2FC0A

Wrn exonuclease, mn dgmp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Werner syndrome helicase
total genus 63
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fc0A00
2HHWA 1SUQA 4CEDA 4JS4A 4CF1A 3VQCA 4DQIA 4H4OA 5C25A 1KSPA 4F2SA 3RWUA 4M3XA 3RMAA 4NCGA 4CE9A 4CJSA 3AO5A 2OYQA 4EZ6A 4KKOA 1JL2A 4CJKA 4OJRA 4CECA 1S1XA 4BDYA 3DYAA 2IGIA 3SYZA 4AHRA 3T3FA 4DFKA 4UQGA 1FKPA 4ID5A 5HRNA 2QKKA 1SV5A 4NCBA 2G8IA 2HW3A 4ZHRA 1HNIA 2O4GA 1S1WA 1VSEA 3RRHA 2XY7A 4HTUA 2HHUA 3OS0A 4M41A 4DTXA 2WONA 5T7BA 3OYGA 1NJWA 1JLCA 3I0SA 3I0RA 1LWEA 1REVA 2D0BA 4FCYA 1NK4A 3QNOA 4DMNA 3L3VA 3ITHA 4CIEA 1TAQA 3MEDA 3DRRA 2B5JA 1UA1A 3F73A 1NK6A 1JLFA 1TL3A 4DSKA 4CK3A 4MQ3A 4CJ5A 1RTJA 1RT2A 4CF2A 3LDSA 3VQAA 4I7FA 3SQ0A 4ZTJA 1N6QA 3AVKA 3S9HA 1WSEA 1VSKA 3CFRA 2FBYA 3LP3A 3M8RA 3AVNA 4OGEA 4HUEA 5J2PA 1NKBA 4KPYA 4GMJB 4OKJA 3BGRA 3L8BA 4OPJA 4DTJA 3LPUA 4G1QA 4AHTA 4AH9A 3NH2A 4M3TA 1SKSA 4FVMA 4DF8A 1NKCA 3U3YA 1S6PA 3SQ1A 4CHPA 4DTSA 1VRUA 3ZSXA 4KI4A 1RDDA 1BIZA 2EX3A 3KLGA 3ISNC 1CLQA 1BISA 3OJSA 2ITGA 2Z1IA 4E7KA 3VQQA 1WAJA 4QAGA 4IDKA 4KTZA 3RTVA 3DLBA 3QESA 1I39A 1IKXA 4AHUA 2HHTA 4FLYA 4CJUA 5JS1A 4OKEA 3VQ8A 3TAPA 4B9UA 3AVCA 3OYKA 3IG1A 1HYZA 4ELUA 4DLEA 4I9LA 3O4NA 4KFBA 4JRPA 4DQSA 4NYFA 4Z4IA 4B8CA 3DOLA 4CHOA 4BACA 1QSYA 4HUFA 3AVMA 4Z4EA 4KRFA 2KZMA 1LWCA 3QO9A 1FXXA 4FJJA 3JSMA 3OYLA 2OPRA 1VSJA 4QCLA 2HNYA 4CEOA 5FRMA 3HVRA 1ZBUA 4E7HA 1VSFA 3OYCA 3EY1A 1Q9YA 4EP5A 4PUOA 4LSLA 2OA8A 1JLAA 2YNIA 1JKHA 3QLHA 1LWFA 4DU4A 1DTQA 4KTWA 1ZBFA 3HXMA 2E6LA 3IRXA 3SCXA 4CK1A 1WSJA 4O0IA 1A5VA 4DQPA 4KREA 1C1CA 3TANA 5CYQA 3HM9A 4OGCA 2Y1JA 2FBTA 3V1RA 2VWJA 3QEIA 1ASVA 3DI6A 1U49A 4ICLA 1RTIA 3CYMA 3K59A 1BQMA 5KI6A 1ZBHA 2XO7A 3QETA 4EZ9A 5FRNA 3KLIA 5C42A 3HPGA 1A5XA 4IG0A 3KLFA 4E3SA 1LV5A 2PYJA 2KQ2A 2WOMA 3OYJA 4DTRA 1LW0A 4I2QA 3RMDA 3QERA 2BGGA 4CGFA 3S3NA 3C94A 1BI4B 1JLGA 3QEVA 3HJFA 4LH5A 3ZSZA 4KV8A 1F21A 4CF8A 1U04A 4HCCA 4KB1A 1S5JA 3I8DA 1RTHA 1WNSA 4E19A 4CJ4A 1NOYA 3D0PA 5J1EA 5CY4A 2XY8A 1XI1A 1KVCA 3U3GA 4DSJA 5SZTA 1QE1A 4CJ3A 3CQ8A 4WE1A 1ZBLA 4M3YA 2X74A 3OYMA 2PYLA 1B9DA 1XC9A 4BDPA 4FJNA 4KTQA 3S3OA 1RCHA 4HVJA 4PA1A 3LAMA 1U45A 2FC0A 1KVBA 1T05A 3T19A 1J54A 3HYFA 1EXQA 4HHTA 4IFYA 3SUOA 3KIOA 4KHUA 4GW6A 4IBNA 1NK9A 3L2RA 4E7JA 2D0CA 1Y97A 3ZT4A 1D9FA 4CGDA 3VQ9A 3S3MA 1C6VA 1W9HA 3LAKA 2YNFA 4BE2A 3SUNA 1BCMA 5DK5A 1QQCA 1RT7A 1U48A 4KHYA 4ELTA 2OPSA 4B9VA 3O3GA 2DY4A 1WSGA 1DTTA 4CJQA 4DU3A 3DM2A 3TABA 2Z1HA 5HRRA 5HLFA 3DRPA 2ATQA 3ZSOA 1VSHA 2DTUA 4DWIA 2A1SA 1HMVA 3V9XA 1WLJA 3AO1A 1RBTA 1XWLA 2BANA 4M3RA 3VQ5A 1X9MA 1TKDA 4OLAA 1HYVA 2RPIA 4Z4HA 4EP4A 1TV6A 4AHVA 1VSIA 3HL8A 1TK8A 4B08A 3U6FA 3THVA 1C0UA 3VQEA 2OPQA 2ZQBA 3MXMA 2HHSA 4ZTFA 3AO2A 1TVRA 3DLGA 3AA5X 2YNGA 3VQBA 1BCOA 4CGGA 4CEZA 3SPYA 4F8RA 4FYDA 4DSIA 1TAUA 4CFAA 4W5QA 1RBUA 3RRGA 4E7IA 4DS4A 1RILA 5HBMA 2HB5A 3CFPA 1TGOA 1BL3A 3MEEA 4KO0A 3IAYA 5K14A 2KW4A 4CJFA 4CHZA 1IKYA 3K5OA 2HHXA 4LY7A 3O3FA 1ASWA 3DLEA 3M8QA 3L3UA 1QS4A 3HT3A 4DQRA 3RMCA 3AVLA 4CK2A 2KFNA 2HHQA 4E1MA 2G8FA 4FLUA 1EETA 4OVLA 3T1AA 3SNNA 1YVUA 3P83D 4PQUA 4CJVA 3LZJA 3G10A 2F96A 4HUGA 4DFJA 3OYFA 3K5MA 3SJJA 4FZYA 2QK9A 4W5TA 3TARA 4W5OA 1KFSA 1LAWA 3ZCMA 5J2NA 1EP4A 4CEBA 4JRQA 4BE0A 2D5RA 3V1QA 1IG9A 3SI6A 1YTAA 4I2PA 4KHSA 1HQEA 1D5AA 3AA3A 3KTQA 4FJ5A 1S1VA 5CZ1A 4NCAA 1YTUA 5JS2A 1X9WA 4PY5A 3ZT0A 1NKEA 1HRHA 4LH4A 1EKEA 3PX0A 3MXJA 2VG7A 1WSIA 3LP2A 2XY6A 3TI0A 3CM6A 3ULDA 1RT5A 4R5PA 4DLGA 3PUFA 1DLOA 3K5LA 2QKBA 1RBRA 4DU1A 4C8KA 1WAFA 3NF7A 2XHBA 4OKKA 3OYDA 3CG7A 1MU2A 3PO5A 4RG8A 2KFZA 3HP9A 3M8SA 4J2BA 3VA3A 1IKWA 1KCFA 2JLEA 5HROA 1QSLA 4FLWA 3OJUA 3TAGA 4N47A 3DOKA 4RW6A 2DFFA 1RBVA 1C0TA 1W0HA 2IS3A 4QOZB 4FK0A 4BDZA 2IDOA 3CFOA 4CCHA 3NF8A 1TKZA 2E4LA 1KLNA 4BWMA 3OYBA 4FJ8A 1IH7A 3FFIA 5J2QA 2KTQA 5FDLA 3DLRA 2HHVA 2X6SA 1S1TA 3CM5A 2GBZA 4CGJA 3LPTA 4B9MA 2Z1JA 2FBVA 1UA0A 2EHGA 3TR8A 4FJHA 4DFMA 4B9NA 3KKRA 3K57A 2Y1IA 3O3HA 3AV9A 3AVGA 3WNHA 3LP1A 2P5GA 3MEGA 5HRSA 4LSNA 1ZBIA 1S9EA 4KAZA 1TKXA 1J9AA 3B6OA 3VQ4A 2RKIA 4F4KA 1VRTA 4FLXA 3NGYA 1UOCA 2ETJA 1SL1A 2G8HA 2XRIA 3A2FA 3SQ4A 3OYEA 1FK9A 5KRSA 3QEXA 1C1AA 1RT1A 1KTQA 1TKTA 2P1JA 4GVMA 1XHZA 1NJYA 3HP6A 4KHWA 1BHLA 2I5JA 3AVHA 4OLBA 1L5UA 4J2AA 2HVIA 2ZD1A 3IS9A 1RDCA 4FJXA 1RT3A 3ZSYA 4N56A 2VG5A 3JYTA 3SZ2A 1VK0A 4M45A 3L2WA 1CZBA 4O0JA 2G8KA 1UWBA 4RW9A 5FROA 1CXUA 1NOZA 3LWLA 1L3TA 4B9TA 4F3TA 4BWJA 1NK8A 2VG6A 4DS5A 2OPPA 5CZ2A 2YNHA 4Y1CA 3SUQA 1G15A 3PX6A 4DSLA 1HYSA 4JLHA 4FJIA 3HVTA 1TK5A 2RN2A 3VQ6A 4CERA 4PWDA 3NBPA 3ALYA 1Q8IA 3PO4A 4AHCA 3NCIA 3ZT1A 4FK2A 1U4BA 2LSNA 3B6PA 3F9KA 3AVBA 4FJMA 3QIOA 4BE1A 3V9ZA 4FZXC 4KHQA 3ZT3A 1HJRA 1YT3A 1NK7A 3C6UA 4FLZA 3RMBA 1SL0A 1JXEA 3V1OA 4IKFA 4M3WA 2DFEA 3NF9A 4AHSA 1D9DA 2ZE2A 3AVIA 1WN7A 3LALA 1VSDA 5I3UA 1N5YA 5KGXA 5J2MA 3PY8A 4KI6A 2JGUA 5HP1A 1WSFA 1T7PA 4LD0A 5KTQA 3OS2A 4E89A 3BDPA 3KK1A 3OS1A 3WNFA 2FBXA 3QNNA 1Q9XA 3MECA 3NH0A 3TAQA 1TK0A 2HNDA 2YHBA 4H4MA 1NK0A 2O4IA 4O55A 1TL1A 1NJZA 4CJEA 4CEFA 3AVJA 4FM0A 1I3AA 3M8PA 3V9UA 3HPHA 4CJLA 1CZ9A 2OZMA 3KD1E 4J2EA 3P1GA 2D0AA 4N41A 3VA0A 2R7YA 4O5BA 1B9FA 2BE2A 4FLTA 4K8ZA 1KVAA 5EU7A 2Z1GA 3QEPA 1JXBA 3K2PA 4Z4GA 4C8MA 3V81A 3AO3A 3VN5A 2VWKA 4CF9A 4O4GA 4JS5A 4H8KA 5I42A 4DG1A 3LP0A 1C0MA 5C24A 4N5SA 2P51A 2RF2A 3VQ7A 2YKNA 3KK3A 3LZIA 1KRPA 4DQQA 4CEAA 4CGHA 1BQNA 5D3GA 4E1NA 3HO1A 2PY5A 5E41A 2BDPA 3NF6A 4C8LA 4CJPA 4W5RA 1VSLA 3K58A 2KZZA 2YV0X 2YKMA 3VQDA 4CIGA 3MAQA 3HPOA 1L3UA 4FJ9A 4FW2A 1BIUA 1T8EA 4DFPA 4CFCA 2G8UA 1ZYQA 4I9QA 4Z4CA 2E6MA 4K8XA 4B9LA 3AVFA 4CHQA 4DF4A 4N76A 4CEQA 4B8AB 4W5NA 4YNQA 3ZT2A 3KLHA 4FW1A 3DLKA 1S1UA 1RDAA 4CIFA 3C6TA 3G0ZA 4CJTA 5HRPA 5SWMA 3PX4A 4DTMA 1RT6A 3DRSA 3KK2A 1R0AA 2AJQA 4CFBA 4C8NA 3DMJA 3QEWA 1NJXA 4Z0UA 4DTNA 3V4IA 2X78A 4XIUA 4FM2A 4CHNA 4Y1DA 3RR8A 2G8VA 3ZSWA 3LANA 3OYAA 4DSEA 3SQ2A 3ZSVA 2HMIA 4F2RA 1LW2A 4AILC 2NUBA 3H08A 4CESA 3ZSQA 1KFDA 3OYIA 1D8YA 1HNVA 4L8RB 4FZZA 3NFAA 4FJLA 4DTUA 4HCBA 3VQPA 2F8TA 4DSFA 4FLVA 4CFDA 1HPZA 2G8WA 3NGIA 4J2DA 2OZSA 4RW7A 2GUIA 3V9WA 2P5OA 1JLEA 4E7LA 1S6QA 2X6NA 1L3VA 1HQUA 1QHTA 4CJRA 1A5WA 1C1BA 4IFVA 4IG3A 4B9SA 3V6DA 2IC3A 4C8OA 3AA4A 2XY5A 3MXIA 3KLEA 3L2UA 3C95A 1LAVA 1NK5A 4ID1A 4RW8A 3TAEA 1WSHA 1GOBA 1RBSA 2IOCA 3QINA 1T03A 1KLMA 2B4JA 1K6YA 3EZ5A 2YHAA 3SV4A 3SUPA 1O1WA 2W42A 3PV8A 1B92A 1XHXA 3E01A 1QTMA 1RNHA 1SKWA 4FJKA 2HVHA 4CGIA 4KB0A 1IO2A 1RT4A 2A1RA 4FXDA 4TSXA 5KRTA 3OY9A 1SKRA 4CEEA 3QIPA 4ELVA 3NE6A 5KGWA 3AO4A 4RW4A 3OYHA 4DTPA 4M3ZA 1FKOA 2B6AA 2DFHA 1J53A 1UAXA 1GOCA 5DMRA 4OPKA 3O4QA 1JLBA 4CHYA 1X1PA 1X9SA 4FK4A 4Q0BA 4FM1A 4DTOA 1JLQA 3KKSA 4CF0A 2PZSA 1IKVA 1RDBA 3NGZA 3RR7A 4FJ7A 1BI4A 3SPZA 3TAMA 4NYNA 3ZSRA 1SL2A 4F3OA 1CXQA 3NHGA 3KJVA 3L2VA 1L3SA 3SV3A 1Z25A 3NH1A 3UIQA 3P5JA 1JL1A 4CJWA 1U47A 3LWMA 3WNGA 4E0DA 4B3OA 1QSSA 3TWHA 3AVAA 2IAJA 3L2QA 3TAFA 3NDKA 2Q3SA 3NAEA 3OYNA 2GV9A 4O44A 1RTDA 3WNEA 3K5NA 2F8SA 4M3UA 1ITGA 3D45A 1ASUA 1Z26A 3HSTB 3EYZA 4KHNA 1VSMA 1GOAA 4M42A 4Z4FA 4FJGA 3V9SA 2HNZA 2QXFA 1J5OA 5CYMA 4MFBA 3OVNA 1EX4A 3ASMA 3DLHA 3AA2A 3HK2A 1S9GA 3KD5E 1BGXT 4Q5VA 4YFUA
chains in the Genus database with same CATH superfamily
1ESVA 1Z05A 3VQCA 4F2SA 2YJFA 4NCGA 4CE9A 3RMAA 3AO5A 4CJKA 1S1XA 4BDYA 3DYAA 3T3FA 4ID5A 3FZMA 2NRXA 3EE9A 1S1WA 3SAGA 5T7BA 2D0BA 5JVGL 3D2FB 3L3VA 3MEDA 1NGAA 3F73A 1NK6A 1TL3A 1T44A 4CK3A 3CJAA 2A41A 4MQ3A 1RT2A 4CJ5A 5DM7L 1N34K 3D2EB 3H46O 3AVKA 3O08A 3S9HA 4BROA 4OGEA 4HUEA 1NKBA 4KPYA 3BGRA 1QQNA 4AHTA 2O8DA 3K9KA 3ZSXA 3ZETB 4G9ZA 3THXB 2O8CA 4IJAA 3VQQA 1WAJA 4FVUA 3SAHA 3RTVA 3QESA 1IKXA 2UXDK 3TSQA 3BUZB 3WXJA 4M7YA 3WEEA 1HYZA 4ISFA 1LCUA 3M1FA 4Z4IA 4CHOA 3AVMA 4C23A 4KRFA 2KZMA 1LWCA 4JD2A 3OYLA 3VF6A 1QQOA 4CEOA 3HVRA 1VSFA 3OYCA 3EY1A 3G4SN 4LSLA 2OA8A 2YNIA 3O9QA 4KTWA 1ZBFA 4KREA 4CK1A 4X64K 2F9WA 3HM9A 2Y1JA 2GTDA 1NLVA 3QEIA 2HF4A 4H0PA 1BQMA 2IIRA 3F9MA 3KLIA 3P31A 3KLFA 4CBUA 4E3SA 1LW0A 4I2QA 3UKRB 5KPTA 3ULEB 4EFHA 4CZMA 1WNSA 3LDLA 4J8FA 3O1WA 3A5MC 3UKUA 3CI5A 4WE1A 2PYLA 3G71N 3QICA 3FZLA 2FC0A 1KVBA 1EXQA 3KIOA 4GW6A 4E7JA 1D9FA 4FL9A 3WT0A 3ZT4A 4PKGA 4BC2A 3GL1A 1C6VA 3SUNA 4KHYA 4ELTA 3I33A 2E2QA 2QA4N 5HLFA 3CCUN 3ZSOA 1Q81O 2A1SA 3V9XA 1WLJA 1RBTA 1XWLA 2BANA 3VQ5A 2KKZA 2RHKA 3OW2M 4IOCL 3H6EA 3VEYA 4C1NI 4B08A 3OHRA 2VYPA 4UY8O 3W0LA 5BR9A 4E1JA 2YNGA 4FYDA 3SPYA 4CZKA 1DEJA 5M1QA 3UKUB 3RRGA 2HSTA 4K25A 4V19S 2HB5A 3CFPA 4KO0A 1BL3A 3MEEA 4YORA 4BRDA 3IAYA 5HL7L 4LY7A 4PKIA 1MA9B 3ULEA 4DQRA 3C65A 1NMNA 4FLUA 1EETA 4OVLA 3T1AA 4EHTA 3LZJA 4HUGA 2F96A 3K5MA 4DR3K 3TARA 1HPMA 3CF5L 3ZCMA 5J2NA 4CEBA 4BE0A 3V1QA 1YTAA 2QWOA 3C6HA 2W41A 2I7NA 4YHHK 2XY6A 4IEEA 3TI0A 4MO5A 3ULDA 4CZGA 3K5LA 4BRPA 1OVYA 4WFNL 1WAFA 3NF7A 4OKKA 5IWAK 4RG8A 5AQXA 1NGIA 