 1V8CA 1K50A 1ET6A 3KLSX 3FILB 1XLNA 4DXFA 2BS4B 4REZA 4OW0A 2PVGC 2ICIA 1PUTA 4LLGM 3AMZA 1N63A 1AWDA 1CK1A 3U4EG 2J53A 1QKZA 2L1AA 4US9A 3BZDB 5E6JA 5EE1A 3P4PB 3P63A 2WU2B 1FMAD 2GB1A 4RCOA 5BMGA 2IGGA 1GAQB 3MC0B 2MJDA 4ZRQA 4RGTA 4KKJA 3IXSA 3PZ7A 1PGAA 4UDUC 1L4ZB 3BVMA 4KX6B 4YSZB 4YTNB 2H89B 2Y5CA 4HKZE 3GP7A 4ZOHC 1KH0A 1H7WA 1XEEA 3P4RB 2QIEB 5AUKA 1XLOA 2N9KA 3AV8A 3EUB2 3R2TA 5C3JB 1PGBA 2IGHA 1JWBD 4C7YA 1SXTA 4YT0B 2G9HD 2GI9A 1EWCA 2KWDA 2Q5WD 5T8IA 2OEDA 2PLPA 1L0YB 1HEZE 4MH8A 1TS2A 3U52E 3SEBA 4NZLB 3GB1A 1F2RC 1D5XC 3Q69A 1D6EC 3ABVB 1IGCA 1ZXIA 1E10A 3W1SA 1FCLA 1CZPA 2R61A 4P16A 2K0PA 4C80A 2WQYB 2E6XA 1SE4A 5MPOA 3DWGC 1SF0A 2XNAC 4D2KA 3FC4A 2NTTA 2AX5A 1VJKA 3R2IA 4NJCA 3AE1B 3V05A 1K53A 1EM7A 1PFDA 3NVYA 2BTEA 1I4PA 3W9CB 4M0WA 2HDEA 2WXIA 1STEA 2JU6X 4LK0M 4RF1A 4XWTA 4LTUA 3TUOA 3W5VB 3VQIA 3CF4A 2HTME 2H88B 1JCKB 1DOIA 1RWSA 3H8HA 3BWUD 3ZYYX 2DBYA 3NVZA 2PTLA 4US8A 4WH4A 1E6EB 2LUMA 4WWMA 3AE6B 3E9SA 1TKYA 4C56C 4GDKB 1AN8A 1MVKA 3EGRA 3TEXA 5BYQA 2MJEA 3OWEB 3P1MA 2J42A 1ENFA 2N9LA 1NVID 3BYTB 1JWUD 3LB8C 4JWUC 2NMQA 1ZOYB 2QMTA 2WXJA 3AH7A 2D5GA 2JX5A 2Y3AA 4RF0A 2FBWB 3O13A 3SFDB 1N5XA 3BVGA 1TKGA 4NAMA 2W55A 3AE7B 1T6BX 4OVZA 2LFIA 2BBCA 3TEWA 1TY2A 3U2SC 2QJLA 4ZHOA 1B1ZA 1NI3A 1F77A 1YMHE 1YQ4B 1TS3A 2RDHA 2CJOA 1TS4A 2RPVA 2SEBD 5EE0A 1L6UA 3P4SB 2KQ4X 2BYTA 4MM3B 3TEYA 4HEA1 1JWSD 1SIJA 2BT6A 1SJED 4GLSC 4A9AA 3HUIA 5BMHA 1C78A 2PW9A 4WURA 3HRDD 1R7SA 3NS1A 1E9MA 1FNVA 4PT5A 1YN4A 1QF6A 2IDYA 2N0SB 1ROEA 1VR9A 4AS1A 3LYYA 2AQ1B 2DLBA 1OFFA 4IKGA 1GPXA 2PMVA 3T3NA 1TS5A 2PIAA 3AM9A 4IDIA 1FFUA 2WXFA 4R3DA 3VRAB 1VZ7A 3Q8CA 2LJIA 1QQRA 3AE4B 1T5XD 2B76B 1ZUD2 2WXKA 3KWVA 1SJHD 1KFYB 2WS3B 2DYOA 4YSXB 3Q8FA 4KGSA 4ZHPA 1LO5D 5G5HA 4J3OD 1FRRA 3MJ5A 4YSYB 1C4PA 1I4XA 2WXGA 2Y5PA 3BK1A 4IOIE 1JQ4A 1FXAA 1SE3A 3BVZA 2DWQA 4JX1C 1VZ8A 2LHDA 1I4RA 2CU3A 3R8BA 3VR8B 2PVOD 1UWMA 1CQVA 2LEKA 2BS3B 1JMLA 2OHFA 1DYQA 2KDMA 3I9V1 4GDLB 1N62A 4L1BA 1C77A 1SSNA 3NUHB 1P7EA 4A55A 2WXNA 3AEEB 2G1EA 4N58A 1C76A 4TQ1A 3TSSA 4A6QA 3PZ8A 2JSVX 2L32A 3FAHA 4A8XC 2WNMA 1XO3A 5C2TB 4HRSA 4YTPB 2WXPA 1TY0A 5FKAC 4DQOC 3LXFA 1HXYD 3IAS1 1JALA 1ZPSA 3Q8BA 5BMIA 2V4IB 4HJGE 4XDCA 2JZPA 5D3DA 1FO4A 1HZ5A 1BMLC 1ESFA 2EKIA 2M19A 3DWMA 3IT6B 3U7ZA 2K3UA 1SE2A 3B9JA 1IBXA 2IJ0A 2L52A 4YWGG 1V1PA 1CJEA 1TYGB 5EE9A 3CWIA 1GTHA 1JWMD 3MHZA 2VZKD 4AQ7A 3ZJUA 1PGXA 3MFGA 3AB5A 1WYGA 1JROA 1ZDXA 2INNE 2WDVB 5G5GA 3NRZA 1KTKA 1FCCC 1HZ6A 1UNSA 4OZCA 3AEGB 1NYQA 3AEAB 1TZOA 4KGTA 3AEDB 4NAWB 4N59A 4TMAB 5BYSA 2BB5A 4A90A 2X38A 1KRHA 2J52A 1VRAB 1D4BA 2RMMA 3NVWA 2LHEA 5HG2A 1FM0D 3AEBB 1V1OA 2ON8A 1IUEA 3Q8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SB3 C;  3BII D;  1YJI A;  3VRA B;  1NEK B;  1DGJ A;  1OQQ A;  2K9X A;  2Q5W D;  3AE4 B;  1NEN B;  2B76 B;  1ZUD 2;  2W54 A;  4ITK A;  2W3S A;  1J7B A;  1DOX A;  1KFY B;  2KMM A;  2WS3 B;  4ZHP A;  4YSX B;  2ACZ B;  1E0Z A;  1QLB B;  3AN1 A;  1QOA A;  1TKE A;  1VDV A;  5G5H A;  5H92 C;  3CIR B;  1FRR A;  3NVV A;  4HRS A;  4YSY B;  1L6V A;  1WXQ A;  3ABV B;  1JW9 D;  1ZXI A;  2W3R A;  1JWA D;  1PDX A;  4WQM A;  1E10 A;  1FXA A;  3SR6 A;  1JQ4 A;  4YTM B;  1CZP A;  1N5W A;  1GPX A;  2DWQ A;  4C80 A;  1E7P B;  4JX1 C;  3AE9 B;  2E3T A;  2CU3 A;  1IUE A;  3VR8 B;  2WQY B;  1RYJ A;  1UWM A;  2PVO D;  3L4P A;  1FFV A;  2L83 A;  1WRI A;  2BS3 B;  2LEK A;  4N6E B;  2OHF A;  5MPO A;  3DWG C;  1YQ3 B;  1N62 A;  1N61 A;  1SF0 A;  1JRP A;  1T3Q A;  3FC4 A;  2MJ3 A;  1WGK A;  1VJK A;  2AX5 A;  3AE1 B;  2PKO A;  3AEE B;  2CJN A;  3NVY A;  1PFD A;  2G1E A;  4N58 A;  2WDQ B;  3W9C B;  1QOF A;  