2FC0A

Wrn exonuclease, mn dgmp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Werner syndrome helicase
total genus 63
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fc0A00
3SUQA 1WSFA 4DFJA 1JXBA 2G8HA 3NGIA 5CYMA 4F4KA 4DLEA 4J2EA 2O4IA 5DMRA 4R5PA 4FJIA 2F8SA 4OLBA 4OPJA 3LP2A 4DTXA 2I5JA 3E01A 5T7BA 1RBSA 3OYFA 4DWIA 4JS4A 3EY1A 3C6UA 4Z4CA 1EP4A 3L2RA 4DU3A 2HHWA 3ALYA 3NDKA 1IKXA 3KLFA 3NBPA 3CG7A 1RTJA 3HM9A 4BE1A 1RT6A 2BE2A 5KTQA 4B9NA 1RDDA 3NH0A 4JRQA 5JS1A 5HROA 1RBVA 4CHNA 2E6MA 3AA5X 4DTNA 4DTPA 1EX4A 4E3SA 2EHGA 1CXUA 4ZTJA 3AA3A 2E4LA 3HPGA 3MEGA 4LH5A 4I9QA 1CLQA 2OPSA 1LWFA 2F96A 4O44A 4CFAA 4CF2A 4KPYA 3NE6A 1U49A 4CJ4A 4FYDA 2W42A 1RDAA 4HTUA 4I2QA 1C6VA 2RPIA 2EX3A 1J9AA 1UOCA 2VWJA 1RBTA 1RT5A 3OY9A 4UQGA 1I3AA 3BGRA 1KLNA 4YFUA 4F2RA 3L3UA 2HHQA 3NGZA 4LSLA 4B9VA 1S1VA 3DOKA 1DLOA 1HJRA 4GW6A 3CFOA 4B08A 1XI1A 1SL2A 3ZCMA 4C8KA 3VQ4A 1L3UA 1D8YA 4N76A 1MU2A 3AVJA 3L3VA 2IAJA 2Z1IA 2XY8A 3S9HA 4PY5A 3JSMA 4DQIA 4B9MA 3AVNA 3QIPA 4CIFA 3D0PA 1IH7A 4CHYA 3KD1E 3HPHA 4E7IA 3F9KA 4RW4A 5CZ2A 3DLEA 2HMIA 1NK8A 4HHTA 3PX0A 1GOBA 1IKYA 3V6DA 3SNNA 3NCIA 1CZ9A 4RW7A 4L8RB 4YNQA 4N47A 1HQEA 4CGDA 5J2NA 4FK2A 1KVCA 3O3GA 4FLVA 4FJ5A 3I0RA 3V1QA 1RT3A 4Z4EA 3ZT3A 1XWLA 1NOZA 3KLHA 1XHXA 3VQ5A 1HNIA 1S9EA 3WNGA 3VQ9A 1L3SA 1CZBA 4FJHA 2HVHA 3MECA 3ZSOA 1ITGA 5KRSA 3NH1A 2GUIA 5FROA 4NCBA 1VRUA 2ATQA 3U6FA 4FW1A 5HP1A 4K8XA 1QE1A 4CFBA 4CF9A 5J1EA 3LDSA 1N5YA 4KB0A 1HYVA 4KHQA 4O0IA 1RTHA 3M8RA 3RMDA 2OPRA 2RN2A 3IRXA 4OKKA 4N56A 4OKJA 1NK9A 4DTUA 1RTDA 3AA4A 4ID5A 4DLGA 1C1CA 2IGIA 2X6SA 3LWLA 2FBTA 3SJJA 1KSPA 3RR7A 2Q3SA 4FLWA 3ZSXA 3WNHA 1WAJA 3NFAA 4W5TA 2R7YA 1ZYQA 4FJLA 1ZBLA 1U45A 4DG1A 1JLAA 5J2PA 3L2VA 2HNDA 5HBMA 1KFSA 2IDOA 1BISA 4IFYA 4W5OA 1G15A 4H4OA 1IKVA 3TAEA 4M3YA 2Z1GA 5HLFA 4E0DA 3VN5A 1T7PA 4KRFA 3HXMA 1LW0A 3HL8A 4WE1A 3AV9A 3K59A 1VSJA 4DFPA 1LAWA 4B9TA 1D9FA 1DTQA 2YHBA 4Y1CA 1NKEA 1LWEA 3HYFA 1KTQA 3LP1A 2OZSA 3AVLA 1KCFA 4CJUA 3S3OA 4E19A 2BANA 1RNHA 4KHSA 5DK5A 2E6LA 1A5WA 1B92A 1JLCA 3SI6A 3SZ2A 1UA1A 4OKEA 3VQQA 2F8TA 2O4GA 2G8FA 5E41A 3NAEA 2XHBA 1KRPA 2DFFA 1JKHA 2YKMA 2YKNA 4KI6A 1TKZA 4CEQA 4FLYA 2A1RA 3VQBA 1T8EA 3VA0A 2AJQA 3NGYA 1HNVA 3H08A 3G10A 4DSFA 3RMAA 3ASMA 3K5MA 1ZBUA 1VSLA 3AO1A 4BWMA 1S1TA 1HYSA 1VSKA 2GV9A 4J2AA 4CJEA 3NF9A 4CIEA 3OYBA 2D5RA 2FBVA 3LALA 3OYNA 2RKIA 4RG8A 4FJXA 1S1WA 2YNHA 3K5LA 3RRHA 2Z1JA 1RT7A 4EP5A 1JL1A 4C8MA 2BDPA 2FBYA 4I7FA 4OGEA 4F8RA 3DRPA 4M45A 1RTIA 5SWMA 1ASWA 3LAMA 3OYIA 4LY7A 4E1NA 1L5UA 2DTUA 3K5OA 4OGCA 3P1GA 4CK1A 4C8OA 2XY5A 4LD0A 3OYDA 1SUQA 1HQUA 1X9MA 1KVAA 2LSNA 5HRPA 1BI4B 1WLJA 3OYKA 3L2QA 3LPTA 4O55A 3QEXA 1FXXA 3V1OA 1TKXA 3TAMA 3SUOA 4DFKA 2NUBA 3V9WA 4KTQA 3JYTA 3SQ2A 3LAKA 4J2DA 3PY8A 4FJ7A 1X1PA 4FJJA 2ZE2A 3AO2A 1HRHA 2HB5A 2FC0A 3MXJA 4CJKA 5SZTA 4JRPA 4DTRA 1TL1A 2PZSA 3KLGA 4QCLA 2B5JA 2FBXA 4FCYA 1S9GA 1EKEA 1WN7A 2G8VA 1GOCA 3K58A 3HP9A 4C8NA 4CGIA 1DTTA 2VG6A 2QXFA 4DSLA 1RT2A 5KRTA 1U47A 2P1JA 2QK9A 1TK8A 4EP4A 4AHUA 4E7JA 4ZHRA 1KLMA 3SV4A 4W5QA 1BCOA 3K2PA 4E7LA 3DRRA 3VQPA 4CEDA 1TKDA 1S5JA 3T1AA 4M3TA 1LV5A 4CESA 3I8DA 4DTSA 3HK2A 3SPZA 1NOYA 4DS5A 4IFVA 3V4IA 3VQAA 4PWDA 4CJRA 4CJQA 4CERA 2D0CA 4CEBA 2P51A 3QETA 3MXIA 4M3WA 4IBNA 2X78A 2DY4A 4FZXC 5EU7A 5HRSA 2HNZA 4BACA 1ASVA 3DRSA 3VQDA 3PO4A 1EETA 3O3FA 3UIQA 4M3UA 3L8BA 2OPQA 1TK0A 4FM1A 1YTUA 3SQ1A 3V9ZA 1QTMA 1NJXA 2OYQA 1W0HA 1NK4A 4CCHA 3QNNA 3S3NA 3L2UA 2HHTA 3CQ8A 3DLBA 4Q5VA 1LAVA 4DF8A 4J2BA 4RW8A 1B9FA 4M3ZA 4KHYA 3QINA 3AO3A 3SV3A 5C25A 4DSEA 3TI0A 3IS9A 4IDKA 5HRNA 1S1XA 1O1WA 2JGUA 3OYJA 3ULDA 1IG9A 3RWUA 4O0JA 4QAGA 2YNFA 4DTMA 2OZMA 4KHNA 3P5JA 3QLHA 3V9SA 1F21A 3O4NA 3ZSZA 1TK5A 3SCXA 1VSDA 1GOAA 4MQ3A 4B9LA 1B9DA 1C0TA 1W9HA 4CIGA 1RDBA 2VG5A 5I3UA 3D45A 3AVAA 2B6AA 1KFDA 4CJPA 3F73A 3SPYA 1RBUA 4O4GA 5K14A 3ZT2A 3HSTB 2DFHA 1IO2A 3TWHA 4BE0A 4KB1A 1NKBA 1VRTA 4CE9A 4E7KA 2RF2A 3AA2A 2KFNA 2KW4A 3LWMA 2HHUA 3V9XA 3VQCA 3DLRA 1R0AA 1JLBA 2WOMA 3CM6A 4CEOA 4E7HA 1WSHA 1KVBA 1C0UA 4CHQA 4W5RA 3L2WA 3LPUA 4CGGA 1EXQA 4IG0A 3V81A 3TANA 4KHUA 2QKKA 3TAPA 1Y97A 4KREA 5C42A 3EYZA 3QIOA 3DMJA 3KJVA 1WSEA 1HPZA 1X9SA 1Q9XA 1C0MA 5CZ1A 4HUEA 1QSYA 3VQ8A 4B9UA 3NF6A 1RT1A 1ASUA 2KQ2A 5C24A 4FLZA 1K6YA 1T05A 1BIZA 4KTZA 3DLKA 4OJRA 1FKOA 1YT3A 4PA1A 3OYMA 4DSKA 3KIOA 4FJ8A 4M3XA 1QQCA 3O4QA 4H4MA 3OYLA 4FW2A 4JLHA 4H8KA 3B6OA 3CFPA 1BI4A 4DQQA 4Z4IA 3M8PA 3T19A 1WSIA 4CJSA 5KGXA 1WNSA 4NCGA 2VG7A 1UWBA 1JL2A 3VQ6A 1T03A 3OJUA 1BIUA 1UAXA 1JLGA 4RW6A 3QESA 2IC3A 4E89A 2B4JA 1FK9A 1TKTA 4EZ9A 4CHZA 4CJ5A 4FJNA 2GBZA 4Z0UA 1NJZA 2JLEA 1D9DA 3KLEA 4Z4GA 3RRGA 4NCAA 2A1SA 3OS2A 1XC9A 1JLEA 5KGWA 3ZSVA 2IS3A 3KKSA 4CHPA 4N5SA 4DTJA 3OYHA 4KV8A 5FRNA 3ZSRA 3RMBA 1QSLA 1TV6A 3DOLA 4CGFA 3KK2A 2G8WA 4RW9A 1BL3A 1BHLA 4CK2A 3QNOA 3MXMA 4N41A 3V1RA 1I39A 1SKSA 1NK6A 4FJKA 3MEDA 3LZJA 4FXDA 2HHXA 3P83D 1RBRA 1J53A 3ZT1A 1VSMA 1RT4A 3C94A 3LANA 3U3GA 4JS5A 2PYJA 2HNYA 3VQEA 1JXEA 1A5XA 3QEWA 1CXQA 4DU1A 3VQ7A 2X6NA 4CHOA 2KZZA 1VSEA 2YHAA 3AO5A 3K57A 4F3TA 3ZSWA 1Q9YA 1VSIA 4FM0A 4F2SA 2Z1HA 3IG1A 4NYNA 4FZZA 4AHSA 3PUFA 4DF4A 3QO9A 3WNEA 3HJFA 1U4BA 5I42A 3TR8A 3OJSA 4BWJA 3HO1A 2D0AA 5KI6A 3TAGA 4AHRA 2WONA 4AHVA 1XHZA 3KK1A 1SL1A 4G1QA 1J5OA 2P5GA 3U3YA 4O5BA 4HUFA 2KFZA 1JLFA 3A2FA 1S1UA 4KO0A 4ELVA 2OA8A 1LW2A 3KK3A 4CJFA 4BDYA 5J2MA 3DI6A 2DFEA 1ZBHA 5JS2A 4DSIA 4CK3A 4OPKA 2HHSA 4KHWA 4GMJB 3NF7A 1QS4A 3PX4A 3G0ZA 3HVRA 4AHCA 3AVHA 4CEAA 4FLUA 3LP0A 3C95A 4Z4FA 4BDZA 1D5AA 4LSNA 3O3HA 3FFIA 4CJLA 3DLHA 4F3OA 3VA3A 1Q8IA 3OYAA 4K8ZA 4TSXA 3T3FA 4M3RA 3AVKA 4CJVA 5CYQA 3ZSQA 3V9UA 3NF8A 4DQSA 3TAFA 2PYLA 2VWKA 4HVJA 4KKOA 5FRMA 4KAZA 2BGGA 2ZD1A 3OS0A 1TAQA 4HCBA 3WNFA 4FJGA 4W5NA 1NK7A 3BDPA 4BDPA 3NHGA 1S6QA 4CF0A 3DYAA 3HT3A 1C1AA 1L3VA 4CF1A 3QEPA 4FK0A 4ID1A 1BQMA 1NJWA 3AVBA 1RILA 3ZT4A 2XY6A 3MEEA 4HCCA 4C8LA 4IKFA 2D0BA 4Y1DA 3M8SA 2YV0X 3QERA 1ZBIA 1SKRA 3DM2A 4FJ9A 3I0SA 3AO4A 4DQRA 3TAQA 3CYMA 3NH2A 1TL3A 3EZ5A 3IAYA 1UA0A 3PO5A 3QEVA 4PUOA 1BQNA 2XO7A 1LWCA 4Q0BA 1HMVA 4FLTA 2KZMA 3QEIA 4DFMA 3TABA 4QOZB 1TAUA 4CGHA 4OLAA 4CEEA 4XIUA 3SQ0A 3SUNA 4CJWA 4DMNA 4ZTFA 2XRIA 4GVMA 2Y1IA 5D3GA 1QHTA 4E1MA 3AVFA 4Z4HA 4LH4A 1WSGA 1QSSA 1BGXT 4KI4A 3OS1A 4CFDA 2HVIA 3AVCA 1ZBFA 4B8AB 1WAFA 4DSJA 3RTVA 1NJYA 3SYZA 4NYFA 3LP3A 3DLGA 3AVMA 1RDCA 1Z26A 2ITGA 3CM5A 5CY4A 4B8CA 2G8IA 2QKBA 4M42A 3ZT0A 1YVUA 2YNGA 2ZQBA 3CFRA 3M8QA 4DU4A 1REVA 4MFBA 3KKRA 1RCHA 4FJMA 4HUGA 1JLQA 1SV5A 4ELUA 3THVA 4CFCA 4FZYA 1TGOA 1WSJA 4FLXA 2Y1JA 1SKWA 4DQPA 4PQUA 4CGJA 4FM2A 3KD5E 4CJTA 4DTOA 2G8UA 1BCMA 2HHVA 1NK5A 3PX6A 3OYEA 3AVGA 4FK4A 1VK0A 2OPPA 3K5NA 4FVMA 1NKCA 3OVNA 1IKWA 4I2PA 3SQ4A 1NK0A 3ISNC 1YTAA 3OYGA 2KTQA 1HYZA 3KLIA 4B9SA 3B6PA 4OVLA 4CJ3A 2IOCA 3RMCA 4DS4A 2YNIA 3AVIA 3MAQA 4CEZA 2P5OA 3KTQA 3ZSYA 3TARA 1A5VA 4I9LA 1S6PA 1SL0A 3LZIA 4B3OA 1J54A 1VSHA 3ITHA 4CECA 5J2QA 4ELTA 2PY5A 5HRRA 1N6QA 2X74A 2G8KA 4ICLA 3PV8A 1Z25A 4EZ6A 3HP6A 1TVRA 1U48A 3HPOA 4IG3A 1U04A 4KFBA 4AHTA 1L3TA 4CF8A 1C1BA 4KTWA 4AILC 3HVTA 1X9WA 3OYCA 3RR8A 5FDLA 3SUPA 1FKPA 2XY7A 1VSFA 4M41A 3S3MA 2HW3A 2ETJA 3C6TA 4AH9A 4CEFA 4BE2A
chains in the Genus database with same CATH superfamily
2UUAK 3D6RA 3J81O 1NGBA 4DLEA 3K9JA 2UU9K 4CZJA 2UUBK 2UXCK 3H45C 5T7BA 3G6EN 4DWIA 3EY1A 4Z4CA 3L2RA 2E1YA 3NBPA 2BE2A 5AQWA 2ZM6K 3AA5X 3ZETB 4DTPA 1E4FT 2EHGA 4CD3A 3LDQA 4ZTJA 2E4LA 4I9QA 2W6LA 2OPSA 1LWFA 1WBBA 5AQMA 4CF2A 5M1QA 2BH1A 2JWKA 4KH5A 1TYQB 2H3GX 2W42A 1RDAA 1JCEA 2YCHA 3SK3A 3HM8A 4RCHA 4F2RA 3NGZA 4LSLA 1S1VA 4BRKA 1NGDA 1S3XA 1SL2A 3FZHA 4JI8K 4GV3A 4DQIA 4B9MA 4CIFA 4GNIA 3KD1E 3HPHA 2ZWHA 5AQKA 4LFBK 3CCEN 4RW4A 3DLEA 1NK8A 3PX0A 3H3OB 2P9KB 2QEXN 4RW7A 4YNQA 4DKWA 3BF1A 4CGDA 5J2NA 1KAXA 3CCRN 3I0RA 4Z4EA 3ZT3A 3VQ9A 2W40A 2HBMA 2IIRA 3MECA 1ITGA 5KRSA 2ZJQL 5FROA 1VRUA 3U6FA 3H1QA 5HP1A 3FLCO 1QE1A 5J1EA 5E84A 3LDSA 3QDKA 4KHQA 4O0IA 3D2FB 3M8RA 4N56A 1NK9A 3NVKA 4PKHA 4DLGA 3LWLA 3RR7A 5HOOA 1ATSA 1BUPA 2Q3SA 1WAJA 4W5TA 3IMXA 1U45A 5J2PA 1JLAA 3L2VA 5BPLA 2IDOA 1BISA 1G15A 2QA4N 4NXNK 2Z1GA 3ENOA 5DM7L 4M63C 4WE1A 4B9TA 1DTQA 1LWEA 4JN4A 1KCFA 4CJUA 4LC9B 1A5WA 1B92A 3SI6A 3SZ2A 1UA1A 4DR6K 2W6KA 4JKHA 3NAEA 4BRGA 2XHBA 1KRPA 2YKMA 3ZYYX 4FLYA 1HNVA 3ASMA 3LDNA 2P9UA 1VSLA 1VHXA 4J2AA 1VQ7N 3NF9A 2D5RA 1GLEG 3J7ZO 2WUSA 2FBVA 4YOYA 2QWLA 2RKIA 3CQYA 3K9KA 3K5LA 3T1YK 4EP5A 4BREA 3TTDA 4WQ4A 3LAMA 5SWMA 1ZXOA 1E4GT 5LJVA 3VPZA 4C8OA 2XY5A 3CCMN 1SUQA 3J8AA 5HRPA 1WLJA 3OYKA 1YI2N 3HOTA 3QEXA 1HNXK 3V9WA 3JYTA 4FWQA 4J2DA 3AO2A 1HRHA 3A0IX 2FC0A 5GINA 3WEEB 2PZSA 1TL1A 1P8ZA 1EKEA 1XC3A 3MK6A 3K58A 3HP9A 4BVOA 3N4PA 3P4IA 4PHTX 1XMOK 4JK8A 1NJIO 1DTTA 2QXFA 3DXKB 2P9SA 4FO0A 2P1JA 2QK9A 5GIPA 1IJJA 1W2BM 3A5LC 2P9NA 1BCOA 3K2PA 1HJOA 5ADXA 5AQHA 5EXWA 4CJ7A 