2FC0A

Wrn exonuclease, mn dgmp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fc0A00
3MECA 4DFKA 1EXQA 4DTMA 2IC3A 4CEFA 3SV4A 2HNDA 3SCXA 3KD5E 1JXEA 1S9GA 1RDCA 4BE2A 1S1VA 4F2RA 2KFNA 4BE0A 3KD1E 4Z4IA 4AILC 1QSYA 2QK9A 2F8TA 3O3FA 1U47A 4AHCA 3DYAA 5J2NA 2WOMA 3O3GA 1IG9A 2D0CA 2ZQBA 1TK0A 3AO2A 1EX4A 3PO5A 3ALYA 4DSKA 3L3UA 4CF0A 2HMIA 1TL3A 4BDPA 3E01A 3VA3A 1BCMA 1SKSA 4KTZA 1KRPA 3V9UA 1EETA 3P83D 4I2PA 1S6PA 4LSNA 3NH2A 4DFPA 4FJ8A 1YTUA 3DOKA 4ZHRA 3PX0A 5HP1A 4OPJA 4E19A 3KK1A 3RMCA 1WAFA 4E7HA 3THVA 4B9NA 4OLBA 1U45A 3O4NA 3OY9A 2KZZA 4O0JA 2GV9A 1RT1A 3EZ5A 4FLWA 3LAKA 4J2AA 3SYZA 3AVBA 1UOCA 4PQUA 3AVKA 1U4BA 4ID5A 1RDDA 2X74A 3DLGA 1CZ9A 4LH4A 4RG8A 1WSFA 1B92A 2HNYA 4CF8A 4EP5A 3S3MA 2FBTA 4DTRA 1NKEA 1T7PA 3TWHA 1NJWA 5HROA 2IS3A 4CFBA 2G8VA 3QEXA 4ICLA 3DLEA 4F2SA 4DS4A 3OYDA 4DQSA 1NJYA 5D3GA 4OKEA 4LD0A 4CJVA 5JS1A 1ZYQA 1YVUA 4BE1A 5HRSA 4WE1A 3BDPA 4B9MA 2BE2A 4DMNA 3DMJA 1L3UA 1RBSA 3SQ2A 1QQCA 2OZMA 5CYQA 4B08A 4KRFA 4CIGA 4C8NA 4CEAA 4DTPA 4Z4FA 3ZSRA 1ASVA 1JLCA 1YTAA 3TANA 4IG0A 1C0TA 3DLBA 4LH5A 1BIUA 3L2WA 4ELVA 1X1PA 3T1AA 2LSNA 4FM0A 1HRHA 1B9DA 3G0ZA 4CF2A 3KLFA 3BGRA 4E7IA 4DTNA 1XI1A 3L3VA 3KLEA 3QEPA 3EY1A 1RBVA 3MXMA 3ZT1A 4AHTA 4Z4GA 2OPQA 2QKBA 3ULDA 1WSEA 1Z26A 4CERA 1NK5A 4JRQA 3CM6A 1TK8A 1S5JA 1U48A 3VQAA 2JGUA 2OA8A 1Z25A 3PV8A 5SWMA 4N76A 4QOZB 2D5RA 3B6PA 3CM5A 3SUNA 4B9SA 1RBUA 4JS5A 3TAPA 1VSHA 5CY4A 2QKKA 4HUGA 1RBRA 3KKSA 4JLHA 4AHRA 3IS9A 4ELTA 3K5OA 3M8RA 3VA0A 3TAGA 4FCYA 1NJXA 2P5OA 1QSSA 3VQ5A 3PO4A 2YNHA 2BGGA 3VQDA 4RW9A 3AO3A 3TARA 2PZSA 3L2QA 1U04A 4O4GA 4BWJA 3VN5A 4DU3A 1RTIA 2E6MA 3ZSQA 4IBNA 1VSLA 3SI6A 4B9UA 1IO2A 2G8WA 2XRIA 4YFUA 3NE6A 4YNQA 2ITGA 4CJLA 3V9XA 1CZBA 3ITHA 4KREA 2OYQA 3AVAA 3HO1A 3I0SA 3U3YA 3VQPA 4CGFA 1NJZA 4F3OA 5J2QA 4CJPA 4MFBA 4KHNA 1NK4A 3LANA 3D0PA 3ZSVA 3DM2A 3NF9A 4DSEA 4FM2A 1XWLA 4E0DA 2O4GA 1QE1A 2DFHA 1T03A 2W42A 4CGHA 5KI6A 3V9ZA 3SNNA 1J5OA 3NAEA 1D9FA 2GUIA 1LAVA 4KI6A 1RDAA 4RW6A 3V1QA 2B6AA 5FROA 4FXDA 1TAQA 3VQ9A 3WNFA 3SUPA 1ZBIA 4BWMA 4N41A 4M3XA 4CIEA 3ZCMA 2G8HA 4NCGA 1EP4A 3ZT3A 4LSLA 2D0AA 4FM1A 3ZT4A 4B8CA 3AVMA 4FLYA 3OJUA 1ZBUA 4DF4A 3PX4A 2ZD1A 1WN7A 4H4MA 3VQBA 3RR7A 1S1WA 4W5NA 1D9DA 3LP2A 3CG7A 2ATQA 1T8EA 1BI4B 4K8XA 1IKWA 2Z1GA 2VWKA 4OLAA 3QESA 4DS5A 1HPZA 4IKFA 4CHNA 4DF8A 5FDLA 4CF9A 1J53A 3V6DA 3LZIA 3B6OA 4RW8A 3KKRA 1C0MA 1WNSA 4W5OA 3NF8A 5HBMA 3OYAA 5DK5A 4IG3A 3AO5A 3QEIA 1U49A 1SKWA 4KB1A 4PWDA 4E89A 3AVLA 1CLQA 4HUFA 4CHOA 4OGEA 1J54A 1LWEA 4DG1A 1NKCA 5I3UA 3TAEA 1ASUA 4B9TA 2AJQA 2RKIA 2PY5A 4I7FA 1SKRA 3HJFA 3OYEA 4J2DA 3AV9A 5J2PA 3LWLA 1B9FA 1HYSA 5DMRA 1RT2A 1WAJA 3ZSWA 1RT4A 4M3WA 4IFVA 3DOLA 5FRMA 4O5BA 2Y1JA 4N5SA 1DLOA 1ASWA 3CFRA 4FZXC 2DY4A 1TK5A 3M8QA 1O1WA 4O44A 4QAGA 4FK2A 3O4QA 3OVNA 3K5MA 2HB5A 1SL0A 1JXBA 2IAJA 2G8UA 3OYKA 2QXFA 3TI0A 3QO9A 2R7YA 4CGGA 3MXJA 1DTQA 1WLJA 4W5TA 4CJTA 1I39A 1RILA 4FJIA 4OJRA 3LDSA 1NK7A 3S3NA 3JYTA 2I5JA 4Y1DA 2EHGA 3DRPA 4E1MA 4O0IA 4H8KA 1RTHA 3EYZA 4M45A 4M41A 3MEGA 4JRPA 4E7LA 4FJGA 1HYVA 4FLVA 1HNVA 4DTSA 1A5WA 4M3YA 2Z1JA 4NYNA 4IDKA 4AH9A 5C42A 4EZ9A 3G10A 3AVIA 4GW6A 2X78A 3AO1A 4PY5A 1Q9XA 4FYDA 1CXQA 3TAMA 4EP4A 3K2PA 3D45A 1ITGA 2A1SA 1SV5A 1C6VA 3I0RA 4OKKA 4CFDA 3NF7A 3K59A 3CQ8A 3DLRA 1SL2A 4N56A 4DTOA 4DQPA 1IKYA 3RTVA 3V4IA 4Q0BA 1RTJA 3LALA 3CYMA 3C6TA 1EKEA 1K6YA 1F21A 1LW0A 4H4OA 3QLHA 4K8ZA 3AVGA 4FK0A 3PUFA 4CFCA 3OYNA 3OS0A 3F73A 1NK9A 1JL2A 2VG5A 2Q3SA 4KTWA 1HJRA 3LP0A 5SZTA 3KK3A 3NHGA 4DWIA 1VSKA 1TAUA 3V81A 4FK4A 1X9WA 3VQEA 3LPTA 3L2UA 4J2BA 2RPIA 3HVTA 3V9WA 4KHUA 4KPYA 3I8DA 1VRTA 2P1JA 3NFAA 3ZSZA 2F8SA 2HW3A 2NUBA 3VQQA 1HQUA 1XHXA 4E7KA 2OPSA 4FJ5A 1ZBHA 3NF6A 3C95A 4IFYA 3ZT2A 4B9LA 4OKJA 2HHUA 4Q5VA 1BQNA 2ZE2A 4CEDA 2VWJA 4F8RA 2KFZA 2EX3A 3OS1A 1KFDA 4KO0A 4C8MA 3IG1A 4CJ5A 3L2VA 3OS2A 1IKVA 3M8SA 1NK8A 5FRNA 3AVFA 2YHBA 1BHLA 2OPPA 5KRSA 3CFPA 2P5GA 2HVIA 4I9LA 2D0BA 3O3HA 3RWUA 4Y1CA 4DQRA 4CEEA 5KRTA 1CXUA 1TKXA 5HLFA 3QNOA 4FW2A 3SQ4A 1UA0A 4DSLA 4AHVA 3MEDA 4KHSA 1NOZA 3QIOA 2HVHA 2PYJA 1RT6A 3MEEA 3RMAA 2HHVA 2Z1IA 4DSJA 3OYCA 4FJKA 1RBTA 2JLEA 4MQ3A 3MAQA 3OYGA 4L8RB 3LZJA 1LV5A 2FBYA 4F3TA 1REVA 4ZTJA 4Z0UA 4HTUA 4BACA 3C6UA 2VG6A 1BL3A 4CGIA 1BGXT 3HP9A 3OYFA 1TVRA 2YKMA 3PX6A 3ZSXA 5E41A 3RRGA 1S9EA 2YNGA 3A2FA 3UIQA 3LP3A 1WSHA 3U6FA 4KAZA 3HYFA 3ISNC 4HVJA 3LP1A 5KGWA 1NK6A 3LAMA 1TGOA 3V1RA 1RT7A 1QTMA 4CK2A 1TKZA 5HRNA 1RT5A 3ZT0A 4ELUA 1KCFA 3SPYA 1I3AA 4CIFA 3RMBA 1TKTA 4E3SA 1BIZA 1BISA 4M3TA 1X9SA 1SL1A 2YHAA 3AVNA 3NBPA 3OYMA 1S1UA 4FLTA 3RR8A 3WNGA 2ETJA 4C8KA 1S6QA 3NGYA 1UA1A 4CEOA 4OGCA 4HCCA 4EZ6A 3KK2A 4B3OA 3VQ4A 4KKOA 2YNIA 3KJVA 3C94A 3NGIA 1KLNA 5KGXA 3T3FA 4J2EA 4N47A 1KVAA 1TKDA 1YT3A 5EU7A 3QERA 3SQ0A 4CJSA 4DFJA 1GOCA 1RT3A 5T7BA 3DLHA 5K14A 2Y1IA 3QNNA 1JLEA 3AA2A 4RW7A 3ZSOA 2XY5A 1XC9A 1T05A 3TR8A 3AVJA 1W9HA 3DLKA 2YNFA 4HUEA 4CHPA 2OPRA 3NH1A 3TAFA 4DSIA 3SQ1A 4CFAA 1C1AA 1SUQA 3SPZA 1S1TA 2E4LA 4CEQA 3U3GA 4DFMA 2XHBA 3KTQA 1L3TA 4KTQA 4FLZA 3JSMA 1TL1A 4DTJA 1C0UA 2G8KA 3HSTB 3TABA 4DQIA 1JLBA 2FC0A 2DFEA 5CZ2A 1GOAA 1J9AA 1KVCA 4Z4EA 3CFOA 3KLIA 5J2MA 2G8IA 1FKPA 4LY7A 1WSIA 4E7JA 5CYMA 5J1EA 4DTUA 4KB0A 2O4IA 1D5AA 1VSEA 4FJMA 3VQCA 3HT3A 4DSFA 3HPHA 3HXMA 4KI4A 4GVMA 3OYIA 4FJJA 1VRUA 4FJLA 1A5XA 4GMJB 3KLGA 1VK0A 4DU1A 1KTQA 1NKBA 4FJ9A 5JS2A 3T19A 4CJQA 1L3SA 4FJNA 4CECA 3RMDA 4ZTFA 1KLMA 3DRRA 3HPGA 4B9VA 3P1GA 1TV6A 3H08A 1L3VA 4NCBA 2Z1HA 3SZ2A 3QEVA 3ZSYA 1W0HA 3K58A 4KHWA 1C1CA 3DRSA 4UQGA 1JLQA 2YV0X 3NGZA 3K5LA 4HHTA 2IDOA 2X6SA 2KQ2A 5HRPA 4DTXA 4CJFA 1KFSA 4M3ZA 2DTUA 1Q9YA 3KIOA 1FKOA 1RNHA 1WSJA 4CEBA 3MXIA 1KSPA 2HHXA 2IGIA 4CHZA 4BDZA 3QIPA 3VQ8A 3HM9A 3TAQA 3HPOA 1BQMA 2FBXA 5HRRA 4CJ4A 2RN2A 2XY8A 3OJSA 1D8YA 3HVRA 2E6LA 2HHWA 2YKNA 4FJ7A 1VSDA 3M8PA 4Z4CA 4DLEA 4FLUA 1ZBLA 4NCAA 4QCLA 1QS4A 4CE9A 1JLGA 2WONA 1QSLA 4CCHA 3K5NA 4KHQA 3LWMA 1HMVA 4KFBA 4FJXA 4FJHA 1VSJA 3AA4A 4G1QA 3F9KA 4W5RA 4JS4A 1A5VA 1KVBA 1LWFA 3AVCA 4CJUA 1RDBA 2P51A 3QINA 4AHSA 3OYLA 1LAWA 3KLHA 3V9SA 4CJRA 3SV3A 4Z4HA 3RRHA 2DFFA 4CHYA 5I42A 2HHQA 3AA5X 4FZYA 1XHZA 4M42A 4OPKA 4CHQA 3P5JA 3NCIA 2F96A 1RCHA 2HNZA 2X6NA 4KV8A 4OVLA 3SUQA 3VQ7A 3IAYA 4BDYA 1RTDA 1QHTA 1R0AA 1HNIA 4CJ3A 4FW1A 1JL1A 3HK2A 2VG7A 2KTQA 1LW2A 3ASMA 1FXXA 3QEWA 3QETA 2XY6A 3S3OA 1HYZA 3HP6A 3AVHA 1NK0A 3NDKA 3HL8A 4I2QA 3K57A 4DU4A 4CF1A 3LPUA 4B8AB 1L5UA 5CZ1A 4W5QA 3SJJA 5KTQA 4DQQA 4I9QA 4XIUA 2G8FA 4CJEA 1IH7A 3NH0A 2PYLA 1MU2A 2A1RA 1BCOA 1Y97A 4C8LA 4PUOA 3SUOA 4ID1A 1VSMA 2HHSA 4AHUA 1UAXA 3L8BA 2HHTA 1GOBA 2KW4A 3OYHA 1G15A 4F4KA 3IRXA 4C8OA 2XO7A 1WSGA 1JLAA 2OZSA 4DLGA 2KZMA 4HCBA 4O55A 4CGDA 4NYFA 1DTTA 4CEZA 3AO4A 1S1XA 3OYJA 1UWBA 4M3RA 3S9HA 1N6QA 1LWCA 2BDPA 2B4JA 4TSXA 5C25A 3OYBA 4FLXA 1IKXA 4CK1A 3V1OA 1N5YA 1NOYA 1X9MA 1Q8IA 1FK9A 1VSFA 5C24A 3DI6A 1BI4A 2FBVA 3AA3A 4PA1A 2RF2A 4CK3A 4RW4A 4CGJA 3WNHA 1HQEA 2XY7A 3PY8A 2BANA 3VQ6A 4E1NA 1VSIA 4CJWA 2B5JA 4M3UA 4R5PA 4FVMA 4CJKA 1JLFA 3L2RA 2IOCA 4KHYA 3WNEA 3FFIA 4CESA 1ZBFA 1C1BA 1JKHA 2GBZA 4FZZA
chains in the Genus database with same CATH superfamily