3B2F A;  3AE8 B;  2M56 B;  2WDR B;  1FRD A;  1QT9 A;  3KWL A;  2WP9 B;  4LTU A;  3AEC B;  3AEF B;  3FAH A;  3W5V B;  3CF4 A;  1V97 A;  2HTM E;  1ZP0 B;  1J7A A;  1XO3 A;  2H88 B;  5C2T B;  4YTP B;  1H7X A;  1YJJ A;  4YXD B;  2MH7 A;  3LXF A;  4FXC A;  1RWS A;  3SFE B;  1DOI A;  1VLB A;  4USA A;  1JAL A;  3AE3 B;  3WCQ A;  3ZYY X;  2DBY A;  3NVZ A;  1QOG A;  1OQR A;  3VR9 B;  1XLQ A;  3W5U B;  1F0Z A;  4US8 A;  1FIQ A;  5EE3 A;  1N60 A;  1A70 A;  1E6E B;  4WWM A;  1EWY C;  3AE6 B;  1L0V B;  4P6V F;  1TKY A;  3AE2 B;  1WWT A;  2WU5 B;  2MJE A;  1FO4 A;  2WLB A;  1B9R A;  1J7C A;  1L5P A;  1NYR A;  2EKI A;  2KAJ A;  2M19 A;  3DWM A;  3HVZ A;  3P1M A;  5AUI A;  5GXG B;  1GTE A;  1NVI D;  2K5P A;  3LB8 C;  4JWU C;  1ZOY B;  3AH7 A;  1FXI A;  2JX5 A;  1V8C A;  2JQR B;  3B9J A;  3ETR A;  2FBW B;  1XLP A;  3SFD B;  1N5X A;  4JWS C;  1XLN A;  2BS4 B;  2L52 A;  1TKG A;  4C7Z A;  2PVG C;  2W55 A;  3AE7 B;  1PUT A;  2K22 A;  3AMZ A;  1N63 A;  1AWD A;  1CJE A;  3B2G A;  1TYG B;  2QJL A;  1I7H A;  3CWI A;  1GTH A;  1NI3 A;  5EE9 A;  4ZHO A;  1AYF A;  4US9 A;  1YQ4 B;  5EE1 A;  2CJO A;  3P4P B;  3P63 A;  3P4Q B;  2WU2 B;  3AB5 A;  1WYG A;  1FMA D;  1JRO A;  5EE0 A;  1GAQ B;  3AE5 B;  1L6U A;  2MJD A;  3P4S B;  3RPF C;  2WDV B;  1SIJ A;  2BT6 A;  4KX6 B;  5G5G A;  1DOY A;  4A9A A;  3NRZ A;  4YSZ B;  4YTN B;  3HUI A;  1RFK A;  2H89 B;  2Y5C A;  3AEG B;  3HRD D;  1NYQ A;  1R7S A;  3AEA B;  3NS1 A;  1E9M A;  3AED B;  1QF6 A;  1QOB A;  5H8Y E;  2N0S B;  3PO0 A;  1ROE A;  4HRO A;  4N59 A;  4ZOH C;  1OFF A;  1KRH A;  1H7W A;  2QIE B;  2BS2 B;  3P4R B;  5AUK A;  1XLO A;  3AV8 A;  1RM6 C;  2PIA A;  3EUB 2;  1TJE A;  5C3J B;  3NVW A;  3AM9 A;  4IDI A;  1JWB D;  3VRB B;  1GT8 A;  1KF6 B;  3AEB B;  1FM0 D;  1FFU A;  4C7Y A;  4YT0 B; 
#chains in the Genus database with same CATH topology
 1RLF A;  1PYW D;  1YJI A;  5FR3 A;  4MGK E;  2JVC A;  4MGZ E;  4ASW C;  3PLU A;  1KLG D;  2LVO A;  2W3S A;  2GBM A;  3J9C A;  1UWX A;  4JLC A;  4EE2 A;  5H92 C;  1VZ6 A;  3OG5 A;  2L7R A;  2V0G A;  5D94 A;  2YEP F;  3ZIM A;  4N6E B;  4ARC A;  1YQ3 B;  4BAX A;  2BB6 A;  1K52 A;  1Z5S B;  3DVN U;  1TGZ B;  1UZX B;  2MJ3 A;  1IYF A;  2N9X A;  2PKO A;  2WDQ B;  2ZW0 A;  4XE0 A;  2WXM A;  1V97 A;  1ZP0 B;  2ZEQ A;  1YJJ A;  1H7X A;  4NJ7 A;  1GC7 A;  3HM3 A;  2TSS A;  2GLS A;  1FD6 A;  1XLQ A;  5LLI A;  1FIQ A;  4FAD A;  1A70 A;  5IAA C;  3DHI C;  2M0X A;  1WJ4 A;  1WE6 A;  1J7C A;  2KAJ A;  3ZDM C;  1P0R A;  3A33 B;  2CR5 A;  2JQR B;  2JXT A;  3ETR A;  4ZRJ A;  1XLP A;  4JWS C;  4M8N A;  2I2Y A;  4L2Y A;  4ANX A;  2W82 A;  1MPE A;  5FR6 A;  1I7H A;  1Q0W B;  2D3G A;  3A4S C;  1AYF A;  1WGD A;  4TQ0 A;  2JRH A;  5L95 C;  3P4Q B;  1UF0 A;  2C60 A;  2NBW B;  2DZK A;  2QSD A;  1R4M I;  1UBI A;  2WXO A;  4LCD E;  4F8C B;  1GG3 A;  3WAP A;  1QOB A;  3PO0 A;  1OTR B;  3V3X A;  3I3T B;  4B0M A;  2BS2 B;  5BO4 B;  4B0E A;  1RM6 C;  4DDI D;  4I6L B;  2NR2 A;  1KF6 B;  2J7Q B;  2KLC A;  2NS5 A;  1LGR A;  2XK5 A;  3HVD A;  2K9X A;  1WXS A;  1HTQ A;  3CIR B;  5LNK 1;  1P7F A;  1YN5 A;  1JW9 D;  4BBN F;  3N9Y C;  4ICV A;  3P42 A;  3GE3 C;  4JQW C;  1A5R A;  5AEK B;  5IN7 A;  2LD9 A;  2L83 A;  1FEH A;  2CHW A;  3VVW B;  2MBO A;  2V3N A;  2CJN A;  1K51 A;  3T9L A;  4FBJ B;  4L23 A;  1D5M C;  5HFY A;  2FUG 1;  2KVZ A;  3QX1 A;  5D6J B;  3JSV B;  1GC6 A;  1WSP A;  2WXR A;  4KSL C;  3DHG C;  3ZGZ A;  2N9P C;  2RD0 A;  1XCQ L;  4JE3 B;  4ZRP A;  5D7G A;  2O6V B;  2WXH A;  3PHX B;  1WWT A;  5JH5 C;  1LM8 B;  2G3Q B;  2WLB A;  5AUI A;  1IP9 A;  3RZW C;  1ET6 A;  4BBN C;  2FNJ B;  4DXF A;  3Q14 