5BN9A 4J2BA 3VA3A 2JLEA 4IO8A 5LJVA 5HROA 1J5EK 4X62K 3CPEA 3ZX2A 5BPNA 4RW6A 1RBVA 4QOZB 4BDZA 4LFCK 1KLNA 3CERA 3OYBA 5J2QA 2HBMA 2P9NB 2Z1JA 4FO0A 3ZETA 2EHGA 4PL7A 3TR8A 4FJHA 4DFMA 2Y1IA 3AVGA 1S3XA 5HRSA 4LSNA 1S9EA 3CJCA 2RKIA 3CPWM 3OYEA 3N4PA 3D2EA 5KRSA 4GVMA 4NXMK 4LF8K 3P39A 3TTCA 3WXMB 3ATUA 1BHLA 3IS9A 2W40A 4FJXA 3ZSYA 3JYTA 3L2WA 1CZBA 1GLBG 4O0JA 5AZJA 1UWBA 5FROA 1L3TA 1NOZA 4DS5A 4DHYA 4BR4A 2OPPA 4JK8A 3CMAN 4XH1A 4B1XB 2FF6A 2PFUA 1TK5A 3VQ6A 4CERA 3WUHA 5C0YA 4FK2A 1OH8A 2Q97A 3B6PA 3L0QA 1YVNA 2VQEK 5C15A 1V4TA 1NK7A 3C6UA 4FLZA 1NJIO 3V1OA 2DFEA 3NF9A 3L6QA 3SBTA 5KGXA 5J2MA 1VQ4N 5EVZA 3PY8A 4KI6A 3WXIA 4DV6K 2I7PA 3WNFA 3NVMA 5AQTA 1Q9XA 2ASOA 4O55A 1TL1A 3M8PA 4J2EA 1XC3A 3ID8A 4CD3A 4N41A 2BE2A 4FLTA 4K8ZA 2Z1GA 1JXBA 3K2PA 4C8MA 4PHTX 3V81A 2VWKA 3O80A 5I42A 4DG1A 5MLCQ 1VQ8N 4H5RA 3LZIA 3CXCM 2O8EA 4CEAA 4CGHA 4CI6A 4GNIA 3HO1A 4CJPA 3THWA 2KZZA 2VGMA 4CIGA 1L3UA 1BIUA 1T8EA 3HI0A 1ZYQA 1NWKA 4Z4CA 3AVFA 4CHQA 4CEQA 4GV9A 4A2AA 3CCMN 4CZEA 3VEOA 5HRPA 3PX4A 4B1VA 3DRSA 3KK2A 1MWKA 3CHWA 3QEWA 1NJXA 5LY3A 3SJHA 1HNZK 5LL6Z 4YOUA 4CHNA 3AY9A 4DV3K 3SQ2A 4CESA 1D8YA 1KFDA 4YY3K 2QTDA 4IJNA 4FPBA 5LJWA 4WQ4C 4A5AA 5BPMA 1HPZA 2UXBK 2OZSA 4JKBA 4E7LA 1S6QA 5GIOA 1SAZA 1L3VA 1C1BA 4MDBA 4IFVA 4FWLA 2IC3A 5C2FA 3O1BA 3KLEA 4BC5A 1NK5A 4ID1A 4BR5A 1GOBA 1RBSA 1KLMA 2B4JA 2YHAA 3SUPA 1QZ5A 3FZFA 1BDGA 1RNHA 3B8AX 4KB0A 4B3MK 3IKMA 2W6KA 3H45C 1TYQA 5KRTA 2P9SA 3QIPA 3OYHA 4LF6K 4JV5K 3O4QA 4Q0BA 3ID6A 4FM1A 2ZJRL 4DTOA 4H03B 4CF0A 1JLQA 4FJ7A 2WFBA 1BI4A 2QWQA 1P8ZA 4K41A 4F3OA 1CXQA 3KJVA 2YHXA 3L2VA 3LM2A 2VGNA 3WQUA 3WNGA 4H5VA 3AVAA 3NDKA 3KZBA 2A3ZA 3OYNA 4O44A 4M3UA 3MWTA 3HSTB 1VSMA 1OH6A 2H3GX 3V9SA 1NGBA 4BQLA 3PSFA 1EX4A 3DLHA 5AZJB 3EKUA 4Q5VA 4YFUA 4CEDA 4JS4A 2VQFK 5C25A 1KSPA 2NRZA 4M3XA 4CJSA 5KQ8A 1C0GA 2WC9A 2UUAK 2HHVA 4CECA 3O9TA 4AHRA 4DR1K 3KWIA 2GWJA 5M1KA 2HW3A 4ILJA 1VSEA 3RRHA 2QEXN 1YXQA 2F4VK 1BOTO 1JLCA 3I0SA 4FCYA 1LWEA 2OANA 1VQ6N 4DMNA 2NRWA 3DRRA 4AQYK 1JLFA 3CJ1A 3LDSA 4DV0K 3SQ0A 4ZTJA 2FSJA 1WSEA 1WB9A 3AVNA 5AQPA 5J2PA 4JK7A 4OKJA 4DTJA 4M3TA 4OPJA 3LPUA 4G1QA 5LMNK 1SKSA 4NLBA 3U3YA 2ZF5O 2ZGYA 4CHPA 4DTSA 4Y0WA 4JHDB 4KI4A 1BIZA 1CLQA 3OJSA 2Z1IA 3CC7N 3TPQA 3A8YA 5EX5A 3UB5A 4FLYA 5JS1A 4OKEA 3VQ8A 4YDUC 3AVCA 4GV3A 4I9LA 4DQSA 3VEXA 4H0VB 3OBWA 1U2VA 2J4RA 4I6MA 2ZJQL 3H1VX 1E3MA 4CBWA 4FJJA 3CJ9A 5ADXH 2OPRA 1VSJA 4K42A 1XNRK 5F2RA 5FRMA 2JWLA 2P9LB 2YI1A 4CZLA 3A5LC 4PUOA 1JKHA 3QLHA 1OH5A 3O4WA 1RGIA 1LWFA 4JKAA 1DTQA 3E1YA 4WQ5A 3HRGA 2E6LA 3HXMA 3SCXA 1WSJA 4O0IA 1A5VA 2Q36A 4DQPA 4JI3K 5AQYA 2O8FA 5CYQA 1SS6A 3V1RA 5BR8K 2VWJA 2YX6A 3C7NB 3CYMA 4CD1A 3U4LA 1N32K 2XO7A 3QETA 4EZ9A 4YOTA 1A5XA 4LF9K 3VTHA 1LV5A 4LF7K 2PYJA 3OYJA 3RMDA 3MN7A 5AQUA 2BGGA 3D6RA 3BF3A 3C94A 1BI4B 4BY9C 3ZSZA 4CF8A 1J6ZA 3IDHA 3NMUA 3ZEUB 4E19A 4YOWA 3D0PA 2XY8A 1KVCA 3U3GA 3NVKA 1LOTB 1IG8A 5AQGA 4CJ3A 2HBJA 2QWRA 3JXUA 1HLUA 3QFPA 1ZBLA 3GDQA 4FJNA 4KTQA 3S3OA 1RCHA 3C6AA 4HVJA 4PA1A 5F0XA 3HYFA 2VWBA 4IFYA 3SUOA 4KHUA 1K9MO 4IBNA 4FOIA 3ZX3A 4B3SK 3S3MA 1BCMA 1U48A 3O3GA 4DV2K 5BPLA 1WSGA 5AQJA 4CJQA 1I94K 3FZKA 3TABA 2Z1HA 1P90A 3DRPA 3P38A 2ZGZA 1VSHA 2DTUA 1HMVA 2NRVA 1NGJA 5DM6L 3AO1A 1X9MA 4JI5K 1TKDA 4H0OA 1TV6A 4AHVA 4B9QA 3VGMA 3THVA 3O6WA 2ZQBA 3LDNA 3DLGA 1TUYA 4BR2A 5HOOA 3SK3A 1TAUA 1RBUA 2PBDA 4E7IA 1RILA 1HKBA 2UYTA 2KW4A 5AQSA 4CJFA 4DV1K 3DXMB 1G99A 4FOEA 3O3FA 1ASWA 1N8RO 2HHQA 3P83D 4KH4A 1KAXA 4FZYA 2KLAA 2NRHA 4W5TA 5JVHL 4W5OA 1EP4A 4CBXA 4I2PA 1D5AA 3AA3A 4JD2B 4FJ5A 5CZ1A 4OPHA 4PY5A 1HRHA 5F1XA 2VG7A 1WSIA 3BF1A 3KK7A 4R5PA 1M1KO 4DLGA 3PUFA 1DLOA 1RBRA 1JCEA 4DR7K 3GG4A 3CG7A 4DCHA 1MU2A 1NNEA 3THWB 3HP9A 1YIJN 3M8SA 2HBKA 1M90O 1KAYA 2HF3A 3TAGA 4N47A 3VF2A 1W0HA 4FK0A 2P9PB 4QS7A 3NF8A 2E4LA 1RDUA 4FJ8A 1IH7A 4BRNA 3DLRA 2GBZA 3LPTA 4B9MA 2FBVA 1MWMA 4B9NA 3KKRA 4WCEL 3WNHA 3GOIA 3LP1A 2P5GA 3OTOK 3B6OA 1EWQA 3FR0A 1DT9A 3NGYA 4DV7K 1FK9A 4KHWA 4J2AA 2JWKA 2ZD1A 5A2QO 1RT3A 4N56A 3SZ2A 1VK0A 4M45A 4RW9A 1CXUA 2FLOA 4BWJA 4WF9L 4K43A 5CZ2A 2YNHA 1G15A 3PX6A 3U8XA 1XMOK 2RN2A 3MX2A 4AHCA 2P9PA 4DR4K 3AVBA 1YT3A 1SL0A 1WOQA 4M3WA 4H0YB 5AQFA 3AVIA 3MDQA 5AJ3K 1VSDA 1N5YA 3FGUA 4E89A 3QBXA 3PSIA 2FBXA 1NK0A 2A6AA 2HNDA 2YHBA 4CEFA 2GUPA 2BH1A 3EEQA 3V9UA 3HPHA 5BRHA 1CZ9A 3P1GA 2P9NA 2WTUA 3VERA 2HBLA 3T7ZA 3JAMO 5CR4A 1NBWA 2IVOA 4AM7A 4O4GA 4H8KA 4BRCA 4IEIA 1C0MA 5C24A 2RF2A 2YKNA 4DQQA 1IBKK 5AQHA 4E1NA 5E41A 3NF6A 1K73O 1TUUA 4IO9L 2YV0X 3MAQA 3VQDA 4DUZK 3HPOA 3TTFA 4FJ9A 4FW2A 3ENHA 3QFUA 4I9QA 2FF3B 3W3DA 3PLAA 3ZT2A 3QBWA 4Z94A 1RDAA 4JKGA 3C6TA 4CJTA 5SWMA 4JKEA 4WQ5C 1R0AA 4OPAA 4A62A 3R8EA 3V4IA 2HMPA 4BVPA 4DR5K 5ELZA 3LANA 3O9SA 2HMIA 4GKKK 4AF1A 5BN8A 3OYIA 3ZEUA 3ZSQA 4R79A 1HNVA 4L8RB 4DUYK 4ILHA 1GLCG 4DTUA 4KH5A 4DSFA 4FLVA 2GWKA 2A5XA 3NGIA 1ATSA 3V9WA 1ZC6A 2NNWA 2X6NA 1QHTA 3CD6N 2KHOA 3V6DA 1SZ2A 3ZX0A 3AA4A 4BG9A 3C95A 3TAEA 3ATVA 5M1NA 3SV4A 1K6YA 2Q2RA 1B92A 3E01A 1QTMA 1SKWA 2FSNA 2HVHA 4CGIA 1IV0A 1RT4A 5BREA 1SKRA 5KPZA 3OY9A 4RW4A 5GINA 1Q9YA 1HR0K 1X9SA 4C1NK 3CCSN 3UE5A 3K0SA 4WYBA 3CCJN 4I6MB 3KKSA 2PZSA 3RR7A 3NGZA 4OX9K 1BA1A 3EO3A 1EWRA 3SPZA 1IBMK 3M6GA 3ZSRA 1SL2A 1ZBSA 3UKRA 3RSEB 4ILGB 3NH1A 3UIQA 5B8HA 1U47A 4B3OA 3C0BA 3LWMA 3TWHA 2IAJA 3TAFA 2Q3SA 2P9KA 1ITGA 1Z26A 4KHNA 1ZXOA 4M42A 4BRHA 4FJGA 1U2VB 3ASMA 3KD5E 1VQON 1QQMA 3FLCO 1SUQA 4CF1A 2NZTA 4DQIA 1VQKN 4PKHA 3A5NC 2OYQA 4EZ6A 4KKOA 1JL2A 4OJRA 3H3OB 4A2BA 4DFKA 2FXUA 3SYZA 2CH6A 4UQGA 1SV5A 3AAQA 4NCBA 3MWPA 2G8IA 3SMPA 1HNIA 2O4GA 2XY7A 2HHUA 3OS0A 4DTXA 1NJWA 2WONA 1Y64A 1KC8O 4K0KK 5AQLA 5FLXO 3I0RA 1REVA 4BR0A 5KPRA 3QNOA 3EKSA 2YHWA 3ITHA 4CIEA 1N33K 4U7BA 3ZLJA 1UA1A 4DQ8A 1JJ2M 4CZHA 4DSKA 2E1YA 4CF2A 1S22A 4ISGA 1N6QA 2AA4A 1VSKA 3CFRA 3LP3A 3LM9A 3M8RA 4GMJB 3L8BA 4PQUA 3NH2A 2QWPA 1VQLN 4FVMA 4DF8A 1NKCA 1S6PA 2GELA 3G25A 2EX3A 1BISA 3I55N 2ITGA 4E7KA 1IJJA 4IDKA 4KTZA 3DLBA 4DKWA 5EY4A 1WBDA 4AHUA 3E66A 3TAPA 3IG1A 3O4NA 1HJOA 3MN5A 4B8CA 3DOLA 5C10A 4BACA 1QSYA 4HUFA 4A5BA 4Z4EA 3DWLA 1FXXA 3JSMA 4QCLA 1NG9A 2HNYA 1TYQB 4B1WB 4JI1K 4EP5A 1K8KA 3QMLA 4M63C 4DU4A 4FWMA 3F2KA 4BGAA 1C1CA 4BRGA 4OGCA 1VHXA 3DI6A 4ICLA 1RTIA 3K59A 5KI6A 1ZBHA 5C42A 1JCGA 2P9SB 5JMVA 1YF5L 2KQ2A 2WOMA 4DB3A 4DTRA 3QERA 3S3NA 3GE1A 4RTFD 4KV8A 2RE2A 4BR7A 3E9OA 3HTVA 4CJ4A 1NOYA 5CY4A 4DSJA 4JI2K 3AAPA 4YOYA 4M3YA 3OYMA 2D4WA 1FJGK 1XC9A 4MLHA 1U45A 3LAMA 1YHQN 1ILYA 1J54A 4GVEA 3PIPL 3U9DA 5E84A 2BTFA 3L2RA 4CGDA 3VQ9A 1W9HA 3LAKA 3OA9A 1RT7A 2Q1NA 2OPSA 4IWVA 1W97L 2DY4A 4JI6K 1KAZA 1DTTA 1Q7YO 3DM2A 5HRRA 1WUAA 4JI4K 4OLAA 3BZKA 3T1YK 1VSIA 3HL8A 4BVOA 2Q31A 2HHSA 2QXLA 4ZTFA 3AA5X 4F8RA 1BCOA 4DSIA 1W7AA 5IT9O 4DS4A 5AQIA 1TGOA 3HBTA 3BEXA 2WBNA 1IKYA 3RVCA 4LFBK 2HHXA 1QS4A 3RMCA 3BZCA 3AVLA 4BG8A 2KFNA 4O8UA 4E1MA 2G8FA 2O8EB 4CJVA 4DFJA 3G10A 3O5BA 3OYFA 1MDUB 1HUXA 4NXNK 3SI6A 3LDPA 4KHSA 1HQEA 3KTQA 4O8KA 1S1VA 3SMSA 1X3MA 5JS2A 1X9WA 3ZT0A 1EKEA 4MLEA 4FWSA 3MXJA 2QM1A 4A59A 3CJBA 3LP2A 4QS8A 1K8KB 3ZYYX 1D4XA 2P9UB 4C8KA 2XHBA 3OYDA 2E88A 3QB0A 4FWQA 5ADXA 1QVGM 2KFZA 1YAGA 5GIPA 4X65K 3DOKA 3I8BA 1C0TA 2E2PA 4JI7K 4CCHA 1TKZA 5AZIB 3CIPA 2KTQA 1X3NA 2X6SA 1S1TA 3C7NA 1HNXK 2OTJN 1UA0A 1NGDA 5M1OA 3K9JA 3O3HA 1BO5O 4PL8A 3J7ZO 3MEGA 1QZ6A 3LDQA 3ENOA 1TKXA 3VQ4A 4F4KA 1VRTA 1SL1A 2ETJA 1OKJA 2XRIA 3A2FA 2ASPA 1QHAA 3QEXA 1C1AA 1RT1A 1TKTA 1XHZA 5GAGP 4IZ9A 2I5JA 3AVHA 4OLBA 2NRRA 1OVQA 4JEPA 2OCEA 3WQTA 4JI0K 5TKWA 3Q7BA 3CCLN 3LWLA 4B9TA 2F9TA 1NK8A 3CQYA 2HOEA 4JLHA 1BA0A 3ALYA 1Q8IA 3PO4A 4DV4K 1HKGA 1U4BA 3FZHA 3M5RA 2LSNA 1RDWX 3F9KA 4FJMA 1VQMN 4B1ZA 3QIOA 4FZXC 2BUPA 1JXEA 4IKFA 2IVPA 1D9DA 4BC4A 3LALA 5I3UA 2P9KB 5E26A 1T7PA 4LD0A 5KTQA 3OS2A 3OS1A 4BRFA 3MECA 3NH0A 4H4MA 2O4IA 3HM8A 1NJZA 4H5WA 1W2BM 3O9UA 4LF5K 3KD1E 3VA0A 1B9FA 3R9PA 5EU7A 4Z4GA 3AO3A 3VN5A 1GLDG 3RSEA 3VQ7A 3KK3A 2IVNA 3Q7CA 3F5TA 2PY5A 4W5RA 4JKDA 4IOAL 2YKMA 3M3ZA 5FPEA 2E5LK 2GEMA 3EN9A 4FPAA 2CGLA 3CCQN 2G8UA 2ZWHA 2E6MA 4B1YB 4N76A 4B8AB 4YNQA 3KLHA 2D1KA 4FW1A 3DLKA 4BGBA 1S1UA 4CJ7A 1O13A 3G0ZA 4DTMA 1RT6A 1SQKA 3N4QA 1WBBA 1HKCA 4C8NA 3DMJA 5C2DA 3DAWA 4DTNA 3WXLA 3I56N 5H1SQ 4FM2A 4Y1DA 3RR8A 2G8VA 5KQDA 4DSEA 3JS6A 4F2RA 3J81O 3AGRA 4AILC 2NUBA 1HNWK 4FJLA 2F8TA 4HCBA 2Q0UA 4JKGB 2GX9A 4CFDA 4J2DA 2GUIA 2P5OA 1KXPA 1HQUA 4IG3A 4B9SA 2CGJA 3O8MA 4C8OA 2XY5A 3MXIA 5CE3A 2YJEA 3MK6A 4RW8A 1WSHA 2IOCA 1T03A 1Q82O 3EZ5A 1O1WA 2W42A 3PV8A 1GLEG 1XHXA 4FJKA 1NU0A 1IO2A 1NGEA 4TSXA 3NE6A 3AO4A 4DTPA 1FKOA 2DFHA 1GOCA 1JLBA 2QWLA 3AARA 1KD1O 3D7EO 3EL2A 3DJCA 1IKVA 1RDBA 4EAHD 3L4IA 4BRMA 3NHGA 1L3SA 3WEEB 3SV3A 3SBGA 3VMFB 4CJWA 4H5NA 2F8SA 1RTDA 3K5NA 3EYZA 1YJ9N 1GOAA 2V7YA 2PAVA 2HNZA 2QXFA 4DR2K 3H1QA 5CYMA 4MFBA 4B1UB 3OVNA 3HK2A 2O8DB 3AA2A 1S72N 1S9GA 3E9LA 1BGXT 