4CJQA 2D0CA 3IDHA 1HX1A 4DR7K 2P51A 2F7TA 1T3VA 3O80A 4IBNA 2X78A 2HNZA 3VQDA 1KC8O 1EETA 3UIQA 4M3UA 3L8BA 1TK0A 4FM1A 4DR5K 3KWIA 1NK4A 3QNNA 3D2EA 4Q5VA 4DF8A 4RW8A 4KHYA 5C25A 3EN9A 5HRNA 3CCJN 4LFAK 3C0BA 4JI5K 2F9WA 3O4NA 4ILHA 3SCXA 4B9LA 1B9DA 3K0SA 4CIGA 1RDBA 3D45A 5HL7L 4M7YA 4JI7K 3SPYA 3GL1A 2I7PA 1VAZA 4FWSA 3TWHA 3AY9A 4R79A 1NKBA 2FF6A 4JKBA 4CE9A 2RF2A 3EKUA 4E7KA 3RVCA 3P38A 2HHUA 2UYTA 3VQCA 4WFAL 1O13A 4CHQA 3F5TA 4C1NI 1EXQA 4IG0A 3V81A 4KHUA 3TAPA 3VEWA 4CZFA 3MMVA 1HNWK 5JMVA 1C0GA 1T05A 3OYMA 4FJ8A 3DLKA 1FKOA 3A5OC 3B6OA 3CFPA 1BI4A 2RE2A 1UWBA 2VG7A 1T03A 5AZIB 4RW6A 4BR4A 2YX6A 1FK9A 5FLXO 3GG4A 4EZ9A 4CHZA 2HF3A 4YOXA 4FJNA 2WTUA 3OHRA 3BF3A 4C1NK 5KGWA 4DTJA 4KV8A 3R8EA 5KPZA 3ZSRA 1NLVA 1JJ2M 1QSLA 3DOLA 5JICA 2G8WA 4RW9A 1BL3A 4CK2A 3H46O 1NK6A 4FJKA 3LZJA 4FXDA 3P83D 1VSMA 2W41A 3U3GA 3VQEA 1A5XA 1JXEA 4DR2K 3NMUA 4AQYK 3GDQA 2YHAA 3K57A 3ZSWA 1Q9YA 4E1JA 4A2AA 5I42A 1VQON 3TR8A 4BWJA 3TAGA 4AHRA 2WONA 4AHVA 4B3TK 4G1QA 1S1UA 3ID8A 2OA8A 3CPWM 1LW2A 1ZBHA 5JS2A 1Q81O 4GV9A 4DSIA 2Q97A 1D4XA 3HVRA 4AHCA 3AVHA 4FPBA 3OBYA 4CEAA 3U9DA 1ATNA 4CJLA 3ZEUB 3VA3A 3OYAA 4CJVA 2HBKA 3ZSQA 4HVJA 5AQOA 4FJGA 1EWQA 2E1ZA 2D0PA 3BDPA 2O8DB 4NLBA 3NHGA 1RDUA 3DYAA 3EL2A 4A2BA 1MDUB 5CE3A 3O4WA 4HCCA 4IKFA 4Y1DA 3F9MA 5AQTA 2YV0X 4H0TB 4MDBA 3CYMA 3NH2A 3IAYA 2CH5A 1BQNA 1GLFO 3ZX3A 5C12A 4DR3K 1EQYA 3DJCA 2KZMA 1TAUA 4DFMA 2V51B 4OLAA 3SUNA 1NGFA 3ID6A 5AQIA 3CXCM 1VQ9N 4ZTFA 3PIPL 3PSIA 1QSSA 4FWLA 3WUHA 1J6ZA 2HVIA 4A5AA 3RTVA 4NYFA 3LP3A 2ITGA 1Z26A 4CVNE 2GWKA 3CCSN 4K25A 3MX5A 3ZT0A 1YVUA 3CFRA 3M8QA 4IDHA 4DU4A 2P9PB 3KKRA 1RCHA 2P9KA 4BG9A 1JLQA 4CFCA 1WSJA 3QMLA 4BG8A 4FM2A 3HBTA 4CJTA 3WQTA 3OYEA 1N36K 2HHSA 1HYZA 3KLIA 1N34K 4XH5A 3RMCA 3THXB 3AVIA 4CEZA 3KWGA 1VSHA 3L6QA 2PY5A 4A5BA 1N6QA 3SBGA 2X74A 1Z25A 4EZ6A 1TVRA 4IG3A 4CF8A 4KTWA 4B1ZA 3W3DA 3SAFA 2XY7A 3W0LA 3RRGA 3SUQA 1T6DA 4DFJA 4WQ5C 2O4IA 5CYMA 1T44A 5DMRA 4R5PA 4FJIA 1RDWX 1VQ6N 4DTXA 3MWTA 1EP4A 4IO9L 5BRDA 3HM9A 1RT6A 5KTQA 3NH0A 3AARA 4BQLA 1RBVA 4BR5A 2WC9A 1EX4A 4E3SA 1GLJO 2P9UB 4JKEA 5B8HA 4LH5A 1CLQA 4OO1J 4O8UA 4O44A 4KPYA 2Q36A 3WXMB 1DGKN 4HTUA 4I2QA 3J7AP 4ILGB 2RPIA 5GADP 4UQGA 3BGRA 2P9IA 4YFUA 2HHQA 2IVPA 4B9VA 3DOKA 3I33A 4GW6A 4B08A 2Q0UA 4WQ5A 1XI1A 3ZCMA 2CGLA 1D8YA 1L3UA 1U6ZA 3AVJA 4IJAA 5BREA 3JSMA 3AVNA 3QIPA 5JVGL 4H5VA 3VEOA 2QWQA 2DPNA 4BR2A 2HMIA 4BVPA 5FPMA 4EHUA 4GY2B 3V6DA 3SNNA 1HQEA 1X9JA 1KVCA 3O3GA 4FLVA 1IBMK 3DXKA 1XWLA 3VQ5A 1S9EA 1CZBA 1N32K 3BZCA 3ZSOA 2HVHA 2P9NB 4NCBA 3SBTA 3SAHA 3J7YP 1HPMA 3C6HA 1DKGD 1HYVA 4NB4A 2RN2A 4FL9A 1TUYA 5BN9A 5ADXH 3TPQA 1RTDA 2PFUA 2ITMA 4ID5A 2IGIA 2FBTA 3WNHA 2R7YA 1ZBLA 4DG1A 4K0KK 1KFSA 5LMUK 4M3YA 2KLAA 2EWSA 4KRFA 3HXMA 1LW0A 4DFPA 4PL8A 1LAWA 1D9FA 3TSQA 2YHBA 4CBWA 4ISEA 4BRCA 3PLAA 1KTQA 3AVLA 5IT9O 3B8AX 1WUAA 4U7BA 2BANA 1RNHA 4KHSA 5DK5A 1JLCA 4F9OA 2E5LK 4BRNA 4FWMA 2F8TA 5C0YA 1GLAG 1R59O 2O8CB 1JKHA 4KI6A 4CEQA 1DEJA 3RSEA 2Q2RA 3L4IA 4DSFA 3K5MA 1VQNN 3AO1A 3R1XA 2GV9A 4CJEA 3OYBA 4KHPK 4CZLA 4JKGB 1S1WA 3TSUA 1IG8A 2FSJA 1JL1A 2BDPA 1IBKK 2FBYA 4BY9C 3CIPA 1RTIA 1Q82O 3FZLA 3VMFB 3E9OA 1L5UA 3M6GA 3UKUA 1X9MA 1KVAA 3IFRA 1BI4B 3Q7CA 1TKXA 3TAMA 3VTIA 5EY4A 4CD1A 5M1OA 1BWFO 4FJJA 2ZE2A 2HB5A 4BC3A 2B5JA 4A61A 4BRAA 1WN7A 3HOSA 1GOCA 4JHDB 4CGIA 4DSLA 4AHUA 3QICA 1KLMA 3SV4A 4BRMA 1QQNA 4E7LA 1TKDA 4CEDA 3T1AA 1LV5A 4YDUA 3I8DA 3SPZA 1NOYA 3H3NO 4I6MB 4CJRA 5AQPA 4NO7A 5EU7A 4IZ9A 5HRSA 3U9ZA 5AQVA 4BACA 3KVGA 3VEZA 3DLBA 4J2BA 1B9FA 4M3ZA 3AO3A 3TI0A 3IS9A 3ULDA 1O1WA 1XNRK 3ZEUA 3HZ6A 2Q0RA 3P5JA 5JVHL 2ZGZA 4JI4K 3O5BA 4MQ3A 3PIOL 2ASPA 2A6AA 3M5RA 3AVAA 3R9PA 2B6AA 1KFDA 4CJPA 4B1VA 4EHTA 2O8DA 3VTHA 1RBUA 1QVFM 3MN7A 4BE0A 1VRTA 4X65K 5IWAK 3LWMA 3V9XA 3DLRA 3CMEN 3FR0A 1WSHA 1KVBA 4FWOA 3L2WA 3LPUA 5AFUA 3EO3A 1Y97A 3T7ZA 1OKJA 4EAHD 1NG9A 5F1XA 1HPZA 1X9SA 3MN6A 1RT1A 3CCVN 1YT3A 1Z05A 3KIOA 5A2QO 1QQCA 3O4QA 4H4MA 4DQQA 1GLDG 3WXLA 3OJUA 1UAXA 2V52B 3MN5A 4BR7A 3QESA 1NGGA 1K8KA 1TKTA 2GBZA 4Z0UA 2P9PA 4LF4K 3O8MA 1I94K 4NCAA 3OS2A 1JLEA 4AM6A 3ZSVA 2IS3A 1QQMA 3VEYA 1NMNA 2ZGYA 4DCHA 3RMBA 1TV6A 4CGFA 3KK2A 4N41A 4H5RA 4IFEA 5AQRA 3H1VX 2HHXA 2KZZA 1J53A 2HNYA 3THXA 4DU1A 3O1BA 3VGLA 4CHOA 2O8FA 2GUPA 4F3TA 2ZJRL 2OTLN 3L0QA 4BRQA 1VSIA 4FM0A 4NYNA 1BU6O 4ILJA 1NGJA 2O8EA 3WNEA 3HI0A 2P9LA 5KI6A 1SL1A 1XHZA 3U3YA 4O5BA 4HUFA 3A2FA 1NGEA 3CJ1A 3O9TA 5F0XA 4ELVA 2V7ZA 3KZBA 4CJFA 5J2MA 5KQDA 1KAYA 4UY8O 4KHWA 4GMJB 3NF7A 4MO5A 4LSNA 4MO4A 1GLLO 3DLHA 3ENHA 4F3OA 2ZJPL 3FFKB 4K8ZA 5AQGA 2O8BA 4M3RA 3V9UA 3VF6A 4DQSA 3CJ9A 5FRMA 1NK7A 2NRRA 2KKZA 1L3VA 1S6QA 3HT3A 1C1AA 4BQZA 1NMDA 2JWLA 3MCAB 4FK0A 1NWKA 4ID1A 1BA1A 3ZT4A 3AVBA 1RILA 2BUPA 1ATRA 3QERA 2QWOA 3DM2A 1HKCA 4DQRA 3CCQN 3M3ZA 3KK7A 3LDLA 1UA0A 3PO5A 1QQOA 3QEVA 1BG3A 4YDUC 1VQ4N 4BC5A 3TABA 4QOZB 4CGHA 4DR4K 4XIUA 3SQ0A 2P9IB 4DMNA 4GVMA 5D3GA 1QHTA 4E1MA 3AVFA 4Z4HA 1WSGA 4KI4A 4CFDA 2Q1NA 1RDCA 4B8CA 2QKBA 3A5MC 2YNGA 3ULEB 3BZKA 3UKRA 5AZJB 4QS7A 4HUGA 4BRLA 1SV5A 1VQKN 4FZYA 1TGOA 2Y1JA 1SKWA 4DQPA 4PQUA 4CGJA 3KD5E 3R6MA 3PX6A 2OPPA 3EE8A 3OVNA 4I2PA 1QZ5A 3SQ4A 3ISNC 3OYGA 2FLOA 3O6WA 3KTQA 3ZSYA 3TARA 1S6PA 3LZIA 3ITHA 1LOTB 4BROA 2RHKA 4ICLA 3PV8A 4CZGA 4MLHA 3CD6N 5C15A 3HPOA 1L3TA 4H0XB 1X9WA 2QI2A 5FDLA 3S3MA 2HW3A 3C6TA 4CEFA 3DAWA 1WSFA 4IWVA 2F8SA 4OLBA 2I5JA 3E01A 1RBSA 3C6UA 2NNWA 2HHWA 2O8CA 3NDKA 3KLFA 1IBLK 3I56N 4BE1A 5JS1A 1RDDA 3RSEB 4JRQA 4CHNA 3O9UA 5LY3A 4GVEA 1CXUA 3HPGA 3THYA 1HLUA 4RWTA 4CFAA 5AQJA 3NE6A 1U49A 4CJ4A 4DV1K 4JI1K 4JKGA 4DV3K 1C6VA 1UOCA 2VWJA 3OY9A 4JKCA 1HJRA 1HKGA 3UKUB 5FPDA 4C8KA 1VQLN 4IOCL 4IXCA 3VQ4A 3T1HK 4N76A 3S9HA 2Z1IA 2XY8A 4PY5A 3JS6A 2OANA 3D0PA 1LCUA 3O1WA 5BR8K 4FWRA 4B3SK 3ENBA 1GOBA 5LL6Z 1IKYA 3E9LA 1CZ9A 4L8RB 4JHDA 4IOAL 4FK2A 3MX2A 4M7XA 3EZWA 1RT3A 1XHXA 1HNIA 4EFHA 1L3SA 1CZAN 5AQFA 3NH1A 5BRHA 4H5TA 4CFBA 4JI3K 3KHYA 3AGRA 5M1PA 1YITN 4GKKK 3SLCA 4WCEL 1RTHA 4I6MA 4OKKA 3IRXA 4OKJA 1KD1O 4DTUA 1BOTO 3AA4A 3QFUA 2HMPA 3SJJA 2E2OA 4DV6K 1ZYQA 3ZSXA 4B1WB 4H03B 4K43A 4KH4A 3BUZB 1P90A 4DV2K 5HLFA 2D0OA 3VN5A 1T7PA 4XH4A 5M1FA 4OPHA 3AV9A 4O5FA 1VSJA 2OTJN 1YUWA 1NKEA 4XEIA 3HYFA 3LP1A 4JAXA 3S3OA 4E19A 1SAZA 4YOUA 1GLBG 4OKEA 3VQQA 2O4GA 4Z94A 4Y0WA 1WBDA 5H1SQ 2DFFA 2GELA 1QZ6A 2YKNA 3EKSA 2A1RA 3VQBA 1T8EA 2ZF5O 4DB3A 3VA0A 2E88A 4MDAA 3G10A 3RMAA 5BPMA 5AQUA 1ZBUA 2UXDK 4BWMA 1HKBA 1HYSA 2YHXA 3QB0A 4CIEA 2AP1A 1BA0A 3LALA 1TUUA 1YJ9N 1OH8A 4RG8A 3VESA 4FJXA 2YNHA 1RT7A 2NZTA 4C8MA 4F8RA 1JCGA 4M45A 2VGMA 5FPNA 4LY7A 1SZ2A 2DTUA 3K5OA 3P1GA 4J8FA 1U2VB 1XUPO 3L2QA 1K9MO 4CBUA 3I55N 1FXXA 3SUOA 4DFKA 2NUBA 3LAKA 4FJ7A 1K8KB 3MXJA 4AILC 3E1YA 4QCLA 4DHYA 4JRPA 3LL3A 4IEEA 3HTVA 2FBXA 1S9GA 3VF4A 5I9EB 4KBOA 4LF7K 3C6AA 3CCLN 1RT2A 1N8RO 2BTFA 1TK8A 5DM6L 4E7JA 2J4RA 4M3TA 4FWKA 2GEMA 4CESA 4DTSA 3HK2A 4DS5A 4IFVA 4PWDA 2O8FB 2E2NA 4CERA 4DR1K 4B9QA 2QM1A 1EO1A 2O8EB 2FSKA 3D7EO 4OPAA 3MXIA 2E8AA 4FZXC 2P9LB 5ELZA 4AF1A 3SAGA 1RGIA 1N33K 4CZKA 3PO4A 3O3FA 5CR4A 2OPQA 1YTUA 3SQ1A 3V9ZA 4BC4A 1NJXA 4CCHA 2HHTA 3ATVA 3E66A 4K41A 1H1VA 1S1XA 2JGUA 1M1KO 1IG9A 1DT9A 4O0JA 4QAGA 5AQXA 4KHNA 2O8BB 3V9SA 3FZFA 3ZSZA 2E20A 1TK5A 1M90O 1VSDA 1VQ5N 5I3UA 5BN8A 1OVQA 3F73A 5K14A 3THWB 4CZMA 2DFHA 1IO2A 3CHWA 3IKMA 4JKDA 2KFNA 4FOIA 1R0AA 2WOMA 3CM6A 4CEOA 5M1KA 2YHYA 1C0UA 2A42A 1Q7YO 3TSPA 3BP8A 4DV4K 5E26A 3EYZA 3DMJA 3KJVA 1KAZA 5CZ1A 1Q9XA 4HUEA 5KQ8A 2KQ2A 5C24A 4FLZA 1BIZA 2WBNA 4KTZA 5AQYA 4DSKA 3F2KA 3OYLA 4CZHA 5KGXA 1WSIA 4LF6K 1WNSA 4BRFA 4NCGA 3O08A 3CJ7A 3FGUA 5AQSA 5AQLA 1QVGM 1JLGA 1NGHA 4E89A 2B4JA 2AA4A 1YF5L 3ULEA 3UKRB 5AZJA 3VGKA 3VETA 1NJZA 1D9DA 3KLEA 2QWPA 4Z4GA 5M1NA 2A1SA 4PKGA 2VYPA 3KKSA 3OYHA 5EVZA 1ILYA 2NRVA 1YJNN 3V1RA 5AJ3K 3MEDA 3LANA 1NGIA 5AFUH 3QEWA 2X6NA 2NLXA 3AO5A 5AQQA 3IG1A 4FZZA 4AHSA 2QTDA 2E2PA 3QO9A 3HJFA 1SQKA 4MLEA 3R3LA 3DXMB 5GAHP 3OJSA 2D0AA 1J5OA 2P5GA 3KK1A 2Q31A 4B1UB 2CGKA 4AM7A 4BDYA 4H5WA 2ASMA 5TKYA 4LFCK 4OPKA 3L4QA 2V7YA 1QS4A 3PX4A 3G0ZA 3LP0A 3C95A 4Z4FA 1MA9B 1D5AA 3O3HA 3FFIA 1Q8IA 4TSXA 2PBDA 1KXPA 3AVKA 3NF8A 3CI5A 3TAFA 2PYLA 2VWKA 4KAZA 2BGGA 2ZD1A 1TAQA 3WNFA 4CZIA 4W5NA 4BDPA 4ISGA 4CF0A 3VF2A 3QEPA 1BQMA 4L3QA 1VQPN 2XY6A 2NRHA 3MEEA 4BC2A 4C8LA 5C10A 2D0BA 3THYB 4FSVA 1ZBIA 4FJ9A 3S41A 1NGCA 1TL3A 3LM2A 2IVNA 1LWCA 4Q0BA 1HMVA 3TTCA 4CEEA 3MWPA 4CJWA 1YXQA 2XRIA 1K73O 4LH4A 4K42A 3OS1A 3AVCA 2F9TA 4DSJA 1WAFA 1NJYA 3SYZA 4YHHK 1KQSM 2G8IA 4M42A 1YJWN 2A40A 3EEQA 2ZQBA 3WXJA 3VERA 4MFBA 3THVA 1ZBSA 3VGMA 5LMNK 1BCMA 1J5EK 4WFBL 4GV6A 3K5NA 1IKWA 2KTQA 4YOWA 3H6EA 3B6PA 4OVLA 4CJ3A 4DS4A 2YNIA 3MAQA 2P5OA 4BGAA 4PL7A 1A5VA 1J54A 4H0OA 5J2QA 1G99A 4ELTA 4DQ8A 5HRRA 3SJHA 4JKFA 4GKJK 4ISFA 3HP6A 1U04A 4AHTA 2VQFK 3QFPA 1HNZK 3LDOA 1C1BA 4BRPA 3I8BA 1NBWA 3OYCA 2NRWA 1FKPA 2GX9A 1VSFA 4M41A 4WQ4C 5GAEP 3FZKA 2F4VK 4AH9A 2FSNA 2KHOA 1JXBA 2G8HA 3NGIA 4F4KA 4J2EA 1Q18A 4OPJA 1Y64A 2YJFA 3LP2A 3BEXA 3CC7N 3OYFA 4JS4A 1C0FA 4DU3A 3ALYA 3CQXA 1BO5O 1IKXA 1Z6RA 2I7NA 3CG7A 1RTJA 4B9NA 5HROA 1OH6A 4JD2B 5AR0A 2E6MA 3FE1A 4DTNA 3AA3A 3MEGA 1Q86O 3O9RA 2F96A 1V4TA 4FYDA 1S72N 1BDGA 1J9AA 2EX3A 3DLLL 1RBTA 3MDQA 1RT5A 1I3AA 1K8AO 3L3UA 3CPEA 4FOEA 1DLOA 4H0YB 3CFOA 4FVUA 2HF4A 1U2VA 1MU2A 3L3VA 2IAJA 3OW2M 1WB9A 3C7NB 3NVMA 3ATUA 3PSFA 3O9SA 1IH7A 4CHYA 1YHQN 5JLFA 3OBWA 4E7IA 1OH7A 3F9KA 5BRFA 5CZ2A 4HHTA 5C2FA 4YOTA 3EE9A 4H0PA 5BPNA 3NCIA 3WQUA 4N47A 5BR9A 4FJ5A 4U67L 3V1QA 4V19S 4DUZK 1NOZA 3KLHA 4IOXA 3WNGA 5LJWA 4FJHA 3WT0A 2GUIA 2ATQA 2YJEA 4K8XA 4FW1A 4CF9A 3QBXA 4NLCA 1N5YA 4KB0A 3U8XA 3RMDA 5MLCQ 4X64K 2OPRA 4JI6K 1C1CA 1KSPA 2X6SA 4XH1A 4FLWA 3NFAA 4CZEA 4FJLA 1ZC6A 2QWRA 3AAQA 2HNDA 5HBMA 5TKWA 3P39A 4W5OA 4IFYA 3QBWA 4H4OA 1IKVA 3TAEA 3M1FA 5KPTA 4E0DA 2VGNA 3GE1A 2NRTA 3ZLJA 4JYAK 3HL8A 3K59A 5EX5A 5F2RA 4Y1CA 4KH6A 2OZSA 3JXUA 2E6LA 2G8FA 3HSCA 4JNEA 5E41A 4BRIA 4IEIA 2WFBA 1TKZA 4CW7B 3THWA 3J80O 3LDPA 2AJQA 3NGYA 3H08A 2UUCK 3ZETA 2GTDA 2YI1A 1S1TA 1VSKA 3TTFA 3TU5A 2PAVA 3OYNA 1TYQA 2E2QA 3RRHA 2Z1JA 4RTFD 4I7FA 4OGEA 2A5XA 3DRPA 1QHAA 3OYIA 1ASWA 4E1NA 4OGCA 2HSTA 4BRDA 4CK1A 4LD0A 3VEVA 3OYDA 1HQUA 1IV0A 2ASOA 2LSNA 4NXMK 3LPTA 4O55A 5GAGP 1NGAA 3V1OA 4KTQA 3SQ2A 3PY8A 1X1PA 5SZTA 4CJKA 4DTRA 3KLGA 4WYBA 4FCYA 2G8VA 4C23A 1MWKA 4C8NA 2VG6A 3G25A 1X3NA 5KRTA 1U47A 4EP4A 3GOIA 3A5NC 4ZHRA 4W5QA 3DRRA 3VQPA 1S5JA 4BR0A 1X3MA 1JCFA 1ESVA 1HR0K 3D2FA 1YIJN 3V4IA 3VQAA 2VQEK 4G9ZA 4QS8A 4CEBA 4X62K 3QETA 4M3WA 4YORA 2DY4A 2UXBK 4BRHA 2VWBA 1XQSC 3DXMA 4JV5K 1ASVA 5C2DA 3DRSA 3MN9A 3U4LA 1OH5A 1QTMA 2OYQA 2QWMA 1W0HA 3S3NA 3MCPA 3L2UA 3IUCA 3CQ8A 1LAVA 4QS9A 4CI6A 4DUYK 3QINA 3SV3A 1YVNA 4DSEA 3CCUN 4IDKA 3OYJA 4YY3K 3WXIA 3RWUA 1FJGK 2YNFA 4DTMA 2OZMA 3QLHA 1NM1A 4PKIA 1F21A 3CERA 3CJAA 1GOAA 3OTOK 2QWNA 1C0TA 1W9HA 2VG5A 3HRGA 4DV5K 4O4GA 3ZT2A 3HSTB 1NU0A 2HBJA 5EOYA 4KB1A 3AA2A 4YOVA 2KW4A 2FF3B 1JLBA 4E7HA 3CC4N 4W5RA 1RFQA 3TANA 4CGGA 3G4SN 1E3MA 4IO8A 2QKKA 4KREA 1EWRA 5C42A 3QIOA 1WSEA 4EIAA 4B9UA 1C0MA 1QSYA 3VQ8A 3NF6A 1ASUA 1K6YA 4PA1A 4OJRA 4DV7K 4M3XA 3LM9A 5FPEA 4FW2A 4JLHA 4H8KA 2HBLA 4Z4IA 3M8PA 1NNEA 1OVYA 3T19A 4CJSA 5KPRA 4WF9L 3VQ6A 5GIOA 1JL2A 3VOVA 1BIUA 2IC3A 4JKAA 3WEEA 4CJ5A 3G71N 3T69A 2JLEA 4LF5K 4H5NA 1XC9A 4HTLA 4CHPA 4N5SA 3CC2N 5FRNA 2P9SB 4JEPA 4CBXA 3MXMA 1BHLA 3QNOA 3N4QA 1I39A 1SKSA 2D1KA 4BGBA 3O9QA 1RBRA 3VEXA 3ZT1A 1RT4A 3C94A 4JS5A 2PYJA 4A57A 1CXQA 3VQ7A 1VSEA 4F2SA 2Z1HA 3C65A 2CH6A 3PUFA 3CMAN 4DF4A 1T6CA 1U4BA 4FPAA 4B3RK 3HO1A 1KLNA 1XNQK 4JI0K 2KFZA 1JLFA 4KO0A 2QW9A 3BY5A 2NRXA 4B1YB 3KK3A 3DI6A 2DFEA 3JAMO 3D2EB 4CK3A 3WXKA 4B1XB 4FLUA 1GLCG 4BDZA 1VQMN 2VCPA 3AGKA 3A8YA 5AQNA 3T3FA 3Q7BA 5CYQA 3UE5A 4KKOA 3OS0A 4HCBA 4LF9K 2CGJA 3SMPA 1YAGA 4JD2A 4CF1A 1NJWA 3CJBA 4IJNA 2QXLA 4LF8K 4O8KA 3CF5L 3M8SA 1SKRA 3I0SA 3AO4A 3P31A 3TAQA 1XMQK 4PUOA 3EZ5A 1V4SA 2XO7A 3CETA 3SMSA 2A3ZA 4FLTA 3QEIA 1WOQA 3UB5A 5AQZA 4JK7A 1S22A 2Y1IA 1BGXT 1W97L 3OA9A 4B8AB 1ZBFA 2NRZA 3C7NA 3DLGA 3AVMA 5AZIA 3AAPA 3CJCA 3CM5A 5CY4A 2HHHK 1SS6A 4FWNA 5JLHA 3GBTA 4DV0K 2YHWA 4B3MK 1REVA 2HOEA 4FJMA 4ELUA 1MWMA 4FLXA 5CHIA 2A41A 2FXUA 4DTOA 2G8UA 2HHVA 4FWPA 1NK5A 4JK9A 3AVGA 4H0VB 3DWLA 1VK0A 4FK4A 4A62A 4FVMA 4HWIA 1NKCA 1NK0A 2OCEA 2D4WA 1YTAA 3ZX0A 3ZX2A 2GWJA 4B9SA 4WFNL 2IOCA 4X66K 2IVOA 3VENA 4I9LA 1W7AA 1SL0A 4B3OA 4CECA 4OX9K 1FW6A 1HUXA 3FZMA 2G8KA 4JI2K 3E9PA 1U48A 4KFBA 3HVTA 4BR9A 3RR8A 3SUPA 4A59A 1VQ8N 2ETJA 4BE2A
chains in the Genus database with same CATH topology
3SUQA 1WSFA 4DFJA 1JXBA 2G8HA 3NGIA 5CYMA 4F4KA 4DLEA 4J2EA 2O4IA 5DMRA 4R5PA 4FJIA 2F8SA 4OLBA 4OPJA 3LP2A 4DTXA 2I5JA 3E01A 5T7BA 1RBSA 3OYFA 4DWIA 4JS4A 3EY1A 3C6UA 4Z4CA 1EP4A 3L2RA 4DU3A 2HHWA 3ALYA 3NDKA 1IKXA 3KLFA 3NBPA 3CG7A 1RTJA 3HM9A 4BE1A 1RT6A 2BE2A 5KTQA 4B9NA 1RDDA 3NH0A 4JRQA 5JS1A 5HROA 1RBVA 4CHNA 2E6MA 3AA5X 4DTNA 4DTPA 1EX4A 4E3SA 2EHGA 1CXUA 4ZTJA 3AA3A 2E4LA 3HPGA 3MEGA 4LH5A 4I9QA 1CLQA 2OPSA 1LWFA 2F96A 4O44A 4CFAA 4CF2A 4KPYA 3NE6A 1U49A 4CJ4A 4FYDA 2W42A 1RDAA 4HTUA 4I2QA 1C6VA 2RPIA 2EX3A 1J9AA 1UOCA 2VWJA 1RBTA 1RT5A 3OY9A 4UQGA 1I3AA 3BGRA 1KLNA 4YFUA 4F2RA 3L3UA 2HHQA 3NGZA 4LSLA 4B9VA 1S1VA 3DOKA 1DLOA 1HJRA 4GW6A 3CFOA 4B08A 1XI1A 1SL2A 3ZCMA 4C8KA 3VQ4A 1L3UA 1D8YA 4N76A 1MU2A 3AVJA 3L3VA 2IAJA 2Z1IA 2XY8A 3S9HA 4PY5A 3JSMA 4DQIA 4B9MA 3AVNA 3QIPA 4CIFA 3D0PA 1IH7A 4CHYA 3KD1E 3HPHA 4E7IA 3F9KA 4RW4A 5CZ2A 3DLEA 2HMIA 1NK8A 4HHTA 3PX0A 1GOBA 1IKYA 3V6DA 3SNNA 3NCIA 1CZ9A 4RW7A 4L8RB 4YNQA 4N47A 1HQEA 4CGDA 5J2NA 4FK2A 1KVCA 3O3GA 4FLVA 4FJ5A 3I0RA 3V1QA 1RT3A 4Z4EA 3ZT3A 1XWLA 1NOZA 3KLHA 1XHXA 3VQ5A 1HNIA 1S9EA 3WNGA 3VQ9A 1L3SA 1CZBA 4FJHA 2HVHA 3MECA 3ZSOA 1ITGA 5KRSA 3NH1A 2GUIA 5FROA 4NCBA 1VRUA 2ATQA 3U6FA 4FW1A 5HP1A 4K8XA 1QE1A 4CFBA 4CF9A 5J1EA 3LDSA 1N5YA 4KB0A 1HYVA 4KHQA 4O0IA 1RTHA 3M8RA 3RMDA 2OPRA 2RN2A 3IRXA 4OKKA 4N56A 4OKJA 1NK9A 4DTUA 1RTDA 3AA4A 4ID5A 4DLGA 1C1CA 2IGIA 2X6SA 3LWLA 2FBTA 3SJJA 1KSPA 3RR7A 2Q3SA 4FLWA 3ZSXA 3WNHA 1WAJA 3NFAA 4W5TA 2R7YA 1ZYQA 4FJLA 1ZBLA 1U45A 4DG1A 1JLAA 5J2PA 3L2VA 2HNDA 5HBMA 1KFSA 2IDOA 1BISA 4IFYA 4W5OA 1G15A 4H4OA 1IKVA 3TAEA 4M3YA 2Z1GA 5HLFA 4E0DA 3VN5A 1T7PA 4KRFA 3HXMA 1LW0A 3HL8A 4WE1A 3AV9A 3K59A 1VSJA 4DFPA 1LAWA 4B9TA 1D9FA 1DTQA 2YHBA 4Y1CA 1NKEA 1LWEA 3HYFA 1KTQA 3LP1A 2OZSA 3AVLA 1KCFA 4CJUA 3S3OA 4E19A 2BANA 1RNHA 4KHSA 5DK5A 2E6LA 1A5WA 1B92A 1JLCA 3SI6A 3SZ2A 1UA1A 4OKEA 3VQQA 2F8TA 2O4GA 2G8FA 5E41A 3NAEA 2XHBA 1KRPA 2DFFA 1JKHA 2YKMA 2YKNA 4KI6A 1TKZA 4CEQA 4FLYA 2A1RA 3VQBA 1T8EA 3VA0A 2AJQA 3NGYA 1HNVA 3H08A 3G10A 4DSFA 3RMAA 3ASMA 3K5MA 1ZBUA 1VSLA 3AO1A 4BWMA 1S1TA 1HYSA 1VSKA 2GV9A 4J2AA 4CJEA 3NF9A 4CIEA 3OYBA 2D5RA 2FBVA 3LALA 3OYNA 2RKIA 4RG8A 4FJXA 1S1WA 2YNHA 3K5LA 3RRHA 2Z1JA 1RT7A 4EP5A 1JL1A 4C8MA 2BDPA 2FBYA 4I7FA 4OGEA 4F8RA 3DRPA 4M45A 1RTIA 5SWMA 1ASWA 3LAMA 3OYIA 4LY7A 4E1NA 1L5UA 2DTUA 3K5OA 4OGCA 3P1GA 4CK1A 4C8OA 2XY5A 4LD0A 3OYDA 1SUQA 1HQUA 1X9MA 1KVAA 2LSNA 5HRPA 1BI4B 1WLJA 3OYKA 3L2QA 3LPTA 4O55A 3QEXA 1FXXA 3V1OA 1TKXA 3TAMA 3SUOA 4DFKA 2NUBA 3V9WA 4KTQA 3JYTA 3SQ2A 3LAKA 4J2DA 3PY8A 4FJ7A 1X1PA 4FJJA 2ZE2A 3AO2A 1HRHA 2HB5A 2FC0A 3MXJA 4CJKA 5SZTA 4JRPA 4DTRA 1TL1A 2PZSA 3KLGA 4QCLA 2B5JA 2FBXA 4FCYA 1S9GA 1EKEA 1WN7A 2G8VA 1GOCA 3K58A 3HP9A 4C8NA 4CGIA 1DTTA 2VG6A 2QXFA 4DSLA 1RT2A 5KRTA 1U47A 2P1JA 2QK9A 1TK8A 4EP4A 4AHUA 4E7JA 4ZHRA 1KLMA 3SV4A 4W5QA 1BCOA 3K2PA 4E7LA 3DRRA 3VQPA 4CEDA 1TKDA 1S5JA 3T1AA 4M3TA 1LV5A 4CESA 3I8DA 4DTSA 3HK2A 3SPZA 1NOYA 4DS5A 4IFVA 3V4IA 3VQAA 4PWDA 4CJRA 4CJQA 4CERA 2D0CA 4CEBA 2P51A 3QETA 3MXIA 4M3WA 4IBNA 2X78A 2DY4A 4FZXC 5EU7A 5HRSA 2HNZA 4BACA 1ASVA 3DRSA 3VQDA 3PO4A 1EETA 3O3FA 3UIQA 4M3UA 3L8BA 2OPQA 1TK0A 4FM1A 1YTUA 3SQ1A 3V9ZA 1QTMA 1NJXA 2OYQA 1W0HA 1NK4A 4CCHA 3QNNA 3S3NA 3L2UA 2HHTA 3CQ8A 3DLBA 4Q5VA 1LAVA 4DF8A 4J2BA 4RW8A 1B9FA 4M3ZA 4KHYA 3QINA 3AO3A 3SV3A 5C25A 4DSEA 3TI0A 3IS9A 4IDKA 5HRNA 1S1XA 1O1WA 2JGUA 3OYJA 3ULDA 1IG9A 3RWUA 4O0JA 4QAGA 2YNFA 4DTMA 2OZMA 4KHNA 3P5JA 3QLHA 3V9SA 1F21A 3O4NA 3ZSZA 1TK5A 3SCXA 1VSDA 1GOAA 4MQ3A 4B9LA 1B9DA 1C0TA 1W9HA 4CIGA 1RDBA 2VG5A 5I3UA 3D45A 3AVAA 2B6AA 1KFDA 4CJPA 3F73A 3SPYA 1RBUA 4O4GA 5K14A 3ZT2A 3HSTB 2DFHA 1IO2A 3TWHA 4BE0A 4KB1A 1NKBA 1VRTA 4CE9A 4E7KA 2RF2A 3AA2A 2KFNA 2KW4A 3LWMA 2HHUA 3V9XA 3VQCA 3DLRA 1R0AA 1JLBA 2WOMA 3CM6A 4CEOA 4E7HA 1WSHA 1KVBA 1C0UA 4CHQA 4W5RA 3L2WA 3LPUA 4CGGA 1EXQA 4IG0A 3V81A 3TANA 4KHUA 2QKKA 3TAPA 1Y97A 4KREA 5C42A 3EYZA 3QIOA 3DMJA 3KJVA 1WSEA 1HPZA 1X9SA 1Q9XA 1C0MA 5CZ1A 4HUEA 1QSYA 3VQ8A 4B9UA 3NF6A 1RT1A 1ASUA 2KQ2A 5C24A 4FLZA 1K6YA 1T05A 1BIZA 4KTZA 3DLKA 4OJRA 1FKOA 1YT3A 4PA1A 3OYMA 4DSKA 3KIOA 4FJ8A 4M3XA 1QQCA 3O4QA 4H4MA 3OYLA 4FW2A 4JLHA 4H8KA 3B6OA 3CFPA 1BI4A 4DQQA 4Z4IA 3M8PA 3T19A 1WSIA 4CJSA 5KGXA 1WNSA 4NCGA 2VG7A 1UWBA 1JL2A 3VQ6A 1T03A 3OJUA 1BIUA 1UAXA 1JLGA 4RW6A 3QESA 2IC3A 4E89A 2B4JA 1FK9A 1TKTA 4EZ9A 4CHZA 4CJ5A 4FJNA 2GBZA 4Z0UA 1NJZA 2JLEA 1D9DA 3KLEA 4Z4GA 3RRGA 4NCAA 2A1SA 3OS2A 1XC9A 1JLEA 5KGWA 3ZSVA 2IS3A 3KKSA 4CHPA 4N5SA 4DTJA 3OYHA 4KV8A 5FRNA 3ZSRA 3RMBA 1QSLA 1TV6A 3DOLA 4CGFA 3KK2A 2G8WA 4RW9A 1BL3A 1BHLA 4CK2A 3QNOA 3MXMA 4N41A 3V1RA 1I39A 1SKSA 1NK6A 4FJKA 3MEDA 3LZJA 4FXDA 2HHXA 3P83D 1RBRA 1J53A 3ZT1A 1VSMA 1RT4A 3C94A 3LANA 3U3GA 4JS5A 2PYJA 2HNYA 3VQEA 1JXEA 1A5XA 3QEWA 1CXQA 4DU1A 3VQ7A 2X6NA 4CHOA 2KZZA 1VSEA 2YHAA 3AO5A 3K57A 4F3TA 3ZSWA 1Q9YA 1VSIA 4FM0A 4F2SA 2Z1HA 3IG1A 4NYNA 4FZZA 4AHSA 3PUFA 4DF4A 3QO9A 3WNEA 3HJFA 1U4BA 5I42A 3TR8A 3OJSA 4BWJA 3HO1A 2D0AA 5KI6A 3TAGA 4AHRA 2WONA 4AHVA 1XHZA 3KK1A 1SL1A 4G1QA 1J5OA 2P5GA 3U3YA 4O5BA 4HUFA 2KFZA 