C;  4WJP A;  2JY6 A;  2ZNV C;  3VAW A;  1N63 A;  1OEY J;  3NZS A;  4A3O A;  1QKZ A;  4AWJ A;  1I35 A;  4DBG A;  2WU2 B;  3PRM B;  4RCO A;  4DK5 A;  2MJD A;  3NJT A;  2Z59 B;  3LJ3 A;  4KX6 B;  4YTN B;  2UYZ B;  2DZM A;  4HKZ E;  1EO6 A;  3ZDT A;  2BYF A;  3GP7 A;  2QIE B;  3AV8 A;  2N9K A;  3EUB 2;  1T0Q C;  2KFK A;  2D07 B;  4C7Y A;  2G9H D;  1EWC A;  3AU4 A;  2D3A A;  5T8I A;  1L0Y B;  1HEZ E;  1TS2 A;  2KT7 A;  3U52 E;  1GJZ A;  3ML9 A;  2KNB A;  3TIX A;  2WYQ A;  1F2R C;  4P1C C;  3A9K B;  1D5X C;  2IO1 B;  2LXC A;  1E10 A;  4W9H A;  3ZO5 B;  1V5O A;  3I5J C;  4C80 A;  3M95 A;  5CX3 A;  4HDQ A;  3R66 C;  2WQY B;  3RZF A;  1SF0 A;  2KZR A;  4LNK A;  3AE1 B;  4IG7 B;  3NVY A;  1I4P A;  4EFO A;  4M0W A;  1WGH A;  4GIV A;  2HTM E;  1JCK B;  2PE9 A;  4AJW A;  2MHJ A;  2LUM A;  4JL9 A;  3AE6 B;  3E9S A;  5E6N A;  2KTF A;  1AN8 A;  3EGR A;  1P9D U;  3P1M A;  4BKS A;  1ENF A;  1ZOY B;  2QDF A;  3U8Z A;  2FBW B;  3BVG A;  4J6I A;  4M02 A;  2LFI A;  2BBC A;  1TY2 A;  1T0R C;  3H1U A;  2A5U A;  4BKS D;  1TS3 A;  5KHQ A;  2INC C;  4HPM B;  3WAM A;  5EE0 A;  1L6U A;  3P4S B;  2BYT A;  4MM3 B;  4MGY E;  3DOW A;  5C1Z A;  3TEY A;  1JWS D;  1SIJ A;  4A9A A;  5BMH A;  1F52 A;  2FCN A;  1R7S A;  1FNV A;  1YN4 A;  3LYY A;  3IG3 A;  2L05 A;  1E7V A;  4IKG A;  3T3N A;  1TS5 A;  4WWP A;  2AL3 A;  4KZC A;  4IDI A;  2IZV B;  4R3D A;  2MBH A;  3Q8C A;  4B9K A;  1HE8 A;  3KWV A;  1Q1O A;  1SJH D;  2MBE A;  1KFY B;  2WS3 B;  2D10 A;  2KTR B;  3MJ5 A;  3BK1 A;  1I4X A;  2WXG A;  2D2Q A;  2DWQ A;  3X0W A;  1VZ8 A;  2CU3 A;  4MJS A;  2OHF A;  3QC8 B;  4MSM B;  3QCA A;  3DBH I;  3I63 C;  5J18 A;  1RAX A;  3OAW A;  1MFW A;  3PZ8 A;  2L32 A;  3FAH A;  4HRS A;  5FKA C;  2WXP A;  1TY0 A;  3IAS 1;  4CYE A;  4N9F 4;  1H4R A;  3APF A;  4HJG E;  5BMI A;  1WJN A;  3N32 A;  2JZP A;  3DVN V;  1HZ5 A;  3ZKJ C;  2MLB A;  3IFW B;  3U7Z A;  2N7D A;  5CHW A;  2L52 A;  2EKE C;  3OJ3 A;  5EE9 A;  4K7S A;  3MHZ A;  3RUI B;  5IO9 A;  2KX0 A;  1WYG A;  4CO7 A;  2M17 A;  2WDV B;  2Z0D B;  3JSV A;  3FKY A;  3NRZ A;  4G0N B;  2KLG A;  1HZ6 A;  2Y5B B;  3PHW B;  1TZO A;  1T0Y A;  4NNJ B;  3RI7 C;  5DPT A;  3ZRC A;  4EZL A;  2KC2 A;  1VRA B;  2O6V A;  1D4B A;  2RMM A;  4JIO U;  2I1K A;  1SB3 C;  1TIF A;  4TSS A;  1NEK B;  1L0X B;  2K25 A;  1QZE A;  4XWW A;  3W1S C;  1DOX A;  4ANV A;  2KMM A;  2DEN B;  4XC2 A;  1SBB B;  2O6V D;  1E7U A;  1QOA A;  4M00 A;  2N1V A;  3ZUN A;  3N3K B;  3NVV A;  3ZRF A;  2W3R A;  1PDX A;  2LXA A;  2LGX A;  4BKG A;  3VUX A;  3QWZ B;  2NTS A;  2G4S A;  5AZG A;  4BKT A;  5FK9 C;  3M3J A;  1T3Q A;  2ZPY A;  5D3I B;  2K8B A;  1HA5 A;  4C00 A;  1QOF A;  4GB9 A;  3AEC B;  3E56 A;  4E74 A;  4TV3 A;  3DQV A;  3A9J B;  4USA A;  2QEJ C;  2RDG A;  2EMT A;  3ZQ4 A;  1TBE A;  1VD2 A;  4RFB A;  1F0Z A;  2BWF A;  4BZA A;  2WXL A;  3ZNI D;  3RNC C;  2WU5 B;  3Q8A A;  2WWZ A;  1D5Z C;  4KVG B;  4K81 A;  1KJT A;  2Z8L A;  3A9K A;  5GXG B;  1FNU A;  3VTW A;  1KLU D;  1ZDV A;  2LGI A;  2M1M A;  3QAR A;  4RGN A;  2J4X A;  2JYE A;  4KGR A;  1UGJ A;  4B95 A;  4C4V B;  1MHX A;  3B2G A;  4FJZ A;  2UWQ A;  1E90 A;  1WYW B;  2VH2 A;  2PEA A;  5JXV A;  1ZE3 D;  2KFJ A;  3HHM A;  3RPF C;  1RFA A;  1KLV A;  1WGG A;  2HE7 A;  4MT5 A;  1YX6 B;  4KSK C;  1DOY A;  4AOF A;  3V6E B;  1C3T A;  4HRO A;  2DNF A;  2EEL A;  1NI2 A;  2INP E;  4FA6 A;  1TJE A;  4OVU A;  4ZYS A;  3VDZ A;  1HTO A;  3BII D;  1OGW A;  1KM7 A;  1JRU A;  4BOZ B;  4OVV A;  1WE7 A;  3H7P B;  1F9J A;  3W2D A;  3AN1 A;  1WF9 A;  2KAN A;  3GS2 A;  1EU4 A;  3Q3F A;  4M0W B;  1YN3 A;  3DBH B;  1E7P B;  3Q3J A;  2E3T A;  3PRZ A;  1V1P B;  1WR6 E;  2GBK A;  4WJQ A;  4MM3 A;  3SU8 X;  1JRP A;  4HKQ A;  1MHH E;  2N1W A;  1LQB A;  2GRI A;  3D32 A;  3RFZ B;  3B2F A;  3DPD A;  2L76 A;  2WDR B;  2KD0 A;  4WWO A;  4CQN A;  4TUU A;  3Q3O C;  1WIA A;  2XN9 C;  3GZN I;  3VR9 B;  1N60 A;  3T3O A;  3UQB A;  2KTR A;  5JHB A;  3URY A;  1GTE A;  1XT9 B;  2CU1 A;  2BKF A;  1V8C A;  3KLS X;  3BY4 B;  2BS4 B;  3JYU A;  2O2V B;  2PVG C;  4LLG M;  3C19 A;  3AMZ A;  3PS6 A;  3U4E G;  3PRP B;  4US9 A;  3BZD B;  4M01 A;  1FMA D;  3PRE A;  2GB1 A;  1GAQ B;  3MC0 B;  4HXD A;  1TTN A;  4KKJ A;  3PZ7 A;  1L4Z B;  4RM8 A;  1WM3 A;  2LVP A;  2FIF A;  1UBQ A;  2G45 B;  1KH0 A;  5C3J B;  2IGH A;  1JWB D;  3WIM A;  2JT4 B;  4YT0 B;  2MP2 B;  2C7M B;  3PSE B;  3HIZ A;  4MJS B;  2Q5W D;  2D3B A;  2KQS A;  2PLP A;  1WFY A;  5L83 A;  3SEB A;  4GOC A;  4NZL B;  3GB1 A;  2BWE S;  2JF5 A;  4IWQ A;  1FCL A;  2JUO A;  2XBB C;  4LJP B;  1WY8 A;  3A1Q B;  2Z0E B;  2KWU B;  1WJU A;  2XEW A;  4D2K A;  2NTT A;  1VJK A;  3DDC B;  3W9C B;  3W1Y A;  2JU6 X;  4LK0 M;  3W5V B;  2ZPN A;  2H88 B;  1RWS A;  3ECI A;  3BWU D;  2LGY A;  3ZYY X;  1FPY A;  3V6C B;  1MVK A;  3TEX A;  3N1Z C;  2KC1 A;  2C9W B;  2J42 A;  2WXJ A;  3EFC A;  2MBB B;  5IOI A;  2W55 A;  3AE7 B;  4HWI B;  4FHK A;  2JXX A;  1LXD A;  3TEW A;  3U2S C;  4NJ6 A;  4ZHO A;  4E3C A;  1AAR A;  2RDH A;  4TKN A;  2PJH A;  1TS4 A;  4IM0 A;  2RPV A;  2SEB D;  3Q6B A;  4LNI A;  2KQ4 X;  2QCZ A;  2BT6 A;  2RDB C;  4ZDV A;  3QJZ A;  3A9J A;  3NS1 A;  2A4Z A;  3VTU A;  1QF6 A;  1IPG A;  2BKR B;  2HJ8 A;  2AQ1 B;  2DLB A;  2KO3 A;  4QAY A;  2WX1 A;  2WXF A;  2KJ6 A;  3VRA B;  4LNF A;  3AE4 B;  1ZUD 2;  2B76 B;  4IC7 B;  5J2R A;  3L16 A;  4BVU C;  4K7W A;  3PV1 A;  1LO5 D;  4WWN A;  4KIK B;  4C4V A;  1C4P A;  1TT5 B;  2RPQ A;  1SE3 A;  3IHP C;  3QQ8 B;  3BVZ A;  3ZXR A;  1I4R A;  2MA9 B;  3VR8 B;  2PVO D;  4IM3 A;  1UWM A;  1CQV A;  4GDL B;  2KDM A;  4WAA A;  4L1B A;  1C77 A;  2FUH B;  2KVR A;  1P7E A;  4A55 A;  2WXN A;  3OJ4 B;  3GZN B;  2YLM A;  2JSV X;  5C2T B;  1HXY D;  1ZPS A;  2C5L C;  3RNE C;  3EC8 A;  1WI0 A;  1X1M A;  5CTR C;  3H7P A;  1ESF A;  3DWM A;  3KUD B;  3Q3N C;  2KX3 A;  1GUA B;  2K3U A;  4IWO A;  3B9J A;  2N9E B;  3B0A A;  2K1F A;  3N1X C;  4PS8 A;  3MTN B;  1V1P A;  1CJE A;  1TYG B;  3B08 A;  3CWI A;  1GTH A;  1JWM D;  4AQ7 A;  4G11 A;  1NBF C;  4W9K A;  3MFG A;  3MHS D;  1V9J A;  3N30 A;  1KTK A;  1EF1 A;  2X8X X;  4KGT A;  3NG0 A;  4NAW B;  4TMA B;  4A90 A;  1KRH A;  2DAJ A;  4URK A;  4BOS C;  1FM0 D;  1IUE A;  3Q8E A;  2ZCB A;  1J0G A;  3UI3 A;  1DGJ A;  1OQQ A;  3ZNZ B;  4ITK A;  1NEN B;  4XDD A;  1Y56 A;  1WZ0 A;  2O2V A;  1E0Z A;  1L6V A;  2BF8 B;  4IW0 A;  3IAM 1;  1JWA D;  3EA6 A;  2K6D B;  3NY5 A;  1TZ1 A;  4HPP A;  2NCN A;  4S17 A;  3VUY A;  1RRB A;  3CSF A;  4HVB A;  1RYJ A;  3ML8 A;  3L4P A;  1FFV A;  1WRI A;  3IBE A;  2M0A A;  1GOZ A;  5LXH A;  3K9O B;  2I38 A;  3MP9 A;  4XX5 A;  2FID A;  4OZB A;  4RM9 A;  1WGK A;  3U30 A;  4HCN B;  2AEH A;  3M62 B;  3AE8 B;  3BYY B;  1J8C A;  1FNW A;  1QT9 A;  1WGR A;  4RGM A;  1J7A A;  1C4A A;  4YXD B;  3VUW A;  3QHT A;  1XCT L;  1IGD A;  2MP2 A;  1OQR A;  2IND C;  1MI0 A;  4GGQ A;  2KN4 A;  1WR1 A;  4EUT A;  3V62 A;  1NYR A;  2N7E A;  4MSQ B;  3KW5 B;  4K1R B;  4PK1 A;  2VH1 A;  3WA0 A;  3I57 A;  2KWV B;  3NZU A;  4DXG A;  1WX8 A;  1WX9 A;  2QIL A;  3A1Q A;  5D2M B;  1GB1 A;  4LJO B;  1LFD A;  1GB4 A;  4LNO A;  1I4G A;  3ZNG C;  2WGS A;  3AE5 B;  4ZRK A;  3ZJT A;  3IVF A;  2BQQ A;  1WZ3 A;  4K7U A;  5GMV A;  1RFK A;  4FUL A;  3GE8 C;  2D3C A;  3KH0 A;  1ZXH A;  5H8Y E;  5HI1 A;  1N6Z