4IFEA 1ATNA 1K8AO 1GLAG 1Q18A 2HHWA 4RWTA 1YUWA 4H4OA 3VF4A 4QS9A 3RWUA 4WQ4A 1XUPO 3MCAB 4JNEA 2IGIA 2QKKA 2NLXA 3VENA 1FKPA 5HRNA 4KH6A 4ZHRA 3WXKA 4HTUA 1E4GT 4M41A 3OYGA 5GADP 3D2FA 1NK4A 3J7AP 4BQZA 1TAQA 3P4IA 2B5JA 4BRLA 5GAEP 1RFQA 1FW6A 1RTJA 3CQXA 3VQAA 4I7FA 2FBYA 5FPDA 1VQ7N 2NRTA 3FFKB 5AQNA 3TU5A 1XNQK 4AH9A 4MDAA 1DGKN 3SQ1A 4RCHA 1VRUA 1KQSM 1RDDA 1X9JA 3KLGA 3ISNC 4GY2B 4QAGA 4JKCA 4A61A 1I39A 2HHHK 1EQYA 2HHTA 2YHYA 3J8AA 5AQWA 4CJUA 4B9UA 3OYKA 4ELUA 4DLEA 4KFBA 2OTLN 3THYB 4JRPA 4NYFA 5AQQA 4KHPK 3MX5A 3QO9A 4XH4A 3VOVA 4IOXA 3VEWA 3T1HK 2YCHA 1ZBUA 4E7HA 1VQPN 1YI2N 3QDKA 1JLAA 4F9OA 3FE1A 3IRXA 3PIOL 4BRIA 3TANA 2FBTA 2O8BB 1ASVA 1U49A 3CC4N 1H1VA 3BY5A 4GKJK 2ITMA 5M1FA 2E2OA 5FRNA 3HPGA 4IG0A 3CCEN 3HSCA 5BRFA 1V4SA 4CGFA 1JLGA 3QEVA 3HJFA 4LH5A 2D0OA 1F21A 4LC9B 1U04A 3DXMA 4HCCA 1S5JA 4KB1A 3I8DA 1RTHA 4H0XB 4NLCA 5J1EA 1XI1A 3T69A 3TSPA 5SZTA 2WUSA 3J80O 1QE1A 3EZWA 3CQ8A 2X74A 4XH5A 1B9DA 1EO1A 5CHIA 4BRQA 4BDPA 3R3LA 3ENBA 4L3QA 1T05A 3T19A 4HHTA 4H5TA 1NK9A 1E4FT 4YOXA 2D0CA 1Y97A 4BE2A 2YNFA 5JLFA 5DK5A 1QQCA 3R1XA 3CETA 4B9VA 3A5OC 4DU3A 4BR9A 2UXCK 1R59O 2ATQA 5LMUK 4DWIA 1VQ5N 4M3RA 1VQ9N 1HYVA 2RPIA 4Z4HA 4EP4A 3J7YP 1ATRA 1TK8A 2W6LA 3U6FA 1C0UA 3VQEA 2OPQA 3MXMA 3AO2A 1TVRA 1YITN 3VQBA 4CGGA 4CEZA 4CFAA 4W5QA 5AQVA 5HBMA 4CZFA 2QW9A 5K14A 3MMVA 4CHZA 3K5OA 4H0TB 3IFRA 1IBLK 1OH7A 3DLEA 3VGLA 3M8QA 3L3UA 3HT3A 2FSKA 2ZM6K 4CK2A 3U9ZA 5AQRA 5FPMA 1YVUA 3SNNA 2AP1A 3SJJA 2QK9A 5FPNA 1GLJO 1KFSA 1LAWA 4JRQA 4FWRA 2D5RA 3KHYA 1IG9A 3AGKA 4NCAA 4FWKA 5AR0A 1YTUA 1NKEA 2O8FB 4LH4A 3PX0A 3CM6A 3O9RA 1RT5A 3GBTA 2QKBA 5JLHA 1VAZA 4DU1A 4CVNE 3VTIA 2F7TA 4O5FA 3PO5A 3E9PA 1GLFO 1VQNN 1IKWA 1KCFA 3OBYA 1QSLA 4FLWA 3VEZA 3OJUA 4FWOA 2P9IB 2DFFA 2IS3A 2IDOA 1Q86O 3CFOA 2Q0RA 1U6ZA 2P9LA 4BWMA 1XMQK 3FFIA 5FDLA 1NGHA 3CM5A 4CGJA 3CMEN 4JHDA 3G6EN 3DXKA 3KWGA 4B3RK 5EOYA 3K57A 3AV9A 4JI8K 2A40A 1ZBIA 4JAXA 1HX1A 4CW7B 4KAZA 1J9AA 4FLXA 1UOCA 2G8HA 3SQ4A 3HZ6A 2DPNA 5I9EB 3LL3A 4JKFA 2P1JA 1KTQA 1NJYA 3HP6A 1NMDA 1T3VA 1L5UA 1YJWN 2HVIA 5TKYA 3VETA 1RDCA 1C0FA 2E1ZA 2VG5A 2P9IA 2G8KA 3DXKB 4F3TA 1NGFA 2ASMA 3TTDA 1YJNN 4OO1J 2VG6A 1T6DA 3L4QA 3CJ7A 4Y1CA 3SUQA 4M7XA 4DR6K 3THXA 4DSLA 2O8CB 1HYSA 3DLLL 3HVTA 4FJIA 3VGKA 4PWDA 3NBPA 2ZJPL 3NCIA 3ZT1A 3CC2N 2E8AA 4GV6A 1BUPA 4KBOA 5AQOA 4BE1A 3V9ZA 4KHQA 2CH5A 4MO4A 1HJRA 3ZT3A 3RMBA 5EXWA 4AHSA 3HOSA 1T6CA 3CCRN 2ZE2A 1WN7A 4JKHA 2JGUA 5HP1A 1WSFA 3BDPA 3KK1A 2CGKA 3QNNA 3TAQA 1TK0A 2QI2A 4CJEA 1GLLO 3AVJA 4FM0A 2QWNA 1I3AA 4CJLA 2OZMA 4WFAL 2D0AA 4IDHA 5AFUA 2R7YA 4O5BA 4LF4K 4FWNA 1KVAA 4EIAA 5GAHP 3MN9A 2V51B 4U67L 5AZIA 3QEPA 2P9UA 1BU6O 4JS5A 4CF9A 3LP0A 2A42A 2P51A 4N5SA 3CCVN 4B3TK 2V7ZA 1KRPA 4EHUA 1BQNA 5D3GA 2EWSA 2BDPA 4C8LA 1VSLA 3K58A 2V52B 4BC3A 4BRKA 4YDUA 3HOTA 4XEIA 3IUCA 4CFCA 4DFPA 4K8XA 4B9LA 2E20A 4DF4A 4YOVA 5JICA 4W5NA 4FSVA 4CIFA 5AQZA 2AJQA 4CFBA 3TSUA 4WFBL 4JYAK 4CZJA 3SAFA 4Z0UA 2X78A 4BRAA 2UUBK 4XIUA 1BWFO 3ZSWA 4BREA 1Z6RA 3MN6A 3OYAA 3ZSVA 1LW2A 3H08A 4X66K 4AM6A 4FZZA 3NFAA 4HTLA 3VQPA 5C12A 1JCFA 5AQMA 4DV5K 3H3NO 4JK9A 2G8WA 1BG3A 4RW7A 2UUCK 3MCPA 1JLEA 1DKGD 4CJRA 4JN4A 1A5WA 5AQKA 4NB4A 3L2UA 1LAVA 3IMXA 3BP8A 5M1PA 3QINA 2O8BA 1N36K 1NGCA 2D0PA 3S41A 3VPZA 2UU9K 4HWIA 2A1RA 4FXDA 4CEEA 4CZIA 4ELVA 5KGWA 3R6MA 4M3ZA 3VESA 2B6AA 4NO7A 1J53A 1UAXA 3LDOA 5DMRA 4OPKA 4CHYA 4FK4A 3VEVA 1X1PA 2E2NA 2VCPA 4A57A 5BRDA 4FWPA 5AFUH 3TAMA 4NYNA 2QWMA 1CZAN 1XQSC 1QVFM 1Z25A 3P5JA 1JL1A 4ISEA 4E0DA 3EE8A 1QSSA 1NM1A 3L2QA 3NAEA 2GV9A 3WNEA 3D45A 1ASUA 3KVGA 4Z4FA 1NGGA 1J5OA 3A0IX 4LFAK 3THYA 3SLCA 4IXCA
chains in the Genus database with same CATH topology
2HHWA 1SUQA 4CEDA 4JS4A 4CF1A 3VQCA 4DQIA 4H4OA 5C25A 1KSPA 4F2SA 3RWUA 4M3XA 3RMAA 4NCGA 4CE9A 4CJSA 3AO5A 2OYQA 4EZ6A 4KKOA 1JL2A 4CJKA 4OJRA 4CECA 1S1XA 4BDYA 3DYAA 2IGIA 3SYZA 4AHRA 3T3FA 4DFKA 4UQGA 1FKPA 4ID5A 5HRNA 2QKKA 1SV5A 4NCBA 2G8IA 2HW3A 4ZHRA 1HNIA 2O4GA 1S1WA 1VSEA 3RRHA 2XY7A 4HTUA 2HHUA 3OS0A 4M41A 4DTXA 2WONA 5T7BA 3OYGA 1NJWA 1JLCA 3I0SA 3I0RA 1LWEA 1REVA 2D0BA 4FCYA 1NK4A 3QNOA 4DMNA 3L3VA 3ITHA 4CIEA 1TAQA 3MEDA 3DRRA 2B5JA 1UA1A 3F73A 1NK6A 1JLFA 1TL3A 4DSKA 4CK3A 4MQ3A 4CJ5A 1RTJA 1RT2A 4CF2A 3LDSA 3VQAA 4I7FA 3SQ0A 4ZTJA 1N6QA 3AVKA 3S9HA 1WSEA 1VSKA 3CFRA 2FBYA 3LP3A 3M8RA 3AVNA 4OGEA 4HUEA 5J2PA 1NKBA 4KPYA 4GMJB 4OKJA 3BGRA 3L8BA 4OPJA 4DTJA 3LPUA 4G1QA 4AHTA 4AH9A 3NH2A 4M3TA 1SKSA 4FVMA 4DF8A 1NKCA 3U3YA 1S6PA 3SQ1A 4CHPA 4DTSA 1VRUA 3ZSXA 4KI4A 1RDDA 1BIZA 2EX3A 3KLGA 3ISNC 1CLQA 1BISA 3OJSA 2ITGA 2Z1IA 4E7KA 3VQQA 1WAJA 4QAGA 4IDKA 4KTZA 3RTVA 3DLBA 3QESA 1I39A 1IKXA 4AHUA 2HHTA 4FLYA 4CJUA 5JS1A 4OKEA 3VQ8A 3TAPA 4B9UA 3AVCA 3OYKA 3IG1A 1HYZA 4ELUA 4DLEA 4I9LA 3O4NA 4KFBA 4JRPA 4DQSA 4NYFA 4Z4IA 4B8CA 3DOLA 4CHOA 4BACA 1QSYA 4HUFA 3AVMA 4Z4EA 4KRFA 2KZMA 1LWCA 3QO9A 1FXXA 4FJJA 3JSMA 3OYLA 2OPRA 1VSJA 4QCLA 2HNYA 4CEOA 5FRMA 3HVRA 1ZBUA 4E7HA 1VSFA 3OYCA 3EY1A 1Q9YA 4EP5A 4PUOA 4LSLA 2OA8A 1JLAA 2YNIA 1JKHA 3QLHA 1LWFA 4DU4A 1DTQA 4KTWA 1ZBFA 3HXMA 2E6LA 3IRXA 3SCXA 4CK1A 1WSJA 4O0IA 1A5VA 4DQPA 4KREA 1C1CA 3TANA 5CYQA 3HM9A 4OGCA 2Y1JA 2FBTA 3V1RA 2VWJA 3QEIA 1ASVA 3DI6A 1U49A 4ICLA 1RTIA 3CYMA 3K59A 1BQMA 5KI6A 1ZBHA 2XO7A 3QETA 4EZ9A 5FRNA 3KLIA 5C42A 3HPGA 1A5XA 4IG0A 3KLFA 4E3SA 1LV5A 2PYJA 2KQ2A 2WOMA 3OYJA 4DTRA 1LW0A 4I2QA 3RMDA 3QERA 2BGGA 4CGFA 3S3NA 3C94A 1BI4B 1JLGA 3QEVA 3HJFA 4LH5A 3ZSZA 4KV8A 1F21A 4CF8A 1U04A 4HCCA 4KB1A 1S5JA 3I8DA 1RTHA 1WNSA 4E19A 4CJ4A 1NOYA 3D0PA 5J1EA 5CY4A 2XY8A 1XI1A 1KVCA 3U3GA 4DSJA 5SZTA 1QE1A 4CJ3A 3CQ8A 4WE1A 1ZBLA 4M3YA 2X74A 3OYMA 2PYLA 1B9DA 1XC9A 4BDPA 4FJNA 4KTQA 3S3OA 1RCHA 4HVJA 4PA1A 3LAMA 1U45A 2FC0A 1KVBA 1T05A 3T19A 1J54A 3HYFA 1EXQA 4HHTA 4IFYA 3SUOA 3KIOA 4KHUA 4GW6A 4IBNA 1NK9A 3L2RA 4E7JA 2D0CA 1Y97A 3ZT4A 1D9FA 4CGDA 3VQ9A 3S3MA 1C6VA 1W9HA 3LAKA 2YNFA 4BE2A 3SUNA 1BCMA 5DK5A 1QQCA 1RT7A 1U48A 4KHYA 4ELTA 2OPSA 4B9VA 3O3GA 2DY4A 1WSGA 1DTTA 4CJQA 4DU3A 3DM2A 3TABA 2Z1HA 5HRRA 5HLFA 3DRPA 2ATQA 3ZSOA 1VSHA 2DTUA 4DWIA 2A1SA 1HMVA 3V9XA 1WLJA 3AO1A 1RBTA 1XWLA 2BANA 4M3RA 3VQ5A 1X9MA 1TKDA 4OLAA 1HYVA 2RPIA 4Z4HA 4EP4A 1TV6A 4AHVA 1VSIA 3HL8A 1TK8A 4B08A 3U6FA 3THVA 1C0UA 3VQEA 2OPQA 2ZQBA 3MXMA 2HHSA 4ZTFA 3AO2A 1TVRA 3DLGA 3AA5X 2YNGA 3VQBA 1BCOA 4CGGA 4CEZA 3SPYA 4F8RA 4FYDA 4DSIA 1TAUA 4CFAA 4W5QA 1RBUA 3RRGA 4E7IA 4DS4A 1RILA 5HBMA 2HB5A 3CFPA 1TGOA 1BL3A 3MEEA 4KO0A 3IAYA 5K14A 2KW4A 4CJFA 4CHZA 1IKYA 3K5OA 2HHXA 4LY7A 3O3FA 1ASWA 3DLEA 3M8QA 3L3UA 1QS4A 3HT3A 4DQRA 3RMCA 3AVLA 4CK2A 2KFNA 2HHQA 4E1MA 2G8FA 4FLUA 1EETA 4OVLA 3T1AA 3SNNA 1YVUA 3P83D 4PQUA 4CJVA 3LZJA 3G10A 2F96A 4HUGA 4DFJA 3OYFA 3K5MA 3SJJA 4FZYA 2QK9A 4W5TA 3TARA 4W5OA 1KFSA 1LAWA 3ZCMA 5J2NA 1EP4A 4CEBA 4JRQA 4BE0A 2D5RA 3V1QA 1IG9A 3SI6A 1YTAA 4I2PA 4KHSA 1HQEA 1D5AA 3AA3A 3KTQA 4FJ5A 1S1VA 5CZ1A 4NCAA 1YTUA 5JS2A 1X9WA 4PY5A 3ZT0A 1NKEA 1HRHA 4LH4A 1EKEA 3PX0A 3MXJA 2VG7A 1WSIA 3LP2A 2XY6A 3TI0A 3CM6A 3ULDA 1RT5A 4R5PA 4DLGA 3PUFA 1DLOA 3K5LA 2QKBA 1RBRA 4DU1A 4C8KA 1WAFA 3NF7A 2XHBA 4OKKA 3OYDA 3CG7A 1MU2A 3PO5A 4RG8A 2KFZA 3HP9A 3M8SA 4J2BA 3VA3A 1IKWA 1KCFA 2JLEA 5HROA 1QSLA 4FLWA 3OJUA 3TAGA 4N47A 3DOKA 4RW6A 2DFFA 1RBVA 1C0TA 1W0HA 2IS3A 4QOZB 4FK0A 4BDZA 2IDOA 3CFOA 4CCHA 3NF8A 1TKZA 2E4LA 1KLNA 4BWMA 3OYBA 4FJ8A 1IH7A 3FFIA 5J2QA 2KTQA 5FDLA 3DLRA 2HHVA 2X6SA 1S1TA 3CM5A 2GBZA 4CGJA 3LPTA 4B9MA 2Z1JA 2FBVA 1UA0A 2EHGA 3TR8A 4FJHA 4DFMA 4B9NA 3KKRA 3K57A 2Y1IA 3O3HA 3AV9A 3AVGA 3WNHA 3LP1A 2P5GA 3MEGA 5HRSA 4LSNA 1ZBIA 1S9EA 4KAZA 1TKXA 1J9AA 3B6OA 3VQ4A 2RKIA 4F4KA 1VRTA 4FLXA 3NGYA 1UOCA 2ETJA 1SL1A 2G8HA 2XRIA 3A2FA 3SQ4A 3OYEA 1FK9A 5KRSA 3QEXA 1C1AA 1RT1A 1KTQA 1TKTA 2P1JA 4GVMA 1XHZA 1NJYA 3HP6A 4KHWA 1BHLA 2I5JA 3AVHA 4OLBA 1L5UA 4J2AA 2HVIA 2ZD1A 3IS9A 1RDCA 4FJXA 1RT3A 3ZSYA 4N56A 2VG5A 3JYTA 3SZ2A 1VK0A 4M45A 3L2WA 1CZBA 4O0JA 2G8KA 1UWBA 4RW9A 5FROA 1CXUA 1NOZA 3LWLA 1L3TA 4B9TA 4F3TA 4BWJA 1NK8A 2VG6A 4DS5A 2OPPA 5CZ2A 2YNHA 4Y1CA 3SUQA 1G15A 3PX6A 4DSLA 1HYSA 4JLHA 4FJIA 3HVTA 1TK5A 2RN2A 3VQ6A 4CERA 4PWDA 3NBPA 3ALYA 1Q8IA 3PO4A 4AHCA 3NCIA 3ZT1A 4FK2A 1U4BA 2LSNA 3B6PA 3F9KA 3AVBA 4FJMA 3QIOA 4BE1A 3V9ZA 4FZXC 4KHQA 3ZT3A 1HJRA 1YT3A 1NK7A 3C6UA 4FLZA 3RMBA 1SL0A 1JXEA 3V1OA 4IKFA 4M3WA 2DFEA 3NF9A 4AHSA 1D9DA 2ZE2A 3AVIA 1WN7A 3LALA 1VSDA 5I3UA 1N5YA 5KGXA 5J2MA 3PY8A 4KI6A 2JGUA 5HP1A 1WSFA 1T7PA 4LD0A 5KTQA 3OS2A 4E89A 3BDPA 3KK1A 3OS1A 3WNFA 2FBXA 3QNNA 1Q9XA 3MECA 3NH0A 3TAQA 1TK0A 2HNDA 2YHBA 4H4MA 1NK0A 2O4IA 4O55A 1TL1A 1NJZA 4CJEA 4CEFA 3AVJA 4FM0A 1I3AA 3M8PA 3V9UA 3HPHA 4CJLA 1CZ9A 2OZMA 3KD1E 4J2EA 3P1GA 2D0AA 4N41A 3VA0A 2R7YA 4O5BA 1B9FA 2BE2A 4FLTA 4K8ZA 1KVAA 5EU7A 2Z1GA 3QEPA 1JXBA 3K2PA 4Z4GA 4C8MA 3V81A 3AO3A 3VN5A 2VWKA 4CF9A 4O4GA 4JS5A 4H8KA 5I42A 4DG1A 