2ITMA 4DTMA 2IC3A 3O9UA 5GAHP 3UKRA 4BE2A 1S1VA 4BE0A 2WC9A 3I8BA 4AHCA 5J2NA 2WOMA 2YHWA 2D0CA 5BREA 1EX4A 1T6DA 1WUAA 2HMIA 1SKSA 1YTUA 4LSNA 5IWAK 5KPZA 3AARA 4O8UA 1OKJA 3PX0A 5JICA 1WAFA 3THVA 4H5TA 2YJFA 3OY9A 2KZZA 3J7YP 1Q18A 3EZ5A 4FLWA 3R1XA 4J2AA 1U4BA 4JKBA 5TKWA 4FSVA 2X74A 4EP5A 2HNYA 5HROA 2G8VA 4CFBA 1Q86O 4LF5K 3UB5A 1XMOK 1YUWA 4B1ZA 4IOAL 5HRSA 1NG9A 5GIPA 3SQ2A 4JAXA 5CYQA 1BOTO 5H1SQ 1OH8A 1RDWX 4Z4FA 5AQHA 3ZSRA 3TANA 1C0FA 5EY4A 4FWRA 1S22A 3T1AA 1HRHA 2QEXN 1XI1A 3D2EB 1N36K 3KLEA 3QDKA 5BPLA 4KH4A 2A3ZA 1GLAG 3MXMA 1RBVA 2I7PA 4DV0K 4Z4GA 4LF6K 3O9TA 1WSEA 3EZWA 3VQAA 2F9WA 4DV1K 1Z25A 4JKGB 4CZJA 5BR8K 1HNZK 2D5RA 3B6PA 2QKKA 4HUGA 4AHRA 4ELTA 3EE8A 3K5OA 3O9QA 3VA0A 4FCYA 1QSSA 3VQ5A 4YOTA 2YNHA 3MN6A 3AO3A 2ZGYA 1U04A 4NLCA 4NXNK 4DUZK 2G8WA 3TTCA 3ITHA 3VQPA 4CGFA 5FPDA 4F3OA 3LANA 4B1VA 4YHHK 3NF9A 1XWLA 1T03A 3PLAA 3BZCA 5KI6A 1LAVA 5GINA 2B6AA 1YIJN 4IZ9A 1E4FT 1BO5O 4GKJK 4BWMA 2NRZA 4N41A 4CIEA 3JXUA 4LSLA 3AVMA 1ZBUA 3T1HK 3J7AP 4H4MA 2P9NA 2QTDA 4W5NA 3MN7A 1T8EA 1BI4B 2VWKA 4WCEL 3ZETB 4B1XB 4CF9A 3H6EA 3B6OA 4RW8A 4FPAA 1C0MA 4W5OA 5AQGA 5HBMA 3OYAA 3QEIA 4KB1A 4PWDA 4E89A 3BZKA 4H0TB 4BRFA 1NKCA 1Z6RA 3TAEA 1ASUA 3BUZB 3UKRB 2BTFA 2ASPA 1OH5A 1RT2A 1WAJA 2IIRA 4JD2A 3CFRA 4IO8A 4O44A 4OPHA 5KQ8A 3OVNA 1SL0A 4BR7A 2G8UA 4RCHA 2QXFA 2FSKA 4R79A 4CGGA 4K41A 1WLJA 2DPNA 4LFCK 1W2BM 1MWKA 1U6ZA 5F2RA 4KH5A 2I5JA 2EHGA 3DRPA 4O0IA 3EYZA 4H8KA 3VETA 2UXDK 4E7LA 4M41A 4EZ9A 1KAYA 3M3ZA 4IDKA 3SBGA 4BR0A 4IWVA 3J8AA 5F0XA 3AO1A 4PY5A 4EP4A 1KQSM 1SV5A 3I0RA 4OKKA 4IDHA 1SL2A 3NF7A 4DQPA 5AQYA 3RTVA 4Q0BA 3LALA 1HKBA 5LMNK 4H4OA 4K8ZA 3QBXA 1X3NA 4CFCA 3OYNA 5I9EB 1HR0K 1NK9A 1JL2A 2OANA 2VG5A 3MWTA 1X9WA 3OHRA 1HJOA 4KPYA 1T3VA 2P1JA 1IJJA 2IVNA 2F8SA 2HW3A 4FJ5A 1ZBHA 3WXLA 4IFYA 4B9LA 1FJGK 3CC4N 4DCHA 3VEZA 1EQYA 3TSPA 1YJNN 2KFZA 4KO0A 1BHLA 5KRSA 2D0BA 5BRHA 3O3HA 2CH6A 4CEEA 2H3GX 3QNOA 4FW2A 4JI0K 4AHVA 4M7XA 5AQFA 1NOZA 3CQXA 4CW7B 3H45C 2PYJA 2HVHA 1TUUA 2Z1IA 3M5RA 4MQ3A 2JLEA 5E26A 3MAQA 4X64K 3E9LA 1REVA 4PL7A 4B3RK 1BL3A 3HP9A 1TVRA 1S9EA 4WQ5C 1WSHA 4H0PA 5KGWA 3LAMA 2UXBK 4CK2A 1TKZA 4GV9A 1SQKA 1KCFA 3THWA 1I3AA 4CZFA 3RMBA 4FPBA 4E3SA 4JI1K 2YHAA 3NBPA 1KC8O 3RR8A 1S6QA 1UA1A 3KK7A 2P9NB 4B3OA 1HNXK 2NRXA 1TYQA 3TPQA 4FOEA 3D7EO 5KGXA 1YT3A 4CJSA 4CZGA 3DLHA 5M1OA 5B8HA 5M1QA 3EEQA 1JLEA 4RW7A 3QNNA 3AVJA 4YDUA 2YNFA 5F1XA 3SQ1A 4CFAA 2WUSA 1SUQA 3KTQA 3EL2A 1L3TA 4KTQA 1TL1A 4DTJA 3GE1A 3TABA 5C15A 1OH7A 4JI3K 2QWPA 3MX5A 1J9AA 3M6GA 4FOIA 4Z4EA 3CFOA 3KLIA 4JD2B 4KB0A 5CYMA 5J1EA 3TSQA 3HOTA 3ID6A 4BRLA 4V19S 5KPRA 2P9LA 1YI2N 1VRUA 3O1WA 1NGHA 5AQWA 4CECA 3DLLL 4XH5A 1KLMA 3DRRA 3P1GA 5FPEA 1ZXOA 4RTFD 1L3VA 2Z1HA 3ZSYA 3O80A 4KHWA 1G99A 3BDPA 2IDOA 4DTXA 3F5TA 4BRNA 4BDZA 3HM9A 3HPOA 2FBXA 3OJSA 4ISEA 2E6LA 2YKNA 1OH6A 2D0PA 3ULEB 2QWMA 2NRRA 3H46O 5LY3A 3LWMA 3IMXA 1VSJA 4CZKA 4W5RA 2BGGA 3KLHA 3V9SA 1LAWA 3A5LC 3RRHA 5I42A 1J6ZA 2ZJRL 4OPKA 3P5JA 2F96A 1RCHA 3SUQA 4KV8A 4BDYA 1RTDA 4CJ3A 2ZF5O 1LW2A 3ASMA 1FXXA 4EFHA 2XY6A 4BR4A 3AVHA 4MLHA 1NK0A 1BDGA 4DU4A 4CF1A 3SJJA 1YXQA 3AGRA 5AQMA 4CJEA 1MWMA 3E66A 1Y97A 4C8LA 2D1KA 4BRPA 3RSEA 3CCEN 3G25A 1BG3A 2YX6A 4BGAA 5C2FA 1JLAA 2KZMA 4CI6A 4HCBA 4CGDA 3AO4A 5BRFA 2UXCK 3VENA 3VGLA 1UWBA 3S9HA 1LWCA 2BDPA 1IKXA 2A41A 1Q8IA 1VSFA 3AA3A 1ESVA 3J7ZO 3T69A 2QW9A 1NGAA 2WTUA 4FWQA 3IFRA 2EWSA 4RW4A 4CGJA 5CR4A 3O4WA 3WQUA 4E1NA 1ZC6A 2IOCA 4KHYA 2QXLA 1JKHA 3THWB 3MECA 4CEFA 1JXEA 1RDCA 4F2RA 3UE5A 4AILC 3SLCA 2QK9A 5GAEP 1I94K 1TYQB 5M1FA 3O3GA 3L3UA 1VQ8N 4K42A 3CCQN 4CF0A 4JKEA 4GV6A 3ZX0A 3E01A 4JKDA 1KRPA 4KTZA 1EETA 1ZBSA 4DFPA 3AGKA 3O5BA 4O5FA 5AFUH 4IXCA 4GV3A 5HP1A 3VESA 3KK1A 3RMCA 1KAZA 2BUPA 3CETA 3GDQA 1VQKN 3SAFA 3AVBA 1QZ5A 1Z05A 3O9SA 1RDDA 3DLGA 4ILJA 4RG8A 4LH4A 1B92A 3LDLA 1T7PA 3S3MA 4AM6A 3CCVN 2IS3A 4ICLA 3DLEA 1JCEA 3OYDA 1NJYA 2KKZA 1ZYQA 2NNWA 5AQXA 3D2EA 3DMJA 3GG4A 1RBSA 2A40A 4KRFA 4CIGA 4C8NA 1GLJO 1GLFO 1JLCA 1YTAA 3CJ7A 4IG0A 3DLBA 1BIUA 4ELVA 1X1PA 4FM0A 1SZ2A 4WQ4C 5A2QO 1MA9B 4AHTA 3ULDA 1Z26A 1NK5A 4L3QA 3I56N 1WB9A 3JAMO 5SWMA 4FWLA 3CM5A 1RBUA 3TAPA 1VSHA 2E88A 3IS9A 3D6RA 1NJXA 4BC2A 3F2KA 3VQDA 3VTHA 1N33K 4KBOA 4PL8A 3H3NO 1KD1O 3CCMN 1RTIA 3DXKA 4I6MA 4B9UA 3W0LA 2XRIA 4JI6K 1HUXA 1CZBA 2OYQA 1NJZA 3EN9A 1NJIO 3J80O 4A5BA 4KHNA 1NK4A 4E0DA 1M1KO 2DFHA 5AJ3K 3RSEB 3SNNA 4JI4K 3FFKB 3NAEA 4KI6A 1W7AA 3CC2N 3K9KA 5CE3A 3UKUB 3TSUA 3WNFA 2G8HA 3ZYYX 4FLYA 5EXWA 3PX4A 4BRIA 3CG7A 2ATQA 3ENHA 1X3MA 2Z1GA 4OLAA 4DS5A 4CHNA 1QZ6A 3V6DA 1N32K 3KVGA 3KKRA 1U49A 4IG3A 3AO5A 4JI5K 4AF1A 4CHOA 1LWEA 2FSJA 2RKIA 3GL1A 2VGNA 5C10A 3AV9A 5J2PA 3PSIA 1B9FA 3ZSWA 3MMVA 3DOLA 3L6QA 1DEJA 3VTIA 3AAPA 1ASWA 1N8RO 2DY4A 3IKMA 3K0SA 3T1YK 4FK2A 1Q82O 1YVNA 5AQQA 3O08A 2IAJA 3OYKA 5MLCQ 3TI0A 3MXJA 1DTQA 4MO4A 2E2NA 3U9ZA 1BA0A 4IOXA 2NLXA 4IKFA 3JYTA 4KHQA 4H5NA 1RTHA 4ILHA 2HMPA 4M45A 3WXMB 4JRPA 4FJGA 1HYVA 4FLVA 1HNVA 4NLBA 3AVIA 4BC5A 4GW6A 4MDBA 3R9PA 3K2PA 2A1SA 1C6VA 3CQ8A 3DLRA 1WBDA 1EKEA 5JLHA 1F21A 2I7NA 5AQTA 3PUFA 3OS0A 3F73A 3NHGA 2ZWHA 1VSKA 3H1VX 1VQMN 3VERA 3FGUA 4FK4A 3LPTA 3L2UA 2F9TA 5M1NA 3HVTA 3I8DA 4BR2A 4U67L 2W40A 2NUBA 3VQQA 1YJWN 3P38A 1NMNA 3CCUN 4DR5K 3NF6A 4BR5A 3ZT2A 4OKJA 3ENOA 5JVHL 2O8DA 2Q97A 4F8RA 1KFDA 4C8MA 5LJVA 5FRNA 3AVFA 4BVPA 3CFPA 5JLFA 4H0VB 1JCGA 4DQRA 2FF6A 5ADXH 4MLEA 2PAVA 4ILGB 4NB4A 3QIOA 3LDOA 5AQNA 3KWIA 3MEEA 5LMUK 5AQOA 3DXKB 4DR2K 4DSJA 4I6MB 3OYCA 1LV5A 4B1WB 4EHTA 3CCJN 4ZTJA 2VG6A 1BGXT 5AQUA 2YKMA 2ZM6K 2YNGA 3A2FA 3U6FA 4KAZA 4EAHD 2VYPA 1NK6A 4YOWA 4Z94A 1QTMA 4JYAK 3D2FB 1TKTA 1VQ6N 1BISA 3LL3A 5AZJA 1X9SA 3FR0A 1QQOA 3OYMA 4BC4A 4C8KA 3CF5L 3NGYA 4OGCA 4B9QA 3TU5A 3VQ4A 4IEEA 4KKOA 3C94A 5BRDA 3T3FA 1KVAA 1TKDA 4DFJA 3HZ6A 2E1YA 2Y1IA 3DJCA 1LCUA 1XC9A 1T05A 3TR8A 1W9HA 1IBLK 4CHPA 1VQ9N 1VQ7N 4OO1J 3U3GA 4DFMA 2XHBA 4BRDA 3THXA 4IEIA 1C0UA 3FE1A 4BRQA 3HSTB 1Q7YO 1JLBA 2DFEA 5CZ2A 1GOAA 4DR1K 3VGMA 2KLAA 1E4GT 4GKKK 1WSIA 3R3LA 3KHYA 2RHKA 4FJMA 3HT3A 2ZJQL 3CC7N 3HPHA 3OYIA 1HKCA 3B8AX 5JS2A 3T19A 1L3SA 3RMDA 4H0OA 3HPGA 4GVEA 3ULEA 4C23A 3H08A 4JK9A 1NGCA 1W0HA 4UQGA 3K5LA 1JLQA 1HKGA 2X6SA 2KQ2A 4CJFA 2VCPA 4M3ZA 1KSPA 1FKOA 4CEBA 4MO5A 3VGKA 4CHZA 3C65A 4CD1A 4XH1A 4CVNE 4PKHA 2RN2A 4DLEA 1U2VA 4NCAA 1QS4A 1QSLA 3K9JA 4K0KK 1HMVA 4KFBA 3AA4A 1A5VA 1LWFA 3AVCA 4CJUA 3OYLA 2P51A 4AHSA 4A62A 4CJRA 4FWKA 4A59A 3OTOK 1Q81O 1XHZA 2NRVA 3NCIA 3IAYA 3VQ7A 3DWLA 4KHPK 1VQ5N 3BF3A 1XMQK 3HK2A 2KTQA 4O8KA 4NO7A 3G6EN 1NU0A 3LDPA 1L5UA 4W5QA 2O8DB 4DQQA 4I9QA 4XIUA 2G8FA 3NH0A 2PYLA 3G71N 2A1RA 1BCOA 2FXUA 4PUOA 4CZLA 3BEXA 3DXMB 3OYHA 4F4KA 3SBTA 4H0YB 4O55A 4FL9A 2P9KA 1J5EK 3OYJA 2OCEA 4MDAA 3VEXA 2B4JA 5C25A 3OYBA 4B3MK 1X9MA 5AQPA 4Y0WA 1FK9A 3MN9A 4LF7K 3DI6A 2FBVA 4PA1A 2RF2A 3HM8A 2XY7A 2A42A 1HQEA 3PY8A 3O6WA 2BANA 1VSIA 2GX9A 2B5JA 4M3UA 5C2DA 4R5PA 4BG9A 4CJKA 3MWPA 3BF1A 4WYBA 3HBTA 3M8SA 3TTDA 5GAGP 5AZJB 2HNDA 2GEMA 1SS6A 3KD5E 1NGFA 4Z4IA 2A5XA 1QSYA 3NVMA 1NGEA 2NZTA 1U47A 5BN9A 2ZQBA 1TK0A 3AO2A 4PKIA 2FLOA 3PO5A 3ALYA 4DSKA 5JVGL 2IVOA 3WXIA 4BDPA 3WXJA 1BCMA 3VA3A 1NNEA 3DOKA 4ZHRA 2P9SA 1P8ZA 4HTLA 4E19A 4E7HA 4B9NA 1U45A 3O4NA 2QWLA 3THXB 1NGJA 4JKFA 1RT1A 3LAKA 4PQUA 1UOCA 3AVKA 4ID5A 1CZ9A 1WSFA 1GLEG 2FBTA 3TWHA 2WBNA 1NJWA 3QEXA 4F2SA 4DS4A 1VQON 4OKEA 4LD0A 4CJVA 5JS1A 4BE1A 4B9MA 4DMNA 2ZJPL 3ID8A 2CGKA 2OZMA 2VGMA 4B08A 1WOQA 1ASVA 4JI8K 2HBMA 2W6LA 1IBMK 1O13A 2O8CA 4CF2A 3KLFA 3BGRA 3MCAB 3L3VA 3CD6N 2QA4N 3EY1A 2O8FA 3ZT1A 2OPQA 2QKBA 2Q1NA 5AFUA 4CERA 3ZLJA 3PIPL 1TK8A 1U2VB 1S5JA 2JGUA 4QOZB 4N76A 4RWTA 3VMFB 5CY4A 3P31A 3VF2A 2Q31A 3KKSA 4JLHA 3FZLA 3M8RA 1GLLO 4HWIA 3TAGA 2P5OA 3CJ1A 2NRTA 4RW9A 2PFUA 4C1NI 3TARA 2PZSA 3L2QA 4BWJA 4DU3A 2E6MA 3ZSQA 4FVUA 1ATNA 1VSLA 4IJAA 1IO2A 5EOYA 