A;  3TL5 A;  3ALB A;  1GT8 A;  5I4D A;  1H8C A;  4W9I A;  3RCZ A;  2W54 A;  2AWT A;  1J7B A;  2FE8 A;  4MEM A;  4E71 A;  3DBL I;  1QLB B;  1VDV A;  1TKE A;  1G6J A;  5AZF A;  2MEK A;  4WQM A;  2JYT A;  3TBL D;  1Z2M A;  1N5W A;  4JPS A;  1WGY A;  2DYM A;  2KMA A;  5IKC M;  2MWS B;  2QC8 A;  1MG8 A;  2JZZ A;  1N61 A;  4PS7 A;  2MW5 A;  2ZNV B;  3ZTC A;  5JHA A;  1YX5 B;  1I4Q A;  1SGH A;  1CMX B;  1XXG A;  3H9D A;  3KWL A;  5TSS A;  2ZVN A;  4ACF A;  4HCP B;  4CHK A;  3NHE B;  4FXC A;  2MH7 A;  3BK2 A;  3RYT A;  4II3 B;  3AE3 B;  2R2Q A;  1QOG A;  1NDD A;  1L0V B;  1J19 A;  3TEZ A;  2JWZ A;  5AZH A;  4AUQ C;  4OHJ A;  1B9R A;  3PPA A;  4KIK A;  3HVZ A;  1BUI C;  1EF5 A;  2IGD A;  1K50 A;  4I6P A;  3AU5 A;  3FIL B;  1XLN A;  2L0F A;  4REZ A;  5DPR A;  4GDL A;  2L1A A;  2V1Y A;  4I6N B;  2DAF A;  2IGG A;  3IXS A;  1PGA A;  3R7Q A;  1U4A A;  2LWP A;  2Y5C A;  1XD3 B;  1VCB A;  3NS8 A;  2KWC A;  2KJR A;  1H7W A;  1XEE A;  3P4R B;  4XGA B;  3R2T A;  1I42 A;  1SXT A;  3ZNH B;  4AJY B;  5CHV C;  2BYV E;  1V81 A;  5IA7 A;  2BPS A;  2ZCC A;  3MC9 A;  2REX A;  2OED A;  3RD2 A;  2LGD A;  3KYD D;  1UEL A;  1WXV A;  5KHO A;  4IWP A;  2LZ6 A;  3ZLZ A;  5HKH A;  1D6E C;  3ABV B;  1IGC A;  1ZXI A;  1S1Q B;  2GOW A;  2ZJD A;  3X23 A;  2AX5 A;  3L08 A;  3R2I A;  4NJC A;  1K53 A;  2GBR A;  1EM7 A;  3RMK C;  2BYE A;  4EZJ A;  4NAW A;  2HDE A;  2WXI A;  1STE A;  4RF1 A;  1YQB A;  4LTU A;  3TUO A;  1ZW7 A;  3EEC A;  3PGE A;  2NBU A;  1E8Y A;  3T8M A;  2DBY A;  4RMA A;  2LAS A;  1E8W A;  4K3B A;  4K3C A;  4WWM A;  1TKY A;  2W9N A;  4LNN A;  4GDK B;  1WJ6 A;  5BYQ A;  2MJE A;  3WAN A;  4GU2 A;  4F7Z A;  1UGM A;  2N9L A;  3LB8 C;  4JWU C;  2NMQ A;  3AH7 A;  1M94 A;  2D5G A;  2Y3A A;  3O13 A;  3SFD B;  2BGF A;  1WXA A;  1T6B X;  4LDT B;  3R3M A;  2QJL A;  2OJW A;  1NI3 A;  3UGB B;  1YMH E;  2V3S A;  4DWF A;  5EDS A;  3P2B A;  3VFK A;  2IY1 B;  1F1H A;  4HEA 1;  2IO3 B;  5LXI B;  3HUI A;  1C78 A;  2PW9 A;  5DPS A;  3ZVV A;  1K8R B;  3TCA A;  2IDY A;  2N0S B;  1ROE A;  1OFF A;  2PMV A;  3DBL B;  2K8C A;  2L3Z A;  2DYB A;  2LJ5 A;  1YJ1 A;  1V5T A;  1T5X D;  2M4N A;  2AL6 A;  1V6E A;  3Q8F A;  4KGS A;  4YSX B;  3ZW3 A;  3U7D A;  4BFR A;  5G5H A;  3TMP B;  1FRR A;  2HD5 B;  2KYW A;  1MG4 A;  2IBI B;  2KXJ A;  2I1J A;  1JQ4 A;  4GMV A;  1FXA A;  4GN1 A;  1V2Y A;  3RNG C;  4JX1 C;  3KUC B;  2LHD A;  1E5W A;  4P1B C;  2LEK A;  2BS3 B;  1GNU A;  4JGH B;  3VH3 B;  2CHZ A;  1V49 A;  4N58 A;  2CS4 A;  1C76 A;  3TSS A;  2KDB A;  4A6Q A;  2OOB B;  4W9D A;  2WNM A;  4A8X C;  4XYC A;  1XO3 A;  4YTP B;  3LXF A;  3B1L X;  2OJR A;  4HK2 A;  2V4I B;  4KDI C;  3WAL A;  4XDC A;  5D3D A;  1FO4 A;  4X57 B;  4GSW A;  2MBQ A;  1SE2 A;  4KZ0 A;  4IUM B;  3DBS A;  3GOE A;  3WAO A;  3DHH C;  4YWG G;  2FCM A;  2KMC A;  3AB5 A;  2UU7 A;  4G3X B;  1P98 A;  1ZDX A;  4PS3 A;  2VRR B;  1FCC C;  3JW0 X;  4OZC A;  3AEG B;  1NYQ A;  3AEA B;  3ONS A;  3AUL A;  4WQO B;  2LVQ A;  3QAQ A;  2BB5 A;  1SE9 A;  5BYS A;  2MCN B;  2J52 A;  3KVF B;  3NVW A;  5HG2 A;  3AEB B;  1V1O A;  1YIW A;  4W9F A;  2L00 B;  2G4D B;  4FN2 A;  1SIF A;  3FIL A;  1ET9 A;  1ZGU B;  1T0S C;  4W9G A;  3L10 B;  1WXQ A;  2BVC A;  4EZK A;  2FCQ A;  4B6W A;  2MSE D;  4PYZ A;  3SHQ A;  3RN9 C;  3AE9 B;  5IP4 D;  4Q2J A;  4MH0 E;  1M4V A;  3N20 C;  5E6O A;  2NBV B;  1S3S G;  3C8Y A;  1SEB D;  4WAF A;  3CST A;  2J0K A;  2ZVO A;  2RSU A;  2M56 B;  2DZJ A;  3DVG X;  1FRD A;  2WP9 B;  3AEF B;  3HK0 A;  2KAC A;  1XQQ A;  2R2O A;  3QK0 A;  2WXQ A;  4RNA A;  5G2N A;  2IPK D;  1YNT E;  2AQ2 B;  3W5U B;  3AXC A;  3UIN B;  4RH6 A;  