3LP0A 1C0MA 5C24A 4N5SA 2P51A 2RF2A 3VQ7A 2YKNA 3KK3A 3LZIA 1KRPA 4DQQA 4CEAA 4CGHA 1BQNA 5D3GA 4E1NA 3HO1A 2PY5A 5E41A 2BDPA 3NF6A 4C8LA 4CJPA 4W5RA 1VSLA 3K58A 2KZZA 2YV0X 2YKMA 3VQDA 4CIGA 3MAQA 3HPOA 1L3UA 4FJ9A 4FW2A 1BIUA 1T8EA 4DFPA 4CFCA 2G8UA 1ZYQA 4I9QA 4Z4CA 2E6MA 4K8XA 4B9LA 3AVFA 4CHQA 4DF4A 4N76A 4CEQA 4B8AB 4W5NA 4YNQA 3ZT2A 3KLHA 4FW1A 3DLKA 1S1UA 1RDAA 4CIFA 3C6TA 3G0ZA 4CJTA 5HRPA 5SWMA 3PX4A 4DTMA 1RT6A 3DRSA 3KK2A 1R0AA 2AJQA 4CFBA 4C8NA 3DMJA 3QEWA 1NJXA 4Z0UA 4DTNA 3V4IA 2X78A 4XIUA 4FM2A 4CHNA 4Y1DA 3RR8A 2G8VA 3ZSWA 3LANA 3OYAA 4DSEA 3SQ2A 3ZSVA 2HMIA 4F2RA 1LW2A 4AILC 2NUBA 3H08A 4CESA 3ZSQA 1KFDA 3OYIA 1D8YA 1HNVA 4L8RB 4FZZA 3NFAA 4FJLA 4DTUA 4HCBA 3VQPA 2F8TA 4DSFA 4FLVA 4CFDA 1HPZA 2G8WA 3NGIA 4J2DA 2OZSA 4RW7A 2GUIA 3V9WA 2P5OA 1JLEA 4E7LA 1S6QA 2X6NA 1L3VA 1HQUA 1QHTA 4CJRA 1A5WA 1C1BA 4IFVA 4IG3A 4B9SA 3V6DA 2IC3A 4C8OA 3AA4A 2XY5A 3MXIA 3KLEA 3L2UA 3C95A 1LAVA 1NK5A 4ID1A 4RW8A 3TAEA 1WSHA 1GOBA 1RBSA 2IOCA 3QINA 1T03A 1KLMA 2B4JA 1K6YA 3EZ5A 2YHAA 3SV4A 3SUPA 1O1WA 2W42A 3PV8A 1B92A 1XHXA 3E01A 1QTMA 1RNHA 1SKWA 4FJKA 2HVHA 4CGIA 4KB0A 1IO2A 1RT4A 2A1RA 4FXDA 4TSXA 5KRTA 3OY9A 1SKRA 4CEEA 3QIPA 4ELVA 3NE6A 5KGWA 3AO4A 4RW4A 3OYHA 4DTPA 4M3ZA 1FKOA 2B6AA 2DFHA 1J53A 1UAXA 1GOCA 5DMRA 4OPKA 3O4QA 1JLBA 4CHYA 1X1PA 1X9SA 4FK4A 4Q0BA 4FM1A 4DTOA 1JLQA 3KKSA 4CF0A 2PZSA 1IKVA 1RDBA 3NGZA 3RR7A 4FJ7A 1BI4A 3SPZA 3TAMA 4NYNA 3ZSRA 1SL2A 4F3OA 1CXQA 3NHGA 3KJVA 3L2VA 1L3SA 3SV3A 1Z25A 3NH1A 3UIQA 3P5JA 1JL1A 4CJWA 1U47A 3LWMA 3WNGA 4E0DA 4B3OA 1QSSA 3TWHA 3AVAA 2IAJA 3L2QA 3TAFA 3NDKA 2Q3SA 3NAEA 3OYNA 2GV9A 4O44A 1RTDA 3WNEA 3K5NA 2F8SA 4M3UA 1ITGA 3D45A 1ASUA 1Z26A 3HSTB 3EYZA 4KHNA 1VSMA 1GOAA 4M42A 4Z4FA 4FJGA 3V9SA 2HNZA 2QXFA 1J5OA 5CYMA 4MFBA 3OVNA 1EX4A 3ASMA 3DLHA 3AA2A 3HK2A 1S9GA 3KD5E 1BGXT 4Q5VA 4YFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHW A;  1SUQ A;  4CED A;  4JS4 A;  4CF1 A;  3VQC A;  4DQI A;  4H4O A;  5C25 A;  1KSP A;  4F2S A;  3RWU A;  4M3X A;  3RMA A;  4NCG A;  4CE9 A;  4CJS A;  3AO5 A;  2OYQ A;  4EZ6 A;  4KKO A;  1JL2 A;  4CJK A;  4OJR A;  4CEC A;  1S1X A;  4BDY A;  3DYA A;  2IGI A;  3SYZ A;  4AHR A;  3T3F A;  4DFK A;  4UQG A;  1FKP A;  4ID5 A;  5HRN A;  2QKK A;  1SV5 A;  4NCB A;  2G8I A;  2HW3 A;  4ZHR A;  1HNI A;  2O4G A;  1S1W A;  1VSE A;  3RRH A;  2XY7 A;  4HTU A;  2HHU A;  3OS0 A;  4M41 A;  4DTX A;  2WON A;  5T7B A;  3OYG A;  1NJW A;  1JLC A;  3I0S A;  3I0R A;  1LWE A;  1REV A;  2D0B A;  4FCY A;  1NK4 A;  3QNO A;  4DMN A;  3L3V A;  3ITH A;  4CIE A;  1TAQ A;  3MED A;  3DRR A;  2B5J A;  1UA1 A;  3F73 A;  1NK6 A;  1JLF A;  1TL3 A;  4DSK A;  4CK3 A;  4MQ3 A;  4CJ5 A;  1RTJ A;  1RT2 A;  4CF2 A;  3LDS A;  3VQA A;  4I7F A;  3SQ0 A;  4ZTJ A;  1N6Q A;  3AVK A;  3S9H A;  1WSE A;  1VSK A;  3CFR A;  2FBY A;  3LP3 A;  3M8R A;  3AVN A;  4OGE A;  4HUE A;  5J2P A;  1NKB A;  4KPY A;  4GMJ B;  4OKJ A;  3BGR A;  3L8B A;  4OPJ A;  4DTJ A;  3LPU A;  4G1Q A;  4AHT A;  4AH9 A;  3NH2 A;  4M3T A;  1SKS A;  4FVM A;  4DF8 A;  1NKC A;  3U3Y A;  1S6P A;  3SQ1 A;  4CHP A;  4DTS A;  1VRU A;  3ZSX A;  4KI4 A;  1RDD A;  1BIZ A;  2EX3 A;  3KLG A;  3ISN C;  1CLQ A;  1BIS A;  3OJS A;  2ITG A;  2Z1I A;  4E7K A;  3VQQ A;  1WAJ A;  4QAG A;  4IDK A;  4KTZ A;  3RTV A;  3DLB A;  3QES A;  1I39 A;  1IKX A;  4AHU A;  2HHT A;  4FLY A;  4CJU A;  5JS1 A;  4OKE A;  3VQ8 A;  3TAP A;  4B9U A;  3AVC A;  3OYK A;  3IG1 A;  1HYZ A;  4ELU A;  4DLE A;  4I9L A;  3O4N A;  4KFB A;  4JRP A;  4DQS A;  4NYF A;  4Z4I A;  4B8C A;  3DOL A;  4CHO A;  4BAC A;  1QSY A;  4HUF A;  3AVM A;  4Z4E A;  4KRF A;  2KZM A;  1LWC A;  3QO9 A;  1FXX A;  4FJJ A;  3JSM A;  3OYL A;  2OPR A;  1VSJ A;  4QCL A;  2HNY A;  4CEO A;  5FRM A;  3HVR A;  1ZBU A;  4E7H A;  1VSF A;  3OYC A;  3EY1 A;  1Q9Y A;  4EP5 A;  4PUO A;  4LSL A;  2OA8 A;  1JLA A;  2YNI A;  1JKH A;  3QLH A;  1LWF A;  4DU4 A;  1DTQ A;  4KTW A;  1ZBF A;  3HXM A;  2E6L A;  3IRX A;  3SCX A;  4CK1 A;  1WSJ A;  4O0I A;  1A5V A;  4DQP A;  4KRE A;  1C1C A;  3TAN A;  5CYQ A;  3HM9 A;  4OGC A;  2Y1J A;  2FBT A;  3V1R A;  2VWJ A;  3QEI A;  1ASV A;  3DI6 A;  1U49 A;  4ICL A;  1RTI A;  3CYM A;  3K59 A;  1BQM A;  5KI6 A;  1ZBH A;  2XO7 A;  3QET A;  4EZ9 A;  5FRN A;  3KLI A;  5C42 A;  3HPG A;  1A5X A;  4IG0 A;  3KLF A;  4E3S A;  1LV5 A;  2PYJ A;  2KQ2 A;  2WOM A;  3OYJ A;  4DTR A;  1LW0 A;  4I2Q A;  3RMD A;  3QER A;  2BGG A;  4CGF A;  3S3N A;  3C94 A;  1BI4 B;  1JLG A;  3QEV A;  3HJF A;  4LH5 A;  3ZSZ A;  4KV8 A;  1F21 A;  4CF8 A;  1U04 A;  4HCC A;  4KB1 A;  1S5J A;  3I8D A;  1RTH A;  1WNS A;  4E19 A;  4CJ4 A;  1NOY A;  3D0P A;  5J1E A;  5CY4 A;  2XY8 A;  1XI1 A;  1KVC A;  3U3G A;  4DSJ A;  5SZT A;  1QE1 A;  4CJ3 A;  3CQ8 A;  4WE1 A;  1ZBL A;  4M3Y A;  2X74 A;  3OYM A;  2PYL A;  1B9D A;  1XC9 A;  4BDP A;  4FJN A;  4KTQ A;  3S3O A;  1RCH A;  4HVJ A;  4PA1 A;  3LAM A;  1U45 A;  2FC0 A;  1KVB A;  1T05 A;  3T19 A;  1J54 A;  3HYF A;  1EXQ A;  4HHT A;  4IFY A;  3SUO A;  3KIO A;  4KHU A;  4GW6 A;  4IBN A;  1NK9 A;  3L2R A;  4E7J A;  2D0C A;  1Y97 A;  3ZT4 A;  1D9F A;  4CGD A;  3VQ9 A;  3S3M A;  1C6V A;  1W9H A;  3LAK A;  2YNF A;  4BE2 A;  3SUN A;  1BCM A;  5DK5 A;  1QQC A;  1RT7 A;  1U48 A;  4KHY A;  4ELT A;  2OPS A;  4B9V A;  3O3G A;  2DY4 A;  1WSG A;  1DTT A;  4CJQ A;  4DU3 A;  3DM2 A;  3TAB A;  2Z1H A;  5HRR A;  5HLF A;  3DRP A;  2ATQ A;  3ZSO A;  1VSH A;  2DTU A;  4DWI A;  2A1S A;  1HMV A;  3V9X A;  1WLJ A;  3AO1 A;  1RBT A;  1XWL A;  2BAN A;  4M3R A;  3VQ5 A;  1X9M A;  1TKD A;  4OLA A;  1HYV A;  2RPI A;  4Z4H A;  4EP4 A;  1TV6 A;  4AHV A;  1VSI A;  3HL8 A;  1TK8 A;  4B08 A;  3U6F A;  3THV A;  1C0U A;  3VQE A;  2OPQ A;  2ZQB A;  3MXM A;  2HHS A;  4ZTF A;  3AO2 A;  1TVR A;  3DLG A;  3AA5 X;  2YNG A;  3VQB A;  1BCO A;  4CGG A;  4CEZ A;  3SPY A;  4F8R A;  4FYD A;  4DSI A;  1TAU A;  4CFA A;  4W5Q A;  1RBU A;  3RRG A;  4E7I A;  4DS4 A;  1RIL A;  5HBM A;  2HB5 A;  3CFP A;  1TGO A;  1BL3 A;  3MEE A;  4KO0 A;  3IAY A;  5K14 A;  2KW4 A;  4CJF A;  4CHZ A;  1IKY A;  3K5O A;  2HHX A;  4LY7 A;  3O3F A;  1ASW A;  3DLE A;  3M8Q A;  3L3U A;  1QS4 A;  3HT3 A;  4DQR A;  3RMC A;  3AVL A;  4CK2 A;  2KFN A;  2HHQ A;  4E1M A;  2G8F A;  4FLU A;  1EET A;  4OVL A;  3T1A A;  3SNN A;  1YVU A;  3P83 D;  4PQU A;  4CJV A;  3LZJ A;  3G10 A;  2F96 A;  4HUG A;  4DFJ A;  3OYF A;  3K5M A;  3SJJ A;  4FZY A;  2QK9 A;  4W5T A;  3TAR A;  4W5O A;  1KFS A;  1LAW A;  3ZCM A;  5J2N A;  1EP4 A;  4CEB A;  4JRQ A;  4BE0 A;  2D5R A;  3V1Q A;  1IG9 A;  3SI6 A;  1YTA A;  4I2P A;  4KHS A;  1HQE A;  1D5A A;  3AA3 A;  3KTQ A;  4FJ5 A;  1S1V A;  5CZ1 A;  4NCA A;  1YTU A;  5JS2 A;  1X9W A;  4PY5 A;  3ZT0 A;  1NKE A;  1HRH A;  4LH4 A;  1EKE A;  3PX0 A;  3MXJ A;  2VG7 A;  1WSI A;  3LP2 A;  2XY6 A;  3TI0 A;  3CM6 A;  3ULD A;  1RT5 A;  4R5P A;  4DLG A;  3PUF A;  1DLO A;  3K5L A;  2QKB A;  1RBR A;  4DU1 A;  4C8K A;  1WAF A;  3NF7 A;  2XHB A;  4OKK A;  3OYD A;  3CG7 A;  1MU2 A;  3PO5 A;  4RG8 A;  2KFZ A;  3HP9 A;  3M8S A;  4J2B A;  3VA3 A;  1IKW A;  1KCF A;  2JLE A;  5HRO A;  1QSL A;  4FLW A;  3OJU A;  3TAG A;  4N47 A;  3DOK A;  4RW6 A;  2DFF A;  1RBV A;  1C0T A;  1W0H A;  2IS3 A;  4QOZ B;  4FK0 A;  4BDZ A;  2IDO A;  3CFO A;  4CCH A;  3NF8 A;  1TKZ A;  2E4L A;  1KLN A;  4BWM A;  3OYB A;  4FJ8 A;  1IH7 A;  3FFI A;  5J2Q A;  2KTQ A;  5FDL A;  3DLR A;  2HHV A;  2X6S A;  1S1T A;  3CM5 A;  2GBZ A;  4CGJ A;  3LPT A;  4B9M A;  2Z1J A;  2FBV A;  1UA0 A;  2EHG A;  3TR8 A;  4FJH A;  4DFM A;  4B9N A;  3KKR A;  3K57 A;  2Y1I A;  3O3H A;  3AV9 A;  3AVG A;  3WNH A;  3LP1 A;  2P5G A;  3MEG A;  5HRS A;  4LSN A;  1ZBI A;  1S9E A;  4KAZ A;  1TKX A;  1J9A A;  3B6O A;  3VQ4 A;  2RKI A;  4F4K A;  1VRT A;  4FLX A;  3NGY A;  1UOC A;  2ETJ A;  1SL1 A;  2G8H A;  2XRI A;  3A2F A;  3SQ4 A;  3OYE A;  1FK9 A;  5KRS A;  3QEX A;  1C1A A;  1RT1 A;  1KTQ A;  1TKT A;  2P1J A;  4GVM A;  1XHZ A;  1NJY A;  3HP6 A;  4KHW A;  1BHL A;  2I5J A;  3AVH A;  4OLB A;  1L5U A;  4J2A A;  2HVI A;  2ZD1 A;  3IS9 A;  1RDC A;  4FJX A;  1RT3 A;  3ZSY A;  4N56 A;  2VG5 A;  3JYT A;  3SZ2 A;  1VK0 A;  4M45 A;  3L2W A;  1CZB A;  4O0J A;  2G8K A;  1UWB A;  4RW9 A;  5FRO A;  1CXU A;  1NOZ A;  3LWL A;  1L3T A;  4B9T A;  4F3T A;  4BWJ A;  1NK8 A;  2VG6 A;  4DS5 A;  2OPP A;  5CZ2 A;  2YNH A;  4Y1C A;  3SUQ A;  1G15 A;  3PX6 A;  4DSL A;  1HYS A;  4JLH A;  4FJI A;  3HVT A;  1TK5 A;  2RN2 A;  3VQ6 A;  4CER A;  4PWD A;  3NBP A;  3ALY A;  1Q8I A;  3PO4 A;  4AHC A;  3NCI A;  3ZT1 A;  4FK2 A;  1U4B A;  2LSN A;  3B6P A;  3F9K A;  3AVB A;  4FJM A;  3QIO A;  4BE1 A;  3V9Z A;  4FZX C;  4KHQ A;  3ZT3 A;  1HJR A;  1YT3 A;  1NK7 A;  3C6U A;  4FLZ A;  3RMB A;  1SL0 A;  1JXE A;  3V1O A;  4IKF A;  4M3W A;  2DFE A;  3NF9 A;  4AHS