1JLFA 3A2FA 1S1UA 4KO0A 4ELVA 2OA8A 1LW2A 3KK3A 4CJFA 4BDYA 5J2MA 3DI6A 2DFEA 1ZBHA 5JS2A 4DSIA 4CK3A 4OPKA 2HHSA 4KHWA 4GMJB 3NF7A 1QS4A 3PX4A 3G0ZA 3HVRA 4AHCA 3AVHA 4CEAA 4FLUA 3LP0A 3C95A 4Z4FA 4BDZA 1D5AA 4LSNA 3O3HA 3FFIA 4CJLA 3DLHA 4F3OA 3VA3A 1Q8IA 3OYAA 4K8ZA 4TSXA 3T3FA 4M3RA 3AVKA 4CJVA 5CYQA 3ZSQA 3V9UA 3NF8A 4DQSA 3TAFA 2PYLA 2VWKA 4HVJA 4KKOA 5FRMA 4KAZA 2BGGA 2ZD1A 3OS0A 1TAQA 4HCBA 3WNFA 4FJGA 4W5NA 1NK7A 3BDPA 4BDPA 3NHGA 1S6QA 4CF0A 3DYAA 3HT3A 1C1AA 1L3VA 4CF1A 3QEPA 4FK0A 4ID1A 1BQMA 1NJWA 3AVBA 1RILA 3ZT4A 2XY6A 3MEEA 4HCCA 4C8LA 4IKFA 2D0BA 4Y1DA 3M8SA 2YV0X 3QERA 1ZBIA 1SKRA 3DM2A 4FJ9A 3I0SA 3AO4A 4DQRA 3TAQA 3CYMA 3NH2A 1TL3A 3EZ5A 3IAYA 1UA0A 3PO5A 3QEVA 4PUOA 1BQNA 2XO7A 1LWCA 4Q0BA 1HMVA 4FLTA 2KZMA 3QEIA 4DFMA 3TABA 4QOZB 1TAUA 4CGHA 4OLAA 4CEEA 4XIUA 3SQ0A 3SUNA 4CJWA 4DMNA 4ZTFA 2XRIA 4GVMA 2Y1IA 5D3GA 1QHTA 4E1MA 3AVFA 4Z4HA 4LH4A 1WSGA 1QSSA 1BGXT 4KI4A 3OS1A 4CFDA 2HVIA 3AVCA 1ZBFA 4B8AB 1WAFA 4DSJA 3RTVA 1NJYA 3SYZA 4NYFA 3LP3A 3DLGA 3AVMA 1RDCA 1Z26A 2ITGA 3CM5A 5CY4A 4B8CA 2G8IA 2QKBA 4M42A 3ZT0A 1YVUA 2YNGA 2ZQBA 3CFRA 3M8QA 4DU4A 1REVA 4MFBA 3KKRA 1RCHA 4FJMA 4HUGA 1JLQA 1SV5A 4ELUA 3THVA 4CFCA 4FZYA 1TGOA 1WSJA 4FLXA 2Y1JA 1SKWA 4DQPA 4PQUA 4CGJA 4FM2A 3KD5E 4CJTA 4DTOA 2G8UA 1BCMA 2HHVA 1NK5A 3PX6A 3OYEA 3AVGA 4FK4A 1VK0A 2OPPA 3K5NA 4FVMA 1NKCA 3OVNA 1IKWA 4I2PA 3SQ4A 1NK0A 3ISNC 1YTAA 3OYGA 2KTQA 1HYZA 3KLIA 4B9SA 3B6PA 4OVLA 4CJ3A 2IOCA 3RMCA 4DS4A 2YNIA 3AVIA 3MAQA 4CEZA 2P5OA 3KTQA 3ZSYA 3TARA 1A5VA 4I9LA 1S6PA 1SL0A 3LZIA 4B3OA 1J54A 1VSHA 3ITHA 4CECA 5J2QA 4ELTA 2PY5A 5HRRA 1N6QA 2X74A 2G8KA 4ICLA 3PV8A 1Z25A 4EZ6A 3HP6A 1TVRA 1U48A 3HPOA 4IG3A 1U04A 4KFBA 4AHTA 1L3TA 4CF8A 1C1BA 4KTWA 4AILC 3HVTA 1X9WA 3OYCA 3RR8A 5FDLA 3SUPA 1FKPA 2XY7A 1VSFA 4M41A 3S3MA 2HW3A 2ETJA 3C6TA 4AH9A 4CEFA 4BE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUQ A;  1WSF A;  4DFJ A;  1JXB A;  2G8H A;  3NGI A;  5CYM A;  4F4K A;  4DLE A;  4J2E A;  2O4I A;  5DMR A;  4R5P A;  4FJI A;  2F8S A;  4OLB A;  4OPJ A;  3LP2 A;  4DTX A;  2I5J A;  3E01 A;  5T7B A;  1RBS A;  3OYF A;  4DWI A;  4JS4 A;  3EY1 A;  3C6U A;  4Z4C A;  1EP4 A;  3L2R A;  4DU3 A;  2HHW A;  3ALY A;  3NDK A;  1IKX A;  3KLF A;  3NBP A;  3CG7 A;  1RTJ A;  3HM9 A;  4BE1 A;  1RT6 A;  2BE2 A;  5KTQ A;  4B9N A;  1RDD A;  3NH0 A;  4JRQ A;  5JS1 A;  5HRO A;  1RBV A;  4CHN A;  2E6M A;  3AA5 X;  4DTN A;  4DTP A;  1EX4 A;  4E3S A;  2EHG A;  1CXU A;  4ZTJ A;  3AA3 A;  2E4L A;  3HPG A;  3MEG A;  4LH5 A;  4I9Q A;  1CLQ A;  2OPS A;  1LWF A;  2F96 A;  4O44 A;  4CFA A;  4CF2 A;  4KPY A;  3NE6 A;  1U49 A;  4CJ4 A;  4FYD A;  2W42 A;  1RDA A;  4HTU A;  4I2Q A;  1C6V A;  2RPI A;  2EX3 A;  1J9A A;  1UOC A;  2VWJ A;  1RBT A;  1RT5 A;  3OY9 A;  4UQG A;  1I3A A;  3BGR A;  1KLN A;  4YFU A;  4F2R A;  3L3U A;  2HHQ A;  3NGZ A;  4LSL A;  4B9V A;  1S1V A;  3DOK A;  1DLO A;  1HJR A;  4GW6 A;  3CFO A;  4B08 A;  1XI1 A;  1SL2 A;  3ZCM A;  4C8K A;  3VQ4 A;  1L3U A;  1D8Y A;  4N76 A;  1MU2 A;  3AVJ A;  3L3V A;  2IAJ A;  2Z1I A;  2XY8 A;  3S9H A;  4PY5 A;  3JSM A;  4DQI A;  4B9M A;  3AVN A;  3QIP A;  4CIF A;  3D0P A;  1IH7 A;  4CHY A;  3KD1 E;  3HPH A;  4E7I A;  3F9K A;  4RW4 A;  5CZ2 A;  3DLE A;  2HMI A;  1NK8 A;  4HHT A;  3PX0 A;  1GOB A;  1IKY A;  3V6D A;  3SNN A;  3NCI A;  1CZ9 A;  4RW7 A;  4L8R B;  4YNQ A;  4N47 A;  1HQE A;  4CGD A;  5J2N A;  4FK2 A;  1KVC A;  3O3G A;  4FLV A;  4FJ5 A;  3I0R A;  3V1Q A;  1RT3 A;  4Z4E A;  3ZT3 A;  1XWL A;  1NOZ A;  3KLH A;  1XHX A;  3VQ5 A;  1HNI A;  1S9E A;  3WNG A;  3VQ9 A;  1L3S A;  1CZB A;  4FJH A;  2HVH A;  3MEC A;  3ZSO A;  1ITG A;  5KRS A;  3NH1 A;  2GUI A;  5FRO A;  4NCB A;  1VRU A;  2ATQ A;  3U6F A;  4FW1 A;  5HP1 A;  4K8X A;  1QE1 A;  4CFB A;  4CF9 A;  5J1E A;  3LDS A;  1N5Y A;  4KB0 A;  1HYV A;  4KHQ A;  4O0I A;  1RTH A;  3M8R A;  3RMD A;  2OPR A;  2RN2 A;  3IRX A;  4OKK A;  4N56 A;  4OKJ A;  1NK9 A;  4DTU A;  1RTD A;  3AA4 A;  4ID5 A;  4DLG A;  1C1C A;  2IGI A;  2X6S A;  3LWL A;  2FBT A;  3SJJ A;  1KSP A;  3RR7 A;  2Q3S A;  4FLW A;  3ZSX A;  3WNH A;  1WAJ A;  3NFA A;  4W5T A;  2R7Y A;  1ZYQ A;  4FJL A;  1ZBL A;  1U45 A;  4DG1 A;  1JLA A;  5J2P A;  3L2V A;  2HND A;  5HBM A;  1KFS A;  2IDO A;  1BIS A;  4IFY A;  4W5O A;  1G15 A;  4H4O A;  1IKV A;  3TAE A;  4M3Y A;  2Z1G A;  5HLF A;  4E0D A;  3VN5 A;  1T7P A;  4KRF A;  3HXM A;  1LW0 A;  3HL8 A;  4WE1 A;  3AV9 A;  3K59 A;  1VSJ A;  4DFP A;  1LAW A;  4B9T A;  1D9F A;  1DTQ A;  2YHB A;  4Y1C A;  1NKE A;  1LWE A;  3HYF A;  1KTQ A;  3LP1 A;  2OZS A;  3AVL A;  1KCF A;  4CJU A;  3S3O A;  4E19 A;  2BAN A;  1RNH A;  4KHS A;  5DK5 A;  2E6L A;  1A5W A;  1B92 A;  1JLC A;  3SI6 A;  3SZ2 A;  1UA1 A;  4OKE A;  3VQQ A;  2F8T A;  2O4G A;  2G8F A;  5E41 A;  3NAE A;  2XHB A;  1KRP A;  2DFF A;  1JKH A;  2YKM A;  2YKN A;  4KI6 A;  1TKZ A;  4CEQ A;  4FLY A;  2A1R A;  3VQB A;  1T8E A;  3VA0 A;  2AJQ A;  3NGY A;  1HNV A;  3H08 A;  3G10 A;  4DSF A;  3RMA A;  3ASM A;  3K5M A;  1ZBU A;  1VSL A;  3AO1 A;  4BWM A;  1S1T A;  1HYS A;  1VSK A;  2GV9 A;  4J2A A;  4CJE A;  3NF9 A;  4CIE A;  3OYB A;  2D5R A;  2FBV A;  3LAL A;  3OYN A;  2RKI A;  4RG8 A;  4FJX A;  1S1W A;  2YNH A;  3K5L A;  3RRH A;  2Z1J A;  1RT7 A;  4EP5 A;  1JL1 A;  4C8M A;  2BDP A;  2FBY A;  4I7F A;  4OGE A;  4F8R A;  3DRP A;  4M45 A;  1RTI A;  5SWM A;  1ASW A;  3LAM A;  3OYI A;  4LY7 A;  4E1N A;  1L5U A;  2DTU A;  3K5O A;  4OGC A;  3P1G A;  4CK1 A;  4C8O A;  2XY5 A;  4LD0 A;  3OYD A;  1SUQ A;  1HQU A;  1X9M A;  1KVA A;  2LSN A;  5HRP A;  1BI4 B;  1WLJ A;  3OYK A;  3L2Q A;  3LPT A;  4O55 A;  3QEX A;  1FXX A;  3V1O A;  1TKX A;  3TAM A;  3SUO A;  4DFK A;  2NUB A;  3V9W A;  4KTQ A;  3JYT A;  3SQ2 A;  3LAK A;  4J2D A;  3PY8 A;  4FJ7 A;  1X1P A;  4FJJ A;  2ZE2 A;  3AO2 A;  1HRH A;  2HB5 A;  2FC0 A;  3MXJ A;  4CJK A;  5SZT A;  4JRP A;  4DTR A;  1TL1 A;  2PZS A;  3KLG A;  4QCL A;  2B5J A;  2FBX A;  4FCY A;  1S9G A;  1EKE A;  1WN7 A;  2G8V A;  1GOC A;  3K58 A;  3HP9 A;  4C8N A;  4CGI A;  1DTT A;  2VG6 A;  2QXF A;  4DSL A;  1RT2 A;  5KRT A;  1U47 A;  2P1J A;  2QK9 A;  1TK8 A;  4EP4 A;  4AHU A;  4E7J A;  4ZHR A;  1KLM A;  3SV4 A;  4W5Q A;  1BCO A;  3K2P A;  4E7L A;  3DRR A;  3VQP A;  4CED A;  1TKD A;  1S5J A;  3T1A A;  4M3T A;  1LV5 A;  4CES A;  3I8D A;  4DTS A;  3HK2 A;  3SPZ A;  1NOY A;  4DS5 A;  4IFV A;  3V4I A;  3VQA A;  4PWD A;  4CJR A;  4CJQ A;  4CER A;  2D0C A;  4CEB A;  2P51 A;  3QET A;  3MXI A;  4M3W A;  4IBN A;  2X78 A;  2DY4 A;  4FZX C;  5EU7 A;  5HRS A;  2HNZ A;  4BAC A;  1ASV A;  3DRS A;  3VQD A;  3PO4 A;  1EET A;  3O3F A;  3UIQ A;  4M3U A;  3L8B A;  2OPQ A;  1TK0 A;  4FM1 A;  1YTU A;  3SQ1 A;  3V9Z A;  1QTM A;  1NJX A;  2OYQ A;  1W0H A;  1NK4 A;  4CCH A;  3QNN A;  3S3N A;  3L2U A;  2HHT A;  3CQ8 A;  3DLB A;  4Q5V A;  1LAV A;  4DF8 A;  4J2B A;  4RW8 A;  1B9F A;  4M3Z A;  4KHY A;  3QIN A;  3AO3 A;  3SV3 A;  5C25 A;  4DSE A;  3TI0 A;  3IS9 A;  4IDK A;  5HRN A;  1S1X A;  1O1W A;  2JGU A;  3OYJ A;  3ULD A;  1IG9 A;  3RWU A;  4O0J A;  4QAG A;  2YNF A;  4DTM A;  2OZM A;  4KHN A;  3P5J A;  3QLH A;  3V9S A;  1F21 A;  3O4N A;  3ZSZ A;  1TK5 A;  3SCX A;  1VSD A;  1GOA A;  4MQ3 A;  4B9L A;  1B9D A;  1C0T A;  1W9H A;  4CIG A;  1RDB A;  2VG5 A;  5I3U A;  3D45 A;  3AVA A;  2B6A A;  1KFD A;  4CJP A;  3F73 A;  3SPY A;  1RBU A;  4O4G A;  5K14 A;  3ZT2 A;  3HST B;  2DFH A;  1IO2 A;  3TWH A;  4BE0 A;  4KB1 A;  1NKB A;  1VRT A;  4CE9 A;  4E7K A;  2RF2 A;  3AA2 A;  2KFN A;  2KW4 A;  3LWM A;  2HHU A;  3V9X A;  3VQC A;  3DLR A;  1R0A A;  1JLB A;  2WOM A;  3CM6 A;  4CEO A;  4E7H A;  1WSH A;  1KVB A;  1C0U A;  4CHQ A;  4W5R A;  3L2W A;  3LPU A;  4CGG A;  1EXQ A;  4IG0 A;  3V81 A;  3TAN A;  4KHU A;  2QKK A;  3TAP A;  1Y97 A;  4KRE A;  5C42 A;  3EYZ A;  3QIO A;  3DMJ A;  3KJV A;  1WSE A;  1HPZ A;  1X9S A;  1Q9X A;  1C0M A;  5CZ1 A;  4HUE A;  1QSY A;  3VQ8 A;  4B9U A;  3NF6 A;  1RT1 A;  1ASU A;  2KQ2 A;  5C24 A;  4FLZ A;  1K6Y A;  1T05 A;  1BIZ A;  4KTZ A;  3DLK A;  4OJR A;  1FKO A;  1YT3 A;  4PA1 A;  3OYM A;  4DSK A;  3KIO A;  4FJ8 A;  4M3X A;  1QQC A;  3O4Q A;  4H4M A;  3OYL A;  4FW2 A;  4JLH A;  4H8K A;  3B6O A;  3CFP A;  1BI4 A;  4DQQ A;  4Z4I A;  3M8P A;  3T19 A;  1WSI A;  4CJS A;  5KGX A;  1WNS A;  4NCG A;  2VG7 A;  1UWB A;  1JL2 A;  3VQ6 A;  1T03 A;  3OJU A;  1BIU A;  1UAX A;  1JLG A;  4RW6 A;  3QES A;  2IC3 A;  4E89 A;  2B4J A;  1FK9 A;  1TKT A;  4EZ9 A;  4CHZ A;  4CJ5 A;  4FJN A;  2GBZ A;  4Z0U A;  1NJZ A;  2JLE A;  1D9D A;  3KLE A;  4Z4G A;  3RRG A;  4NCA A;  2A1S A;  3OS2 A;  1XC9 A;  1JLE A;  5KGW A;  3ZSV A;  2IS3 A;  3KKS A;  4CHP A;  4N5S A;  4DTJ A;  3OYH A;  4KV8 A;  5FRN A;  3ZSR A;  3RMB A;  1QSL A;  1TV6 A;  3DOL A;  4CGF A;  3KK2 A;  2G8W