3NE6A 2ITGA 3V9XA 3UKUA 3NMUA 3Q7CA 5J2QA 4CJPA 4DB3A 4GY2B 3D0PA 1HLUA 3ZSVA 1GLCG 2O4GA 3THYB 2W42A 1J5OA 3V9ZA 1K8AO 3A0IX 4G9ZA 5FROA 4FXDA 2UUAK 3VQ9A 3SAHA 2P9KB 2QWQA 3R6MA 4M3XA 3ZCMA 3CPWM 4NCGA 4DR3K 1EP4A 3ZT3A 5BPNA 3TTFA 1W97L 2UU9K 4DF4A 3ZT4A 2W6KA 5AQZA 5HOOA 3RR7A 4JI2K 4BG8A 3LP2A 1IBKK 3VOVA 4H5WA 4DF8A 2IVPA 1J53A 1GLDG 1WNSA 3VEOA 3NF8A 4BRGA 5DK5A 1K9MO 3U9DA 1SKWA 4WFBL 4CZIA 3AVLA 1CLQA 4OGEA 4DG1A 5I3UA 2HSTA 2AJQA 2PY5A 1X9JA 3HJFA 3OYEA 3LWLA 2V51B 1HYSA 4M3WA 4IFVA 3QB0A 5FRMA 2O8BA 2JWLA 1DLOA 4FZXC 1TK5A 3M8QA 3O1BA 2QWNA 3EKUA 3O4QA 3K5MA 1RGIA 1JXBA 2QWRA 3QO9A 3G4SN 3CERA 2P9SB 2E8AA 4BROA 5KQDA 5AQLA 3HSCA 4YOXA 2UUCK 3VEVA 3VEYA 1I39A 1RILA 1NK7A 3S3NA 4E1MA 2Q0UA 4DV6K 4BVOA 3BY5A 2A6AA 1A5WA 2Z1JA 4NYNA 4AH9A 3W3DA 3G10A 1ATRA 4FWMA 4FYDA 1CXQA 3TAMA 2P9UA 3AAQA 1ITGA 4CFDA 1JCFA 4X66K 3K59A 4N56A 4DTOA 4WFAL 4YDUC 3GOIA 3CYMA 2NRHA 3C6TA 1K6YA 3QLHA 3AVGA 4FK0A 5HL7L 3WUHA 4H0XB 3C6AA 1T6CA 5SZTA 1TAUA 3V81A 3VQEA 3E9PA 4J2BA 1XUPO 2O8CB 3V9WA 4M63C 4B3SK 1VRTA 3NFAA 4H5VA 5AZIA 4CD3A 2O8FB 1HQUA 2CH5A 2OPSA 3CJCA 4QS7A 3C95A 4CBWA 4U7BA 2HHUA 4Q5VA 4JNEA 2FF3B 4NXMK 4PKGA 2ZE2A 2VWJA 2ASOA 3KZBA 3IG1A 4CJ5A 1YAGA 2YHBA 4DR6K 1BWFO 5AQJA 2P5GA 4I9LA 4Y1CA 1CXUA 1NBWA 4BRHA 4DSLA 1UA0A 3VEWA 1RT6A 3RMAA 4FJKA 3LZJA 3D2FA 2FSNA 2FBYA 2CGLA 4H5RA 4DV4K 4BACA 4CGIA 3OYFA 3ZSXA 3MN5A 3UIQA 3HYFA 3ISNC 3QFUA 4HVJA 3LP1A 3E9OA 1TGOA 3V1RA 1RT7A 4JKHA 4M7YA 5FLXO 1RT5A 3SPYA 2E2QA 3SMSA 1SL1A 4JV5K 4FLTA 3U4LA 4LFAK 3WNGA 4CEOA 4FWNA 2YNIA 2P9PA 3C7NA 3KJVA 1KLNA 4BC3A 3QERA 3SQ0A 3JS6A 5E84A 1RT3A 1NWKA 5T7BA 5ADXA 3E1YA 1YJ9N 3L4QA 2YHXA 2ASMA 3DLKA 2Q36A 4JK8A 1NGBA 4HUEA 4EHUA 2OPRA 5AR0A 3NH1A 3TAFA 1C1AA 3SPZA 1S1TA 2E4LA 1C0GA 3FZFA 4ISFA 5GIOA 2FC0A 4BR9A 2O8BB 1KVCA 3S41A 1K8KA 2OTLN 4LF9K 4LY7A 4A57A 4DTUA 1EO1A 2O4IA 1VSEA 4DSFA 1EWQA 3HXMA 3ZEUA 3ZX2A 1VHXA 4DU1A 4BRMA 4JEPA 1NKBA 4FJ9A 4FJNA 4CJQA 3AY9A 4JKCA 3SAGA 4C1NK 3QEVA 3K58A 1DGKN 1C1CA 2YV0X 4HHTA 5DM7L 1KFSA 2DTUA 2HHXA 4XEIA 1RNHA 1WSJA 1HPMA 2E1ZA 2IGIA 3PIOL 3QIPA 3VQ8A 2D4WA 4CJ4A 5HRRA 2P9UB 4BQZA 1D8YA 3HVRA 4YOUA 1VSDA 2WFBA 4Z4CA 4FJ7A 1HNWK 4CE9A 1JLGA 2WONA 2CGJA 3K5NA 4FJXA 5TKYA 4G1QA 4YORA 4JS4A 1KVBA 2F8TA 1RDBA 3QINA 4WQ5A 4Z4HA 4CHYA 3AA5X 4FZYA 3CXCM 4M42A 4CHQA 3EO3A 4OVLA 1M90O 4CJ7A 4H03B 1QHTA 1R0AA 1HNIA 1JL1A 1NM1A 2VG7A 3DXMA 1VQNN 5AZIB 3QEWA 3QETA 3HP6A 3LM9A 3DAWA 3VF6A 3K57A 4I2QA 3LPUA 5CZ1A 5KTQA 4FO0A 3CMEN 2JWKA 3HTVA 4JK7A 4PHTX 3CPEA 3SUOA 2UUBK 4ID1A 2KW4A 3PSFA 1G15A 4B3TK 1QQNA 3IRXA 4AQYK 4C8OA 3MDQA 2OZSA 1DKGD 1DTTA 1S1XA 3R8EA 3H1QA 3OA9A 1N6QA 4DV5K 3T7ZA 5DM6L 4FLXA 1N5YA 4JKAA 3WEEA 3M1FA 4EIAA 1LOTB 3ATVA 4CK3A 3WNHA 2OTJN 3VQ6A 1S72N 4CJWA 5M1KA 1JLFA 3L2RA 3WNEA 4CESA 1ZBFA 1C1BA 2GBZA 4FZZA 1P90A 4DFKA 1EXQA 3SV4A 3SCXA 1ILYA 2GUPA 3A5OC 1S9GA 2KFNA 5FPNA 3KD1E 4CBXA 3O3FA 2P9PB 3C7NB 3DYAA 1IG9A 3OW2M 1RDUA 4BRKA 1TL3A 1YF5L 4YOVA 3P83D 3V9UA 4I2PA 1S6PA 3NH2A 1OVQA 4FJ8A 3CHWA 4OPJA 4OLBA 4O0JA 2GV9A 3SYZA 4CF8A 2P9IA 1IG8A 1NKEA 4DTRA 4X62K 1BU6O 1K8KB 1NLVA 3CI5A 1QVGM 4DQSA 4KH6A 5D3GA 1V4TA 1VQPN 1YVUA 4WE1A 2BE2A 3ZEUB 1L3UA 1QQCA 4BY9C 4CEAA 4DTPA 2E5LK 3A5NC 1XQSC 1C0TA 4LH5A 3L2WA 2LSNA 2QM1A 5AQSA 1B9DA 5EX5A 2HBKA 3G0ZA 4E7IA 4DTNA 4WF9L 3I33A 3QEPA 1KXPA 4FWOA 4ISGA 4CBUA 3GBTA 4JRQA 3CM6A 5LJWA 1U48A 1S3XA 2OA8A 1NGGA 3P39A 3WT0A 3PV8A 4CZEA 3SUNA 2HF3A 4B9SA 2AA4A 2KHOA 4JS5A 1RBRA 3PO4A 3IDHA 4O4GA 3VN5A 3THYA 4CZHA 4IBNA 3SI6A 5BPMA 4YFUA 4YNQA 4CJLA 3VF4A 4KREA 3AVAA 3HO1A 3I0SA 3U3YA 4DHYA 4MFBA 5LL6Z 2GWJA 3DM2A 4DSEA 4FWPA 4FM2A 3O8MA 4WFNL 1QE1A 5ELZA 4CGHA 2E2PA 1QQMA 4QS9A 1D9FA 2GUIA 5KPTA 1R59O 1RDAA 4RW6A 3V1QA 1TAQA 3WXKA 4DKWA 3SUPA 1ZBIA 3SMPA 4BREA 4YY3K 2D0AA 4FM1A 4B8CA 3N4PA 3OJUA 3HRGA 2ZD1A 1WN7A 3VQBA 1S1WA 1D9DA 3WEEB 4K8XA 1IKWA 3O9RA 3QESA 1HPZA 2VWBA 5FDLA 1QVFM 1ATSA 5C12A 4LFBK 3QBWA 4LC9B 3LZIA 5GADP 4B1UB 1V4SA 4HUFA 2GELA 1J54A 4B9TA 3C6HA 4K25A 4I7FA 1SKRA 2HBJA 1GLBG 3I55N 4J2DA 4UY8O 4DUYK 5DMRA 2YI1A 3MCPA 1RT4A 3HI0A 4B1YB 4A61A 3ATUA 3Q7BA 1YITN 2HF4A 4O5BA 5FPMA 4WQ4A 4BQLA 4N5SA 3FZMA 2Y1JA 1QHAA 2HBLA 3CCSN 3ENBA 1O1WA 4QAGA 2YCHA 2HB5A 1SAZA 2R7YA 4BRCA 3A8YA 5IT9O 3OBYA 4W5TA 1VQLN 4CJTA 4FJIA 4OJRA 1BUPA 3LDSA 4Y1DA 3C0BA 4DQ8A 5BN8A 2P9IB 3MEGA 2V7ZA 4DTSA 4QS8A 4M3YA 5C42A 3ZX3A 2X78A 1Q9XA 3D45A 1IKYA 3V4IA 1RTJA 2AP1A 3BP8A 4A5AA 1LW0A 1T44A 2GWKA 1WBBA 1JJ2M 4IJNA 2Q3SA 4KTWA 1HJRA 3LP0A 3A5MC 3KK3A 4DV7K 4DWIA 2O8EA 2RPIA 3VPZA 1DT9A 2V52B 4KHUA 4DV3K 5AQKA 3LM2A 3ZSZA 3QFPA 1XHXA 4E7KA 2J4RA 1BQNA 4JHDA 4CEDA 4X65K 2EX3A 3N4QA 4A2AA 3OS1A 1NK8A 3L2VA 3OS2A 1IKVA 4IOCL 4BGBA 2OPPA 2HVIA 2F7TA 2Q2RA 1K73O 3RWUA 5KRTA 1TKXA 3U8XA 1OVYA 5HLFA 3SQ4A 1NGDA 4KHSA 3MEDA 1FW6A 1H1VA 5AQRA 4F9OA 2F4VK 4K43A 3H3OB 2HHVA 1HX1A 1RBTA 3QMLA 3OYGA 4L8RB 2QWOA 3CQYA 2NRWA 4F3TA 4AM7A 4Z0UA 4HTUA 3C6UA 3FLCO 3PX6A 3CIPA 5E41A 3RRGA 3LP3A 3CMAN 3EE9A 3HOSA 5BR9A 5HRNA 4ELUA 3ZT0A 1Y64A 4CIFA 1IV0A 1BIZA 4M3TA 1XNRK 4DR4K 2D0OA 3AVNA 1S1UA 2V7YA 3CCRN 2ETJA 5JMVA 3CJ9A 4HCCA 4EZ6A 3KK2A 1EWRA 3NGIA 4J2EA 4N47A 2E20A 1XC3A 4BRAA 5EU7A 1GOCA 4E1JA 3CCLN 5K14A 3AA2A 3ZSOA 2HHHK 4OPAA 2XY5A 3P4IA 3SJHA 1BA1A 2VQEK 4DSIA 4CEQA 4FLZA 3JSMA 2G8KA 4DQIA 1VQ4N 3CJAA 4CZMA 5J2MA 4LF4K 2G8IA 1FKPA 4E7JA 1D5AA 3VQCA 4KI4A 5AQVA 4DR7K 4GVMA 4FJJA 4FJLA 1A5XA 4GMJB 2UYTA 1VK0A 3KLGA 1KTQA 2VQFK 4LF8K 4ZTFA 2PBDA 4B9VA 3F9MA 1TV6A 4YOYA 3WQTA 4NCBA 3SZ2A 3L0QA 3DRSA 3NGZA 1CZAN 5HRPA 5C0YA 4DV2K 2P9LB 4XH4A 3KIOA 3MXIA 1Q9YA 3FZHA 3TAQA 3SK3A 1BQMA 1D4XA 2XY8A 1RFQA 2HHWA 2QI2A 3M8PA 1ZBLA 4FLUA 1YHQN 4QCLA 5EVZA 4JKGA 1NGIA 4CCHA 3OBWA 1XNQK 4FJHA 4OX9K 3F9KA 1VAZA 4A2BA 4GNIA 2ZGZA 3SV3A 3NVKA 2HHQA 2DFFA 3L4IA 2O8EB 2RE2A 2HOEA 1E3MA 2HNZA 2HHSA 2X6NA 4FW1A 4FWSA 3S3OA 1MDUB 1HYZA 2GTDA 3NDKA 3HL8A 4B8AB 1TUYA 4JHDB 3CJBA 3RVCA 3MK6A 1IH7A 2E2OA 1MU2A 3EKSA 3LDNA 1VSMA 4AHUA 1UAXA 3L8BA 4IFEA 2HHTA 1GOBA 4IO9L 2XO7A 1WSGA 1N34K 3FZKA 4DLGA 4NYFA 2YJEA 4CEZA 3MX2A 4M3RA 2W41A 4TSXA 1KAXA 4CK1A 3V1OA 1NOYA 4JN4A 2YHYA 5AQIA 5C24A 1BI4A 2Q0RA 3LDQA 3IUCA 3ZETA 3QICA 5M1PA 4JI7K 4J8FA 2BH1A 4FVMA 1NMDA 5CHIA 3FFIA 3KWGA 3J81O
chains in the Genus database with same CATH topology
3MECA 4DFKA 1EXQA 4DTMA 2IC3A 4CEFA 3SV4A 2HNDA 3SCXA 3KD5E 1JXEA 1S9GA 1RDCA 4BE2A 1S1VA 4F2RA 2KFNA 4BE0A 3KD1E 4Z4IA 4AILC 1QSYA 2QK9A 2F8TA 3O3FA 1U47A 4AHCA 3DYAA 5J2NA 2WOMA 3O3GA 1IG9A 2D0CA 2ZQBA 1TK0A 3AO2A 1EX4A 3PO5A 3ALYA 4DSKA 3L3UA 4CF0A 2HMIA 1TL3A 4BDPA 3E01A 3VA3A 1BCMA 1SKSA 4KTZA 1KRPA 3V9UA 1EETA 3P83D 4I2PA 1S6PA 4LSNA 3NH2A 4DFPA 4FJ8A 1YTUA 3DOKA 4ZHRA 3PX0A 5HP1A 4OPJA 4E19A 3KK1A 3RMCA 1WAFA 4E7HA 3THVA 4B9NA 4OLBA 1U45A 3O4NA 3OY9A 2KZZA 4O0JA 2GV9A 1RT1A 3EZ5A 4FLWA 3LAKA 4J2AA 3SYZA 3AVBA 1UOCA 4PQUA 3AVKA 1U4BA 4ID5A 1RDDA 2X74A 3DLGA 1CZ9A 4LH4A 4RG8A 1WSFA 1B92A 2HNYA 4CF8A 4EP5A 3S3MA 2FBTA 4DTRA 1NKEA 1T7PA 3TWHA 1NJWA 5HROA 2IS3A 4CFBA 2G8VA 3QEXA 4ICLA 3DLEA 4F2SA 4DS4A 3OYDA 4DQSA 1NJYA 5D3GA 4OKEA 4LD0A 4CJVA 5JS1A 1ZYQA 1YVUA 4BE1A 5HRSA 4WE1A 3BDPA 4B9MA 2BE2A 4DMNA 3DMJA 1L3UA 1RBSA 3SQ2A 1QQCA 2OZMA 5CYQA 4B08A 4KRFA 4CIGA 4C8NA 4CEAA 4DTPA 4Z4FA 3ZSRA 1ASVA 1JLCA 1YTAA 3TANA 4IG0A 1C0TA 3DLBA 4LH5A 1BIUA 3L2WA 4ELVA 1X1PA 3T1AA 2LSNA 4FM0A 1HRHA 1B9DA 3G0ZA 4CF2A 3KLFA 3BGRA 4E7IA 4DTNA 1XI1A 3L3VA 3KLEA 3QEPA 3EY1A 1RBVA 3MXMA 3ZT1A 4AHTA 4Z4GA 2OPQA 2QKBA 3ULDA 1WSEA 