A;  1D9D A;  2ZE2 A;  3AVI A;  1WN7 A;  3LAL A;  1VSD A;  5I3U A;  1N5Y A;  5KGX A;  5J2M A;  3PY8 A;  4KI6 A;  2JGU A;  5HP1 A;  1WSF A;  1T7P A;  4LD0 A;  5KTQ A;  3OS2 A;  4E89 A;  3BDP A;  3KK1 A;  3OS1 A;  3WNF A;  2FBX A;  3QNN A;  1Q9X A;  3MEC A;  3NH0 A;  3TAQ A;  1TK0 A;  2HND A;  2YHB A;  4H4M A;  1NK0 A;  2O4I A;  4O55 A;  1TL1 A;  1NJZ A;  4CJE A;  4CEF A;  3AVJ A;  4FM0 A;  1I3A A;  3M8P A;  3V9U A;  3HPH A;  4CJL A;  1CZ9 A;  2OZM A;  3KD1 E;  4J2E A;  3P1G A;  2D0A A;  4N41 A;  3VA0 A;  2R7Y A;  4O5B A;  1B9F A;  2BE2 A;  4FLT A;  4K8Z A;  1KVA A;  5EU7 A;  2Z1G A;  3QEP A;  1JXB A;  3K2P A;  4Z4G A;  4C8M A;  3V81 A;  3AO3 A;  3VN5 A;  2VWK A;  4CF9 A;  4O4G A;  4JS5 A;  4H8K A;  5I42 A;  4DG1 A;  3LP0 A;  1C0M A;  5C24 A;  4N5S A;  2P51 A;  2RF2 A;  3VQ7 A;  2YKN A;  3KK3 A;  3LZI A;  1KRP A;  4DQQ A;  4CEA A;  4CGH A;  1BQN A;  5D3G A;  4E1N A;  3HO1 A;  2PY5 A;  5E41 A;  2BDP A;  3NF6 A;  4C8L A;  4CJP A;  4W5R A;  1VSL A;  3K58 A;  2KZZ A;  2YV0 X;  2YKM A;  3VQD A;  4CIG A;  3MAQ A;  3HPO A;  1L3U A;  4FJ9 A;  4FW2 A;  1BIU A;  1T8E A;  4DFP A;  4CFC A;  2G8U A;  1ZYQ A;  4I9Q A;  4Z4C A;  2E6M A;  4K8X A;  4B9L A;  3AVF A;  4CHQ A;  4DF4 A;  4N76 A;  4CEQ A;  4B8A B;  4W5N A;  4YNQ A;  3ZT2 A;  3KLH A;  4FW1 A;  3DLK A;  1S1U A;  1RDA A;  4CIF A;  3C6T A;  3G0Z A;  4CJT A;  5HRP A;  5SWM A;  3PX4 A;  4DTM A;  1RT6 A;  3DRS A;  3KK2 A;  1R0A A;  2AJQ A;  4CFB A;  4C8N A;  3DMJ A;  3QEW A;  1NJX A;  4Z0U A;  4DTN A;  3V4I A;  2X78 A;  4XIU A;  4FM2 A;  4CHN A;  4Y1D A;  3RR8 A;  2G8V A;  3ZSW A;  3LAN A;  3OYA A;  4DSE A;  3SQ2 A;  3ZSV A;  2HMI A;  4F2R A;  1LW2 A;  4AIL C;  2NUB A;  3H08 A;  4CES A;  3ZSQ A;  1KFD A;  3OYI A;  1D8Y A;  1HNV A;  4L8R B;  4FZZ A;  3NFA A;  4FJL A;  4DTU A;  4HCB A;  3VQP A;  2F8T A;  4DSF A;  4FLV A;  4CFD A;  1HPZ A;  2G8W A;  3NGI A;  4J2D A;  2OZS A;  4RW7 A;  2GUI A;  3V9W A;  2P5O A;  1JLE A;  4E7L A;  1S6Q A;  2X6N A;  1L3V A;  1HQU A;  1QHT A;  4CJR A;  1A5W A;  1C1B A;  4IFV A;  4IG3 A;  4B9S A;  3V6D A;  2IC3 A;  4C8O A;  3AA4 A;  2XY5 A;  3MXI A;  3KLE A;  3L2U A;  3C95 A;  1LAV A;  1NK5 A;  4ID1 A;  4RW8 A;  3TAE A;  1WSH A;  1GOB A;  1RBS A;  2IOC A;  3QIN A;  1T03 A;  1KLM A;  2B4J A;  1K6Y A;  3EZ5 A;  2YHA A;  3SV4 A;  3SUP A;  1O1W A;  2W42 A;  3PV8 A;  1B92 A;  1XHX A;  3E01 A;  1QTM A;  1RNH A;  1SKW A;  4FJK A;  2HVH A;  4CGI A;  4KB0 A;  1IO2 A;  1RT4 A;  2A1R A;  4FXD A;  4TSX A;  5KRT A;  3OY9 A;  1SKR A;  4CEE A;  3QIP A;  4ELV A;  3NE6 A;  5KGW A;  3AO4 A;  4RW4 A;  3OYH A;  4DTP A;  4M3Z A;  1FKO A;  2B6A A;  2DFH A;  1J53 A;  1UAX A;  1GOC A;  5DMR A;  4OPK A;  3O4Q A;  1JLB A;  4CHY A;  1X1P A;  1X9S A;  4FK4 A;  4Q0B A;  4FM1 A;  4DTO A;  1JLQ A;  3KKS A;  4CF0 A;  2PZS A;  1IKV A;  1RDB A;  3NGZ A;  3RR7 A;  4FJ7 A;  1BI4 A;  3SPZ A;  3TAM A;  4NYN A;  3ZSR A;  1SL2 A;  4F3O A;  1CXQ A;  3NHG A;  3KJV A;  3L2V A;  1L3S A;  3SV3 A;  1Z25 A;  3NH1 A;  3UIQ A;  3P5J A;  1JL1 A;  4CJW A;  1U47 A;  3LWM A;  3WNG A;  4E0D A;  4B3O A;  1QSS A;  3TWH A;  3AVA A;  2IAJ A;  3L2Q A;  3TAF A;  3NDK A;  2Q3S A;  3NAE A;  3OYN A;  2GV9 A;  4O44 A;  1RTD A;  3WNE A;  3K5N A;  2F8S A;  4M3U A;  1ITG A;  3D45 A;  1ASU A;  1Z26 A;  3HST B;  3EYZ A;  4KHN A;  1VSM A;  1GOA A;  4M42 A;  4Z4F A;  4FJG A;  3V9S A;  2HNZ A;  2QXF A;  1J5O A;  5CYM A;  4MFB A;  3OVN A;  1EX4 A;  3ASM A;  3DLH A;  3AA2 A;  3HK2 A;  1S9G A;  3KD5 E;  1BGX T;  4Q5V A;  4YFU A; 
#chains in the Genus database with same CATH topology
 1ESV A;  1Z05 A;  3VQC A;  4F2S A;  2YJF A;  4NCG A;  4CE9 A;  3RMA A;  3AO5 A;  4CJK A;  1S1X A;  4BDY A;  3DYA A;  3T3F A;  4ID5 A;  3FZM A;  2NRX A;  3EE9 A;  1S1W A;  3SAG A;  5T7B A;  2D0B A;  5JVG L;  3D2F B;  3L3V A;  3MED A;  1NGA A;  3F73 A;  1NK6 A;  1TL3 A;  1T44 A;  4CK3 A;  3CJA A;  2A41 A;  4MQ3 A;  1RT2 A;  4CJ5 A;  5DM7 L;  1N34 K;  3D2E B;  3H46 O;  3AVK A;  3O08 A;  3S9H A;  4BRO A;  4OGE A;  4HUE A;  1NKB A;  4KPY A;  3BGR A;  1QQN A;  4AHT A;  2O8D A;  3K9K A;  3ZSX A;  3ZET B;  4G9Z A;  3THX B;  2O8C A;  4IJA A;  3VQQ A;  1WAJ A;  4FVU A;  3SAH A;  3RTV A;  3QES A;  1IKX A;  2UXD K;  3TSQ A;  3BUZ B;  3WXJ A;  4M7Y A;  3WEE A;  1HYZ A;  4ISF A;  1LCU A;  3M1F A;  4Z4I A;  4CHO A;  3AVM A;  4C23 A;  4KRF A;  2KZM A;  1LWC A;  4JD2 A;  3OYL A;  3VF6 A;  1QQO A;  4CEO A;  3HVR A;  1VSF A;  3OYC A;  3EY1 A;  3G4S N;  4LSL A;  2OA8 A;  2YNI A;  3O9Q A;  4KTW A;  1ZBF A;  4KRE A;  4CK1 A;  4X64 K;  2F9W A;  3HM9 A;  2Y1J A;  2GTD A;  1NLV A;  3QEI A;  2HF4 A;  4H0P A;  1BQM A;  2IIR A;  3F9M A;  3KLI A;  3P31 A;  3KLF A;  4CBU A;  4E3S A;  1LW0 A;  4I2Q A;  3UKR B;  5KPT A;  3ULE B;  4EFH A;  4CZM A;  1WNS A;  3LDL A;  4J8F A;  3O1W A;  3A5M C;  3UKU A;  3CI5 A;  4WE1 A;  2PYL A;  3G71 N;  3QIC A;  3FZL A;  2FC0 A;  1KVB A;  1EXQ A;  3KIO A;  4GW6 A;  4E7J A;  1D9F A;  4FL9 A;  3WT0 A;  3ZT4 A;  4PKG A;  4BC2 A;  3GL1 A;  1C6V A;  3SUN A;  4KHY A;  4ELT A;  3I33 A;  2E2Q A;  2QA4 N;  5HLF A;  3CCU N;  3ZSO A;  1Q81 O;  2A1S A;  3V9X A;  1WLJ A;  1RBT A;  1XWL A;  2BAN A;  3VQ5 A;  2KKZ A;  2RHK A;  3OW2 M;  4IOC L;  3H6E A;  3VEY A;  4C1N I;  4B08 A;  3OHR A;  2VYP A;  4UY8 O;  3W0L A;  5BR9 A;  4E1J A;  2YNG A;  4FYD A;  3SPY A;  4CZK A;  1DEJ A;  5M1Q A;  3UKU B;  3RRG A;  2HST A;  4K25 A;  4V19 S;  2HB5 A;  3CFP A;  4KO0 A;  1BL3 A;  3MEE A;  4YOR A;  4BRD A;  3IAY A;  5HL7 L;  4LY7 A;  4PKI A;  1MA9 B;  3ULE A;  4DQR A;  3C65 A;  1NMN A;  4FLU A;  1EET A;  4OVL A;  3T1A A;  4EHT A;  3LZJ A;  4HUG A;  2F96 A;  3K5M A;  4DR3 K;  3TAR A;  1HPM A;  3CF5 L;  3ZCM A;  5J2N A;  4CEB A;  4BE0 A;  3V1Q A;  1YTA A;  2QWO A;  3C6H A;  2W41 A;  2I7N A;  4YHH K;  2XY6 A;  4IEE A;  3TI0 A;  4MO5 A;  3ULD A;  4CZG A;  3K5L A;  4BRP A;  1OVY A;  4WFN L;  1WAF A;  3NF7 A;  4OKK A;  5IWA K;  4RG8 A;  5AQX A;  1NGI A;  5BN9 A;  4J2B A;  3VA3 A;  2JLE A;  4IO8 A;  5LJV A;  5HRO A;  1J5E K;  4X62 K;  3CPE A;  3ZX2 A;  5BPN A;  4RW6 A;  1RBV A;  4QOZ B;  4BDZ A;  4LFC K;  1KLN A;  3CER A;  3OYB A;  5J2Q A;  2HBM A;  2P9N B;  2Z1J A;  4FO0 A;  3ZET A;  2EHG A;  4PL7 A;  3TR8 A;  4FJH A;  4DFM A;  2Y1I A;  3AVG A;  1S3X A;  5HRS A;  4LSN A;  1S9E A;  3CJC A;  2RKI A;  3CPW M;  3OYE A;  3N4P A;  3D2E A;  5KRS A;  4GVM A;  4NXM K;  4LF8 K;  3P39 A;  3TTC A;  3WXM B;  3ATU A;  1BHL A;  3IS9 A;  2W40 A;  4FJX A;  3ZSY A;  3JYT A;  3L2W A;  1CZB A;  1GLB G;  4O0J A;  5AZJ A;  1UWB A;  5FRO A;  1L3T A;  1NOZ A;  4DS5 A;  4DHY A;  4BR4 A;  2OPP A;  4JK8 A;  3CMA N;  4XH1 A;  4B1X B;  2FF6 A;  2PFU A;  1TK5 A;  3VQ6 A;  4CER A;  3WUH A;  5C0Y A;  4FK2 A;  1OH8 A;  2Q97 A;  3B6P A;  3L0Q A;  1YVN A;  2VQE K;  5C15 A;  1V4T A;  1NK7 A;  3C6U A;  4FLZ A;  1NJI O;  3V1O A;  2DFE A;  3NF9 A;  3L6Q A;  3SBT A;  5KGX A;  5J2M A;  1VQ4 N;  5EVZ A;  3PY8 A;  4KI6 A;  3WXI A;  4DV6 K;  2I7P A;  3WNF A;  3NVM A;  5AQT A;  1Q9X A;  2ASO A;  4O55 A;  1TL1 A;  3M8P A;  4J2E A;  1XC3 A;  3ID8 A;  4CD3 A;  4N41 A;  2BE2 A;  4FLT A;  4K8Z A;  2Z1G A;  1JXB A;  3K2P A;  4C8M A;  4PHT X;  3V81 A;  2VWK A;  3O80 A;  5I42 A;  4DG1 A;  5MLC Q;  1VQ8 N;  4H5R A;  3LZI A;  3CXC M;  2O8E A;  4CEA A;  4CGH A;  4CI6 A;  4GNI A;  3HO1 A;  4CJP A;  3THW A;  2KZZ A;  2VGM A;  4CIG A;  1L3U A;  1BIU A;  1T8E A;  3HI0 A;  1ZYQ A;  1NWK A;  4Z4C A;  3AVF A;  4CHQ A;  4CEQ A;  4GV9 A;  4A2A A;  3CCM N;  4CZE A;  3VEO A;  5HRP A;  3PX4 A;  4B1V A;  3DRS A;  3KK2 A;  1MWK A;  3CHW A;  3QEW A;  1NJX A;  5LY3 A;  3SJH A;  1HNZ K;  5LL6 Z;  4YOU A;  4CHN A;  3AY9 A;  4DV3 K;  3SQ2 A;  4CES A;  1D8Y A;  1KFD A;  4YY3 K;  2QTD A;  4IJN A;  4FPB A;  5LJW A;  4WQ4 C;  4A5A A;  5BPM A;  1HPZ A;  2UXB K;  2OZS A;  4JKB A;  4E7L A;  1S6Q A;  5GIO A;  1SAZ A;  1L3V A;  1C1B A;  4MDB A;  4IFV A;  4FWL A;  2IC3 A;  5C2F A;  3O1B A;  3KLE A;  4BC5 A;  1NK5 A;  4ID1 A;  4BR5 A;  1GOB A;  1RBS A;  1KLM A;  2B4J A;  2YHA A;  3SUP A;  1QZ5 A;  3FZF A;  1BDG A;  1RNH A;  3B8A X;  4KB0 A;  4B3M K;  3IKM A;  2W6K A;  3H45 C;  1TYQ A;  5KRT A;  2P9S A;  3QIP A;  3OYH A;  4LF6 K;  4JV5 K;  3O4Q A;  4Q0B A;  3ID6 A;  4FM1 A;  2ZJR L;  4DTO A;  4H03 B;  4CF0 A;  1JLQ A;  4FJ7 A;  2WFB A;  1BI4 A;  2QWQ A;  1P8Z A;  4K41 A;  4F3O A;  1CXQ A;  3KJV A;  2YHX A;  3L2V A;  3LM2 A;  2VGN A;  3WQU A;  3WNG A;  4H5V A;  3AVA A;  3NDK A;  3KZB A;  2A3Z A;  3OYN A;  4O44 A;  4M3U A;  3MWT A;  3HST B;  1VSM A;  1OH6 A;  2H3G X;  3V9S A;  1NGB A;  4BQL A;  3PSF A;  1EX4 A;  3DLH A;  5AZJ B;  3EKU A;  4Q5V A;  4YFU A;  4CED A;  4JS4 A;  2VQF K;  5C25 A;  1KSP A;  2NRZ A;  4M3X A;  4CJS A;  5KQ8 A;  1C0G A;  2WC9 A;  2UUA K;  2HHV A;  