1EWY C;  3PLV A;  3AE2 B;  2JPH A;  2LRU A;  1UUP A;  1C4C A;  1L5P A;  1Q10 A;  1ACC A;  4IM2 A;  2ZW1 A;  1V86 A;  3M63 B;  4NQK E;  1FXI A;  1AW7 A;  1EU3 A;  5HHD G;  2NPT B;  2AQ3 B;  1UH6 A;  1OEY A;  4C7Z A;  3DVG Y;  1XF5 L;  4DXA B;  2K22 A;  3KUZ A;  3V60 A;  4G50 A;  2KN5 A;  2LMC A;  3JVZ X;  4H2A A;  4M8M A;  5G55 A;  1Q5W B;  2KDF B;  2L0T A;  2CHX A;  1C9F A;  1YD8 U;  1MJD A;  4HDO A;  2D11 A;  4II2 B;  1WMH B;  3AI5 A;  1P3Q U;  4MAC A;  3KQ4 A;  2CKH B;  4AP4 C;  3VRB B;  4FLH A;  4GDK A;  4OZA A;  4MDK E;  4FJY A;  1HQR D;  2J0J A;  3SDL C;  3VTV A;  2PE6 B;  2PPH A;  4ZRI A;  1QIL A;  4RGO S;  5BYR A;  2ACZ B;  2MX2 A;  2N4F A;  3L17 A;  4DHZ E;  2VZK B;  4WIP A;  3PVL A;  4W9C A;  3SR6 A;  4KKI A;  2N7J A;  1F2R I;  4YTM B;  1IBX B;  3MC8 A;  2JZ3 B;  4EEW A;  4DHJ B;  3IT4 B;  2J0M A;  2JWU A;  4ANW A;  2ONQ A;  4P7I A;  4ARI A;  1C79 A;  1BXT A;  4LDT D;  2ZZP B;  3APD A;  3SD5 A;  1L4D B;  3BIN A;  2BW2 A;  1PQS A;  2V3P A;  1WXM A;  3Q3M C;  3DBR I;  1R4M B;  3WCQ A;  3SFE B;  1VLB A;  3NZ3 A;  3RT3 B;  2KJH B;  4O1N A;  5JZE B;  5DPW A;  5EE3 A;  3L0W B;  2SAK A;  1I4H A;  4P6V F;  5DCN A;  3TJP A;  3ZJV A;  4S0R A;  5CHF A;  2YEP B;  2KDE B;  2K5P A;  4EKU A;  1E8Z A;  3UF8 A;  4ZYN A;  4OW0 A;  2ICI A;  1PUT A;  3ZXV A;  1AWD A;  1CK1 A;  2J53 A;  2GBN A;  3H7S A;  3VHT C;  2WHI A;  5E6J A;  5EE1 A;  3P4P B;  3UIO B;  3P63 A;  1UD7 A;  5BMG A;  2MQJ A;  4ZRQ A;  4FHJ A;  3CF6 E;  4RGT A;  4HLE A;  3PT2 B;  4UDU C;  1V80 A;  4NQL B;  3BVM A;  4YSZ B;  2H89 B;  1E8X A;  4ZOH C;  3MJW A;  3EFU A;  3QIJ A;  5AUK A;  1XLO A;  1PGB A;  3RNF C;  1R4N I;  5TR5 A;  2GI9 A;  1ISN A;  2KWD A;  3UIP B;  4WJN A;  2EMS A;  4MH8 A;  3UQA A;  2KDI A;  3Q69 A;  3W1S A;  4FJV B;  1CZP A;  2R61 A;  4P16 A;  2K0P A;  2IYD B;  2E6X A;  1SE4 A;  4W9E A;  5MPO A;  3DWG C;  2ASQ A;  3S2A A;  2FAZ A;  2IO0 B;  2XNA C;  3FC4 A;  3H6N A;  3QA8 A;  3V05 A;  1PFD A;  2IO2 B;  2BTE A;  3PZD A;  3PTF C;  1C1Y B;  4F1S A;  3K9P B;  4XWT A;  4EOY A;  4KV2 A;  2GMI C;  3VQI A;  3CF4 A;  1DOI A;  3H8H A;  2M8S A;  4MEL A;  3NVZ A;  4NY0 A;  2PTL A;  2JRI B;  2K39 A;  4DHZ B;  1Y8R C;  4US8 A;  4WH4 A;  1E6E B;  4A20 A;  1L7Y A;  4C56 C;  2AYO B;  2KOX A;  2C7N B;  3CMM B;  3OWE B;  2XK5 B;  3BYT B;  1NVI D;  1JWU D;  2IY0 B;  2QMT A;  4RF0 A;  2JX5 A;  5C23 A;  1WM2 A;  1N5X A;  4YL8 A;  1TKG A;  4NAM A;  4OVZ A;  4DDG D;  3O65 B;  1B1Z A;  3L13 A;  1F77 A;  2KQ7 A;  3HM6 X;  4NPN A;  1YQ4 B;  2CJO A;  5J17 A;  4MGI E;  3L54 A;  1SJE D;  4GLS C;  1WRD B;  2MRP A;  2K6Q A;  4WUR A;  3HRD D;  3V61 A;  1E9M A;  4PT5 A;  3VH4 B;  2KKC A;  1VR9 A;  1FXT B;  1WH3 A;  4AS1 A;  3APC A;  4KDL B;  1GPX A;  2PIA A;  3AM9 A;  1FFU A;  3A4R A;  3R7R A;  1VZ7 A;  2LJI A;  1QQR A;  2WXK A;  2NPT A;  2DYO A;  2HTH A;  2WX0 A;  3LDZ E;  3RUL A;  4ZHP A;  2K8H A;  4J3O D;  2L8J A;  4YSY B;  2Y5P A;  3KYC D;  2LI5 A;  2LRW A;  4IOI E;  1P1A A;  3RNB C;  4PYU A;  1WX7 A;  2GBJ A;  2YVC A;  4ICU A;  3R8B A;  3DBR B;  4XZ4 A;  4HJK A;  1JML A;  1DYQ A;  3I9V 1;  1N62 A;  1SSN A;  3NUH B;  2QHO A;  3VXW A;  1WMH A;  3AEE B;  2C7H A;  3C0R B;  2G1E A;  4WJO A;  1YOV B;  4TQ1 A;  1EUV B;  4W9J A;  2B3A A;  3EHV A;  4DQO C;  3ZTD A;  2FCS A;  4HPL B;  2RR9 A;  3RNA C;  1JAL A;  3ENE A;  3Q8B A;  4GXB A;  1ZKH A;  1BT0 A;  2KFK B;  3DCG A;  1OQY A;  3N1Y C;  1BML C;  2EKI A;  2M19 A;  2LGS A;  2KHW B;  3IT6 B;  2KK8 A;  1IBX A;  2IJ0 A;  2DZI A;  3Q2A C;  2VZK D;  3ZJU A;  1L2N A;  4ANU A;  1PGX A;  2DX5 B;  1JRO A;  2INN E;  4DHJ D;  1D3Z A;  2NVU I;  1R4N B;  5G5G A;  3NOB A;  1UNS A;  2V9H A;  2WDT B;  3AED B;  1KOT A;  4N59 A;  2DHZ A;  4W9L A;  2V4L A;  2LUE A;  2X38 A;  3OLM D;  5E6P A;  2HJ1 A;  2LHE A;  2ON8 A;  2RGF A;  4A3P A; 