1Z26A 4CERA 1NK5A 4JRQA 3CM6A 1TK8A 1S5JA 1U48A 3VQAA 2JGUA 2OA8A 1Z25A 3PV8A 5SWMA 4N76A 4QOZB 2D5RA 3B6PA 3CM5A 3SUNA 4B9SA 1RBUA 4JS5A 3TAPA 1VSHA 5CY4A 2QKKA 4HUGA 1RBRA 3KKSA 4JLHA 4AHRA 3IS9A 4ELTA 3K5OA 3M8RA 3VA0A 3TAGA 4FCYA 1NJXA 2P5OA 1QSSA 3VQ5A 3PO4A 2YNHA 2BGGA 3VQDA 4RW9A 3AO3A 3TARA 2PZSA 3L2QA 1U04A 4O4GA 4BWJA 3VN5A 4DU3A 1RTIA 2E6MA 3ZSQA 4IBNA 1VSLA 3SI6A 4B9UA 1IO2A 2G8WA 2XRIA 4YFUA 3NE6A 4YNQA 2ITGA 4CJLA 3V9XA 1CZBA 3ITHA 4KREA 2OYQA 3AVAA 3HO1A 3I0SA 3U3YA 3VQPA 4CGFA 1NJZA 4F3OA 5J2QA 4CJPA 4MFBA 4KHNA 1NK4A 3LANA 3D0PA 3ZSVA 3DM2A 3NF9A 4DSEA 4FM2A 1XWLA 4E0DA 2O4GA 1QE1A 2DFHA 1T03A 2W42A 4CGHA 5KI6A 3V9ZA 3SNNA 1J5OA 3NAEA 1D9FA 2GUIA 1LAVA 4KI6A 1RDAA 4RW6A 3V1QA 2B6AA 5FROA 4FXDA 1TAQA 3VQ9A 3WNFA 3SUPA 1ZBIA 4BWMA 4N41A 4M3XA 4CIEA 3ZCMA 2G8HA 4NCGA 1EP4A 3ZT3A 4LSLA 2D0AA 4FM1A 3ZT4A 4B8CA 3AVMA 4FLYA 3OJUA 1ZBUA 4DF4A 3PX4A 2ZD1A 1WN7A 4H4MA 3VQBA 3RR7A 1S1WA 4W5NA 1D9DA 3LP2A 3CG7A 2ATQA 1T8EA 1BI4B 4K8XA 1IKWA 2Z1GA 2VWKA 4OLAA 3QESA 4DS5A 1HPZA 4IKFA 4CHNA 4DF8A 5FDLA 4CF9A 1J53A 3V6DA 3LZIA 3B6OA 4RW8A 3KKRA 1C0MA 1WNSA 4W5OA 3NF8A 5HBMA 3OYAA 5DK5A 4IG3A 3AO5A 3QEIA 1U49A 1SKWA 4KB1A 4PWDA 4E89A 3AVLA 1CLQA 4HUFA 4CHOA 4OGEA 1J54A 1LWEA 4DG1A 1NKCA 5I3UA 3TAEA 1ASUA 4B9TA 2AJQA 2RKIA 2PY5A 4I7FA 1SKRA 3HJFA 3OYEA 4J2DA 3AV9A 5J2PA 3LWLA 1B9FA 1HYSA 5DMRA 1RT2A 1WAJA 3ZSWA 1RT4A 4M3WA 4IFVA 3DOLA 5FRMA 4O5BA 2Y1JA 4N5SA 1DLOA 1ASWA 3CFRA 4FZXC 2DY4A 1TK5A 3M8QA 1O1WA 4O44A 4QAGA 4FK2A 3O4QA 3OVNA 3K5MA 2HB5A 1SL0A 1JXBA 2IAJA 2G8UA 3OYKA 2QXFA 3TI0A 3QO9A 2R7YA 4CGGA 3MXJA 1DTQA 1WLJA 4W5TA 4CJTA 1I39A 1RILA 4FJIA 4OJRA 3LDSA 1NK7A 3S3NA 3JYTA 2I5JA 4Y1DA 2EHGA 3DRPA 4E1MA 4O0IA 4H8KA 1RTHA 3EYZA 4M45A 4M41A 3MEGA 4JRPA 4E7LA 4FJGA 1HYVA 4FLVA 1HNVA 4DTSA 1A5WA 4M3YA 2Z1JA 4NYNA 4IDKA 4AH9A 5C42A 4EZ9A 3G10A 3AVIA 4GW6A 2X78A 3AO1A 4PY5A 1Q9XA 4FYDA 1CXQA 3TAMA 4EP4A 3K2PA 3D45A 1ITGA 2A1SA 1SV5A 1C6VA 3I0RA 4OKKA 4CFDA 3NF7A 3K59A 3CQ8A 3DLRA 1SL2A 4N56A 4DTOA 4DQPA 1IKYA 3RTVA 3V4IA 4Q0BA 1RTJA 3LALA 3CYMA 3C6TA 1EKEA 1K6YA 1F21A 1LW0A 4H4OA 3QLHA 4K8ZA 3AVGA 4FK0A 3PUFA 4CFCA 3OYNA 3OS0A 3F73A 1NK9A 1JL2A 2VG5A 2Q3SA 4KTWA 1HJRA 3LP0A 5SZTA 3KK3A 3NHGA 4DWIA 1VSKA 1TAUA 3V81A 4FK4A 1X9WA 3VQEA 3LPTA 3L2UA 4J2BA 2RPIA 3HVTA 3V9WA 4KHUA 4KPYA 3I8DA 1VRTA 2P1JA 3NFAA 3ZSZA 2F8SA 2HW3A 2NUBA 3VQQA 1HQUA 1XHXA 4E7KA 2OPSA 4FJ5A 1ZBHA 3NF6A 3C95A 4IFYA 3ZT2A 4B9LA 4OKJA 2HHUA 4Q5VA 1BQNA 2ZE2A 4CEDA 2VWJA 4F8RA 2KFZA 2EX3A 3OS1A 1KFDA 4KO0A 4C8MA 3IG1A 4CJ5A 3L2VA 3OS2A 1IKVA 3M8SA 1NK8A 5FRNA 3AVFA 2YHBA 1BHLA 2OPPA 5KRSA 3CFPA 2P5GA 2HVIA 4I9LA 2D0BA 3O3HA 3RWUA 4Y1CA 4DQRA 4CEEA 5KRTA 1CXUA 1TKXA 5HLFA 3QNOA 4FW2A 3SQ4A 1UA0A 4DSLA 4AHVA 3MEDA 4KHSA 1NOZA 3QIOA 2HVHA 2PYJA 1RT6A 3MEEA 3RMAA 2HHVA 2Z1IA 4DSJA 3OYCA 4FJKA 1RBTA 2JLEA 4MQ3A 3MAQA 3OYGA 4L8RB 3LZJA 1LV5A 2FBYA 4F3TA 1REVA 4ZTJA 4Z0UA 4HTUA 4BACA 3C6UA 2VG6A 1BL3A 4CGIA 1BGXT 3HP9A 3OYFA 1TVRA 2YKMA 3PX6A 3ZSXA 5E41A 3RRGA 1S9EA 2YNGA 3A2FA 3UIQA 3LP3A 1WSHA 3U6FA 4KAZA 3HYFA 3ISNC 4HVJA 3LP1A 5KGWA 1NK6A 3LAMA 1TGOA 3V1RA 1RT7A 1QTMA 4CK2A 1TKZA 5HRNA 1RT5A 3ZT0A 4ELUA 1KCFA 3SPYA 1I3AA 4CIFA 3RMBA 1TKTA 4E3SA 1BIZA 1BISA 4M3TA 1X9SA 1SL1A 2YHAA 3AVNA 3NBPA 3OYMA 1S1UA 4FLTA 3RR8A 3WNGA 2ETJA 4C8KA 1S6QA 3NGYA 1UA1A 4CEOA 4OGCA 4HCCA 4EZ6A 3KK2A 4B3OA 3VQ4A 4KKOA 2YNIA 3KJVA 3C94A 3NGIA 1KLNA 5KGXA 3T3FA 4J2EA 4N47A 1KVAA 1TKDA 1YT3A 5EU7A 3QERA 3SQ0A 4CJSA 4DFJA 1GOCA 1RT3A 5T7BA 3DLHA 5K14A 2Y1IA 3QNNA 1JLEA 3AA2A 4RW7A 3ZSOA 2XY5A 1XC9A 1T05A 3TR8A 3AVJA 1W9HA 3DLKA 2YNFA 4HUEA 4CHPA 2OPRA 3NH1A 3TAFA 4DSIA 3SQ1A 4CFAA 1C1AA 1SUQA 3SPZA 1S1TA 2E4LA 4CEQA 3U3GA 4DFMA 2XHBA 3KTQA 1L3TA 4KTQA 4FLZA 3JSMA 1TL1A 4DTJA 1C0UA 2G8KA 3HSTB 3TABA 4DQIA 1JLBA 2FC0A 2DFEA 5CZ2A 1GOAA 1J9AA 1KVCA 4Z4EA 3CFOA 3KLIA 5J2MA 2G8IA 1FKPA 4LY7A 1WSIA 4E7JA 5CYMA 5J1EA 4DTUA 4KB0A 2O4IA 1D5AA 1VSEA 4FJMA 3VQCA 3HT3A 4DSFA 3HPHA 3HXMA 4KI4A 4GVMA 3OYIA 4FJJA 1VRUA 4FJLA 1A5XA 4GMJB 3KLGA 1VK0A 4DU1A 1KTQA 1NKBA 4FJ9A 5JS2A 3T19A 4CJQA 1L3SA 4FJNA 4CECA 3RMDA 4ZTFA 1KLMA 3DRRA 3HPGA 4B9VA 3P1GA 1TV6A 3H08A 1L3VA 4NCBA 2Z1HA 3SZ2A 3QEVA 3ZSYA 1W0HA 3K58A 4KHWA 1C1CA 3DRSA 4UQGA 1JLQA 2YV0X 3NGZA 3K5LA 4HHTA 2IDOA 2X6SA 2KQ2A 5HRPA 4DTXA 4CJFA 1KFSA 4M3ZA 2DTUA 1Q9YA 3KIOA 1FKOA 1RNHA 1WSJA 4CEBA 3MXIA 1KSPA 2HHXA 2IGIA 4CHZA 4BDZA 3QIPA 3VQ8A 3HM9A 3TAQA 3HPOA 1BQMA 2FBXA 5HRRA 4CJ4A 2RN2A 2XY8A 3OJSA 1D8YA 3HVRA 2E6LA 2HHWA 2YKNA 4FJ7A 1VSDA 3M8PA 4Z4CA 4DLEA 4FLUA 1ZBLA 4NCAA 4QCLA 1QS4A 4CE9A 1JLGA 2WONA 1QSLA 4CCHA 3K5NA 4KHQA 3LWMA 1HMVA 4KFBA 4FJXA 4FJHA 1VSJA 3AA4A 4G1QA 3F9KA 4W5RA 4JS4A 1A5VA 1KVBA 1LWFA 3AVCA 4CJUA 1RDBA 2P51A 3QINA 4AHSA 3OYLA 1LAWA 3KLHA 3V9SA 4CJRA 3SV3A 4Z4HA 3RRHA 2DFFA 4CHYA 5I42A 2HHQA 3AA5X 4FZYA 1XHZA 4M42A 4OPKA 4CHQA 3P5JA 3NCIA 2F96A 1RCHA 2HNZA 2X6NA 4KV8A 4OVLA 3SUQA 3VQ7A 3IAYA 4BDYA 1RTDA 1QHTA 1R0AA 1HNIA 4CJ3A 4FW1A 1JL1A 3HK2A 2VG7A 2KTQA 1LW2A 3ASMA 1FXXA 3QEWA 3QETA 2XY6A 3S3OA 1HYZA 3HP6A 3AVHA 1NK0A 3NDKA 3HL8A 4I2QA 3K57A 4DU4A 4CF1A 3LPUA 4B8AB 1L5UA 5CZ1A 4W5QA 3SJJA 5KTQA 4DQQA 4I9QA 4XIUA 2G8FA 4CJEA 1IH7A 3NH0A 2PYLA 1MU2A 2A1RA 1BCOA 1Y97A 4C8LA 4PUOA 3SUOA 4ID1A 1VSMA 2HHSA 4AHUA 1UAXA 3L8BA 2HHTA 1GOBA 2KW4A 3OYHA 1G15A 4F4KA 3IRXA 4C8OA 2XO7A 1WSGA 1JLAA 2OZSA 4DLGA 2KZMA 4HCBA 4O55A 4CGDA 4NYFA 1DTTA 4CEZA 3AO4A 1S1XA 3OYJA 1UWBA 4M3RA 3S9HA 1N6QA 1LWCA 2BDPA 2B4JA 4TSXA 5C25A 3OYBA 4FLXA 1IKXA 4CK1A 3V1OA 1N5YA 1NOYA 1X9MA 1Q8IA 1FK9A 1VSFA 5C24A 3DI6A 1BI4A 2FBVA 3AA3A 4PA1A 2RF2A 4CK3A 4RW4A 4CGJA 3WNHA 1HQEA 2XY7A 3PY8A 2BANA 3VQ6A 4E1NA 1VSIA 4CJWA 2B5JA 4M3UA 4R5PA 4FVMA 4CJKA 1JLFA 3L2RA 2IOCA 4KHYA 3WNEA 3FFIA 4CESA 1ZBFA 1C1BA 1JKHA 2GBZA 4FZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEC A;  4DFK A;  1EXQ A;  4DTM A;  2IC3 A;  4CEF A;  3SV4 A;  2HND A;  3SCX A;  3KD5 E;  1JXE A;  1S9G A;  1RDC A;  4BE2 A;  1S1V A;  4F2R A;  2KFN A;  4BE0 A;  3KD1 E;  4Z4I A;  4AIL C;  1QSY A;  2QK9 A;  2F8T A;  3O3F A;  1U47 A;  4AHC A;  3DYA A;  5J2N A;  2WOM A;  3O3G A;  1IG9 A;  2D0C A;  2ZQB A;  1TK0 A;  3AO2 A;  1EX4 A;  3PO5 A;  3ALY A;  4DSK A;  3L3U A;  4CF0 A;  2HMI A;  1TL3 A;  4BDP A;  3E01 A;  3VA3 A;  1BCM A;  1SKS A;  4KTZ A;  1KRP A;  3V9U A;  1EET A;  3P83 D;  4I2P A;  1S6P A;  4LSN A;  3NH2 A;  4DFP A;  4FJ8 A;  1YTU A;  3DOK A;  4ZHR A;  3PX0 A;  5HP1 A;  4OPJ A;  4E19 A;  3KK1 A;  3RMC A;  1WAF A;  4E7H A;  3THV A;  4B9N A;  4OLB A;  1U45 A;  3O4N A;  3OY9 A;  2KZZ A;  4O0J A;  2GV9 A;  1RT1 A;  3EZ5 A;  4FLW A;  3LAK A;  4J2A A;  3SYZ A;  3AVB A;  1UOC A;  4PQU A;  3AVK A;  1U4B A;  4ID5 A;  1RDD A;  2X74 A;  3DLG A;  1CZ9 A;  4LH4 A;  4RG8 A;  1WSF A;  1B92 A;  2HNY A;  4CF8 A;  4EP5 A;  3S3M A;  2FBT A;  4DTR A;  1NKE A;  1T7P A;  3TWH A;  1NJW A;  5HRO A;  2IS3 A;  4CFB A;  2G8V A;  3QEX A;  4ICL A;  3DLE A;  4F2S A;  4DS4 A;  3OYD A;  4DQS A;  1NJY A;  5D3G A;  4OKE A;  4LD0 A;  4CJV A;  5JS1 A;  1ZYQ A;  1YVU A;  4BE1 A;  5HRS A;  4WE1 A;  3BDP A;  4B9M A;  2BE2 A;  4DMN A;  3DMJ A;  1L3U A;  1RBS A;  3SQ2 A;  1QQC A;  2OZM A;  5CYQ A;  4B08 A;  4KRF A;  4CIG A;  4C8N A;  4CEA A;  4DTP A;  4Z4F A;  3ZSR A;  1ASV A;  1JLC A;  1YTA A;  3TAN A;  4IG0 A;  1C0T A;  3DLB A;  4LH5 A;  1BIU A;  3L2W A;  4ELV A;  1X1P A;  3T1A A;  2LSN A;  4FM0 A;  1HRH A;  1B9D A;  3G0Z A;  4CF2 A;  3KLF A;  3BGR A;  4E7I