4CEC A;  3O9T A;  4AHR A;  4DR1 K;  3KWI A;  2GWJ A;  5M1K A;  2HW3 A;  4ILJ A;  1VSE A;  3RRH A;  2QEX N;  1YXQ A;  2F4V K;  1BOT O;  1JLC A;  3I0S A;  4FCY A;  1LWE A;  2OAN A;  1VQ6 N;  4DMN A;  2NRW A;  3DRR A;  4AQY K;  1JLF A;  3CJ1 A;  3LDS A;  4DV0 K;  3SQ0 A;  4ZTJ A;  2FSJ A;  1WSE A;  1WB9 A;  3AVN A;  5AQP A;  5J2P A;  4JK7 A;  4OKJ A;  4DTJ A;  4M3T A;  4OPJ A;  3LPU A;  4G1Q A;  5LMN K;  1SKS A;  4NLB A;  3U3Y A;  2ZF5 O;  2ZGY A;  4CHP A;  4DTS A;  4Y0W A;  4JHD B;  4KI4 A;  1BIZ A;  1CLQ A;  3OJS A;  2Z1I A;  3CC7 N;  3TPQ A;  3A8Y A;  5EX5 A;  3UB5 A;  4FLY A;  5JS1 A;  4OKE A;  3VQ8 A;  4YDU C;  3AVC A;  4GV3 A;  4I9L A;  4DQS A;  3VEX A;  4H0V B;  3OBW A;  1U2V A;  2J4R A;  4I6M A;  2ZJQ L;  3H1V X;  1E3M A;  4CBW A;  4FJJ A;  3CJ9 A;  5ADX H;  2OPR A;  1VSJ A;  4K42 A;  1XNR K;  5F2R A;  5FRM A;  2JWL A;  2P9L B;  2YI1 A;  4CZL A;  3A5L C;  4PUO A;  1JKH A;  3QLH A;  1OH5 A;  3O4W A;  1RGI A;  1LWF A;  4JKA A;  1DTQ A;  3E1Y A;  4WQ5 A;  3HRG A;  2E6L A;  3HXM A;  3SCX A;  1WSJ A;  4O0I A;  1A5V A;  2Q36 A;  4DQP A;  4JI3 K;  5AQY A;  2O8F A;  5CYQ A;  1SS6 A;  3V1R A;  5BR8 K;  2VWJ A;  2YX6 A;  3C7N B;  3CYM A;  4CD1 A;  3U4L A;  1N32 K;  2XO7 A;  3QET A;  4EZ9 A;  4YOT A;  1A5X A;  4LF9 K;  3VTH A;  1LV5 A;  4LF7 K;  2PYJ A;  3OYJ A;  3RMD A;  3MN7 A;  5AQU A;  2BGG A;  3D6R A;  3BF3 A;  3C94 A;  1BI4 B;  4BY9 C;  3ZSZ A;  4CF8 A;  1J6Z A;  3IDH A;  3NMU A;  3ZEU B;  4E19 A;  4YOW A;  3D0P A;  2XY8 A;  1KVC A;  3U3G A;  3NVK A;  1LOT B;  1IG8 A;  5AQG A;  4CJ3 A;  2HBJ A;  2QWR A;  3JXU A;  1HLU A;  3QFP A;  1ZBL A;  3GDQ A;  4FJN A;  4KTQ A;  3S3O A;  1RCH A;  3C6A A;  4HVJ A;  4PA1 A;  5F0X A;  3HYF A;  2VWB A;  4IFY A;  3SUO A;  4KHU A;  1K9M O;  4IBN A;  4FOI A;  3ZX3 A;  4B3S K;  3S3M A;  1BCM A;  1U48 A;  3O3G A;  4DV2 K;  5BPL A;  1WSG A;  5AQJ A;  4CJQ A;  1I94 K;  3FZK A;  3TAB A;  2Z1H A;  1P90 A;  3DRP A;  3P38 A;  2ZGZ A;  1VSH A;  2DTU A;  1HMV A;  2NRV A;  1NGJ A;  5DM6 L;  3AO1 A;  1X9M A;  4JI5 K;  1TKD A;  4H0O A;  1TV6 A;  4AHV A;  4B9Q A;  3VGM A;  3THV A;  3O6W A;  2ZQB A;  3LDN A;  3DLG A;  1TUY A;  4BR2 A;  5HOO A;  3SK3 A;  1TAU A;  1RBU A;  2PBD A;  4E7I A;  1RIL A;  1HKB A;  2UYT A;  2KW4 A;  5AQS A;  4CJF A;  4DV1 K;  3DXM B;  1G99 A;  4FOE A;  3O3F A;  1ASW A;  1N8R O;  2HHQ A;  3P83 D;  4KH4 A;  1KAX A;  4FZY A;  2KLA A;  2NRH A;  4W5T A;  5JVH L;  4W5O A;  1EP4 A;  4CBX A;  4I2P A;  1D5A A;  3AA3 A;  4JD2 B;  4FJ5 A;  5CZ1 A;  4OPH A;  4PY5 A;  1HRH A;  5F1X A;  2VG7 A;  1WSI A;  3BF1 A;  3KK7 A;  4R5P A;  1M1K O;  4DLG A;  3PUF A;  1DLO A;  1RBR A;  1JCE A;  4DR7 K;  3GG4 A;  3CG7 A;  4DCH A;  1MU2 A;  1NNE A;  3THW B;  3HP9 A;  1YIJ N;  3M8S A;  2HBK A;  1M90 O;  1KAY A;  2HF3 A;  3TAG A;  4N47 A;  3VF2 A;  1W0H A;  4FK0 A;  2P9P B;  4QS7 A;  3NF8 A;  2E4L A;  1RDU A;  4FJ8 A;  1IH7 A;  4BRN A;  3DLR A;  2GBZ A;  3LPT A;  4B9M A;  2FBV A;  1MWM A;  4B9N A;  3KKR A;  4WCE L;  3WNH A;  3GOI A;  3LP1 A;  2P5G A;  3OTO K;  3B6O A;  1EWQ A;  3FR0 A;  1DT9 A;  3NGY A;  4DV7 K;  1FK9 A;  4KHW A;  4J2A A;  2JWK A;  2ZD1 A;  5A2Q O;  1RT3 A;  4N56 A;  3SZ2 A;  1VK0 A;  4M45 A;  4RW9 A;  1CXU A;  2FLO A;  4BWJ A;  4WF9 L;  4K43 A;  5CZ2 A;  2YNH A;  1G15 A;  3PX6 A;  3U8X A;  1XMO K;  2RN2 A;  3MX2 A;  4AHC A;  2P9P A;  4DR4 K;  3AVB A;  1YT3 A;  1SL0 A;  1WOQ A;  4M3W A;  4H0Y B;  5AQF A;  3AVI A;  3MDQ A;  5AJ3 K;  1VSD A;  1N5Y A;  3FGU A;  4E89 A;  3QBX A;  3PSI A;  2FBX A;  1NK0 A;  2A6A A;  2HND A;  2YHB A;  4CEF A;  2GUP A;  2BH1 A;  3EEQ A;  3V9U A;  3HPH A;  5BRH A;  1CZ9 A;  3P1G A;  2P9N A;  2WTU A;  3VER A;  2HBL A;  3T7Z A;  3JAM O;  5CR4 A;  1NBW A;  2IVO A;  4AM7 A;  4O4G A;  4H8K A;  4BRC A;  4IEI A;  1C0M A;  5C24 A;  2RF2 A;  2YKN A;  4DQQ A;  1IBK K;  5AQH A;  4E1N A;  5E41 A;  3NF6 A;  1K73 O;  1TUU A;  4IO9 L;  2YV0 X;  3MAQ A;  3VQD A;  4DUZ K;  3HPO A;  3TTF A;  4FJ9 A;  4FW2 A;  3ENH A;  3QFU A;  4I9Q A;  2FF3 B;  3W3D A;  3PLA A;  3ZT2 A;  3QBW A;  4Z94 A;  1RDA A;  4JKG A;  3C6T A;  4CJT A;  5SWM A;  4JKE A;  4WQ5 C;  1R0A A;  4OPA A;  4A62 A;  3R8E A;  3V4I A;  2HMP A;  4BVP A;  4DR5 K;  5ELZ A;  3LAN A;  3O9S A;  2HMI A;  4GKK K;  4AF1 A;  5BN8 A;  3OYI A;  3ZEU A;  3ZSQ A;  4R79 A;  1HNV A;  4L8R B;  4DUY K;  4ILH A;  1GLC G;  4DTU A;  4KH5 A;  4DSF A;  4FLV A;  2GWK A;  2A5X A;  3NGI A;  1ATS A;  3V9W A;  1ZC6 A;  2NNW A;  2X6N A;  1QHT A;  3CD6 N;  2KHO A;  3V6D A;  1SZ2 A;  3ZX0 A;  3AA4 A;  4BG9 A;  3C95 A;  3TAE A;  3ATV A;  5M1N A;  3SV4 A;  1K6Y A;  2Q2R A;  1B92 A;  3E01 A;  1QTM A;  1SKW A;  2FSN A;  2HVH A;  4CGI A;  1IV0 A;  1RT4 A;  5BRE A;  1SKR A;  5KPZ A;  3OY9 A;  4RW4 A;  5GIN A;  1Q9Y A;  1HR0 K;  1X9S A;  4C1N K;  3CCS N;  3UE5 A;  3K0S A;  4WYB A;  3CCJ N;  4I6M B;  3KKS A;  2PZS A;  3RR7 A;  3NGZ A;  4OX9 K;  1BA1 A;  3EO3 A;  1EWR A;  3SPZ A;  1IBM K;  3M6G A;  3ZSR A;  1SL2 A;  1ZBS A;  3UKR A;  3RSE B;  4ILG B;  3NH1 A;  3UIQ A;  5B8H A;  1U47 A;  4B3O A;  3C0B A;  3LWM A;  3TWH A;  2IAJ A;  3TAF A;  2Q3S A;  2P9K A;  1ITG A;  1Z26 A;  4KHN A;  1ZXO A;  4M42 A;  4BRH A;  4FJG A;  1U2V B;  3ASM A;  3KD5 E;  1VQO N;  1QQM A;  3FLC O;  1SUQ A;  4CF1 A;  2NZT A;  4DQI A;  1VQK N;  4PKH A;  3A5N C;  2OYQ A;  4EZ6 A;  4KKO A;  1JL2 A;  4OJR A;  3H3O B;  4A2B A;  4DFK A;  2FXU A;  3SYZ A;  2CH6 A;  4UQG A;  1SV5 A;  3AAQ A;  4NCB A;  3MWP A;  2G8I A;  3SMP A;  1HNI A;  2O4G A;  2XY7 A;  2HHU A;  3OS0 A;  4DTX A;  1NJW A;  2WON A;  1Y64 A;  1KC8 O;  4K0K K;  5AQL A;  5FLX O;  3I0R A;  1REV A;  4BR0 A;  5KPR A;  3QNO A;  3EKS A;  2YHW A;  3ITH A;  4CIE A;  1N33 K;  4U7B A;  3ZLJ A;  1UA1 A;  4DQ8 A;  1JJ2 M;  4CZH A;  4DSK A;  2E1Y A;  4CF2 A;  1S22 A;  4ISG A;  1N6Q A;  2AA4 A;  1VSK A;  3CFR A;  3LP3 A;  3LM9 A;  3M8R A;  4GMJ B;  3L8B A;  4PQU A;  3NH2 A;  2QWP A;  1VQL N;  4FVM A;  4DF8 A;  1NKC A;  1S6P A;  2GEL A;  3G25 A;  2EX3 A;  1BIS A;  3I55 N;  2ITG A;  4E7K A;  1IJJ A;  4IDK A;  4KTZ A;  3DLB A;  4DKW A;  5EY4 A;  1WBD A;  4AHU A;  3E66 A;  3TAP A;  3IG1 A;  3O4N A;  1HJO A;  3MN5 A;  4B8C A;  3DOL A;  5C10 A;  4BAC A;  1QSY A;  4HUF A;  4A5B A;  4Z4E A;  3DWL A;  1FXX A;  3JSM A;  4QCL A;  1NG9 A;  2HNY A;  1TYQ B;  4B1W B;  4JI1 K;  4EP5 A;  1K8K A;  3QML A;  4M63 C;  4DU4 A;  4FWM A;  3F2K A;  4BGA A;  1C1C A;  4BRG A;  4OGC A;  1VHX A;  3DI6 A;  4ICL A;  1RTI A;  3K59 A;  5KI6 A;  1ZBH A;  5C42 A;  1JCG A;  2P9S B;  5JMV A;  1YF5 L;  2KQ2 A;  2WOM A;  4DB3 A;  4DTR A;  3QER A;  3S3N A;  3GE1 A;  4RTF D;  4KV8 A;  2RE2 A;  4BR7 A;  3E9O A;  3HTV A;  4CJ4 A;  1NOY A;  5CY4 A;  4DSJ A;  4JI2 K;  3AAP A;  4YOY A;  4M3Y A;  3OYM A;  2D4W A;  1FJG K;  1XC9 A;  4MLH A;  1U45 A;  3LAM A;  1YHQ N;  1ILY A;  1J54 A;  4GVE A;  3PIP L;  3U9D A;  5E84 A;  2BTF A;  3L2R A;  4CGD A;  3VQ9 A;  1W9H A;  3LAK A;  3OA9 A;  1RT7 A;  2Q1N A;  2OPS A;  4IWV A;  1W97 L;  2DY4 A;  4JI6 K;  1KAZ A;  1DTT A;  1Q7Y O;  3DM2 A;  5HRR A;  1WUA A;  4JI4 K;  4OLA A;  3BZK A;  3T1Y K;  1VSI A;  3HL8 A;  4BVO A;  2Q31 A;  2HHS A;  2QXL A;  4ZTF A;  3AA5 X;  4F8R A;  1BCO A;  4DSI A;  1W7A A;  5IT9 O;  4DS4 A;  5AQI A;  1TGO A;  3HBT A;  3BEX A;  2WBN A;  1IKY A;  3RVC A;  4LFB K;  2HHX A;  1QS4 A;  3RMC A;  3BZC A;  3AVL A;  4BG8 A;  2KFN A;  4O8U A;  4E1M A;  2G8F A;  2O8E B;  4CJV A;  4DFJ A;  3G10 A;  3O5B A;  3OYF A;  1MDU B;  1HUX A;  4NXN K;  3SI6 A;  3LDP A;  4KHS A;  1HQE A;  3KTQ A;  4O8K A;  1S1V A;  3SMS A;  1X3M A;  5JS2 A;  1X9W A;  3ZT0 A;  1EKE A;  4MLE A;  4FWS A;  3MXJ A;  2QM1 A;  4A59 A;  3CJB A;  3LP2 A;  4QS8 A;  1K8K B;  3ZYY X;  1D4X A;  2P9U B;  4C8K A;  2XHB A;  3OYD A;  2E88 A;  3QB0 A;  4FWQ A;  5ADX A;  1QVG M;  2KFZ A;  1YAG A;  5GIP A;  4X65 K;  3DOK A;  3I8B A;  1C0T A;  2E2P A;  4JI7 K;  4CCH A;  1TKZ A;  5AZI B;  3CIP A;  2KTQ A;  1X3N A;  2X6S A;  1S1T A;  3C7N A;  1HNX K;  2OTJ N;  1UA0 A;  1NGD A;  5M1O A;  3K9J A;  3O3H A;  1BO5 O;  4PL8 A;  3J7Z O;  3MEG A;  1QZ6 A;  3LDQ A;  3ENO A;  1TKX A;  3VQ4 A;  4F4K A;  1VRT A;  1SL1 A;  2ETJ A;  1OKJ A;  2XRI A;  3A2F A;  2ASP A;  1QHA A;  3QEX A;  1C1A A;  1RT1 A;  1TKT A;  1XHZ A;  5GAG P;  4IZ9 A;  2I5J A;  3AVH A;  4OLB A;  2NRR A;  1OVQ A;  4JEP A;  2OCE A;  3WQT A;  4JI0 K;  5TKW A;  3Q7B A;  3CCL N;  3LWL A;  4B9T A;  2F9T A;  1NK8 A;  3CQY A;  2HOE A;  4JLH A;  1BA0 A;  3ALY A;  1Q8I A;  3PO4 A;  4DV4 K;  1HKG A;  1U4B A;  3FZH A;  3M5R A;  2LSN A;  1RDW X;  3F9K A;  4FJM A;  1VQM N;  4B1Z A;  3QIO A;  4FZX C;  2BUP A;  1JXE A;  4IKF A;  2IVP A;  1D9D A;  4BC4 A;  3LAL A;  5I3U A;  2P9K B;  5E26 A;  1T7P A;  4LD0 A;  5KTQ A;  3OS2 A;  3OS1 A;  4BRF A;  