#chains in the Genus database with same CATH homology
 1SB3 C;  1PYW D;  1YJI A;  5FR3 A;  4TSS A;  1NEK B;  3UI3 A;  1DGJ A;  1OQQ A;  1L0X B;  1KLG D;  1NEN B;  4ITK A;  4XDD A;  4XWW A;  1Y56 A;  2W3S A;  3FIL A;  1ET9 A;  1DOX A;  3J9C A;  2KMM A;  1UWX A;  4EE2 A;  1SBB B;  1E0Z A;  1QOA A;  5H92 C;  1VZ6 A;  3NVV A;  1L6V A;  1WXQ A;  2W3R A;  3IAM 1;  1JWA D;  1PDX A;  3EA6 A;  2V0G A;  2YEP F;  2NTS A;  3AE9 B;  4Q2J A;  1RYJ A;  3L4P A;  4N6E B;  1FFV A;  1WRI A;  4ARC A;  5FK9 C;  2M0A A;  1GOZ A;  1M4V A;  1YQ3 B;  2I38 A;  3MP9 A;  2BB6 A;  1K52 A;  1T3Q A;  2MJ3 A;  4OZB A;  1WGK A;  5D3I B;  2PKO A;  1HA5 A;  3C8Y A;  1SEB D;  4WAF A;  2WDQ B;  2ZW0 A;  1QOF A;  3AE8 B;  2M56 B;  3BYY B;  1FRD A;  1FNW A;  1QT9 A;  2WP9 B;  3AEC B;  3AEF B;  2KAC A;  4XE0 A;  4RGM A;  2WXM A;  1V97 A;  3E56 A;  1ZP0 B;  1J7A A;  1YJJ A;  1H7X A;  1C4A A;  4YXD B;  4USA A;  2WXQ A;  2QEJ C;  1XCT L;  1IGD A;  2RDG A;  4RNA A;  3ZQ4 A;  2IPK D;  2TSS A;  1OQR A;  4RFB A;  1YNT E;  1FD6 A;  1XLQ A;  1MI0 A;  2AQ2 B;  3W5U B;  1F0Z A;  1FIQ A;  1A70 A;  4RH6 A;  1EWY C;  2KN4 A;  2WXL A;  3AE2 B;  2WU5 B;  3Q8A A;  1UUP A;  1C4C A;  1D5Z C;  1J7C A;  1L5P A;  1NYR A;  2KAJ A;  2Z8L A;  1Q10 A;  1ACC A;  1FNU A;  5GXG B;  2ZW1 A;  1FXI A;  1KLU D;  2JQR B;  2JXT A;  1ZDV A;  3ETR A;  1AW7 A;  1XLP A;  2LGI A;  4JWS C;  1EU3 A;  3I57 A;  5HHD G;  4RGN A;  2J4X A;  2JYE A;  2AQ3 B;  2I2Y A;  4C7Z A;  4KGR A;  4L2Y A;  1UGJ A;  4DXG A;  1XF5 L;  2QIL A;  2K22 A;  2W82 A;  1MPE A;  1MHX A;  3B2G A;  1GB1 A;  1I7H A;  2LMC A;  1AYF A;  4TQ0 A;  1GB4 A;  3P4Q B;  1I4G A;  5JXV A;  4H2A A;  3AE5 B;  3ZJT A;  1ZE3 D;  2QSD A;  3RPF C;  1C9F A;  4MT5 A;  1DOY A;  1RFK A;  2WXO A;  1ZXH A;  4MAC A;  1QOB A;  5H8Y E;  3PO0 A;  4HRO A;  3KQ4 A;  2EEL A;  5HI1 A;  3V3X A;  4B0M A;  2BS2 B;  4B0E A;  1RM6 C;  2INP E;  1TJE A;  3VRB B;  1GT8 A;  1KF6 B;  4ZYS A;  5I4D A;  4OZA A;  1HQR D;  3BII D;  3HVD A;  2K9X A;  2W54 A;  1J7B A;  2FE8 A;  1QIL A;  4RGO S;  5BYR A;  3W2D A;  2ACZ B;  1QLB B;  3AN1 A;  1VDV A;  1TKE A;  3CIR B;  5LNK 1;  1P7F A;  1YN5 A;  2VZK B;  1EU4 A;  3GS2 A;  4WIP A;  2MEK A;  1JW9 D;  4WQM A;  3N9Y C;  2JYT A;  3P42 A;  1YN3 A;  1F2R I;  4YTM B;  2N7J A;  1N5W A;  4KKI A;  3SR6 A;  1IBX B;  1E7P B;  4JPS A;  2DYM A;  2E3T A;  3IT4 B;  2JWU A;  2L83 A;  1V1P B;  1FEH A;  1N61 A;  2ONQ A;  4ARI A;  1C79 A;  1BXT A;  1JRP A;  4HKQ A;  1L4D B;  2V3N A;  1MHH E;  2BW2 A;  2GRI A;  2V3P A;  2CJN A;  3RFZ B;  1K51 A;  1I4Q A;  3B2F A;  2WDR B;  4L23 A;  1D5M C;  1XXG A;  3KWL A;  5TSS A;  5HFY A;  4CQN A;  2FUG 1;  4FXC A;  2MH7 A;  3WCQ A;  3BK2 A;  1WSP A;  2WXR A;  3SFE B;  1VLB A;  3NZ3 A;  3AE3 B;  3ZGZ A;  1QOG A;  4O1N A;  2XN9 C;  3VR9 B;  1XCQ L;  4JE3 B;  5EE3 A;  1N60 A;  2SAK A;  1I4H A;  1L0V B;  5D7G A;  4ZRP A;  2WXH A;  4P6V F;  3TEZ A;  3ZJV A;  1WWT A;  4OHJ A;  3T3O A;  2WLB A;  1B9R A;  2YEP B;  3HVZ A;  1BUI C;  5AUI A;  3URY A;  1GTE A;  2K5P A;  2IGD A;  1V8C A;  1K50 A;  1ET6 A;  3KLS X;  3FIL B;  1XLN A;  4DXF A;  2BS4 B;  4REZ A;  4OW0 A;  2PVG C;  2ICI A;  1PUT A;  4LLG M;  3AMZ A;  1N63 A;  1AWD A;  1CK1 A;  3U4E G;  2J53 A;  1QKZ A;  2L1A A;  4US9 A;  3BZD B;  5E6J A;  5EE1 A;  3P4P B;  3P63 A;  2WU2 B;  1FMA D;  2GB1 A;  4RCO A;  5BMG A;  2IGG A;  1GAQ B;  3MC0 B;  2MJD A;  4ZRQ A;  4RGT A;  4KKJ A;  3IXS A;  3PZ7 A;  1PGA