A;  4DTN A;  1XI1 A;  3L3V A;  3KLE A;  3QEP A;  3EY1 A;  1RBV A;  3MXM A;  3ZT1 A;  4AHT A;  4Z4G A;  2OPQ A;  2QKB A;  3ULD A;  1WSE A;  1Z26 A;  4CER A;  1NK5 A;  4JRQ A;  3CM6 A;  1TK8 A;  1S5J A;  1U48 A;  3VQA A;  2JGU A;  2OA8 A;  1Z25 A;  3PV8 A;  5SWM A;  4N76 A;  4QOZ B;  2D5R A;  3B6P A;  3CM5 A;  3SUN A;  4B9S A;  1RBU A;  4JS5 A;  3TAP A;  1VSH A;  5CY4 A;  2QKK A;  4HUG A;  1RBR A;  3KKS A;  4JLH A;  4AHR A;  3IS9 A;  4ELT A;  3K5O A;  3M8R A;  3VA0 A;  3TAG A;  4FCY A;  1NJX A;  2P5O A;  1QSS A;  3VQ5 A;  3PO4 A;  2YNH A;  2BGG A;  3VQD A;  4RW9 A;  3AO3 A;  3TAR A;  2PZS A;  3L2Q A;  1U04 A;  4O4G A;  4BWJ A;  3VN5 A;  4DU3 A;  1RTI A;  2E6M A;  3ZSQ A;  4IBN A;  1VSL A;  3SI6 A;  4B9U A;  1IO2 A;  2G8W A;  2XRI A;  4YFU A;  3NE6 A;  4YNQ A;  2ITG A;  4CJL A;  3V9X A;  1CZB A;  3ITH A;  4KRE A;  2OYQ A;  3AVA A;  3HO1 A;  3I0S A;  3U3Y A;  3VQP A;  4CGF A;  1NJZ A;  4F3O A;  5J2Q A;  4CJP A;  4MFB A;  4KHN A;  1NK4 A;  3LAN A;  3D0P A;  3ZSV A;  3DM2 A;  3NF9 A;  4DSE A;  4FM2 A;  1XWL A;  4E0D A;  2O4G A;  1QE1 A;  2DFH A;  1T03 A;  2W42 A;  4CGH A;  5KI6 A;  3V9Z A;  3SNN A;  1J5O A;  3NAE A;  1D9F A;  2GUI A;  1LAV A;  4KI6 A;  1RDA A;  4RW6 A;  3V1Q A;  2B6A A;  5FRO A;  4FXD A;  1TAQ A;  3VQ9 A;  3WNF A;  3SUP A;  1ZBI A;  4BWM A;  4N41 A;  4M3X A;  4CIE A;  3ZCM A;  2G8H A;  4NCG A;  1EP4 A;  3ZT3 A;  4LSL A;  2D0A A;  4FM1 A;  3ZT4 A;  4B8C A;  3AVM A;  4FLY A;  3OJU A;  1ZBU A;  4DF4 A;  3PX4 A;  2ZD1 A;  1WN7 A;  4H4M A;  3VQB A;  3RR7 A;  1S1W A;  4W5N A;  1D9D A;  3LP2 A;  3CG7 A;  2ATQ A;  1T8E A;  1BI4 B;  4K8X A;  1IKW A;  2Z1G A;  2VWK A;  4OLA A;  3QES A;  4DS5 A;  1HPZ A;  4IKF A;  4CHN A;  4DF8 A;  5FDL A;  4CF9 A;  1J53 A;  3V6D A;  3LZI A;  3B6O A;  4RW8 A;  3KKR A;  1C0M A;  1WNS A;  4W5O A;  3NF8 A;  5HBM A;  3OYA A;  5DK5 A;  4IG3 A;  3AO5 A;  3QEI A;  1U49 A;  1SKW A;  4KB1 A;  4PWD A;  4E89 A;  3AVL A;  1CLQ A;  4HUF A;  4CHO A;  4OGE A;  1J54 A;  1LWE A;  4DG1 A;  1NKC A;  5I3U A;  3TAE A;  1ASU A;  4B9T A;  2AJQ A;  2RKI A;  2PY5 A;  4I7F A;  1SKR A;  3HJF A;  3OYE A;  4J2D A;  3AV9 A;  5J2P A;  3LWL A;  1B9F A;  1HYS A;  5DMR A;  1RT2 A;  1WAJ A;  3ZSW A;  1RT4 A;  4M3W A;  4IFV A;  3DOL A;  5FRM A;  4O5B A;  2Y1J A;  4N5S A;  1DLO A;  1ASW A;  3CFR A;  4FZX C;  2DY4 A;  1TK5 A;  3M8Q A;  1O1W A;  4O44 A;  4QAG A;  4FK2 A;  3O4Q A;  3OVN A;  3K5M A;  2HB5 A;  1SL0 A;  1JXB A;  2IAJ A;  2G8U A;  3OYK A;  2QXF A;  3TI0 A;  3QO9 A;  2R7Y A;  4CGG A;  3MXJ A;  1DTQ A;  1WLJ A;  4W5T A;  4CJT A;  1I39 A;  1RIL A;  4FJI A;  4OJR A;  3LDS A;  1NK7 A;  3S3N A;  3JYT A;  2I5J A;  4Y1D A;  2EHG A;  3DRP A;  4E1M A;  4O0I A;  4H8K A;  1RTH A;  3EYZ A;  4M45 A;  4M41 A;  3MEG A;  4JRP A;  4E7L A;  4FJG A;  1HYV A;  4FLV A;  1HNV A;  4DTS A;  1A5W A;  4M3Y A;  2Z1J A;  4NYN A;  4IDK A;  4AH9 A;  5C42 A;  4EZ9 A;  3G10 A;  3AVI A;  4GW6 A;  2X78 A;  3AO1 A;  4PY5 A;  1Q9X A;  4FYD A;  1CXQ A;  3TAM A;  4EP4 A;  3K2P A;  3D45 A;  1ITG A;  2A1S A;  1SV5 A;  1C6V A;  3I0R A;  4OKK A;  4CFD A;  3NF7 A;  3K59 A;  3CQ8 A;  3DLR A;  1SL2 A;  4N56 A;  4DTO A;  4DQP A;  1IKY A;  3RTV A;  3V4I A;  4Q0B A;  1RTJ A;  3LAL A;  3CYM A;  3C6T A;  1EKE A;  1K6Y A;  1F21 A;  1LW0 A;  4H4O A;  3QLH A;  4K8Z A;  3AVG A;  4FK0 A;  3PUF A;  4CFC A;  3OYN A;  3OS0 A;  3F73 A;  1NK9 A;  1JL2 A;  2VG5 A;  2Q3S A;  4KTW A;  1HJR A;  3LP0 A;  5SZT A;  3KK3 A;  3NHG A;  4DWI A;  1VSK A;  1TAU A;  3V81 A;  4FK4 A;  1X9W A;  3VQE A;  3LPT A;  3L2U A;  4J2B A;  2RPI A;  3HVT A;  3V9W A;  4KHU A;  4KPY A;  3I8D A;  1VRT A;  2P1J A;  3NFA A;  3ZSZ A;  2F8S A;  2HW3 A;  2NUB A;  3VQQ A;  1HQU A;  1XHX A;  4E7K A;  2OPS A;  4FJ5 A;  1ZBH A;  3NF6 A;  3C95 A;  4IFY A;  3ZT2 A;  4B9L A;  4OKJ A;  2HHU A;  4Q5V A;  1BQN A;  2ZE2 A;  4CED A;  2VWJ A;  4F8R A;  2KFZ A;  2EX3 A;  3OS1 A;  1KFD A;  4KO0 A;  4C8M A;  3IG1 A;  4CJ5 A;  3L2V A;  3OS2 A;  1IKV A;  3M8S A;  1NK8 A;  5FRN A;  3AVF A;  2YHB A;  1BHL A;  2OPP A;  5KRS A;  3CFP A;  2P5G A;  2HVI A;  4I9L A;  2D0B A;  3O3H A;  3RWU A;  4Y1C A;  4DQR A;  4CEE A;  5KRT A;  1CXU A;  1TKX A;  5HLF A;  3QNO A;  4FW2 A;  3SQ4 A;  1UA0 A;  4DSL A;  4AHV A;  3MED A;  4KHS A;  1NOZ A;  3QIO A;  2HVH A;  2PYJ A;  1RT6 A;  3MEE A;  3RMA A;  2HHV A;  2Z1I A;  4DSJ A;  3OYC A;  4FJK A;  1RBT A;  2JLE A;  4MQ3 A;  3MAQ A;  3OYG A;  4L8R B;  3LZJ A;  1LV5 A;  2FBY A;  4F3T A;  1REV A;  4ZTJ A;  4Z0U A;  4HTU A;  4BAC A;  3C6U A;  2VG6 A;  1BL3 A;  4CGI A;  1BGX T;  3HP9 A;  3OYF A;  1TVR A;  2YKM A;  3PX6 A;  3ZSX A;  5E41 A;  3RRG A;  1S9E A;  2YNG A;  3A2F A;  3UIQ A;  3LP3 A;  1WSH A;  3U6F A;  4KAZ A;  3HYF A;  3ISN C;  4HVJ A;  3LP1 A;  5KGW A;  1NK6 A;  3LAM A;  1TGO A;  3V1R A;  1RT7 A;  1QTM A;  4CK2 A;  1TKZ A;  5HRN A;  1RT5 A;  3ZT0 A;  4ELU A;  1KCF A;  3SPY A;  1I3A A;  4CIF A;  3RMB A;  1TKT A;  4E3S A;  1BIZ A;  1BIS A;  4M3T A;  1X9S A;  1SL1 A;  2YHA A;  3AVN A;  3NBP A;  3OYM A;  1S1U A;  4FLT A;  3RR8 A;  3WNG A;  2ETJ A;  4C8K A;  1S6Q A;  3NGY A;  1UA1 A;  4CEO A;  4OGC A;  4HCC A;  4EZ6 A;  3KK2 A;  4B3O A;  3VQ4 A;  4KKO A;  2YNI A;  3KJV A;  3C94 A;  3NGI A;  1KLN A;  5KGX A;  3T3F A;  4J2E A;  4N47 A;  1KVA A;  1TKD A;  1YT3 A;  5EU7 A;  3QER A;  3SQ0 A;  4CJS A;  4DFJ A;  1GOC A;  1RT3 A;  5T7B A;  3DLH A;  5K14 A;  2Y1I A;  3QNN A;  1JLE A;  3AA2 A;  4RW7 A;  3ZSO A;  2XY5 A;  1XC9 A;  1T05 A;  3TR8 A;  3AVJ A;  1W9H A;  3DLK A;  2YNF A;  4HUE A;  4CHP A;  2OPR A;  3NH1 A;  3TAF A;  4DSI A;  3SQ1 A;  4CFA A;  1C1A A;  1SUQ A;  3SPZ A;  1S1T A;  2E4L A;  4CEQ A;  3U3G A;  4DFM A;  2XHB A;  3KTQ A;  1L3T A;  4KTQ A;  4FLZ A;  3JSM A;  1TL1 A;  4DTJ A;  1C0U A;  2G8K A;  3HST B;  3TAB A;  4DQI A;  1JLB A;  2FC0 A;  2DFE A;  5CZ2 A;  1GOA A;  1J9A A;  1KVC A;  4Z4E A;  3CFO A;  3KLI A;  5J2M A;  2G8I A;  1FKP A;  4LY7 A;  1WSI A;  4E7J A;  5CYM A;  5J1E A;  4DTU A;  4KB0 A;  2O4I A;  1D5A A;  1VSE A;  4FJM A;  3VQC A;  3HT3 A;  4DSF A;  3HPH A;  3HXM A;  4KI4 A;  4GVM A;  3OYI A;  4FJJ A;  1VRU A;  4FJL A;  1A5X A;  4GMJ B;  3KLG A;  1VK0 A;  4DU1 A;  1KTQ A;  1NKB A;  4FJ9 A;  5JS2 A;  3T19 A;  4CJQ A;  1L3S A;  4FJN A;  4CEC A;  3RMD A;  4ZTF A;  1KLM A;  3DRR A;  3HPG A;  4B9V A;  3P1G A;  1TV6 A;  3H08 A;  1L3V A;  4NCB A;  2Z1H A;  3SZ2 A;  3QEV A;  3ZSY A;  1W0H A;  3K58 A;  4KHW A;  1C1C A;  3DRS A;  4UQG A;  1JLQ A;  2YV0 X;  3NGZ A;  3K5L A;  4HHT A;  2IDO A;  2X6S A;  2KQ2 A;  5HRP A;  4DTX A;  4CJF A;  1KFS A;  4M3Z A;  2DTU A;  1Q9Y A;  3KIO A;  1FKO A;  1RNH A;  1WSJ A;  4CEB A;  3MXI A;  1KSP A;  2HHX A;  2IGI A;  4CHZ A;  4BDZ A;  3QIP A;  3VQ8 A;  3HM9 A;  3TAQ A;  3HPO A;  1BQM A;  2FBX A;  5HRR A;  4CJ4 A;  2RN2 A;  2XY8 A;  3OJS A;  1D8Y A;  3HVR A;  2E6L A;  2HHW A;  2YKN A;  4FJ7 A;  1VSD A;  3M8P A;  4Z4C A;  4DLE A;  4FLU A;  1ZBL A;  4NCA A;  4QCL A;  1QS4 A;  4CE9 A;  1JLG A;  2WON A;  1QSL A;  4CCH A;  3K5N A;  4KHQ A;  3LWM A;  1HMV A;  4KFB A;  4FJX A;  4FJH A;  1VSJ A;  3AA4 A;  4G1Q A;  3F9K A;  4W5R A;  4JS4 A;  1A5V A;  1KVB A;  1LWF A;  3AVC A;  4CJU A;  1RDB A;  2P51 A;  3QIN A;  4AHS A;  3OYL A;  1LAW A;  3KLH A;  3V9S A;  4CJR A;  3SV3 A;  4Z4H A;  3RRH A;  2DFF A;  4CHY A;  5I42 A;  2HHQ A;  3AA5 X;  4FZY A;  1XHZ A;  4M42 A;  4OPK A;  4CHQ A;  3P5J A;  3NCI A;  2F96 A;  1RCH