3MEC A;  3NH0 A;  4H4M A;  2O4I A;  3HM8 A;  1NJZ A;  4H5W A;  1W2B M;  3O9U A;  4LF5 K;  3KD1 E;  3VA0 A;  1B9F A;  3R9P A;  5EU7 A;  4Z4G A;  3AO3 A;  3VN5 A;  1GLD G;  3RSE A;  3VQ7 A;  3KK3 A;  2IVN A;  3Q7C A;  3F5T A;  2PY5 A;  4W5R A;  4JKD A;  4IOA L;  2YKM A;  3M3Z A;  5FPE A;  2E5L K;  2GEM A;  3EN9 A;  4FPA A;  2CGL A;  3CCQ N;  2G8U A;  2ZWH A;  2E6M A;  4B1Y B;  4N76 A;  4B8A B;  4YNQ A;  3KLH A;  2D1K A;  4FW1 A;  3DLK A;  4BGB A;  1S1U A;  4CJ7 A;  1O13 A;  3G0Z A;  4DTM A;  1RT6 A;  1SQK A;  3N4Q A;  1WBB A;  1HKC A;  4C8N A;  3DMJ A;  5C2D A;  3DAW A;  4DTN A;  3WXL A;  3I56 N;  5H1S Q;  4FM2 A;  4Y1D A;  3RR8 A;  2G8V A;  5KQD A;  4DSE A;  3JS6 A;  4F2R A;  3J81 O;  3AGR A;  4AIL C;  2NUB A;  1HNW K;  4FJL A;  2F8T A;  4HCB A;  2Q0U A;  4JKG B;  2GX9 A;  4CFD A;  4J2D A;  2GUI A;  2P5O A;  1KXP A;  1HQU A;  4IG3 A;  4B9S A;  2CGJ A;  3O8M A;  4C8O A;  2XY5 A;  3MXI A;  5CE3 A;  2YJE A;  3MK6 A;  4RW8 A;  1WSH A;  2IOC A;  1T03 A;  1Q82 O;  3EZ5 A;  1O1W A;  2W42 A;  3PV8 A;  1GLE G;  1XHX A;  4FJK A;  1NU0 A;  1IO2 A;  1NGE A;  4TSX A;  3NE6 A;  3AO4 A;  4DTP A;  1FKO A;  2DFH A;  1GOC A;  1JLB A;  2QWL A;  3AAR A;  1KD1 O;  3D7E O;  3EL2 A;  3DJC A;  1IKV A;  1RDB A;  4EAH D;  3L4I A;  4BRM A;  3NHG A;  1L3S A;  3WEE B;  3SV3 A;  3SBG A;  3VMF B;  4CJW A;  4H5N A;  2F8S A;  1RTD A;  3K5N A;  3EYZ A;  1YJ9 N;  1GOA A;  2V7Y A;  2PAV A;  2HNZ A;  2QXF A;  4DR2 K;  3H1Q A;  5CYM A;  4MFB A;  4B1U B;  3OVN A;  3HK2 A;  2O8D B;  3AA2 A;  1S72 N;  1S9G A;  3E9L A;  1BGX T;  4IFE A;  1ATN A;  1K8A O;  1GLA G;  1Q18 A;  2HHW A;  4RWT A;  1YUW A;  4H4O A;  3VF4 A;  4QS9 A;  3RWU A;  4WQ4 A;  1XUP O;  3MCA B;  4JNE A;  2IGI A;  2QKK A;  2NLX A;  3VEN A;  1FKP A;  5HRN A;  4KH6 A;  4ZHR A;  3WXK A;  4HTU A;  1E4G T;  4M41 A;  3OYG A;  5GAD P;  3D2F A;  1NK4 A;  3J7A P;  4BQZ A;  1TAQ A;  3P4I A;  2B5J A;  4BRL A;  5GAE P;  1RFQ A;  1FW6 A;  1RTJ A;  3CQX A;  3VQA A;  4I7F A;  2FBY A;  5FPD A;  1VQ7 N;  2NRT A;  3FFK B;  5AQN A;  3TU5 A;  1XNQ K;  4AH9 A;  4MDA A;  1DGK N;  3SQ1 A;  4RCH A;  1VRU A;  1KQS M;  1RDD A;  1X9J A;  3KLG A;  3ISN C;  4GY2 B;  4QAG A;  4JKC A;  4A61 A;  1I39 A;  2HHH K;  1EQY A;  2HHT A;  2YHY A;  3J8A A;  5AQW A;  4CJU A;  4B9U A;  3OYK A;  4ELU A;  4DLE A;  4KFB A;  2OTL N;  3THY B;  4JRP A;  4NYF A;  5AQQ A;  4KHP K;  3MX5 A;  3QO9 A;  4XH4 A;  3VOV A;  4IOX A;  3VEW A;  3T1H K;  2YCH A;  1ZBU A;  4E7H A;  1VQP N;  1YI2 N;  3QDK A;  1JLA A;  4F9O A;  3FE1 A;  3IRX A;  3PIO L;  4BRI A;  3TAN A;  2FBT A;  2O8B B;  1ASV A;  1U49 A;  3CC4 N;  1H1V A;  3BY5 A;  4GKJ K;  2ITM A;  5M1F A;  2E2O A;  5FRN A;  3HPG A;  4IG0 A;  3CCE N;  3HSC A;  5BRF A;  1V4S A;  4CGF A;  1JLG A;  3QEV A;  3HJF A;  4LH5 A;  2D0O A;  1F21 A;  4LC9 B;  1U04 A;  3DXM A;  4HCC A;  1S5J A;  4KB1 A;  3I8D A;  1RTH A;  4H0X B;  4NLC A;  5J1E A;  1XI1 A;  3T69 A;  3TSP A;  5SZT A;  2WUS A;  3J80 O;  1QE1 A;  3EZW A;  3CQ8 A;  2X74 A;  4XH5 A;  1B9D A;  1EO1 A;  5CHI A;  4BRQ A;  4BDP A;  3R3L A;  3ENB A;  4L3Q A;  1T05 A;  3T19 A;  4HHT A;  4H5T A;  1NK9 A;  1E4F T;  4YOX A;  2D0C A;  1Y97 A;  4BE2 A;  2YNF A;  5JLF A;  5DK5 A;  1QQC A;  3R1X A;  3CET A;  4B9V A;  3A5O C;  4DU3 A;  4BR9 A;  2UXC K;  1R59 O;  2ATQ A;  5LMU K;  4DWI A;  1VQ5 N;  4M3R A;  1VQ9 N;  1HYV A;  2RPI A;  4Z4H A;  4EP4 A;  3J7Y P;  1ATR A;  1TK8 A;  2W6L A;  3U6F A;  1C0U A;  3VQE A;  2OPQ A;  3MXM A;  3AO2 A;  1TVR A;  1YIT N;  3VQB A;  4CGG A;  4CEZ A;  4CFA A;  4W5Q A;  5AQV A;  5HBM A;  4CZF A;  2QW9 A;  5K14 A;  3MMV A;  4CHZ A;  3K5O A;  4H0T B;  3IFR A;  1IBL K;  1OH7 A;  3DLE A;  3VGL A;  3M8Q A;  3L3U A;  3HT3 A;  2FSK A;  2ZM6 K;  4CK2 A;  3U9Z A;  5AQR A;  5FPM A;  1YVU A;  3SNN A;  2AP1 A;  3SJJ A;  2QK9 A;  5FPN A;  1GLJ O;  1KFS A;  1LAW A;  4JRQ A;  4FWR A;  2D5R A;  3KHY A;  1IG9 A;  3AGK A;  4NCA A;  4FWK A;  5AR0 A;  1YTU A;  1NKE A;  2O8F B;  4LH4 A;  3PX0 A;  3CM6 A;  3O9R A;  1RT5 A;  3GBT A;  2QKB A;  5JLH A;  1VAZ A;  4DU1 A;  4CVN E;  3VTI A;  2F7T A;  4O5F A;  3PO5 A;  3E9P A;  1GLF O;  1VQN N;  1IKW A;  1KCF A;  3OBY A;  1QSL A;  4FLW A;  3VEZ A;  3OJU A;  4FWO A;  2P9I B;  2DFF A;  2IS3 A;  2IDO A;  1Q86 O;  3CFO A;  2Q0R A;  1U6Z A;  2P9L A;  4BWM A;  1XMQ K;  3FFI A;  5FDL A;  1NGH A;  3CM5 A;  4CGJ A;  3CME N;  4JHD A;  3G6E N;  3DXK A;  3KWG A;  4B3R K;  5EOY A;  3K57 A;  3AV9 A;  4JI8 K;  2A40 A;  1ZBI A;  4JAX A;  1HX1 A;  4CW7 B;  4KAZ A;  1J9A A;  4FLX A;  1UOC A;  2G8H A;  3SQ4 A;  3HZ6 A;  2DPN A;  5I9E B;  3LL3 A;  4JKF A;  2P1J A;  1KTQ A;  1NJY A;  3HP6 A;  1NMD A;  1T3V A;  1L5U A;  1YJW N;  2HVI A;  5TKY A;  3VET A;  1RDC A;  1C0F A;  2E1Z A;  2VG5 A;  2P9I A;  2G8K A;  3DXK B;  4F3T A;  1NGF A;  2ASM A;  3TTD A;  1YJN N;  4OO1 J;  2VG6 A;  1T6D A;  3L4Q A;  3CJ7 A;  4Y1C A;  3SUQ A;  4M7X A;  4DR6 K;  3THX A;  4DSL A;  2O8C B;  1HYS A;  3DLL L;  3HVT A;  4FJI A;  3VGK A;  4PWD A;  3NBP A;  2ZJP L;  3NCI A;  3ZT1 A;  3CC2 N;  2E8A A;  4GV6 A;  1BUP A;  4KBO A;  5AQO A;  4BE1 A;  3V9Z A;  4KHQ A;  2CH5 A;  4MO4 A;  1HJR A;  3ZT3 A;  3RMB A;  5EXW A;  4AHS A;  3HOS A;  1T6C A;  3CCR N;  2ZE2 A;  1WN7 A;  4JKH A;  2JGU A;  5HP1 A;  1WSF A;  3BDP A;  3KK1 A;  2CGK A;  3QNN A;  3TAQ A;  1TK0 A;  2QI2 A;  4CJE A;  1GLL O;  3AVJ A;  4FM0 A;  2QWN A;  1I3A A;  4CJL A;  2OZM A;  4WFA L;  2D0A A;  4IDH A;  5AFU A;  2R7Y A;  4O5B A;  4LF4 K;  4FWN A;  1KVA A;  4EIA A;  5GAH P;  3MN9 A;  2V51 B;  4U67 L;  5AZI A;  3QEP A;  2P9U A;  1BU6 O;  4JS5 A;  4CF9 A;  3LP0 A;  2A42 A;  2P51 A;  4N5S A;  3CCV N;  4B3T K;  2V7Z A;  1KRP A;  4EHU A;  1BQN A;  5D3G A;  2EWS A;  2BDP A;  4C8L A;  1VSL A;  3K58 A;  2V52 B;  4BC3 A;  4BRK A;  4YDU A;  3HOT A;  4XEI A;  3IUC A;  4CFC A;  4DFP A;  4K8X A;  4B9L A;  2E20 A;  4DF4 A;  4YOV A;  5JIC A;  4W5N A;  4FSV A;  4CIF A;  5AQZ A;  2AJQ A;  4CFB A;  3TSU A;  4WFB L;  4JYA K;  4CZJ A;  3SAF A;  4Z0U A;  2X78 A;  4BRA A;  2UUB K;  4XIU A;  1BWF O;  3ZSW A;  4BRE A;  1Z6R A;  3MN6 A;  3OYA A;  3ZSV A;  1LW2 A;  3H08 A;  4X66 K;  4AM6 A;  4FZZ A;  3NFA A;  4HTL A;  3VQP A;  5C12 A;  1JCF A;  5AQM A;  4DV5 K;  3H3N O;  4JK9 A;  2G8W A;  1BG3 A;  4RW7 A;  2UUC K;  3MCP A;  1JLE A;  1DKG D;  4CJR A;  4JN4 A;  1A5W A;  5AQK A;  4NB4 A;  3L2U A;  1LAV A;  3IMX A;  3BP8 A;  5M1P A;  3QIN A;  2O8B A;  1N36 K;  1NGC A;  2D0P A;  3S41 A;  3VPZ A;  2UU9 K;  4HWI A;  2A1R A;  4FXD A;  4CEE A;  4CZI A;  4ELV A;  5KGW A;  3R6M A;  4M3Z A;  3VES A;  2B6A A;  4NO7 A;  1J53 A;  1UAX A;  3LDO A;  5DMR A;  4OPK A;  4CHY A;  4FK4 A;  3VEV A;  1X1P A;  2E2N A;  2VCP A;  4A57 A;  5BRD A;  4FWP A;  5AFU H;  3TAM A;  4NYN A;  2QWM A;  1CZA N;  1XQS C;  1QVF M;  1Z25 A;  3P5J A;  1JL1 A;  4ISE A;  4E0D A;  3EE8 A;  1QSS A;  1NM1 A;  3L2Q A;  3NAE A;  2GV9 A;  3WNE A;  3D45 A;  1ASU A;  3KVG A;  4Z4F A;  1NGG A;  1J5O A;  3A0I X;  4LFA K;  3THY A;  3SLC A;  4IXC A; 
#chains in the Genus database with same CATH homology
 2HHW A;  1SUQ A;  4CED A;  4JS4 A;  4CF1 A;  3VQC A;  4DQI A;  4H4O A;  5C25 A;  1KSP A;  4F2S A;  3RWU A;  4M3X A;  3RMA A;  4NCG A;  4CE9 A;  4CJS A;  3AO5 A;  2OYQ A;  4EZ6 A;  4KKO A;  1JL2 A;  4CJK A;  4OJR A;  4CEC A;  1S1X A;  4BDY A;  3DYA A;  2IGI A;  3SYZ A;  4AHR A;  3T3F A;  4DFK A;  4UQG A;  1FKP A;  4ID5 A;  5HRN A;  2QKK A;  1SV5 A;  4NCB A;  2G8I A;  2HW3 A;  4ZHR A;  1HNI A;  2O4G A;  1S1W A;  1VSE A;  3RRH A;  2XY7 A;  4HTU A;  2HHU A;  3OS0 A;  4M41 A;  4DTX A;  2WON A;  5T7B A;  3OYG A;  1NJW A;  1JLC A;  3I0S A;  3I0R A;  1LWE A;  1REV A;  2D0B A;  4FCY A;  1NK4 A;  3QNO A;  4DMN A;  3L3V A;  3ITH A;  4CIE A;  1TAQ A;  3MED A;  3DRR A;  2B5J A;  1UA1 A;  3F73 A;  1NK6 A;  1JLF A;  1TL3 A;  4DSK A;  4CK3 A;  4MQ3 A;  4CJ5 A;  1RTJ A;  1RT2 A;  4CF2 A;  3LDS A;  3VQA A;  4I7F A;  3SQ0 A;  4ZTJ A;  1N6Q A;  3AVK A;  3S9H A;  1WSE A;  1VSK A;  3CFR A;  2FBY A;  3LP3 A;  3M8R A;  3AVN A;  4OGE A;  4HUE A;  5J2P A;  1NKB A;  4KPY A;  4GMJ B;  4OKJ A;  3BGR A;  3L8B A;  4OPJ A;  4DTJ A;  3LPU A;  4G1Q A;  4AHT A;  4AH9 A;  3NH2 A;  4M3T A;  1SKS A;  4FVM A;  4DF8 A;  1NKC A;  3U3Y A;  1S6P A;  3SQ1 A;  4CHP A;  4DTS A;  1VRU A;  3ZSX A;  4KI4 A;  1RDD A;  1BIZ A;  2EX3 A;  3KLG A;  3ISN C;  1CLQ A;  1BIS A;  3OJS A;  2ITG A;  2Z1I A;  4E7K A;  3VQQ A;  1WAJ A;  4QAG A;  4IDK A;  4KTZ A;  3RTV A;  3DLB A;  3QES A;  1I39 A;  1IKX A;  4AHU A;  2HHT A;  4FLY A;  4CJU A;  5JS1 A;  4OKE A;  3VQ8 A;  3TAP A;  4B9U A;  3AVC A;  3OYK A;  3IG1 A;  1HYZ A;  4ELU A;  4DLE A;  4I9L A;  3O4N A;  4KFB A;  4JRP A;  4DQS A;  4NYF A;  4Z4I A;  4B8C A;  3DOL A;  4CHO A;  4BAC A;  1QSY A;  