A;  4RW9 A;  1BL3 A;  1BHL A;  4CK2 A;  3QNO A;  3MXM A;  4N41 A;  3V1R A;  1I39 A;  1SKS A;  1NK6 A;  4FJK A;  3MED A;  3LZJ A;  4FXD A;  2HHX A;  3P83 D;  1RBR A;  1J53 A;  3ZT1 A;  1VSM A;  1RT4 A;  3C94 A;  3LAN A;  3U3G A;  4JS5 A;  2PYJ A;  2HNY A;  3VQE A;  1JXE A;  1A5X A;  3QEW A;  1CXQ A;  4DU1 A;  3VQ7 A;  2X6N A;  4CHO A;  2KZZ A;  1VSE A;  2YHA A;  3AO5 A;  3K57 A;  4F3T A;  3ZSW A;  1Q9Y A;  1VSI A;  4FM0 A;  4F2S A;  2Z1H A;  3IG1 A;  4NYN A;  4FZZ A;  4AHS A;  3PUF A;  4DF4 A;  3QO9 A;  3WNE A;  3HJF A;  1U4B A;  5I42 A;  3TR8 A;  3OJS A;  4BWJ A;  3HO1 A;  2D0A A;  5KI6 A;  3TAG A;  4AHR A;  2WON A;  4AHV A;  1XHZ A;  3KK1 A;  1SL1 A;  4G1Q A;  1J5O A;  2P5G A;  3U3Y A;  4O5B A;  4HUF A;  2KFZ A;  1JLF A;  3A2F A;  1S1U A;  4KO0 A;  4ELV A;  2OA8 A;  1LW2 A;  3KK3 A;  4CJF A;  4BDY A;  5J2M A;  3DI6 A;  2DFE A;  1ZBH A;  5JS2 A;  4DSI A;  4CK3 A;  4OPK A;  2HHS A;  4KHW A;  4GMJ B;  3NF7 A;  1QS4 A;  3PX4 A;  3G0Z A;  3HVR A;  4AHC A;  3AVH A;  4CEA A;  4FLU A;  3LP0 A;  3C95 A;  4Z4F A;  4BDZ A;  1D5A A;  4LSN A;  3O3H A;  3FFI A;  4CJL A;  3DLH A;  4F3O A;  3VA3 A;  1Q8I A;  3OYA A;  4K8Z A;  4TSX A;  3T3F A;  4M3R A;  3AVK A;  4CJV A;  5CYQ A;  3ZSQ A;  3V9U A;  3NF8 A;  4DQS A;  3TAF A;  2PYL A;  2VWK A;  4HVJ A;  4KKO A;  5FRM A;  4KAZ A;  2BGG A;  2ZD1 A;  3OS0 A;  1TAQ A;  4HCB A;  3WNF A;  4FJG A;  4W5N A;  1NK7 A;  3BDP A;  4BDP A;  3NHG A;  1S6Q A;  4CF0 A;  3DYA A;  3HT3 A;  1C1A A;  1L3V A;  4CF1 A;  3QEP A;  4FK0 A;  4ID1 A;  1BQM A;  1NJW A;  3AVB A;  1RIL A;  3ZT4 A;  2XY6 A;  3MEE A;  4HCC A;  4C8L A;  4IKF A;  2D0B A;  4Y1D A;  3M8S A;  2YV0 X;  3QER A;  1ZBI A;  1SKR A;  3DM2 A;  4FJ9 A;  3I0S A;  3AO4 A;  4DQR A;  3TAQ A;  3CYM A;  3NH2 A;  1TL3 A;  3EZ5 A;  3IAY A;  1UA0 A;  3PO5 A;  3QEV A;  4PUO A;  1BQN A;  2XO7 A;  1LWC A;  4Q0B A;  1HMV A;  4FLT A;  2KZM A;  3QEI A;  4DFM A;  3TAB A;  4QOZ B;  1TAU A;  4CGH A;  4OLA A;  4CEE A;  4XIU A;  3SQ0 A;  3SUN A;  4CJW A;  4DMN A;  4ZTF A;  2XRI A;  4GVM A;  2Y1I A;  5D3G A;  1QHT A;  4E1M A;  3AVF A;  4Z4H A;  4LH4 A;  1WSG A;  1QSS A;  1BGX T;  4KI4 A;  3OS1 A;  4CFD A;  2HVI A;  3AVC A;  1ZBF A;  4B8A B;  1WAF A;  4DSJ A;  3RTV A;  1NJY A;  3SYZ A;  4NYF A;  3LP3 A;  3DLG A;  3AVM A;  1RDC A;  1Z26 A;  2ITG A;  3CM5 A;  5CY4 A;  4B8C A;  2G8I A;  2QKB A;  4M42 A;  3ZT0 A;  1YVU A;  2YNG A;  2ZQB A;  3CFR A;  3M8Q A;  4DU4 A;  1REV A;  4MFB A;  3KKR A;  1RCH A;  4FJM A;  4HUG A;  1JLQ A;  1SV5 A;  4ELU A;  3THV A;  4CFC A;  4FZY A;  1TGO A;  1WSJ A;  4FLX A;  2Y1J A;  1SKW A;  4DQP A;  4PQU A;  4CGJ A;  4FM2 A;  3KD5 E;  4CJT A;  4DTO A;  2G8U A;  1BCM A;  2HHV A;  1NK5 A;  3PX6 A;  3OYE A;  3AVG A;  4FK4 A;  1VK0 A;  2OPP A;  3K5N A;  4FVM A;  1NKC A;  3OVN A;  1IKW A;  4I2P A;  3SQ4 A;  1NK0 A;  3ISN C;  1YTA A;  3OYG A;  2KTQ A;  1HYZ A;  3KLI A;  4B9S A;  3B6P A;  4OVL A;  4CJ3 A;  2IOC A;  3RMC A;  4DS4 A;  2YNI A;  3AVI A;  3MAQ A;  4CEZ A;  2P5O A;  3KTQ A;  3ZSY A;  3TAR A;  1A5V A;  4I9L A;  1S6P A;  1SL0 A;  3LZI A;  4B3O A;  1J54 A;  1VSH A;  3ITH A;  4CEC A;  5J2Q A;  4ELT A;  2PY5 A;  5HRR A;  1N6Q A;  2X74 A;  2G8K A;  4ICL A;  3PV8 A;  1Z25 A;  4EZ6 A;  3HP6 A;  1TVR A;  1U48 A;  3HPO A;  4IG3 A;  1U04 A;  4KFB A;  4AHT A;  1L3T A;  4CF8 A;  1C1B A;  4KTW A;  4AIL C;  3HVT A;  1X9W A;  3OYC A;  3RR8 A;  5FDL A;  3SUP A;  1FKP A;  2XY7 A;  1VSF A;  4M41 A;  3S3M A;  2HW3 A;  2ETJ A;  3C6T A;  4AH9 A;  4CEF A;  4BE2 A; 
#chains in the Genus database with same CATH topology
 2UUA K;  3D6R A;  3J81 O;  1NGB A;  4DLE A;  3K9J A;  2UU9 K;  4CZJ A;  2UUB K;  2UXC K;  3H45 C;  5T7B A;  3G6E N;  4DWI A;  3EY1 A;  4Z4C A;  3L2R A;  2E1Y A;  3NBP A;  2BE2 A;  5AQW A;  2ZM6 K;  3AA5 X;  3ZET B;  4DTP A;  1E4F T;  2EHG A;  4CD3 A;  3LDQ A;  4ZTJ A;  2E4L A;  4I9Q A;  2W6L A;  2OPS A;  1LWF A;  1WBB A;  5AQM A;  4CF2 A;  5M1Q A;  2BH1 A;  2JWK A;  4KH5 A;  1TYQ B;  2H3G X;  2W42 A;  1RDA A;  1JCE A;  2YCH A;  3SK3 A;  3HM8 A;  4RCH A;  4F2R A;  3NGZ A;  4LSL A;  1S1V A;  4BRK A;  1NGD A;  1S3X A;  1SL2 A;  3FZH A;  4JI8 K;  4GV3 A;  4DQI A;  4B9M A;  4CIF A;  4GNI A;  3KD1 E;  3HPH A;  2ZWH A;  5AQK A;  4LFB K;  3CCE N;  4RW4 A;  3DLE A;  1NK8 A;  3PX0 A;  3H3O B;  2P9K B;  2QEX N;  4RW7 A;  4YNQ A;  4DKW A;  3BF1 A;  4CGD A;  5J2N A;  1KAX A;  3CCR N;  3I0R A;  4Z4E A;  3ZT3 A;  3VQ9 A;  2W40 A;  2HBM A;  2IIR A;  3MEC A;  1ITG A;  5KRS A;  2ZJQ L;  5FRO A;  1VRU A;  3U6F A;  3H1Q A;  5HP1 A;  3FLC O;  1QE1 A;  5J1E A;  5E84 A;  3LDS A;  3QDK A;  4KHQ A;  4O0I A;  3D2F B;  3M8R A;  4N56 A;  1NK9 A;  3NVK A;  4PKH A;  4DLG A;  3LWL A;  3RR7 A;  5HOO A;  1ATS A;  1BUP A;  2Q3S A;  1WAJ A;  4W5T A;  3IMX A;  1U45 A;  5J2P A;  1JLA A;  3L2V A;  5BPL A;  2IDO A;  1BIS A;  1G15 A;  2QA4 N;  4NXN K;  2Z1G A;  3ENO A;  5DM7 L;  4M63 C;  4WE1 A;  4B9T A;  1DTQ A;  1LWE A;  4JN4 A;  1KCF A;  4CJU A;  4LC9 B;  1A5W A;  1B92 A;  3SI6 A;  3SZ2 A;  1UA1 A;  4DR6 K;  2W6K A;  4JKH A;  3NAE A;  4BRG A;  2XHB A;  1KRP A;  2YKM A;  3ZYY X;  4FLY A;  1HNV A;  3ASM A;  3LDN A;  2P9U A;  1VSL A;  1VHX A;  4J2A A;  1VQ7 N;  3NF9 A;  2D5R A;  1GLE G;  3J7Z O;  2WUS A;  2FBV A;  4YOY A;  2QWL A;  2RKI A;  3CQY A;  3K9K A;  3K5L A;  3T1Y K;  4EP5 A;  4BRE A;  3TTD A;  4WQ4 A;  3LAM A;  5SWM A;  1ZXO A;  1E4G T;  5LJV A;  3VPZ A;  4C8O A;  2XY5 A;  3CCM N;  1SUQ A;  3J8A A;  5HRP A;  1WLJ A;  3OYK A;  1YI2 N;  3HOT A;  3QEX A;  1HNX K;  3V9W A;  3JYT A;  4FWQ A;  4J2D A;  3AO2 A;  1HRH A;  3A0I X;  2FC0 A;  5GIN A;  3WEE B;  2PZS A;  1TL1 A;  1P8Z A;  1EKE A;  1XC3 A;  3MK6 A;  3K58 A;  3HP9 A;  4BVO A;  3N4P A;  3P4I A;  4PHT X;  1XMO K;  4JK8 A;  1NJI O;  1DTT A;  2QXF A;  3DXK B;  2P9S A;  4FO0 A;  2P1J A;  2QK9 A;  5GIP A;  1IJJ A;  1W2B M;  3A5L C;  2P9N A;  1BCO A;  3K2P A;  1HJO A;  5ADX A;  5AQH A;  5EXW A;  4CJ7 A;  4CJQ A;  2D0C A;  3IDH A;  1HX1 A;  4DR7 K;  2P51 A;  2F7T A;  1T3V A;  3O80 A;  4IBN A;  2X78 A;  2HNZ A;  3VQD A;  1KC8 O;  1EET A;  3UIQ A;  4M3U A;  3L8B A;  1TK0 A;  4FM1 A;  4DR5 K;  3KWI A;  1NK4 A;  3QNN A;  3D2E A;  4Q5V A;  4DF8 A;  4RW8 A;  4KHY A;  5C25 A;  3EN9 A;  5HRN A;  3CCJ N;  4LFA K;  3C0B A;  4JI5 K;  2F9W A;  3O4N A;  4ILH A;  3SCX A;  4B9L A;  1B9D A;  3K0S A;  4CIG A;  1RDB A;  3D45 A;  5HL7 L;  4M7Y A;  4JI7 K;  3SPY A;  3GL1 A;  2I7P A;  1VAZ A;  4FWS A;  3TWH A;  3AY9 A;  4R79 A;  1NKB A;  2FF6 A;  4JKB A;  4CE9 A;  2RF2 A;  3EKU A;  4E7K A;  3RVC A;  3P38 A;  2HHU A;  2UYT A;  3VQC A;  4WFA L;  1O13 A;  4CHQ A;  3F5T A;  4C1N I;  1EXQ A;  4IG0 A;  3V81 A;  4KHU A;  3TAP A;  3VEW A;  4CZF A;  3MMV A;  1HNW K;  5JMV A;  1C0G A;  1T05 A;  3OYM A;  4FJ8 A;  3DLK A;  1FKO A;  3A5O C;  3B6O A;  3CFP A;  1BI4 A;  2RE2 A;  1UWB A;  2VG7 A;  1T03 A;  5AZI B;  4RW6 A;  4BR4 A;  2YX6 A;  1FK9 A;  5FLX O;  3GG4 A;  4EZ9 A;  4CHZ A;  2HF3 A;  4YOX A;  4FJN A;  2WTU A;  3OHR A;  3BF3 A;  4C1N K;  5KGW A;  4DTJ A;  4KV8 A;  3R8E A;  5KPZ A;  3ZSR A;  1NLV A;  1JJ2 M;  1QSL A;  3DOL A;  5JIC A;  2G8W A;  4RW9 A;  1BL3 A;  4CK2 A;  3H46 O;  1NK6 A;  4FJK A;  3LZJ A;  4FXD A;  3P83 D;  1VSM A;  2W41 A;  3U3G A;  3VQE A;  1A5X A;  1JXE A;  4DR2 K;  3NMU A;  4AQY K;  3GDQ A;  2YHA A;  3K57 A;  3ZSW A;  1Q9Y A;  4E1J A;  4A2A A;  5I42 A;  1VQO N;  3TR8 A;  4BWJ A;  3TAG A;  4AHR A;  2WON A;  4AHV A;  4B3T K;  4G1Q A;  1S1U A;  3ID8 A;  2OA8 A;  3CPW M;  1LW2 A;  1ZBH A;  5JS2 A;  1Q81 O;  4GV9 A;  4DSI A;  2Q97 A;  1D4X A;  3HVR A;  4AHC A;  3AVH A;  4FPB A;  3OBY A;  4CEA A;  3U9D A;  1ATN A;  4CJL A;  3ZEU B;  3VA3 A;  3OYA A;  4CJV A;  2HBK A;  3ZSQ A;  4HVJ A;  5AQO A;  4FJG A;  1EWQ A;  2E1Z A;  2D0P A;  3BDP A;  2O8D B;  4NLB A;  3NHG A;  1RDU A;  3DYA A;  3EL2 A;  4A2B A;  1MDU B;  5CE3 A;  3O4W A;  4HCC A;  4IKF A;  4Y1D A;  3F9M A;  5AQT A;  2YV0 X;  4H0T B;  4MDB A;  3CYM A;  3NH2 A;  3IAY A;  2CH5 A;  1BQN A;  1GLF O;  3ZX3 A;  5C12 A;  4DR3 K;  1EQY A;  3DJC A;  2KZM A;  1TAU A;  4DFM A;  2V51 B;  4OLA A;  3SUN A;  1NGF A;  3ID6 A;  5AQI A;  3CXC M;  1VQ9 N;  4ZTF A;  3PIP L;  3PSI A;  1QSS A;  4FWL A;  3WUH A;  1J6Z A;  2HVI A;  4A5A A;  3RTV A;  4NYF A;  3LP3 A;  2ITG A;  1Z26 A;  4CVN E;  2GWK A;  3CCS N;  4K25 A;  3MX5 A;  3ZT0 A;  1YVU A;  3CFR A;  3M8Q A;  4IDH A;  4DU4 A;  2P9P B;  3KKR A;  1RCH A;  2P9K A;  4BG9 A;  1JLQ A;  4CFC A;  1WSJ A;  3QML A;  4BG8 A;  4FM2 A;  3HBT A;  4CJT A;  3WQT A;  3OYE A;  1N36 K;  2HHS A;  1HYZ A;  3KLI A;  1N34 K;  4XH5 A;  3RMC A;  3THX B;  3AVI A;  4CEZ A;  3KWG A;  1VSH A;  3L6Q A;  2PY5 A;  4A5B A;  1N6Q A;  3SBG A;  2X74 A;  1Z25 A;  4EZ6 A;  1TVR A;  4IG3 A;  4CF8 A;  