A;  2HNZ A;  2X6N A;  4KV8 A;  4OVL A;  3SUQ A;  3VQ7 A;  3IAY A;  4BDY A;  1RTD A;  1QHT A;  1R0A A;  1HNI A;  4CJ3 A;  4FW1 A;  1JL1 A;  3HK2 A;  2VG7 A;  2KTQ A;  1LW2 A;  3ASM A;  1FXX A;  3QEW A;  3QET A;  2XY6 A;  3S3O A;  1HYZ A;  3HP6 A;  3AVH A;  1NK0 A;  3NDK A;  3HL8 A;  4I2Q A;  3K57 A;  4DU4 A;  4CF1 A;  3LPU A;  4B8A B;  1L5U A;  5CZ1 A;  4W5Q A;  3SJJ A;  5KTQ A;  4DQQ A;  4I9Q A;  4XIU A;  2G8F A;  4CJE A;  1IH7 A;  3NH0 A;  2PYL A;  1MU2 A;  2A1R A;  1BCO A;  1Y97 A;  4C8L A;  4PUO A;  3SUO A;  4ID1 A;  1VSM A;  2HHS A;  4AHU A;  1UAX A;  3L8B A;  2HHT A;  1GOB A;  2KW4 A;  3OYH A;  1G15 A;  4F4K A;  3IRX A;  4C8O A;  2XO7 A;  1WSG A;  1JLA A;  2OZS A;  4DLG A;  2KZM A;  4HCB A;  4O55 A;  4CGD A;  4NYF A;  1DTT A;  4CEZ A;  3AO4 A;  1S1X A;  3OYJ A;  1UWB A;  4M3R A;  3S9H A;  1N6Q A;  1LWC A;  2BDP A;  2B4J A;  4TSX A;  5C25 A;  3OYB A;  4FLX A;  1IKX A;  4CK1 A;  3V1O A;  1N5Y A;  1NOY A;  1X9M A;  1Q8I A;  1FK9 A;  1VSF A;  5C24 A;  3DI6 A;  1BI4 A;  2FBV A;  3AA3 A;  4PA1 A;  2RF2 A;  4CK3 A;  4RW4 A;  4CGJ A;  3WNH A;  1HQE A;  2XY7 A;  3PY8 A;  2BAN A;  3VQ6 A;  4E1N A;  1VSI A;  4CJW A;  2B5J A;  4M3U A;  4R5P A;  4FVM A;  4CJK A;  1JLF A;  3L2R A;  2IOC A;  4KHY A;  3WNE A;  3FFI A;  4CES A;  1ZBF A;  1C1B A;  1JKH A;  2GBZ A;  4FZZ A; 
#chains in the Genus database with same CATH topology
 2ITM A;  4DTM A;  2IC3 A;  3O9U A;  5GAH P;  3UKR A;  4BE2 A;  1S1V A;  4BE0 A;  2WC9 A;  3I8B A;  4AHC A;  5J2N A;  2WOM A;  2YHW A;  2D0C A;  5BRE A;  1EX4 A;  1T6D A;  1WUA A;  2HMI A;  1SKS A;  1YTU A;  4LSN A;  5IWA K;  5KPZ A;  3AAR A;  4O8U A;  1OKJ A;  3PX0 A;  5JIC A;  1WAF A;  3THV A;  4H5T A;  2YJF A;  3OY9 A;  2KZZ A;  3J7Y P;  1Q18 A;  3EZ5 A;  4FLW A;  3R1X A;  4J2A A;  1U4B A;  4JKB A;  5TKW A;  4FSV A;  2X74 A;  4EP5 A;  2HNY A;  5HRO A;  2G8V A;  4CFB A;  1Q86 O;  4LF5 K;  3UB5 A;  1XMO K;  1YUW A;  4B1Z A;  4IOA L;  5HRS A;  1NG9 A;  5GIP A;  3SQ2 A;  4JAX A;  5CYQ A;  1BOT O;  5H1S Q;  1OH8 A;  1RDW X;  4Z4F A;  5AQH A;  3ZSR A;  3TAN A;  1C0F A;  5EY4 A;  4FWR A;  1S22 A;  3T1A A;  1HRH A;  2QEX N;  1XI1 A;  3D2E B;  1N36 K;  3KLE A;  3QDK A;  5BPL A;  4KH4 A;  2A3Z A;  1GLA G;  3MXM A;  1RBV A;  2I7P A;  4DV0 K;  4Z4G A;  4LF6 K;  3O9T A;  1WSE A;  3EZW A;  3VQA A;  2F9W A;  4DV1 K;  1Z25 A;  4JKG B;  4CZJ A;  5BR8 K;  1HNZ K;  2D5R A;  3B6P A;  2QKK A;  4HUG A;  4AHR A;  4ELT A;  3EE8 A;  3K5O A;  3O9Q A;  3VA0 A;  4FCY A;  1QSS A;  3VQ5 A;  4YOT A;  2YNH A;  3MN6 A;  3AO3 A;  2ZGY A;  1U04 A;  4NLC A;  4NXN K;  4DUZ K;  2G8W A;  3TTC A;  3ITH A;  3VQP A;  4CGF A;  5FPD A;  4F3O A;  3LAN A;  4B1V A;  4YHH K;  3NF9 A;  1XWL A;  1T03 A;  3PLA A;  3BZC A;  5KI6 A;  1LAV A;  5GIN A;  2B6A A;  1YIJ N;  4IZ9 A;  1E4F T;  1BO5 O;  4GKJ K;  4BWM A;  2NRZ A;  4N41 A;  4CIE A;  3JXU A;  4LSL A;  3AVM A;  1ZBU A;  3T1H K;  3J7A P;  4H4M A;  2P9N A;  2QTD A;  4W5N A;  3MN7 A;  1T8E A;  1BI4 B;  2VWK A;  4WCE L;  3ZET B;  4B1X B;  4CF9 A;  3H6E A;  3B6O A;  4RW8 A;  4FPA A;  1C0M A;  4W5O A;  5AQG A;  5HBM A;  3OYA A;  3QEI A;  4KB1 A;  4PWD A;  4E89 A;  3BZK A;  4H0T B;  4BRF A;  1NKC A;  1Z6R A;  3TAE A;  1ASU A;  3BUZ B;  3UKR B;  2BTF A;  2ASP A;  1OH5 A;  1RT2 A;  1WAJ A;  2IIR A;  4JD2 A;  3CFR A;  4IO8 A;  4O44 A;  4OPH A;  5KQ8 A;  3OVN A;  1SL0 A;  4BR7 A;  2G8U A;  4RCH A;  2QXF A;  2FSK A;  4R79 A;  4CGG A;  4K41 A;  1WLJ A;  2DPN A;  4LFC K;  1W2B M;  1MWK A;  1U6Z A;  5F2R A;  4KH5 A;  2I5J A;  2EHG A;  3DRP A;  4O0I A;  3EYZ A;  4H8K A;  3VET A;  2UXD K;  4E7L A;  4M41 A;  4EZ9 A;  1KAY A;  3M3Z A;  4IDK A;  3SBG A;  4BR0 A;  4IWV A;  3J8A A;  5F0X A;  3AO1 A;  4PY5 A;  4EP4 A;  1KQS M;  1SV5 A;  3I0R A;  4OKK A;  4IDH A;  1SL2 A;  3NF7 A;  4DQP A;  5AQY A;  3RTV A;  4Q0B A;  3LAL A;  1HKB A;  5LMN K;  4H4O A;  4K8Z A;  3QBX A;  1X3N A;  4CFC A;  3OYN A;  5I9E B;  1HR0 K;  1NK9 A;  1JL2 A;  2OAN A;  2VG5 A;  3MWT A;  1X9W A;  3OHR A;  1HJO A;  4KPY A;  1T3V A;  2P1J A;  1IJJ A;  2IVN A;  2F8S A;  2HW3 A;  4FJ5 A;  1ZBH A;  3WXL A;  4IFY A;  4B9L A;  1FJG K;  3CC4 N;  4DCH A;  3VEZ A;  1EQY A;  3TSP A;  1YJN N;  2KFZ A;  4KO0 A;  1BHL A;  5KRS A;  2D0B A;  5BRH A;  3O3H A;  2CH6 A;  4CEE A;  2H3G X;  3QNO A;  4FW2 A;  4JI0 K;  4AHV A;  4M7X A;  5AQF A;  1NOZ A;  3CQX A;  4CW7 B;  3H45 C;  2PYJ A;  2HVH A;  1TUU A;  2Z1I A;  3M5R A;  4MQ3 A;  2JLE A;  5E26 A;  3MAQ A;  4X64 K;  3E9L A;  1REV A;  4PL7 A;  4B3R K;  1BL3 A;  3HP9 A;  1TVR A;  1S9E A;  4WQ5 C;  1WSH A;  4H0P A;  5KGW A;  3LAM A;  2UXB K;  4CK2 A;  1TKZ A;  4GV9 A;  1SQK A;  1KCF A;  3THW A;  1I3A A;  4CZF A;  3RMB A;  4FPB A;  4E3S A;  4JI1 K;  2YHA A;  3NBP A;  1KC8 O;  3RR8 A;  1S6Q A;  1UA1 A;  3KK7 A;  2P9N B;  4B3O A;  1HNX K;  2NRX A;  1TYQ A;  3TPQ A;  4FOE A;  3D7E O;  5KGX A;  1YT3 A;  4CJS A;  4CZG A;  3DLH A;  5M1O A;  5B8H A;  5M1Q A;  3EEQ A;  1JLE A;  4RW7 A;  3QNN A;  3AVJ A;  4YDU A;  2YNF A;  5F1X A;  3SQ1 A;  4CFA A;  2WUS A;  1SUQ A;  3KTQ A;  3EL2 A;  1L3T A;  4KTQ A;  1TL1 A;  4DTJ A;  3GE1 A;  3TAB A;  5C15 A;  1OH7 A;  4JI3 K;  2QWP A;  3MX5 A;  1J9A A;  3M6G A;  4FOI A;  4Z4E A;  3CFO A;  3KLI A;  4JD2 B;  4KB0 A;  5CYM A;  5J1E A;  3TSQ A;  3HOT A;  3ID6 A;  4BRL A;  4V19 S;  5KPR A;  2P9L A;  1YI2 N;  1VRU A;  3O1W A;  1NGH A;  5AQW A;  4CEC A;  3DLL L;  4XH5 A;  1KLM A;  3DRR A;  3P1G A;  5FPE A;  1ZXO A;  4RTF D;  1L3V A;  2Z1H A;  3ZSY A;  3O80 A;  4KHW A;  1G99 A;  3BDP A;  2IDO A;  4DTX A;  3F5T A;  4BRN A;  4BDZ A;  3HM9 A;  3HPO A;  2FBX A;  3OJS A;  4ISE A;  2E6L A;  2YKN A;  1OH6 A;  2D0P A;  3ULE B;  2QWM A;  2NRR A;  3H46 O;  5LY3 A;  3LWM A;  3IMX A;  1VSJ A;  4CZK A;  4W5R A;  2BGG A;  3KLH A;  3V9S A;  1LAW A;  3A5L C;  3RRH A;  5I42 A;  1J6Z A;  2ZJR L;  4OPK A;  3P5J A;  2F96 A;  1RCH A;  3SUQ A;  4KV8 A;  4BDY A;  1RTD A;  4CJ3 A;  2ZF5 O;  1LW2 A;  3ASM A;  1FXX A;  4EFH A;  2XY6 A;  4BR4 A;  3AVH A;  4MLH A;  1NK0 A;  1BDG A;  4DU4 A;  4CF1 A;  3SJJ A;  1YXQ A;  3AGR A;  5AQM A;  4CJE A;  1MWM A;  3E66 A;  1Y97 A;  4C8L A;  2D1K A;  4BRP A;  3RSE A;  3CCE N;  3G25 A;  1BG3 A;  2YX6 A;  4BGA A;  5C2F A;  1JLA A;  2KZM A;  4CI6 A;  4HCB A;  4CGD A;  3AO4 A;  5BRF A;  2UXC K;  3VEN A;  3VGL A;  1UWB A;  3S9H A;  1LWC A;  2BDP A;  1IKX A;  2A41 A;  1Q8I A;  1VSF A;  3AA3 A;  1ESV A;  3J7Z O;  3T69 A;  2QW9 A;  1NGA A;  2WTU A;  4FWQ A;  3IFR A;  2EWS A;  4RW4 A;  4CGJ A;  5CR4 A;  3O4W A;  3WQU A;  4E1N A;  1ZC6 A;  2IOC A;  4KHY A;  2QXL A;  1JKH A;  3THW B;  3MEC A;  4CEF A;  1JXE A;  1RDC A;  4F2R A;  3UE5 A;  4AIL C;  3SLC A;  2QK9 A;  5GAE P;  1I94 K;  1TYQ B;  5M1F A;  3O3G A;  3L3U A;  1VQ8 N;  4K42 A;  3CCQ N;  4CF0 A;  4JKE A;  4GV6 A;  3ZX0 A;  3E01 A;  4JKD A;  1KRP A;  4KTZ A;  1EET A;  1ZBS A;  4DFP A;  3AGK A;  3O5B A;  4O5F A;  5AFU H;  4IXC A;  4GV3 A;  5HP1 A;  3VES A;  3KK1 A;  3RMC A;  1KAZ A;  2BUP A;  3CET A;  3GDQ A;  1VQK N;  3SAF A;  3AVB A;  1QZ5 A;  1Z05 A;  3O9S A;  1RDD A;  3DLG A;  4ILJ A;  4RG8 A;  4LH4 A;  1B92 A;  3LDL A;  1T7P A;  3S3M A;  4AM6 A;  3CCV N;  2IS3 A;  4ICL A;  3DLE A;  1JCE A;  3OYD A;  1NJY A;  2KKZ A;  1ZYQ A;  2NNW A;  5AQX A;  3D2E A;  3DMJ A;  3GG4 A;  1RBS A;  2A40 A;  4KRF A;  4CIG A;  4C8N A;  1GLJ O;  1GLF O;  1JLC A;  1YTA A;  3CJ7 A;  4IG0 A;  3DLB A;  1BIU A;  4ELV A;  