4HUF A;  3AVM A;  4Z4E A;  4KRF A;  2KZM A;  1LWC A;  3QO9 A;  1FXX A;  4FJJ A;  3JSM A;  3OYL A;  2OPR A;  1VSJ A;  4QCL A;  2HNY A;  4CEO A;  5FRM A;  3HVR A;  1ZBU A;  4E7H A;  1VSF A;  3OYC A;  3EY1 A;  1Q9Y A;  4EP5 A;  4PUO A;  4LSL A;  2OA8 A;  1JLA A;  2YNI A;  1JKH A;  3QLH A;  1LWF A;  4DU4 A;  1DTQ A;  4KTW A;  1ZBF A;  3HXM A;  2E6L A;  3IRX A;  3SCX A;  4CK1 A;  1WSJ A;  4O0I A;  1A5V A;  4DQP A;  4KRE A;  1C1C A;  3TAN A;  5CYQ A;  3HM9 A;  4OGC A;  2Y1J A;  2FBT A;  3V1R A;  2VWJ A;  3QEI A;  1ASV A;  3DI6 A;  1U49 A;  4ICL A;  1RTI A;  3CYM A;  3K59 A;  1BQM A;  5KI6 A;  1ZBH A;  2XO7 A;  3QET A;  4EZ9 A;  5FRN A;  3KLI A;  5C42 A;  3HPG A;  1A5X A;  4IG0 A;  3KLF A;  4E3S A;  1LV5 A;  2PYJ A;  2KQ2 A;  2WOM A;  3OYJ A;  4DTR A;  1LW0 A;  4I2Q A;  3RMD A;  3QER A;  2BGG A;  4CGF A;  3S3N A;  3C94 A;  1BI4 B;  1JLG A;  3QEV A;  3HJF A;  4LH5 A;  3ZSZ A;  4KV8 A;  1F21 A;  4CF8 A;  1U04 A;  4HCC A;  4KB1 A;  1S5J A;  3I8D A;  1RTH A;  1WNS A;  4E19 A;  4CJ4 A;  1NOY A;  3D0P A;  5J1E A;  5CY4 A;  2XY8 A;  1XI1 A;  1KVC A;  3U3G A;  4DSJ A;  5SZT A;  1QE1 A;  4CJ3 A;  3CQ8 A;  4WE1 A;  1ZBL A;  4M3Y A;  2X74 A;  3OYM A;  2PYL A;  1B9D A;  1XC9 A;  4BDP A;  4FJN A;  4KTQ A;  3S3O A;  1RCH A;  4HVJ A;  4PA1 A;  3LAM A;  1U45 A;  2FC0 A;  1KVB A;  1T05 A;  3T19 A;  1J54 A;  3HYF A;  1EXQ A;  4HHT A;  4IFY A;  3SUO A;  3KIO A;  4KHU A;  4GW6 A;  4IBN A;  1NK9 A;  3L2R A;  4E7J A;  2D0C A;  1Y97 A;  3ZT4 A;  1D9F A;  4CGD A;  3VQ9 A;  3S3M A;  1C6V A;  1W9H A;  3LAK A;  2YNF A;  4BE2 A;  3SUN A;  1BCM A;  5DK5 A;  1QQC A;  1RT7 A;  1U48 A;  4KHY A;  4ELT A;  2OPS A;  4B9V A;  3O3G A;  2DY4 A;  1WSG A;  1DTT A;  4CJQ A;  4DU3 A;  3DM2 A;  3TAB A;  2Z1H A;  5HRR A;  5HLF A;  3DRP A;  2ATQ A;  3ZSO A;  1VSH A;  2DTU A;  4DWI A;  2A1S A;  1HMV A;  3V9X A;  1WLJ A;  3AO1 A;  1RBT A;  1XWL A;  2BAN A;  4M3R A;  3VQ5 A;  1X9M A;  1TKD A;  4OLA A;  1HYV A;  2RPI A;  4Z4H A;  4EP4 A;  1TV6 A;  4AHV A;  1VSI A;  3HL8 A;  1TK8 A;  4B08 A;  3U6F A;  3THV A;  1C0U A;  3VQE A;  2OPQ A;  2ZQB A;  3MXM A;  2HHS A;  4ZTF A;  3AO2 A;  1TVR A;  3DLG A;  3AA5 X;  2YNG A;  3VQB A;  1BCO A;  4CGG A;  4CEZ A;  3SPY A;  4F8R A;  4FYD A;  4DSI A;  1TAU A;  4CFA A;  4W5Q A;  1RBU A;  3RRG A;  4E7I A;  4DS4 A;  1RIL A;  5HBM A;  2HB5 A;  3CFP A;  1TGO A;  1BL3 A;  3MEE A;  4KO0 A;  3IAY A;  5K14 A;  2KW4 A;  4CJF A;  4CHZ A;  1IKY A;  3K5O A;  2HHX A;  4LY7 A;  3O3F A;  1ASW A;  3DLE A;  3M8Q A;  3L3U A;  1QS4 A;  3HT3 A;  4DQR A;  3RMC A;  3AVL A;  4CK2 A;  2KFN A;  2HHQ A;  4E1M A;  2G8F A;  4FLU A;  1EET A;  4OVL A;  3T1A A;  3SNN A;  1YVU A;  3P83 D;  4PQU A;  4CJV A;  3LZJ A;  3G10 A;  2F96 A;  4HUG A;  4DFJ A;  3OYF A;  3K5M A;  3SJJ A;  4FZY A;  2QK9 A;  4W5T A;  3TAR A;  4W5O A;  1KFS A;  1LAW A;  3ZCM A;  5J2N A;  1EP4 A;  4CEB A;  4JRQ A;  4BE0 A;  2D5R A;  3V1Q A;  1IG9 A;  3SI6 A;  1YTA A;  4I2P A;  4KHS A;  1HQE A;  1D5A A;  3AA3 A;  3KTQ A;  4FJ5 A;  1S1V A;  5CZ1 A;  4NCA A;  1YTU A;  5JS2 A;  1X9W A;  4PY5 A;  3ZT0 A;  1NKE A;  1HRH A;  4LH4 A;  1EKE A;  3PX0 A;  3MXJ A;  2VG7 A;  1WSI A;  3LP2 A;  2XY6 A;  3TI0 A;  3CM6 A;  3ULD A;  1RT5 A;  4R5P A;  4DLG A;  3PUF A;  1DLO A;  3K5L A;  2QKB A;  1RBR A;  4DU1 A;  4C8K A;  1WAF A;  3NF7 A;  2XHB A;  4OKK A;  3OYD A;  3CG7 A;  1MU2 A;  3PO5 A;  4RG8 A;  2KFZ A;  3HP9 A;  3M8S A;  4J2B A;  3VA3 A;  1IKW A;  1KCF A;  2JLE A;  5HRO A;  1QSL A;  4FLW A;  3OJU A;  3TAG A;  4N47 A;  3DOK A;  4RW6 A;  2DFF A;  1RBV A;  1C0T A;  1W0H A;  2IS3 A;  4QOZ B;  4FK0 A;  4BDZ A;  2IDO A;  3CFO A;  4CCH A;  3NF8 A;  1TKZ A;  2E4L A;  1KLN A;  4BWM A;  3OYB A;  4FJ8 A;  1IH7 A;  3FFI A;  5J2Q A;  2KTQ A;  5FDL A;  3DLR A;  2HHV A;  2X6S A;  1S1T A;  3CM5 A;  2GBZ A;  4CGJ A;  3LPT A;  4B9M A;  2Z1J A;  2FBV A;  1UA0 A;  2EHG A;  3TR8 A;  4FJH A;  4DFM A;  4B9N A;  3KKR A;  3K57 A;  2Y1I A;  3O3H A;  3AV9 A;  3AVG A;  3WNH A;  3LP1 A;  2P5G A;  3MEG A;  5HRS A;  4LSN A;  1ZBI A;  1S9E A;  4KAZ A;  1TKX A;  1J9A A;  3B6O A;  3VQ4 A;  2RKI A;  4F4K A;  1VRT A;  4FLX A;  3NGY A;  1UOC A;  2ETJ A;  1SL1 A;  2G8H A;  2XRI A;  3A2F A;  3SQ4 A;  3OYE A;  1FK9 A;  5KRS A;  3QEX A;  1C1A A;  1RT1 A;  1KTQ A;  1TKT A;  2P1J A;  4GVM A;  1XHZ A;  1NJY A;  3HP6 A;  4KHW A;  1BHL A;  2I5J A;  3AVH A;  4OLB A;  1L5U A;  4J2A A;  2HVI A;  2ZD1 A;  3IS9 A;  1RDC A;  4FJX A;  1RT3 A;  3ZSY A;  4N56 A;  2VG5 A;  3JYT A;  3SZ2 A;  1VK0 A;  4M45 A;  3L2W A;  1CZB A;  4O0J A;  2G8K A;  1UWB A;  4RW9 A;  5FRO A;  1CXU A;  1NOZ A;  3LWL A;  1L3T A;  4B9T A;  4F3T A;  4BWJ A;  1NK8 A;  2VG6 A;  4DS5 A;  2OPP A;  5CZ2 A;  2YNH A;  4Y1C A;  3SUQ A;  1G15 A;  3PX6 A;  4DSL A;  1HYS A;  4JLH A;  4FJI A;  3HVT A;  1TK5 A;  2RN2 A;  3VQ6 A;  4CER A;  4PWD A;  3NBP A;  3ALY A;  1Q8I A;  3PO4 A;  4AHC A;  3NCI A;  3ZT1 A;  4FK2 A;  1U4B A;  2LSN A;  3B6P A;  3F9K A;  3AVB A;  4FJM A;  3QIO A;  4BE1 A;  3V9Z A;  4FZX C;  4KHQ A;  3ZT3 A;  1HJR A;  1YT3 A;  1NK7 A;  3C6U A;  4FLZ A;  3RMB A;  1SL0 A;  1JXE A;  3V1O A;  4IKF A;  4M3W A;  2DFE A;  3NF9 A;  4AHS A;  1D9D A;  2ZE2 A;  3AVI A;  1WN7 A;  3LAL A;  1VSD A;  5I3U A;  1N5Y A;  5KGX A;  5J2M A;  3PY8 A;  4KI6 A;  2JGU A;  5HP1 A;  1WSF A;  1T7P A;  4LD0 A;  5KTQ A;  3OS2 A;  4E89 A;  3BDP A;  3KK1 A;  3OS1 A;  3WNF A;  2FBX A;  3QNN A;  1Q9X A;  3MEC A;  3NH0 A;  3TAQ A;  1TK0 A;  2HND A;  2YHB A;  4H4M A;  1NK0 A;  2O4I A;  4O55 A;  1TL1 A;  1NJZ A;  4CJE A;  4CEF A;  3AVJ A;  4FM0 A;  1I3A A;  3M8P A;  3V9U A;  3HPH A;  4CJL A;  1CZ9 A;  2OZM A;  3KD1 E;  4J2E A;  3P1G A;  2D0A A;  4N41 A;  3VA0 A;  2R7Y A;  4O5B A;  1B9F A;  2BE2 A;  4FLT A;  4K8Z A;  1KVA A;  5EU7 A;  2Z1G A;  3QEP A;  1JXB A;  3K2P A;  4Z4G A;  4C8M A;  3V81 A;  3AO3 A;  3VN5 A;  2VWK A;  4CF9 A;  4O4G A;  4JS5 A;  4H8K A;  5I42 A;  4DG1 A;  3LP0 A;  1C0M A;  5C24 A;  4N5S A;  2P51 A;  2RF2 A;  3VQ7 A;  2YKN A;  3KK3 A;  3LZI A;  1KRP A;  4DQQ A;  4CEA A;  4CGH A;  1BQN A;  5D3G A;  4E1N A;  3HO1 A;  2PY5 A;  5E41 A;  2BDP A;  3NF6 A;  4C8L A;  4CJP A;  4W5R A;  1VSL A;  3K58 A;  2KZZ A;  2YV0 X;  2YKM A;  3VQD A;  4CIG A;  3MAQ A;  3HPO A;  1L3U A;  4FJ9 A;  4FW2 A;  1BIU A;  1T8E A;  4DFP A;  4CFC A;  2G8U A;  1ZYQ A;  4I9Q A;  4Z4C A;  2E6M A;  4K8X A;  4B9L A;  3AVF A;  4CHQ A;  4DF4 A;  4N76 A;  4CEQ A;  4B8A B;  4W5N A;  4YNQ A;  3ZT2 A;  3KLH A;  4FW1 A;  3DLK A;  1S1U A;  1RDA A;  4CIF A;  3C6T A;  3G0Z A;  4CJT A;  5HRP A;  5SWM A;  3PX4 A;  4DTM A;  1RT6 A;  3DRS A;  3KK2 A;  1R0A A;  2AJQ A;  4CFB A;  4C8N A;  3DMJ A;  3QEW A;  1NJX A;  4Z0U A;  4DTN A;  3V4I A;  2X78 A;  4XIU A;  4FM2 A;  4CHN A;  4Y1D A;  3RR8 A;  2G8V A;  3ZSW A;  3LAN A;  3OYA A;  4DSE A;  3SQ2 A;  3ZSV A;  2HMI A;  4F2R A;  1LW2 A;  4AIL C;  2NUB A;  3H08 A;  4CES A;  3ZSQ A;  1KFD A;  3OYI A;  1D8Y A;  1HNV A;  4L8R B;  4FZZ A;  3NFA A;  4FJL A;  4DTU A;  4HCB A;  3VQP A;  2F8T A;  4DSF A;  4FLV A;  4CFD A;  1HPZ A;  2G8W A;  3NGI A;  4J2D A;  2OZS A;  4RW7 A;  2GUI A;  3V9W A;  2P5O A;  1JLE A;  4E7L A;  1S6Q A;  2X6N A;  1L3V A;  1HQU A;  1QHT A;  4CJR A;  1A5W A;  1C1B A;  4IFV A;  4IG3 A;  4B9S A;  3V6D A;  2IC3 A;  4C8O A;  3AA4 A;  2XY5 A;  3MXI A;  3KLE A;  3L2U A;  3C95 A;  1LAV A;  1NK5 A;  4ID1 A;  4RW8 A;  3TAE A;  1WSH A;  1GOB A;  1RBS A;  2IOC A;  3QIN A;  1T03 A;  1KLM A;  2B4J A;  1K6Y A;  3EZ5 A;  2YHA A;  3SV4 A;  3SUP A;  1O1W A;  2W42 A;  3PV8 A;  1B92 A;  1XHX A;  3E01 A;  1QTM A;  1RNH A;  1SKW A;  4FJK A;  2HVH A;  4CGI A;  4KB0 A;  1IO2 A;  1RT4 A;  2A1R A;  4FXD A;  4TSX A;  5KRT A;  3OY9 A;  1SKR A;  4CEE A;  3QIP A;  4ELV A;  3NE6 A;  5KGW A;  3AO4 A;  4RW4 A;  3OYH A;  4DTP A;  4M3Z A;  1FKO A;  2B6A A;  2DFH A;  1J53 A;  1UAX A;  1GOC A;  5DMR A;  4OPK A;  3O4Q A;  1JLB A;  4CHY A;  1X1P A;  1X9S A;  4FK4 A;  4Q0B A;  4FM1 A;  4DTO A;  1JLQ A;  3KKS A;  4CF0 A;  2PZS A;  1IKV A;  1RDB A;  3NGZ A;  3RR7 A;  4FJ7 A;  1BI4 A;  3SPZ A;  3TAM A;  4NYN A;  3ZSR A;  1SL2 A;  4F3O A;  1CXQ A;  3NHG A;  3KJV A;  3L2V A;  1L3S A;  3SV3 A;  1Z25 A;  3NH1 A;  3UIQ A;  3P5J A;  1JL1 A;  4CJW A;  1U47 A;  3LWM A;  3WNG A;  4E0D A;  4B3O A;  1QSS A;  3TWH A;  3AVA A;  2IAJ A;  3L2Q A;  3TAF A;  3NDK A;  2Q3S A;  3NAE A;  3OYN A;  2GV9 A;  4O44 A;  1RTD A;  3WNE A;  3K5N A;  2F8S A;  4M3U A;  1ITG A;  3D45 A;  1ASU A;  1Z26 A;  3HST B;  3EYZ A;  4KHN A;  1VSM A;  1GOA A;  4M42 A;  4Z4F A;  4FJG A;  3V9S A;  2HNZ A;  2QXF A;  1J5O A;  5CYM A;  4MFB A;  3OVN A;  1EX4 A;  3ASM A;  3DLH A;  3AA2 A;  3HK2 A;  1S9G A;  3KD5 E;  1BGX T;  4Q5V A;  4YFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...