A;  4UDU C;  1L4Z B;  3BVM A;  4KX6 B;  4YSZ B;  4YTN B;  2H89 B;  2Y5C A;  4HKZ E;  3GP7 A;  4ZOH C;  1KH0 A;  1H7W A;  1XEE A;  3P4R B;  2QIE B;  5AUK A;  1XLO A;  2N9K A;  3AV8 A;  3EUB 2;  3R2T A;  5C3J B;  1PGB A;  2IGH A;  1JWB D;  4C7Y A;  1SXT A;  4YT0 B;  2G9H D;  2GI9 A;  1EWC A;  2KWD A;  2Q5W D;  5T8I A;  2OED A;  2PLP A;  1L0Y B;  1HEZ E;  4MH8 A;  1TS2 A;  3U52 E;  3SEB A;  4NZL B;  3GB1 A;  1F2R C;  1D5X C;  3Q69 A;  1D6E C;  3ABV B;  1IGC A;  1ZXI A;  1E10 A;  3W1S A;  1FCL A;  1CZP A;  2R61 A;  4P16 A;  2K0P A;  4C80 A;  2WQY B;  2E6X A;  1SE4 A;  5MPO A;  3DWG C;  1SF0 A;  2XNA C;  4D2K A;  3FC4 A;  2NTT A;  2AX5 A;  1VJK A;  3R2I A;  4NJC A;  3AE1 B;  3V05 A;  1K53 A;  1EM7 A;  1PFD A;  3NVY A;  2BTE A;  1I4P A;  3W9C B;  4M0W A;  2HDE A;  2WXI A;  1STE A;  2JU6 X;  4LK0 M;  4RF1 A;  4XWT A;  4LTU A;  3TUO A;  3W5V B;  3VQI A;  3CF4 A;  2HTM E;  2H88 B;  1JCK B;  1DOI A;  1RWS A;  3H8H A;  3BWU D;  3ZYY X;  2DBY A;  3NVZ A;  2PTL A;  4US8 A;  4WH4 A;  1E6E B;  2LUM A;  4WWM A;  3AE6 B;  3E9S A;  1TKY A;  4C56 C;  4GDK B;  1AN8 A;  1MVK A;  3EGR A;  3TEX A;  5BYQ A;  2MJE A;  3OWE B;  3P1M A;  2J42 A;  1ENF A;  2N9L A;  1NVI D;  3BYT B;  1JWU D;  3LB8 C;  4JWU C;  2NMQ A;  1ZOY B;  2QMT A;  2WXJ A;  3AH7 A;  2D5G A;  2JX5 A;  2Y3A A;  4RF0 A;  2FBW B;  3O13 A;  3SFD B;  1N5X A;  3BVG A;  1TKG A;  4NAM A;  2W55 A;  3AE7 B;  1T6B X;  4OVZ A;  2LFI A;  2BBC A;  3TEW A;  1TY2 A;  3U2S C;  2QJL A;  4ZHO A;  1B1Z A;  1NI3 A;  1F77 A;  1YMH E;  1YQ4 B;  1TS3 A;  2RDH A;  2CJO A;  1TS4 A;  2RPV A;  2SEB D;  5EE0 A;  1L6U A;  3P4S B;  2KQ4 X;  2BYT A;  4MM3 B;  3TEY A;  4HEA 1;  1JWS D;  1SIJ A;  2BT6 A;  1SJE D;  4GLS C;  4A9A A;  3HUI A;  5BMH A;  1C78 A;  2PW9 A;  4WUR A;  3HRD D;  1R7S A;  3NS1 A;  1E9M A;  1FNV A;  4PT5 A;  1YN4 A;  1QF6 A;  2IDY A;  2N0S B;  1ROE A;  1VR9 A;  4AS1 A;  3LYY A;  2AQ1 B;  2DLB A;  1OFF A;  4IKG A;  1GPX A;  2PMV A;  3T3N A;  1TS5 A;  2PIA A;  3AM9 A;  4IDI A;  1FFU A;  2WXF A;  4R3D A;  3VRA B;  1VZ7 A;  3Q8C A;  2LJI A;  1QQR A;  3AE4 B;  1T5X D;  2B76 B;  1ZUD 2;  2WXK A;  3KWV A;  1SJH D;  1KFY B;  2WS3 B;  2DYO A;  4YSX B;  3Q8F A;  4KGS A;  4ZHP A;  1LO5 D;  5G5H A;  4J3O D;  1FRR A;  3MJ5 A;  4YSY B;  1C4P A;  1I4X A;  2WXG A;  2Y5P A;  3BK1 A;  4IOI E;  1JQ4 A;  1FXA A;  1SE3 A;  3BVZ A;  2DWQ A;  4JX1 C;  1VZ8 A;  2LHD A;  1I4R A;  2CU3 A;  3R8B A;  3VR8 B;  2PVO D;  1UWM A;  1CQV A;  2LEK A;  2BS3 B;  1JML A;  2OHF A;  1DYQ A;  2KDM A;  3I9V 1;  4GDL B;  1N62 A;  4L1B A;  1C77 A;  1SSN A;  3NUH B;  1P7E A;  4A55 A;  2WXN A;  3AEE B;  2G1E A;  4N58 A;  1C76 A;  4TQ1 A;  3TSS A;  4A6Q A;  3PZ8 A;  2JSV X;  2L32 A;  3FAH A;  4A8X C;  2WNM A;  1XO3 A;  5C2T B;  4HRS A;  4YTP B;  2WXP A;  1TY0 A;  5FKA C;  4DQO C;  3LXF A;  1HXY D;  3IAS 1;  1JAL A;  1ZPS A;  3Q8B A;  5BMI A;  2V4I B;  4HJG E;  4XDC A;  2JZP A;  5D3D A;  1FO4 A;  1HZ5 A;  1BML C;  1ESF A;  2EKI A;  2M19 A;  3DWM A;  3IT6 B;  3U7Z A;  2K3U A;  1SE2 A;  3B9J A;  1IBX A;  2IJ0 A;  2L52 A;  4YWG G;  1V1P A;  1CJE A;  1TYG B;  5EE9 A;  3CWI A;  1GTH A;  1JWM D;  3MHZ A;  2VZK D;  4AQ7 A;  3ZJU A;  1PGX A;  3MFG A;  3AB5 A;  1WYG A;  1JRO A;  1ZDX A;  2INN E;  2WDV B;  5G5G A;  3NRZ A;  1KTK A;  1FCC C;  1HZ6 A;  1UNS A;  4OZC A;  3AEG B;  1NYQ A;  3AEA B;  1TZO A;  4KGT A;  3AED B;  4NAW B;  4N59 A;  4TMA B;  5BYS A;  2BB5 A;  4A90 A;  2X38 A;  1KRH A;  2J52 A;  1VRA B;  1D4B A;  2RMM A;  3NVW A;  2LHE A;  5HG2 A;  1FM0 D;  3AEB B;  1V1O A;  2ON8 A;  1IUE A;  3Q8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...