1X1P A;  4FM0 A;  1SZ2 A;  4WQ4 C;  5A2Q O;  1MA9 B;  4AHT A;  3ULD A;  1Z26 A;  1NK5 A;  4L3Q A;  3I56 N;  1WB9 A;  3JAM O;  5SWM A;  4FWL A;  3CM5 A;  1RBU A;  3TAP A;  1VSH A;  2E88 A;  3IS9 A;  3D6R A;  1NJX A;  4BC2 A;  3F2K A;  3VQD A;  3VTH A;  1N33 K;  4KBO A;  4PL8 A;  3H3N O;  1KD1 O;  3CCM N;  1RTI A;  3DXK A;  4I6M A;  4B9U A;  3W0L A;  2XRI A;  4JI6 K;  1HUX A;  1CZB A;  2OYQ A;  1NJZ A;  3EN9 A;  1NJI O;  3J80 O;  4A5B A;  4KHN A;  1NK4 A;  4E0D A;  1M1K O;  2DFH A;  5AJ3 K;  3RSE B;  3SNN A;  4JI4 K;  3FFK B;  3NAE A;  4KI6 A;  1W7A A;  3CC2 N;  3K9K A;  5CE3 A;  3UKU B;  3TSU A;  3WNF A;  2G8H A;  3ZYY X;  4FLY A;  5EXW A;  3PX4 A;  4BRI A;  3CG7 A;  2ATQ A;  3ENH A;  1X3M A;  2Z1G A;  4OLA A;  4DS5 A;  4CHN A;  1QZ6 A;  3V6D A;  1N32 K;  3KVG A;  3KKR A;  1U49 A;  4IG3 A;  3AO5 A;  4JI5 K;  4AF1 A;  4CHO A;  1LWE A;  2FSJ A;  2RKI A;  3GL1 A;  2VGN A;  5C10 A;  3AV9 A;  5J2P A;  3PSI A;  1B9F A;  3ZSW A;  3MMV A;  3DOL A;  3L6Q A;  1DEJ A;  3VTI A;  3AAP A;  1ASW A;  1N8R O;  2DY4 A;  3IKM A;  3K0S A;  3T1Y K;  4FK2 A;  1Q82 O;  1YVN A;  5AQQ A;  3O08 A;  2IAJ A;  3OYK A;  5MLC Q;  3TI0 A;  3MXJ A;  1DTQ A;  4MO4 A;  2E2N A;  3U9Z A;  1BA0 A;  4IOX A;  2NLX A;  4IKF A;  3JYT A;  4KHQ A;  4H5N A;  1RTH A;  4ILH A;  2HMP A;  4M45 A;  3WXM B;  4JRP A;  4FJG A;  1HYV A;  4FLV A;  1HNV A;  4NLB A;  3AVI A;  4BC5 A;  4GW6 A;  4MDB A;  3R9P A;  3K2P A;  2A1S A;  1C6V A;  3CQ8 A;  3DLR A;  1WBD A;  1EKE A;  5JLH A;  1F21 A;  2I7N A;  5AQT A;  3PUF A;  3OS0 A;  3F73 A;  3NHG A;  2ZWH A;  1VSK A;  3H1V X;  1VQM N;  3VER A;  3FGU A;  4FK4 A;  3LPT A;  3L2U A;  2F9T A;  5M1N A;  3HVT A;  3I8D A;  4BR2 A;  4U67 L;  2W40 A;  2NUB A;  3VQQ A;  1YJW N;  3P38 A;  1NMN A;  3CCU N;  4DR5 K;  3NF6 A;  4BR5 A;  3ZT2 A;  4OKJ A;  3ENO A;  5JVH L;  2O8D A;  2Q97 A;  4F8R A;  1KFD A;  4C8M A;  5LJV A;  5FRN A;  3AVF A;  4BVP A;  3CFP A;  5JLF A;  4H0V B;  1JCG A;  4DQR A;  2FF6 A;  5ADX H;  4MLE A;  2PAV A;  4ILG B;  4NB4 A;  3QIO A;  3LDO A;  5AQN A;  3KWI A;  3MEE A;  5LMU K;  5AQO A;  3DXK B;  4DR2 K;  4DSJ A;  4I6M B;  3OYC A;  1LV5 A;  4B1W B;  4EHT A;  3CCJ N;  4ZTJ A;  2VG6 A;  1BGX T;  5AQU A;  2YKM A;  2ZM6 K;  2YNG A;  3A2F A;  3U6F A;  4KAZ A;  4EAH D;  2VYP A;  1NK6 A;  4YOW A;  4Z94 A;  1QTM A;  4JYA K;  3D2F B;  1TKT A;  1VQ6 N;  1BIS A;  3LL3 A;  5AZJ A;  1X9S A;  3FR0 A;  1QQO A;  3OYM A;  4BC4 A;  4C8K A;  3CF5 L;  3NGY A;  4OGC A;  4B9Q A;  3TU5 A;  3VQ4 A;  4IEE A;  4KKO A;  3C94 A;  5BRD A;  3T3F A;  1KVA A;  1TKD A;  4DFJ A;  3HZ6 A;  2E1Y A;  2Y1I A;  3DJC A;  1LCU A;  1XC9 A;  1T05 A;  3TR8 A;  1W9H A;  1IBL K;  4CHP A;  1VQ9 N;  1VQ7 N;  4OO1 J;  3U3G A;  4DFM A;  2XHB A;  4BRD A;  3THX A;  4IEI A;  1C0U A;  3FE1 A;  4BRQ A;  3HST B;  1Q7Y O;  1JLB A;  2DFE A;  5CZ2 A;  1GOA A;  4DR1 K;  3VGM A;  2KLA A;  1E4G T;  4GKK K;  1WSI A;  3R3L A;  3KHY A;  2RHK A;  4FJM A;  3HT3 A;  2ZJQ L;  3CC7 N;  3HPH A;  3OYI A;  1HKC A;  3B8A X;  5JS2 A;  3T19 A;  1L3S A;  3RMD A;  4H0O A;  3HPG A;  4GVE A;  3ULE A;  4C23 A;  3H08 A;  4JK9 A;  1NGC A;  1W0H A;  4UQG A;  3K5L A;  1JLQ A;  1HKG A;  2X6S A;  2KQ2 A;  4CJF A;  2VCP A;  4M3Z A;  1KSP A;  1FKO A;  4CEB A;  4MO5 A;  3VGK A;  4CHZ A;  3C65 A;  4CD1 A;  4XH1 A;  4CVN E;  4PKH A;  2RN2 A;  4DLE A;  1U2V A;  4NCA A;  1QS4 A;  1QSL A;  3K9J A;  4K0K K;  1HMV A;  4KFB A;  3AA4 A;  1A5V A;  1LWF A;  3AVC A;  4CJU A;  3OYL A;  2P51 A;  4AHS A;  4A62 A;  4CJR A;  4FWK A;  4A59 A;  3OTO K;  1Q81 O;  1XHZ A;  2NRV A;  3NCI A;  3IAY A;  3VQ7 A;  3DWL A;  4KHP K;  1VQ5 N;  3BF3 A;  1XMQ K;  3HK2 A;  2KTQ A;  4O8K A;  4NO7 A;  3G6E N;  1NU0 A;  3LDP A;  1L5U A;  4W5Q A;  2O8D B;  4DQQ A;  4I9Q A;  4XIU A;  2G8F A;  3NH0 A;  2PYL A;  3G71 N;  2A1R A;  1BCO A;  2FXU A;  4PUO A;  4CZL A;  3BEX A;  3DXM B;  3OYH A;  4F4K A;  3SBT A;  4H0Y B;  4O55 A;  4FL9 A;  2P9K A;  1J5E K;  3OYJ A;  2OCE A;  4MDA A;  3VEX A;  2B4J A;  5C25 A;  3OYB A;  4B3M K;  1X9M A;  5AQP A;  4Y0W A;  1FK9 A;  3MN9 A;  4LF7 K;  3DI6 A;  2FBV A;  4PA1 A;  2RF2 A;  3HM8 A;  2XY7 A;  2A42 A;  1HQE A;  3PY8 A;  3O6W A;  2BAN A;  1VSI A;  2GX9 A;  2B5J A;  4M3U A;  5C2D A;  4R5P A;  4BG9 A;  4CJK A;  3MWP A;  3BF1 A;  4WYB A;  3HBT A;  3M8S A;  3TTD A;  5GAG P;  5AZJ B;  2HND A;  2GEM A;  1SS6 A;  3KD5 E;  1NGF A;  4Z4I A;  2A5X A;  1QSY A;  3NVM A;  1NGE A;  2NZT A;  1U47 A;  5BN9 A;  2ZQB A;  1TK0 A;  3AO2 A;  4PKI A;  2FLO A;  3PO5 A;  3ALY A;  4DSK A;  5JVG L;  2IVO A;  3WXI A;  4BDP A;  3WXJ A;  1BCM A;  3VA3 A;  1NNE A;  3DOK A;  4ZHR A;  2P9S A;  1P8Z A;  4HTL A;  4E19 A;  4E7H A;  4B9N A;  1U45 A;  3O4N A;  2QWL A;  3THX B;  1NGJ A;  4JKF A;  1RT1 A;  3LAK A;  4PQU A;  1UOC A;  3AVK A;  4ID5 A;  1CZ9 A;  1WSF A;  1GLE G;  2FBT A;  3TWH A;  2WBN A;  1NJW A;  3QEX A;  4F2S A;  4DS4 A;  1VQO N;  4OKE A;  4LD0 A;  4CJV A;  5JS1 A;  4BE1 A;  4B9M A;  4DMN A;  2ZJP L;  3ID8 A;  2CGK A;  2OZM A;  2VGM A;  4B08 A;  1WOQ A;  1ASV A;  4JI8 K;  2HBM A;  2W6L A;  1IBM K;  1O13 A;  2O8C A;  4CF2 A;  3KLF A;  3BGR A;  3MCA B;  3L3V A;  3CD6 N;  2QA4 N;  3EY1 A;  2O8F A;  3ZT1 A;  2OPQ A;  2QKB A;  2Q1N A;  5AFU A;  4CER A;  3ZLJ A;  3PIP L;  1TK8 A;  1U2V B;  1S5J A;  2JGU A;  4QOZ B;  4N76 A;  4RWT A;  3VMF B;  5CY4 A;  3P31 A;  3VF2 A;  2Q31 A;  3KKS A;  4JLH A;  3FZL A;  3M8R A;  1GLL O;  4HWI A;  3TAG A;  2P5O A;  3CJ1 A;  2NRT A;  4RW9 A;  2PFU A;  4C1N I;  3TAR A;  2PZS A;  3L2Q A;  4BWJ A;  4DU3 A;  2E6M A;  3ZSQ A;  4FVU A;  1ATN A;  1VSL A;  4IJA A;  1IO2 A;  5EOY A;  3NE6 A;  2ITG A;  3V9X A;  3UKU A;  3NMU A;  3Q7C A;  5J2Q A;  4CJP A;  4DB3 A;  4GY2 B;  3D0P A;  1HLU A;  3ZSV A;  1GLC G;  2O4G A;  3THY B;  2W42 A;  1J5O A;  3V9Z A;  1K8A O;  3A0I X;  4G9Z A;  5FRO A;  4FXD A;  2UUA K;  3VQ9 A;  3SAH A;  2P9K B;  2QWQ A;  3R6M A;  4M3X A;  3ZCM A;  3CPW M;  4NCG A;  4DR3 K;  1EP4 A;  3ZT3 A;  5BPN A;  3TTF A;  1W97 L;  2UU9 K;  4DF4 A;  3ZT4 A;  2W6K A;  5AQZ A;  5HOO A;  3RR7 A;  4JI2 K;  4BG8 A;  3LP2 A;  1IBK K;  3VOV A;  4H5W A;  4DF8 A;  2IVP A;  1J53 A;  1GLD G;  1WNS A;  3VEO A;  3NF8 A;  4BRG A;  5DK5 A;  1K9M O;  3U9D A;  1SKW A;  4WFB L;  4CZI A;  3AVL A;  1CLQ A;  4OGE A;  4DG1 A;  5I3U A;  2HST A;  2AJQ A;  2PY5 A;  1X9J A;  3HJF A;  3OYE A;  3LWL A;  2V51 B;  1HYS A;  4M3W A;  4IFV A;  3QB0 A;  5FRM A;  2O8B A;  2JWL A;  1DLO A;  4FZX C;  1TK5 A;  3M8Q A;  3O1B A;  2QWN A;  3EKU A;  3O4Q A;  3K5M A;  1RGI A;  1JXB A;  2QWR A;  3QO9 A;  3G4S N;  3CER A;  2P9S B;  2E8A A;  4BRO A;  5KQD A;  5AQL A;  3HSC A;  4YOX A;  2UUC K;  3VEV A;  3VEY A;  1I39 A;  1RIL A;  1NK7 A;  3S3N A;  4E1M A;  2Q0U A;  4DV6 K;  4BVO A;  3BY5 A;  2A6A A;  1A5W A;  2Z1J A;  4NYN A;  4AH9 A;  3W3D A;  3G10 A;  1ATR A;  4FWM A;  4FYD A;  1CXQ A;  3TAM A;  2P9U A;  3AAQ A;  1ITG A;  4CFD A;  1JCF A;  4X66 K;  3K59 A;  4N56 A;  4DTO A;  4WFA L;  4YDU C;  3GOI A;  3CYM A;  2NRH A;  3C6T A;  1K6Y A;  3QLH A;  3AVG A;  4FK0 A;  5HL7 L;  3WUH A;  4H0X B;  3C6A A;  1T6C A;  5SZT A;  1TAU A;  3V81 A;  3VQE A;  3E9P A;  4J2B A;  1XUP O;  2O8C B;  3V9W A;  4M63 C;  4B3S K;  1VRT A;  3NFA A;  4H5V A;  5AZI A;  4CD3 A;  2O8F B;  1HQU A;  2CH5 A;  2OPS A;  3CJC A;  4QS7 A;  3C95 A;  4CBW A;  4U7B A;  2HHU A;  4Q5V A;  4JNE A;  2FF3 B;  4NXM K;  4PKG A;  2ZE2 A;  2VWJ A;  2ASO