4KTW A;  4B1Z A;  3W3D A;  3SAF A;  2XY7 A;  3W0L A;  3RRG A;  3SUQ A;  1T6D A;  4DFJ A;  4WQ5 C;  2O4I A;  5CYM A;  1T44 A;  5DMR A;  4R5P A;  4FJI A;  1RDW X;  1VQ6 N;  4DTX A;  3MWT A;  1EP4 A;  4IO9 L;  5BRD A;  3HM9 A;  1RT6 A;  5KTQ A;  3NH0 A;  3AAR A;  4BQL A;  1RBV A;  4BR5 A;  2WC9 A;  1EX4 A;  4E3S A;  1GLJ O;  2P9U B;  4JKE A;  5B8H A;  4LH5 A;  1CLQ A;  4OO1 J;  4O8U A;  4O44 A;  4KPY A;  2Q36 A;  3WXM B;  1DGK N;  4HTU A;  4I2Q A;  3J7A P;  4ILG B;  2RPI A;  5GAD P;  4UQG A;  3BGR A;  2P9I A;  4YFU A;  2HHQ A;  2IVP A;  4B9V A;  3DOK A;  3I33 A;  4GW6 A;  4B08 A;  2Q0U A;  4WQ5 A;  1XI1 A;  3ZCM A;  2CGL A;  1D8Y A;  1L3U A;  1U6Z A;  3AVJ A;  4IJA A;  5BRE A;  3JSM A;  3AVN A;  3QIP A;  5JVG L;  4H5V A;  3VEO A;  2QWQ A;  2DPN A;  4BR2 A;  2HMI A;  4BVP A;  5FPM A;  4EHU A;  4GY2 B;  3V6D A;  3SNN A;  1HQE A;  1X9J A;  1KVC A;  3O3G A;  4FLV A;  1IBM K;  3DXK A;  1XWL A;  3VQ5 A;  1S9E A;  1CZB A;  1N32 K;  3BZC A;  3ZSO A;  2HVH A;  2P9N B;  4NCB A;  3SBT A;  3SAH A;  3J7Y P;  1HPM A;  3C6H A;  1DKG D;  1HYV A;  4NB4 A;  2RN2 A;  4FL9 A;  1TUY A;  5BN9 A;  5ADX H;  3TPQ A;  1RTD A;  2PFU A;  2ITM A;  4ID5 A;  2IGI A;  2FBT A;  3WNH A;  2R7Y A;  1ZBL A;  4DG1 A;  4K0K K;  1KFS A;  5LMU K;  4M3Y A;  2KLA A;  2EWS A;  4KRF A;  3HXM A;  1LW0 A;  4DFP A;  4PL8 A;  1LAW A;  1D9F A;  3TSQ A;  2YHB A;  4CBW A;  4ISE A;  4BRC A;  3PLA A;  1KTQ A;  3AVL A;  5IT9 O;  3B8A X;  1WUA A;  4U7B A;  2BAN A;  1RNH A;  4KHS A;  5DK5 A;  1JLC A;  4F9O A;  2E5L K;  4BRN A;  4FWM A;  2F8T A;  5C0Y A;  1GLA G;  1R59 O;  2O8C B;  1JKH A;  4KI6 A;  4CEQ A;  1DEJ A;  3RSE A;  2Q2R A;  3L4I A;  4DSF A;  3K5M A;  1VQN N;  3AO1 A;  3R1X A;  2GV9 A;  4CJE A;  3OYB A;  4KHP K;  4CZL A;  4JKG B;  1S1W A;  3TSU A;  1IG8 A;  2FSJ A;  1JL1 A;  2BDP A;  1IBK K;  2FBY A;  4BY9 C;  3CIP A;  1RTI A;  1Q82 O;  3FZL A;  3VMF B;  3E9O A;  1L5U A;  3M6G A;  3UKU A;  1X9M A;  1KVA A;  3IFR A;  1BI4 B;  3Q7C A;  1TKX A;  3TAM A;  3VTI A;  5EY4 A;  4CD1 A;  5M1O A;  1BWF O;  4FJJ A;  2ZE2 A;  2HB5 A;  4BC3 A;  2B5J A;  4A61 A;  4BRA A;  1WN7 A;  3HOS A;  1GOC A;  4JHD B;  4CGI A;  4DSL A;  4AHU A;  3QIC A;  1KLM A;  3SV4 A;  4BRM A;  1QQN A;  4E7L A;  1TKD A;  4CED A;  3T1A A;  1LV5 A;  4YDU A;  3I8D A;  3SPZ A;  1NOY A;  3H3N O;  4I6M B;  4CJR A;  5AQP A;  4NO7 A;  5EU7 A;  4IZ9 A;  5HRS A;  3U9Z A;  5AQV A;  4BAC A;  3KVG A;  3VEZ A;  3DLB A;  4J2B A;  1B9F A;  4M3Z A;  3AO3 A;  3TI0 A;  3IS9 A;  3ULD A;  1O1W A;  1XNR K;  3ZEU A;  3HZ6 A;  2Q0R A;  3P5J A;  5JVH L;  2ZGZ A;  4JI4 K;  3O5B A;  4MQ3 A;  3PIO L;  2ASP A;  2A6A A;  3M5R A;  3AVA A;  3R9P A;  2B6A A;  1KFD A;  4CJP A;  4B1V A;  4EHT A;  2O8D A;  3VTH A;  1RBU A;  1QVF M;  3MN7 A;  4BE0 A;  1VRT A;  4X65 K;  5IWA K;  3LWM A;  3V9X A;  3DLR A;  3CME N;  3FR0 A;  1WSH A;  1KVB A;  4FWO A;  3L2W A;  3LPU A;  5AFU A;  3EO3 A;  1Y97 A;  3T7Z A;  1OKJ A;  4EAH D;  1NG9 A;  5F1X A;  1HPZ A;  1X9S A;  3MN6 A;  1RT1 A;  3CCV N;  1YT3 A;  1Z05 A;  3KIO A;  5A2Q O;  1QQC A;  3O4Q A;  4H4M A;  4DQQ A;  1GLD G;  3WXL A;  3OJU A;  1UAX A;  2V52 B;  3MN5 A;  4BR7 A;  3QES A;  1NGG A;  1K8K A;  1TKT A;  2GBZ A;  4Z0U A;  2P9P A;  4LF4 K;  3O8M A;  1I94 K;  4NCA A;  3OS2 A;  1JLE A;  4AM6 A;  3ZSV A;  2IS3 A;  1QQM A;  3VEY A;  1NMN A;  2ZGY A;  4DCH A;  3RMB A;  1TV6 A;  4CGF A;  3KK2 A;  4N41 A;  4H5R A;  4IFE A;  5AQR A;  3H1V X;  2HHX A;  2KZZ A;  1J53 A;  2HNY A;  3THX A;  4DU1 A;  3O1B A;  3VGL A;  4CHO A;  2O8F A;  2GUP A;  4F3T A;  2ZJR L;  2OTL N;  3L0Q A;  4BRQ A;  1VSI A;  4FM0 A;  4NYN A;  1BU6 O;  4ILJ A;  1NGJ A;  2O8E A;  3WNE A;  3HI0 A;  2P9L A;  5KI6 A;  1SL1 A;  1XHZ A;  3U3Y A;  4O5B A;  4HUF A;  3A2F A;  1NGE A;  3CJ1 A;  3O9T A;  5F0X A;  4ELV A;  2V7Z A;  3KZB A;  4CJF A;  5J2M A;  5KQD A;  1KAY A;  4UY8 O;  4KHW A;  4GMJ B;  3NF7 A;  4MO5 A;  4LSN A;  4MO4 A;  1GLL O;  3DLH A;  3ENH A;  4F3O A;  2ZJP L;  3FFK B;  4K8Z A;  5AQG A;  2O8B A;  4M3R A;  3V9U A;  3VF6 A;  4DQS A;  3CJ9 A;  5FRM A;  1NK7 A;  2NRR A;  2KKZ A;  1L3V A;  1S6Q A;  3HT3 A;  1C1A A;  4BQZ A;  1NMD A;  2JWL A;  3MCA B;  4FK0 A;  1NWK A;  4ID1 A;  1BA1 A;  3ZT4 A;  3AVB A;  1RIL A;  2BUP A;  1ATR A;  3QER A;  2QWO A;  3DM2 A;  1HKC A;  4DQR A;  3CCQ N;  3M3Z A;  3KK7 A;  3LDL A;  1UA0 A;  3PO5 A;  1QQO A;  3QEV A;  1BG3 A;  4YDU C;  1VQ4 N;  4BC5 A;  3TAB A;  4QOZ B;  4CGH A;  4DR4 K;  4XIU A;  3SQ0 A;  2P9I B;  4DMN A;  4GVM A;  5D3G A;  1QHT A;  4E1M A;  3AVF A;  4Z4H A;  1WSG A;  4KI4 A;  4CFD A;  2Q1N A;  1RDC A;  4B8C A;  2QKB A;  3A5M C;  2YNG A;  3ULE B;  3BZK A;  3UKR A;  5AZJ B;  4QS7 A;  4HUG A;  4BRL A;  1SV5 A;  1VQK N;  4FZY A;  1TGO A;  2Y1J A;  1SKW A;  4DQP A;  4PQU A;  4CGJ A;  3KD5 E;  3R6M A;  3PX6 A;  2OPP A;  3EE8 A;  3OVN A;  4I2P A;  1QZ5 A;  3SQ4 A;  3ISN C;  3OYG A;  2FLO A;  3O6W A;  3KTQ A;  3ZSY A;  3TAR A;  1S6P A;  3LZI A;  3ITH A;  1LOT B;  4BRO A;  2RHK A;  4ICL A;  3PV8 A;  4CZG A;  4MLH A;  3CD6 N;  5C15 A;  3HPO A;  1L3T A;  4H0X B;  1X9W A;  2QI2 A;  5FDL A;  3S3M A;  2HW3 A;  3C6T A;  4CEF A;  3DAW A;  1WSF A;  4IWV A;  2F8S A;  4OLB A;  2I5J A;  3E01 A;  1RBS A;  3C6U A;  2NNW A;  2HHW A;  2O8C A;  3NDK A;  3KLF A;  1IBL K;  3I56 N;  4BE1 A;  5JS1 A;  1RDD A;  3RSE B;  4JRQ A;  4CHN A;  3O9U A;  5LY3 A;  4GVE A;  1CXU A;  3HPG A;  3THY A;  1HLU A;  4RWT A;  4CFA A;  5AQJ A;  3NE6 A;  1U49 A;  4CJ4 A;  4DV1 K;  4JI1 K;  4JKG A;  4DV3 K;  1C6V A;  1UOC A;  2VWJ A;  3OY9 A;  4JKC A;  1HJR A;  1HKG A;  3UKU B;  5FPD A;  4C8K A;  1VQL N;  4IOC L;  4IXC A;  3VQ4 A;  3T1H K;  4N76 A;  3S9H A;  2Z1I A;  2XY8 A;  4PY5 A;  3JS6 A;  2OAN A;  3D0P A;  1LCU A;  3O1W A;  5BR8 K;  4FWR A;  4B3S K;  3ENB A;  1GOB A;  5LL6 Z;  1IKY A;  3E9L A;  1CZ9 A;  4L8R B;  4JHD A;  4IOA L;  4FK2 A;  3MX2 A;  4M7X A;  3EZW A;  1RT3 A;  1XHX A;  1HNI A;  4EFH A;  1L3S A;  1CZA N;  5AQF A;  3NH1 A;  5BRH A;  4H5T A;  4CFB A;  4JI3 K;  3KHY A;  3AGR A;  5M1P A;  1YIT N;  4GKK K;  3SLC A;  4WCE L;  1RTH A;  4I6M A;  4OKK A;  3IRX A;  4OKJ A;  1KD1 O;  4DTU A;  1BOT O;  3AA4 A;  3QFU A;  2HMP A;  3SJJ A;  2E2O A;  4DV6 K;  1ZYQ A;  3ZSX A;  4B1W B;  4H03 B;  4K43 A;  4KH4 A;  3BUZ B;  1P90 A;  4DV2 K;  5HLF A;  2D0O A;  3VN5 A;  1T7P A;  4XH4 A;  5M1F A;  4OPH A;  3AV9 A;  4O5F A;  1VSJ A;  2OTJ N;  1YUW A;  1NKE A;  4XEI A;  3HYF A;  3LP1 A;  4JAX A;  3S3O A;  4E19 A;  1SAZ A;  4YOU A;  1GLB G;  4OKE A;  3VQQ A;  2O4G A;  4Z94 A;  4Y0W A;  1WBD A;  5H1S Q;  2DFF A;  2GEL A;  1QZ6 A;  2YKN A;  3EKS A;  2A1R A;  3VQB A;  1T8E A;  2ZF5 O;  4DB3 A;  3VA0 A;  2E88 A;  4MDA A;  3G10 A;  3RMA A;  5BPM A;  5AQU A;  1ZBU A;  2UXD K;  4BWM A;  1HKB A;  1HYS A;  2YHX A;  3QB0 A;  4CIE A;  2AP1 A;  1BA0 A;  3LAL A;  1TUU A;  1YJ9 N;  1OH8 A;  4RG8 A;  3VES A;  4FJX A;  2YNH A;  1RT7 A;  2NZT A;  4C8M A;  4F8R A;  1JCG A;  4M45 A;  2VGM A;  5FPN A;  4LY7 A;  1SZ2 A;  2DTU A;  3K5O A;  3P1G A;  4J8F A;  1U2V B;  1XUP O;  3L2Q A;  1K9M O;  4CBU A;  3I55 N;  1FXX A;  3SUO A;  4DFK A;  2NUB A;  3LAK A;  4FJ7 A;  1K8K B;  3MXJ A;  4AIL C;  3E1Y A;  4QCL A;  4DHY A;  4JRP A;  3LL3 A;  4IEE A;  3HTV A;  2FBX A;  1S9G A;  3VF4 A;  5I9E B;  4KBO A;  4LF7 K;  3C6A A;  3CCL N;  1RT2 A;  1N8R O;  2BTF A;  1TK8 A;  5DM6 L;  4E7J A;  2J4R A;  4M3T A;  4FWK A;  2GEM A;  4CES A;  4DTS A;  3HK2 A;  4DS5 A;  4IFV A;  4PWD A;  2O8F B;  2E2N A;  4CER A;  4DR1 K;  4B9Q A;  2QM1 A;  1EO1 A;  2O8E B;  2FSK A;  3D7E O;  4OPA A;  3MXI A;  2E8A A;  4FZX C;  2P9L B;  5ELZ A;  4AF1 A;  3SAG A;  1RGI A;  1N33 K;  4CZK A;  3PO4 A;  3O3F A;  5CR4 A;  2OPQ A;  1YTU A;  3SQ1 A;  3V9Z A;  4BC4 A;  1NJX A;  4CCH A;  2HHT A;  3ATV A;  3E66 A;  4K41 A;  1H1V A;  1S1X A;  2JGU A;  1M1K O;  1IG9 A;  1DT9 A;  4O0J A;  4QAG A;  5AQX A;  4KHN A;  2O8B B;  3V9S A;  3FZF A;  3ZSZ A;  2E20 A;  1TK5 A;  1M90 O;  1VSD A;  1VQ5 N;  5I3U A;  5BN8 A;  1OVQ A;  3F73 A;  5K14 A;  3THW B;  4CZM A;  2DFH A;  1IO2 A;  3CHW A;  3IKM A;  4JKD A;  2KFN A;  4FOI A;  1R0A A;  2WOM A;  3CM6 A;  4CEO A;  5M1K A;  2YHY A;  1C0U A;  2A42 A;  1Q7Y O;  3TSP A;  3BP8 A;  4DV4 K;  5E26 A;  3EYZ A;  3DMJ A;  3KJV A;  1KAZ A;  5CZ1 A;  1Q9X A;  4HUE A;  5KQ8 A;  2KQ2 A;  5C24 A;  4FLZ A;  1BIZ A;  2WBN A;  4KTZ A;  5AQY A;  4DSK A;  3F2K A;  3OYL A;  4CZH A;  5KGX A;  1WSI A;  4LF6 K;  1WNS A;  4BRF A;  4NCG A;  3O08 A;  3CJ7 A;  3FGU A;  5AQS A;  5AQL A;  1QVG M;  1JLG A;  1NGH A;  4E89 A;  2B4J A;  2AA4 A;  1YF5 L;  3ULE A;  3UKR B;  5AZJ A;  3VGK A;  3VET A;  1NJZ A;  1D9D A;  3KLE A;  2QWP A;  4Z4G A;  5M1N A;  2A1S A;  4PKG A;  2VYP A;  3KKS A;  3OYH A;  5EVZ A;  1ILY A;  2NRV A;  1YJN N;  3V1R A;  5AJ3 K;  3MED A;  3LAN A;  1NGI A;  5AFU H;  3QEW A;  2X6N A;  2NLX A;  3AO5 A;  5AQQ A;  3IG1 A;  4FZZ A;  4AHS A;  2QTD A;  2E2P A;  3QO9 A;  3HJF A;  1SQK A;  4MLE A;  3R3L A;  3DXM B;  5GAH P;  3OJS A;  2D0A A;  1J5O A;  2P5G A;  3KK1 A;  2Q31 A;  4B1U B;  2CGK A;  4AM7 A;  4BDY A;  4H5W A;  2ASM A;  5TKY A;  4LFC K;  4OPK A;  3L4Q A;  2V7Y A;  1QS4 A;  3PX4 A;  3G0Z A;  3LP0 A;  3C95 A;  4Z4F A;  1MA9 B;  1D5A A;  3O3H A;  3FFI A;  1Q8I A;  4TSX A;  2PBD A;  1KXP A;  3AVK A;  3NF8 A;  3CI5 A;  3TAF A;  2PYL A;  2VWK A;  4KAZ A;  2BGG A;  2ZD1 A;  1TAQ A;  3WNF A;  4CZI A;  4W5N A;  4BDP A;  4ISG A;  4CF0 A;  3VF2 A;  3QEP A;  1BQM A;  4L3Q A;  1VQP N;  2XY6 A;  2NRH A;  3MEE A;  4BC2 A;  4C8L A;  5C10 A;  2D0B A;  3THY B;  4FSV A;  1ZBI A;  4FJ9 A;  3S41 A;  1NGC A;  1TL3 A;  3LM2 A;  2IVN A;  1LWC A;  4Q0B A;  1HMV A;  3TTC A;  4CEE A;  3MWP A;  4CJW A;  1YXQ A;  2XRI A;  1K73 O;  4LH4 A;  4K42 A;  3OS1 A;  3AVC A;  2F9T A;  4DSJ A;  1WAF A;  1NJY A;  3SYZ A;  4YHH K;  1KQS M;  2G8I A;  4M42 A;  1YJW N;  2A40 A;  3EEQ A;  2ZQB A;  3WXJ A;  3VER A;  4MFB A;  3THV A;  1ZBS A;  3VGM A;  5LMN K;  1BCM A;  1J5E K;  4WFB L;  4GV6 A;  3K5N A;  1IKW A;  2KTQ A;  4YOW A;  3H6E A;  3B6P A;  4OVL A;  4CJ3 A;  4DS4 A;  2YNI A;  3MAQ A;  2P5O A;  4BGA A;  4PL7 A;  1A5V A;  1J54 A;  4H0O A;  5J2Q A;  1G99 A;  4ELT A;  4DQ8 A;  5HRR A;  3SJH A;  4JKF A;  4GKJ K;  4ISF A;  3HP6 A;  1U04 A;  4AHT A;  2VQF K;  3QFP A;  1HNZ K;  3LDO A;  1C1B A;  4BRP A;  3I8B A;  1NBW A;  3OYC A;  2NRW A;  1FKP A;  2GX9 A;  1VSF A;  4M41 A;  4WQ4 C;  5GAE P;  3FZK A;  2F4V K;  4AH9 A;  2FSN A;  2KHO A;  1JXB A;  2G8H A;  3NGI A;  4F4K A;  4J2E A;  1Q18 A;  4OPJ A;  1Y64 A;  2YJF A;  3LP2 A;  3BEX A;  3CC7 N;  3OYF A;  4JS4 A;  1C0F A;  4DU3 A;  3ALY A;  3CQX A;  1BO5 O;  1IKX A;  1Z6R A;  2I7N A;  3CG7 A;  1RTJ A;  4B9N A;  5HRO A;  1OH6 A;  4JD2 B;  5AR0 A;  2E6M A;  3FE1 A;  4DTN A;  3AA3 A;  3MEG A;  1Q86 O;  3O9R A;  2F96 A;  1V4T A;  4FYD A;  1S72 N;  1BDG A;  1J9A A;  2EX3 A;  3DLL L;  1RBT A;  3MDQ A;  1RT5 A;  1I3A A;  1K8A O;  3L3U A;  3CPE A;  4FOE A;  1DLO A;  4H0Y B;  3CFO A;  4FVU A;  2HF4 A;  1U2V A;  1MU2 A;  3L3V A;  2IAJ A;  3OW2 M;  1WB9 A;  3C7N B;  3NVM A;  3ATU A;  3PSF A;  3O9S A;  1IH7 A;  4CHY A;  1YHQ N;  5JLF A;  3OBW A;  4E7I A;  1OH7 A;  3F9K A;  5BRF A;  5CZ2 A;  4HHT A;  5C2F A;  4YOT A;  3EE9 A;  4H0P A;  5BPN A;  3NCI A;  3WQU A;  4N47 A;  5BR9 A;  4FJ5 A;  4U67 L;  3V1Q A;  4V19 S;  4DUZ K;  1NOZ A;  3KLH A;  4IOX A;  3WNG A;  5LJW A;  4FJH A;  3WT0 A;  2GUI A;  2ATQ A;  2YJE A;  4K8X A;  4FW1 A;  4CF9 A;  3QBX A;  4NLC A;  1N5Y A;  4KB0 A;  3U8X A;  3RMD A;  5MLC Q;  4X64 K;  2OPR A;  4JI6 K;  1C1C A;  1KSP A;  2X6S A;  4XH1 A;  4FLW A;  3NFA A;  4CZE A;  4FJL A;  1ZC6 A;  2QWR A;  3AAQ A;  2HND A;  5HBM A;  5TKW A;  3P39 A;  4W5O A;  4IFY A;  3QBW A;  4H4O A;  1IKV A;  3TAE A;  3M1F A;  5KPT A;  4E0D A;  2VGN A;  3GE1 A;  2NRT A;  3ZLJ A;  4JYA K;  3HL8 A;  3K59 A;  5EX5 A;  5F2R A;  4Y1C A;  4KH6 A;  2OZS A;  3JXU A;  2E6L A;  2G8F A;  3HSC A;  4JNE A;  5E41 A;  4BRI A;  4IEI A;  2WFB A;  1TKZ A;  4CW7 B;  3THW A;  3J80 O;  3LDP A;  2AJQ A;  3NGY A;  3H08 A;  2UUC K;  3ZET A;  2GTD A;  2YI1 A;  1S1T A;  1VSK A;  3TTF A;  3TU5 A;  2PAV A;  3OYN A;  1TYQ A;  2E2Q A;  3RRH A;  2Z1J A;  4RTF D;  4I7F A;  4OGE A;  2A5X A;  3DRP A;  1QHA A;  3OYI A;  1ASW A;  4E1N A;  4OGC A;  2HST A;  4BRD A;  4CK1 A;  4LD0 A;  3VEV A;  3OYD A;  1HQU A;  1IV0 A;  2ASO A;  2LSN A;  4NXM K;  3LPT A;  4O55 A;  5GAG P;  1NGA A;  3V1O A;  4KTQ A;  3SQ2 A;  3PY8 A;  1X1P A;  5SZT A;  4CJK A;  4DTR A;  3KLG A;  4WYB A;  4FCY A;  2G8V A;  4C23 A;  1MWK A;  4C8N A;  2VG6 A;  3G25 A;  1X3N A;  5KRT A;  1U47 A;  4EP4 A;  3GOI A;  3A5N C;  4ZHR A;  4W5Q A;  3DRR A;  3VQP A;  1S5J A;  4BR0 A;  1X3M A;  1JCF A;  1ESV A;  1HR0 K;  3D2F A;  1YIJ N;  3V4I A;  3VQA A;  2VQE K;  4G9Z A;  4QS8 A;  4CEB A;  4X62 K;  3QET A;  4M3W A;  4YOR A;  2DY4 A;  2UXB K;  4BRH A;  2VWB A;  1XQS C;  3DXM A;  4JV5 K;  1ASV A;  5C2D A;  3DRS A;  3MN9 A;  3U4L A;  1OH5 A;  1QTM A;  2OYQ A;  2QWM A;  1W0H A;  3S3N A;  3MCP A;  3L2U A;  3IUC A;  3CQ8 A;  1LAV A;  4QS9 A;  4CI6 A;  4DUY K;  3QIN A;  3SV3 A;  1YVN A;  4DSE A;  3CCU N;  4IDK A;  3OYJ A;  4YY3 K;  3WXI A;  3RWU A;  1FJG K;  2YNF A;  4DTM A;  2OZM A;  3QLH A;  1NM1 A;  4PKI A;  1F21 A;  3CER A;  3CJA A;  1GOA A;  3OTO K;  2QWN A;  1C0T A;  1W9H A;  2VG5 A;  3HRG A;  4DV5 K;  4O4G A;  3ZT2 A;  3HST B;  1NU0 A;  2HBJ A;  5EOY A;  4KB1 A;  3AA2 A;  4YOV A;  2KW4 A;  2FF3 B;  1JLB A;  4E7H A;  3CC4 N;  4W5R A;  1RFQ A;  3TAN A;  4CGG A;  3G4S N;  1E3M A;  4IO8 A;  2QKK A;  4KRE A;  1EWR A;  5C42 A;  3QIO A;  1WSE A;  4EIA A;  4B9U A;  1C0M A;  1QSY A;  3VQ8 A;  3NF6 A;  1ASU A;  1K6Y A;  4PA1 A;  4OJR A;  4DV7 K;  4M3X A;  3LM9 A;  5FPE A;  4FW2 A;  4JLH A;  4H8K A;  2HBL A;  4Z4I A;  3M8P A;  1NNE A;  1OVY A;  3T19 A;  4CJS A;  5KPR A;  4WF9 L;  3VQ6 A;  5GIO A;  1JL2 A;  3VOV A;  1BIU A;  2IC3 A;  4JKA A;  3WEE A;  4CJ5 A;  3G71 N;  3T69 A;  2JLE A;  4LF5 K;  4H5N A;  1XC9 A;  4HTL A;  4CHP A;  4N5S A;  3CC2 N;  5FRN A;  2P9S B;  4JEP A;  4CBX A;  3MXM A;  1BHL A;  3QNO A;  3N4Q A;  1I39 A;  1SKS A;  2D1K A;  4BGB A;  3O9Q A;  1RBR A;  3VEX A;  3ZT1 A;  1RT4 A;  3C94 A;  4JS5 A;  2PYJ A;  4A57 A;  1CXQ A;  3VQ7 A;  1VSE A;  4F2S A;  2Z1H A;  3C65 A;  2CH6 A;  3PUF A;  3CMA N;  4DF4 A;  1T6C A;  1U4B A;  4FPA A;  4B3R K;  3HO1 A;  1KLN A;  1XNQ K;  4JI0 K;  2KFZ A;  1JLF A;  4KO0 A;  2QW9 A;  3BY5 A;  2NRX A;  4B1Y B;  3KK3 A;  3DI6 A;  2DFE A;  3JAM O;  3D2E B;  4CK3 A;  3WXK A;  4B1X B;  4FLU A;  1GLC G;  4BDZ A;  1VQM N;  2VCP A;  3AGK A;  3A8Y A;  5AQN A;  3T3F A;  3Q7B A;  5CYQ A;  3UE5 A;  4KKO A;  3OS0 A;  4HCB A;  4LF9 K;  2CGJ A;  3SMP A;  1YAG A;  4JD2 A;  4CF1 A;  1NJW A;  3CJB A;  4IJN A;  2QXL A;  4LF8 K;  4O8K A;  3CF5 L;  3M8S A;  1SKR A;  3I0S A;  3AO4 A;  3P31 A;  3TAQ A;  1XMQ K;  4PUO A;  3EZ5 A;  1V4S A;  2XO7 A;  3CET A;  3SMS A;  2A3Z A;  4FLT A;  3QEI A;  1WOQ A;  3UB5 A;  5AQZ A;  4JK7 A;  1S22 A;  2Y1I A;  1BGX T;  1W97 L;  3OA9 A;  4B8A B;  1ZBF A;  2NRZ A;  3C7N A;  3DLG A;  3AVM A;  5AZI A;  3AAP A;  3CJC A;  3CM5 A;  5CY4 A;  2HHH K;  1SS6 A;  4FWN A;  5JLH A;  3GBT A;  4DV0 K;  2YHW A;  4B3M K;  1REV A;  2HOE A;  4FJM A;  4ELU A;  1MWM A;  4FLX A;  5CHI A;  2A41 A;  2FXU A;  4DTO A;  2G8U A;  2HHV A;  4FWP A;  1NK5 A;  4JK9 A;  3AVG A;  4H0V B;  3DWL A;  1VK0 A;  4FK4 A;  4A62 A;  4FVM A;  4HWI A;  1NKC A;  1NK0 A;  2OCE A;  2D4W A;  1YTA A;  3ZX0 A;  3ZX2 A;  2GWJ A;  4B9S A;  4WFN L;  2IOC A;  4X66 K;  2IVO A;  3VEN A;  4I9L A;  1W7A A;  1SL0 A;  4B3O A;  4CEC A;  4OX9 K;  1FW6 A;  1HUX A;  3FZM A;  2G8K A;  4JI2 K;  3E9P A;  1U48 A;  4KFB A;  3HVT A;  4BR9 A;  3RR8 A;  3SUP A;  4A59 A;  1VQ8 N;  2ETJ A;  4BE2 A; 
#chains in the Genus database with same CATH homology
 3SUQ A;  1WSF A;  4DFJ A;  1JXB A;  2G8H A;  3NGI A;  5CYM A;  4F4K A;  4DLE A;  4J2E A;  2O4I A;  5DMR A;  4R5P A;  4FJI A;  2F8S A;  4OLB A;  4OPJ A;  3LP2 A;  4DTX A;  2I5J A;  3E01 A;  5T7B A;  1RBS A;  3OYF A;  4DWI A;  4JS4 A;  3EY1 A;  3C6U A;  4Z4C A;  1EP4 A;  3L2R A;  4DU3 A;  2HHW A;  3ALY A;  3NDK A;  1IKX A;  3KLF A;  3NBP A;  3CG7 A;  1RTJ A;  3HM9 A;  4BE1 A;  1RT6 A;  2BE2 A;  5KTQ A;  4B9N A;  1RDD A;  3NH0 A;  4JRQ A;  5JS1 A;  5HRO A;  1RBV A;  4CHN A;  2E6M A;  3AA5 X;  4DTN A;  4DTP A;  1EX4 A;  4E3S A;  2EHG A;  1CXU A;  4ZTJ A;  3AA3 A;  2E4L A;  3HPG A;  3MEG A;  4LH5 A;  4I9Q A;  1CLQ A;  2OPS A;  1LWF A;  2F96 A;  4O44 A;  4CFA A;  4CF2 A;  4KPY A;  3NE6 A;  1U49 A;  4CJ4 A;  4FYD A;  2W42 A;  1RDA A;  4HTU A;  4I2Q A;  1C6V A;  2RPI A;  2EX3 A;  1J9A A;  1UOC A;  2VWJ A;  1RBT A;  1RT5 A;  3OY9 A;  4UQG A;  1I3A A;  3BGR A;  1KLN A;  4YFU A;  4F2R A;  3L3U A;  2HHQ A;  3NGZ A;  4LSL A;  4B9V A;  1S1V A;  3DOK A;  1DLO A;  1HJR A;  4GW6 A;  3CFO A;  4B08 A;  1XI1 A;  1SL2 A;  3ZCM A;  4C8K A;  3VQ4 A;  1L3U A;  1D8Y A;  4N76 A;  1MU2 A;  3AVJ A;  3L3V A;  2IAJ A;  2Z1I A;  2XY8 A;  3S9H A;  4PY5 A;  3JSM A;  4DQI A;  4B9M A;  3AVN A;  3QIP A;  4CIF A;  3D0P A;  1IH7 A;  4CHY A;  3KD1 E;  3HPH A;  4E7I A;  3F9K A;  4RW4 A;  5CZ2 A;  3DLE A;  2HMI A;  1NK8 A;  4HHT A;  3PX0 A;  1GOB A;  1IKY A;  3V6D A;  3SNN A;  3NCI A;  1CZ9 A;  4RW7 A;  4L8R B;  4YNQ A;  4N47 A;  1HQE A;  4CGD A;  5J2N A;  4FK2 A;  1KVC A;  3O3G A;  4FLV A;  4FJ5 A;  3I0R A;  3V1Q A;  1RT3 A;  4Z4E A;  3ZT3 A;  1XWL A;  1NOZ A;  3KLH A;  1XHX A;  3VQ5 A;  1HNI A;  1S9E A;  3WNG A;  3VQ9 A;  1L3S A;  1CZB A;  4FJH A;  2HVH A;  3MEC A;  3ZSO A;  1ITG A;  5KRS A;  3NH1 A;  2GUI A;  5FRO A;  4NCB A;  1VRU A;  2ATQ A;  3U6F A;  4FW1 A;  5HP1 A;  4K8X A;  1QE1 A;  4CFB A;  4CF9 A;  5J1E A;  3LDS A;  1N5Y A;  4KB0 A;  1HYV A;  4KHQ A;  4O0I A;  1RTH A;  3M8R A;  3RMD A;  2OPR A;  2RN2 A;  3IRX A;  4OKK A;  4N56 A;  4OKJ A;  1NK9 A;  4DTU A;  1RTD A;  3AA4 A;  4ID5 A;  4DLG A;  1C1C A;  2IGI A;  2X6S A;  3LWL A;  2FBT A;  3SJJ A;  1KSP A;  3RR7 A;  2Q3S A;  4FLW A;  3ZSX A;  3WNH A;  1WAJ A;  3NFA A;  4W5T A;  2R7Y A;  1ZYQ A;  4FJL A;  1ZBL A;  1U45 A;  4DG1 A;  1JLA A;  5J2P A;  3L2V A;  2HND A;  5HBM A;  1KFS A;  2IDO A;  1BIS A;  4IFY A;  4W5O A;  1G15 A;  4H4O A;  1IKV A;  3TAE A;  4M3Y A;  2Z1G A;  5HLF A;  4E0D A;  3VN5 A;  1T7P A;  4KRF A;  3HXM A;  1LW0 A;  3HL8 A;  4WE1 A;  3AV9 A;  3K59 A;  1VSJ A;  4DFP A;  1LAW A;  4B9T A;  1D9F A;  1DTQ A;  2YHB A;  4Y1C A;  1NKE A;  1LWE A;  3HYF A;  1KTQ A;  3LP1 A;  2OZS A;  3AVL A;  1KCF A;  4CJU A;  3S3O A;  4E19 A;  2BAN A;  1RNH A;  4KHS A;  5DK5 A;  2E6L A;  1A5W A;  1B92 A;  1JLC A;  3SI6 A;  3SZ2 A;  1UA1 A;  4OKE A;  3VQQ A;  2F8T A;  2O4G A;  2G8F A;  5E41 A;  3NAE A;  2XHB A;  1KRP A;  2DFF A;  1JKH A;  2YKM A;  2YKN A;  4KI6 A;  1TKZ A;  4CEQ A;  4FLY A;  2A1R A;  3VQB A;  1T8E A;  3VA0 A;  2AJQ A;  3NGY A;  1HNV A;  3H08 A;  3G10 A;  4DSF A;  3RMA A;  3ASM A;  3K5M A;  1ZBU A;  1VSL A;  3AO1 A;  4BWM A;  1S1T A;  1HYS A;  1VSK A;  2GV9 A;  4J2A A;  4CJE A;  3NF9 A;  4CIE A;  3OYB A;  2D5R A;  2FBV A;  3LAL A;  3OYN A;  2RKI A;  4RG8 A;  4FJX A;  1S1W A;  2YNH A;  3K5L A;  3RRH A;  2Z1J A;  1RT7 A;  4EP5 A;  1JL1 A;  4C8M A;  2BDP A;  2FBY A;  4I7F A;  4OGE A;  4F8R A;  3DRP A;  4M45 A;  1RTI A;  5SWM A;  1ASW A;  3LAM A;  3OYI A;  4LY7 A;  4E1N A;  1L5U A;  2DTU A;  3K5O A;  4OGC A;  3P1G A;  4CK1 A;  4C8O A;  2XY5 A;  4LD0 A;  3OYD A;  1SUQ A;  1HQU A;  1X9M A;  1KVA A;  2LSN A;  5HRP A;  1BI4 B;  1WLJ A;  3OYK A;  3L2Q A;  3LPT A;  4O55 A;  3QEX A;  1FXX A;  3V1O A;  1TKX A;  3TAM A;  3SUO A;  4DFK A;  2NUB A;  3V9W A;  4KTQ A;  3JYT A;  3SQ2 A;  3LAK A;  4J2D A;  3PY8 A;  4FJ7 A;  1X1P A;  4FJJ A;  2ZE2 A;  3AO2 A;  1HRH A;  2HB5 A;  2FC0 A;  3MXJ A;  4CJK A;  5SZT A;  4JRP A;  4DTR A;  1TL1 A;  2PZS A;  3KLG A;  4QCL A;  2B5J A;  2FBX A;  4FCY A;  1S9G A;  1EKE A;  1WN7 A;  2G8V A;  1GOC A;  3K58 A;  3HP9 A;  4C8N A;  4CGI A;  1DTT A;  2VG6 A;  2QXF A;  4DSL A;  1RT2 A;  5KRT A;  1U47 A;  2P1J A;  2QK9 A;  1TK8 A;  4EP4 A;  4AHU A;  4E7J A;  4ZHR A;  1KLM A;  3SV4 A;  4W5Q A;  1BCO A;  3K2P A;  4E7L A;  3DRR A;  3VQP A;  4CED A;  1TKD A;  1S5J A;  3T1A A;  4M3T A;  1LV5 A;  4CES A;  3I8D A;  4DTS A;  3HK2 A;  3SPZ A;  1NOY A;  4DS5 A;  4IFV A;  3V4I A;  3VQA A;  4PWD A;  4CJR A;  4CJQ A;  4CER A;  2D0C A;  4CEB A;  2P51 A;  3QET A;  3MXI A;  4M3W A;  4IBN A;  2X78 A;  2DY4 A;  4FZX C;  5EU7 A;  5HRS A;  2HNZ A;  4BAC A;  1ASV A;  3DRS A;  3VQD A;  3PO4 A;  1EET A;  3O3F A;  3UIQ A;  4M3U A;  3L8B A;  2OPQ A;  1TK0 A;  4FM1 A;  1YTU A;  3SQ1 A;  3V9Z A;  1QTM A;  1NJX A;  2OYQ A;  1W0H A;  1NK4 A;  4CCH A;  3QNN A;  3S3N A;  3L2U A;  2HHT A;  3CQ8 A;  3DLB A;  4Q5V A;  1LAV A;  4DF8 A;  4J2B A;  4RW8 A;  1B9F A;  4M3Z A;  4KHY A;  3QIN A;  3AO3 A;  3SV3 A;  5C25 A;  4DSE A;  3TI0 A;  3IS9 A;  4IDK A;  5HRN A;  1S1X A;  1O1W A;  2JGU A;  3OYJ A;  3ULD A;  1IG9 A;  3RWU A;  4O0J A;  4QAG A;  2YNF A;  4DTM A;  2OZM A;  4KHN A;  3P5J A;  3QLH A;  3V9S A;  1F21 A;  3O4N A;  3ZSZ A;  1TK5 A;  3SCX A;  1VSD A;  1GOA A;  4MQ3 A;  4B9L A;  1B9D A;  1C0T A;  1W9H A;  4CIG A;  1RDB A;  2VG5 A;  5I3U A;  3D45 A;  3AVA A;  2B6A A;  1KFD A;  4CJP A;  3F73 A;  3SPY A;  1RBU A;  4O4G A;  5K14 A;  3ZT2 A;  3HST B;  2DFH A;  1IO2 A;  3TWH A;  4BE0 A;  4KB1 A;  1NKB A;  1VRT A;  4CE9 A;  4E7K A;  2RF2 A;  3AA2 A;  2KFN A;  2KW4 A;  3LWM A;  2HHU A;  3V9X A;  3VQC A;  3DLR A;  1R0A A;  1JLB A;  2WOM A;  3CM6 A;  4CEO A;  4E7H A;  1WSH A;  1KVB A;  1C0U A;  4CHQ A;  4W5R A;  3L2W A;  3LPU A;  4CGG A;  1EXQ A;  4IG0 A;  3V81 A;  3TAN A;  4KHU A;  2QKK A;  3TAP A;  1Y97 A;  4KRE A;  5C42 A;  3EYZ A;  3QIO A;  3DMJ A;  3KJV A;  1WSE A;  1HPZ A;  1X9S A;  1Q9X A;  1C0M A;  5CZ1 A;  4HUE A;  1QSY A;  3VQ8 A;  4B9U A;  3NF6 A;  1RT1 A;  1ASU A;  2KQ2 A;  5C24 A;  4FLZ A;  1K6Y A;  1T05 A;  1BIZ A;  4KTZ A;  3DLK A;  4OJR A;  1FKO A;  1YT3 A;  4PA1 A;  3OYM A;  4DSK A;  3KIO A;  4FJ8 A;  4M3X A;  1QQC A;  3O4Q A;  4H4M A;  3OYL A;  4FW2 A;  4JLH A;  4H8K A;  3B6O A;  3CFP A;  1BI4 A;  4DQQ A;  4Z4I A;  3M8P A;  3T19 A;  1WSI A;  4CJS A;  5KGX A;  1WNS A;  4NCG A;  2VG7 A;  1UWB A;  1JL2 A;  3VQ6 A;  1T03 A;  3OJU A;  1BIU A;  1UAX A;  1JLG A;  4RW6 A;  3QES A;  2IC3 A;  4E89 A;  2B4J A;  1FK9 A;  1TKT A;  4EZ9 A;  4CHZ A;  4CJ5 A;  4FJN A;  2GBZ A;  4Z0U A;  1NJZ A;  2JLE A;  1D9D A;  3KLE A;  4Z4G A;  3RRG A;  4NCA A;  2A1S A;  3OS2 A;  1XC9 A;  1JLE A;  5KGW A;  3ZSV A;  2IS3 A;  3KKS A;  4CHP A;  4N5S A;  4DTJ A;  3OYH A;  4KV8 A;  5FRN A;  3ZSR A;  3RMB A;  1QSL A;  1TV6 A;  3DOL A;  4CGF A;  3KK2 A;  2G8W A;  4RW9 A;  1BL3 A;  1BHL A;  4CK2 A;  3QNO A;  3MXM A;  4N41 A;  3V1R A;  1I39 A;  1SKS A;  1NK6 A;  4FJK A;  3MED A;  3LZJ A;  4FXD A;  2HHX A;  3P83 D;  1RBR A;  1J53 A;  3ZT1 A;  1VSM A;  1RT4 A;  3C94 A;  3LAN A;  3U3G A;  4JS5 A;  2PYJ A;  2HNY A;  3VQE A;  1JXE A;  1A5X A;  3QEW A;  1CXQ A;  4DU1 A;  3VQ7 A;  2X6N A;  4CHO A;  2KZZ A;  1VSE A;  2YHA A;  3AO5 A;  3K57 A;  4F3T A;  3ZSW A;  1Q9Y A;  1VSI A;  4FM0 A;  4F2S A;  2Z1H A;  3IG1 A;  4NYN A;  4FZZ A;  4AHS A;  3PUF A;  4DF4 A;  3QO9 A;  3WNE A;  3HJF A;  1U4B A;  5I42 A;  3TR8 A;  3OJS A;  4BWJ A;  3HO1 A;  2D0A A;  5KI6 A;  3TAG A;  4AHR A;  2WON A;  4AHV A;  1XHZ A;  3KK1 A;  1SL1 A;  4G1Q A;  1J5O A;  2P5G A;  3U3Y A;  4O5B A;  4HUF A;  2KFZ A;  1JLF A;  3A2F A;  1S1U A;  4KO0 A;  4ELV A;  2OA8 A;  1LW2 A;  3KK3 A;  4CJF A;  4BDY A;  5J2M A;  3DI6 A;  2DFE A;  1ZBH A;  5JS2 A;  4DSI A;  4CK3 A;  4OPK A;  2HHS A;  4KHW A;  4GMJ B;  3NF7 A;  1QS4 A;  3PX4 A;  3G0Z A;  3HVR A;  4AHC A;  3AVH A;  4CEA A;  4FLU A;  3LP0 A;  3C95 A;  4Z4F A;  4BDZ A;  1D5A A;  4LSN A;  3O3H A;  3FFI A;  4CJL A;  3DLH A;  4F3O A;  3VA3 A;  1Q8I A;  3OYA A;  4K8Z A;  4TSX A;  3T3F A;  4M3R A;  3AVK A;  4CJV A;  5CYQ A;  3ZSQ A;  3V9U A;  3NF8 A;  4DQS A;  3TAF A;  2PYL A;  2VWK A;  4HVJ A;  4KKO A;  5FRM A;  4KAZ A;  2BGG A;  2ZD1 A;  3OS0 A;  1TAQ A;  4HCB A;  3WNF A;  4FJG A;  4W5N A;  1NK7 A;  3BDP A;  4BDP A;  3NHG A;  1S6Q A;  4CF0 A;  3DYA A;  3HT3 A;  1C1A A;  1L3V A;  4CF1 A;  3QEP A;  4FK0 A;  4ID1 A;  1BQM A;  1NJW A;  3AVB A;  1RIL A;  3ZT4 A;  2XY6 A;  3MEE A;  4HCC A;  4C8L A;  4IKF A;  2D0B A;  4Y1D A;  3M8S A;  2YV0 X;  3QER A;  1ZBI A;  1SKR A;  3DM2 A;  4FJ9 A;  3I0S A;  3AO4 A;  4DQR A;  3TAQ A;  3CYM A;  3NH2 A;  1TL3 A;  3EZ5 A;  3IAY A;  1UA0 A;  3PO5 A;  3QEV A;  4PUO A;  1BQN A;  2XO7 A;  1LWC A;  4Q0B A;  1HMV A;  4FLT A;  2KZM A;  3QEI A;  4DFM A;  3TAB A;  4QOZ B;  1TAU A;  4CGH A;  4OLA A;  4CEE A;  4XIU A;  3SQ0 A;  3SUN A;  4CJW A;  4DMN A;  4ZTF A;  2XRI A;  4GVM A;  2Y1I A;  5D3G A;  1QHT A;  4E1M A;  3AVF A;  4Z4H A;  4LH4 A;  1WSG A;  1QSS A;  1BGX T;  4KI4 A;  3OS1 A;  4CFD A;  2HVI A;  3AVC A;  1ZBF A;  4B8A B;  1WAF A;  4DSJ A;  3RTV A;  1NJY A;  3SYZ A;  4NYF A;  3LP3 A;  3DLG A;  3AVM A;  1RDC A;  1Z26 A;  2ITG A;  3CM5 A;  5CY4 A;  4B8C A;  2G8I A;  2QKB A;  4M42 A;  3ZT0 A;  1YVU A;  2YNG A;  2ZQB A;  3CFR A;  3M8Q A;  4DU4 A;  1REV A;  4MFB A;  3KKR A;  1RCH A;  4FJM A;  4HUG A;  1JLQ A;  1SV5 A;  4ELU A;  3THV A;  4CFC A;  4FZY A;  1TGO A;  1WSJ A;  4FLX A;  2Y1J A;  1SKW A;  4DQP A;  4PQU A;  4CGJ A;  4FM2 A;  3KD5 E;  4CJT A;  4DTO A;  2G8U A;  1BCM A;  2HHV A;  1NK5 A;  3PX6 A;  3OYE A;  3AVG A;  4FK4 A;  1VK0 A;  2OPP A;  3K5N A;  4FVM A;  1NKC A;  3OVN A;  1IKW A;  4I2P A;  3SQ4 A;  1NK0 A;  3ISN C;  1YTA A;  3OYG A;  2KTQ A;  1HYZ A;  3KLI A;  4B9S A;  3B6P A;  4OVL A;  4CJ3 A;  2IOC A;  3RMC A;  4DS4 A;  2YNI A;  3AVI A;  3MAQ A;  4CEZ A;  2P5O A;  3KTQ A;  3ZSY A;  3TAR A;  1A5V A;  4I9L A;  1S6P A;  1SL0 A;  3LZI A;  4B3O A;  1J54 A;  1VSH A;  3ITH A;  4CEC A;  5J2Q A;  4ELT A;  2PY5 A;  5HRR A;  1N6Q A;  2X74 A;  2G8K A;  4ICL A;  3PV8 A;  1Z25 A;  4EZ6 A;  3HP6 A;  1TVR A;  1U48 A;  3HPO A;  4IG3 A;  1U04 A;  4KFB A;  4AHT A;  1L3T A;  4CF8 A;  1C1B A;  4KTW A;  4AIL C;  3HVT A;  1X9W A;  3OYC A;  3RR8 A;  5FDL A;  3SUP A;  1FKP A;  2XY7 A;  1VSF A;  4M41 A;  3S3M A;  2HW3 A;  2ETJ A;  3C6T A;  4AH9 A;  4CEF A;  4BE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...