A;  3KZB A;  3IG1 A;  4CJ5 A;  1YAG A;  2YHB A;  4DR6 K;  1BWF O;  5AQJ A;  2P5G A;  4I9L A;  4Y1C A;  1CXU A;  1NBW A;  4BRH A;  4DSL A;  1UA0 A;  3VEW A;  1RT6 A;  3RMA A;  4FJK A;  3LZJ A;  3D2F A;  2FSN A;  2FBY A;  2CGL A;  4H5R A;  4DV4 K;  4BAC A;  4CGI A;  3OYF A;  3ZSX A;  3MN5 A;  3UIQ A;  3HYF A;  3ISN C;  3QFU A;  4HVJ A;  3LP1 A;  3E9O A;  1TGO A;  3V1R A;  1RT7 A;  4JKH A;  4M7Y A;  5FLX O;  1RT5 A;  3SPY A;  2E2Q A;  3SMS A;  1SL1 A;  4JV5 K;  4FLT A;  3U4L A;  4LFA K;  3WNG A;  4CEO A;  4FWN A;  2YNI A;  2P9P A;  3C7N A;  3KJV A;  1KLN A;  4BC3 A;  3QER A;  3SQ0 A;  3JS6 A;  5E84 A;  1RT3 A;  1NWK A;  5T7B A;  5ADX A;  3E1Y A;  1YJ9 N;  3L4Q A;  2YHX A;  2ASM A;  3DLK A;  2Q36 A;  4JK8 A;  1NGB A;  4HUE A;  4EHU A;  2OPR A;  5AR0 A;  3NH1 A;  3TAF A;  1C1A A;  3SPZ A;  1S1T A;  2E4L A;  1C0G A;  3FZF A;  4ISF A;  5GIO A;  2FC0 A;  4BR9 A;  2O8B B;  1KVC A;  3S41 A;  1K8K A;  2OTL N;  4LF9 K;  4LY7 A;  4A57 A;  4DTU A;  1EO1 A;  2O4I A;  1VSE A;  4DSF A;  1EWQ A;  3HXM A;  3ZEU A;  3ZX2 A;  1VHX A;  4DU1 A;  4BRM A;  4JEP A;  1NKB A;  4FJ9 A;  4FJN A;  4CJQ A;  3AY9 A;  4JKC A;  3SAG A;  4C1N K;  3QEV A;  3K58 A;  1DGK N;  1C1C A;  2YV0 X;  4HHT A;  5DM7 L;  1KFS A;  2DTU A;  2HHX A;  4XEI A;  1RNH A;  1WSJ A;  1HPM A;  2E1Z A;  2IGI A;  3PIO L;  3QIP A;  3VQ8 A;  2D4W A;  4CJ4 A;  5HRR A;  2P9U B;  4BQZ A;  1D8Y A;  3HVR A;  4YOU A;  1VSD A;  2WFB A;  4Z4C A;  4FJ7 A;  1HNW K;  4CE9 A;  1JLG A;  2WON A;  2CGJ A;  3K5N A;  4FJX A;  5TKY A;  4G1Q A;  4YOR A;  4JS4 A;  1KVB A;  2F8T A;  1RDB A;  3QIN A;  4WQ5 A;  4Z4H A;  4CHY A;  3AA5 X;  4FZY A;  3CXC M;  4M42 A;  4CHQ A;  3EO3 A;  4OVL A;  1M90 O;  4CJ7 A;  4H03 B;  1QHT A;  1R0A A;  1HNI A;  1JL1 A;  1NM1 A;  2VG7 A;  3DXM A;  1VQN N;  5AZI B;  3QEW A;  3QET A;  3HP6 A;  3LM9 A;  3DAW A;  3VF6 A;  3K57 A;  4I2Q A;  3LPU A;  5CZ1 A;  5KTQ A;  4FO0 A;  3CME N;  2JWK A;  3HTV A;  4JK7 A;  4PHT X;  3CPE A;  3SUO A;  2UUB K;  4ID1 A;  2KW4 A;  3PSF A;  1G15 A;  4B3T K;  1QQN A;  3IRX A;  4AQY K;  4C8O A;  3MDQ A;  2OZS A;  1DKG D;  1DTT A;  1S1X A;  3R8E A;  3H1Q A;  3OA9 A;  1N6Q A;  4DV5 K;  3T7Z A;  5DM6 L;  4FLX A;  1N5Y A;  4JKA A;  3WEE A;  3M1F A;  4EIA A;  1LOT B;  3ATV A;  4CK3 A;  3WNH A;  2OTJ N;  3VQ6 A;  1S72 N;  4CJW A;  5M1K A;  1JLF A;  3L2R A;  3WNE A;  4CES A;  1ZBF A;  1C1B A;  2GBZ A;  4FZZ A;  1P90 A;  4DFK A;  1EXQ A;  3SV4 A;  3SCX A;  1ILY A;  2GUP A;  3A5O C;  1S9G A;  2KFN A;  5FPN A;  3KD1 E;  4CBX A;  3O3F A;  2P9P B;  3C7N B;  3DYA A;  1IG9 A;  3OW2 M;  1RDU A;  4BRK A;  1TL3 A;  1YF5 L;  4YOV A;  3P83 D;  3V9U A;  4I2P A;  1S6P A;  3NH2 A;  1OVQ A;  4FJ8 A;  3CHW A;  4OPJ A;  4OLB A;  4O0J A;  2GV9 A;  3SYZ A;  4CF8 A;  2P9I A;  1IG8 A;  1NKE A;  4DTR A;  4X62 K;  1BU6 O;  1K8K B;  1NLV A;  3CI5 A;  1QVG M;  4DQS A;  4KH6 A;  5D3G A;  1V4T A;  1VQP N;  1YVU A;  4WE1 A;  2BE2 A;  3ZEU B;  1L3U A;  1QQC A;  4BY9 C;  4CEA A;  4DTP A;  2E5L K;  3A5N C;  1XQS C;  1C0T A;  4LH5 A;  3L2W A;  2LSN A;  2QM1 A;  5AQS A;  1B9D A;  5EX5 A;  2HBK A;  3G0Z A;  4E7I A;  4DTN A;  4WF9 L;  3I33 A;  3QEP A;  1KXP A;  4FWO A;  4ISG A;  4CBU A;  3GBT A;  4JRQ A;  3CM6 A;  5LJW A;  1U48 A;  1S3X A;  2OA8 A;  1NGG A;  3P39 A;  3WT0 A;  3PV8 A;  4CZE A;  3SUN A;  2HF3 A;  4B9S A;  2AA4 A;  2KHO A;  4JS5 A;  1RBR A;  3PO4 A;  3IDH A;  4O4G A;  3VN5 A;  3THY A;  4CZH A;  4IBN A;  3SI6 A;  5BPM A;  4YFU A;  4YNQ A;  4CJL A;  3VF4 A;  4KRE A;  3AVA A;  3HO1 A;  3I0S A;  3U3Y A;  4DHY A;  4MFB A;  5LL6 Z;  2GWJ A;  3DM2 A;  4DSE A;  4FWP A;  4FM2 A;  3O8M A;  4WFN L;  1QE1 A;  5ELZ A;  4CGH A;  2E2P A;  1QQM A;  4QS9 A;  1D9F A;  2GUI A;  5KPT A;  1R59 O;  1RDA A;  4RW6 A;  3V1Q A;  1TAQ A;  3WXK A;  4DKW A;  3SUP A;  1ZBI A;  3SMP A;  4BRE A;  4YY3 K;  2D0A A;  4FM1 A;  4B8C A;  3N4P A;  3OJU A;  3HRG A;  2ZD1 A;  1WN7 A;  3VQB A;  1S1W A;  1D9D A;  3WEE B;  4K8X A;  1IKW A;  3O9R A;  3QES A;  1HPZ A;  2VWB A;  5FDL A;  1QVF M;  1ATS A;  5C12 A;  4LFB K;  3QBW A;  4LC9 B;  3LZI A;  5GAD P;  4B1U B;  1V4S A;  4HUF A;  2GEL A;  1J54 A;  4B9T A;  3C6H A;  4K25 A;  4I7F A;  1SKR A;  2HBJ A;  1GLB G;  3I55 N;  4J2D A;  4UY8 O;  4DUY K;  5DMR A;  2YI1 A;  3MCP A;  1RT4 A;  3HI0 A;  4B1Y B;  4A61 A;  3ATU A;  3Q7B A;  1YIT N;  2HF4 A;  4O5B A;  5FPM A;  4WQ4 A;  4BQL A;  4N5S A;  3FZM A;  2Y1J A;  1QHA A;  2HBL A;  3CCS N;  3ENB A;  1O1W A;  4QAG A;  2YCH A;  2HB5 A;  1SAZ A;  2R7Y A;  4BRC A;  3A8Y A;  5IT9 O;  3OBY A;  4W5T A;  1VQL N;  4CJT A;  4FJI A;  4OJR A;  1BUP A;  3LDS A;  4Y1D A;  3C0B A;  4DQ8 A;  5BN8 A;  2P9I B;  3MEG A;  2V7Z A;  4DTS A;  4QS8 A;  4M3Y A;  5C42 A;  3ZX3 A;  2X78 A;  1Q9X A;  3D45 A;  1IKY A;  3V4I A;  1RTJ A;  2AP1 A;  3BP8 A;  4A5A A;  1LW0 A;  1T44 A;  2GWK A;  1WBB A;  1JJ2 M;  4IJN A;  2Q3S A;  4KTW A;  1HJR A;  3LP0 A;  3A5M C;  3KK3 A;  4DV7 K;  4DWI A;  2O8E A;  2RPI A;  3VPZ A;  1DT9 A;  2V52 B;  4KHU A;  4DV3 K;  5AQK A;  3LM2 A;  3ZSZ A;  3QFP A;  1XHX A;  4E7K A;  2J4R A;  1BQN A;  4JHD A;  4CED A;  4X65 K;  2EX3 A;  3N4Q A;  4A2A A;  3OS1 A;  1NK8 A;  3L2V A;  3OS2 A;  1IKV A;  4IOC L;  4BGB A;  2OPP A;  2HVI A;  2F7T A;  2Q2R A;  1K73 O;  3RWU A;  5KRT A;  1TKX A;  3U8X A;  1OVY A;  5HLF A;  3SQ4 A;  1NGD A;  4KHS A;  3MED A;  1FW6 A;  1H1V A;  5AQR A;  4F9O A;  2F4V K;  4K43 A;  3H3O B;  2HHV A;  1HX1 A;  1RBT A;  3QML A;  3OYG A;  4L8R B;  2QWO A;  3CQY A;  2NRW A;  4F3T A;  4AM7 A;  4Z0U A;  4HTU A;  3C6U A;  3FLC O;  3PX6 A;  3CIP A;  5E41 A;  3RRG A;  3LP3 A;  3CMA N;  3EE9 A;  3HOS A;  5BR9 A;  5HRN A;  4ELU A;  3ZT0 A;  1Y64 A;  4CIF A;  1IV0 A;  1BIZ A;  4M3T A;  1XNR K;  4DR4 K;  2D0O A;  3AVN A;  1S1U A;  2V7Y A;  3CCR N;  2ETJ A;  5JMV A;  3CJ9 A;  4HCC A;  4EZ6 A;  3KK2 A;  1EWR A;  3NGI A;  4J2E A;  4N47 A;  2E20 A;  1XC3 A;  4BRA A;  5EU7 A;  1GOC A;  4E1J A;  3CCL N;  5K14 A;  3AA2 A;  3ZSO A;  2HHH K;  4OPA A;  2XY5 A;  3P4I A;  3SJH A;  1BA1 A;  2VQE K;  4DSI A;  4CEQ A;  4FLZ A;  3JSM A;  2G8K A;  4DQI A;  1VQ4 N;  3CJA A;  4CZM A;  5J2M A;  4LF4 K;  2G8I A;  1FKP A;  4E7J A;  1D5A A;  3VQC A;  4KI4 A;  5AQV A;  4DR7 K;  4GVM A;  4FJJ A;  4FJL A;  1A5X A;  4GMJ B;  2UYT A;  1VK0 A;  3KLG A;  1KTQ A;  2VQF K;  4LF8 K;  4ZTF A;  2PBD A;  4B9V A;  3F9M A;  1TV6 A;  4YOY A;  3WQT A;  4NCB A;  3SZ2 A;  3L0Q A;  3DRS A;  3NGZ A;  1CZA N;  5HRP A;  5C0Y A;  4DV2 K;  2P9L B;  4XH4 A;  3KIO A;  3MXI A;  1Q9Y A;  3FZH A;  3TAQ A;  3SK3 A;  1BQM A;  1D4X A;  2XY8 A;  1RFQ A;  2HHW A;  2QI2 A;  3M8P A;  1ZBL A;  4FLU A;  1YHQ N;  4QCL A;  5EVZ A;  4JKG A;  1NGI A;  4CCH A;  3OBW A;  1XNQ K;  4FJH A;  4OX9 K;  3F9K A;  1VAZ A;  4A2B A;  4GNI A;  2ZGZ A;  3SV3 A;  3NVK A;  2HHQ A;  2DFF A;  3L4I A;  2O8E B;  2RE2 A;  2HOE A;  1E3M A;  2HNZ A;  2HHS A;  2X6N A;  4FW1 A;  4FWS A;  3S3O A;  1MDU B;  1HYZ A;  2GTD A;  3NDK A;  3HL8 A;  4B8A B;  1TUY A;  4JHD B;  3CJB A;  3RVC A;  3MK6 A;  1IH7 A;  2E2O A;  1MU2 A;  3EKS A;  3LDN A;  1VSM A;  4AHU A;  1UAX A;  3L8B A;  4IFE A;  2HHT A;  1GOB A;  4IO9 L;  2XO7 A;  1WSG A;  1N34 K;  3FZK A;  4DLG A;  4NYF A;  2YJE A;  4CEZ A;  3MX2 A;  4M3R A;  2W41 A;  4TSX A;  1KAX A;  4CK1 A;  3V1O A;  1NOY A;  4JN4 A;  2YHY A;  5AQI A;  5C24 A;  1BI4 A;  2Q0R A;  3LDQ A;  3IUC A;  3ZET A;  3QIC A;  5M1P A;  4JI7 K;  4J8F A;  2BH1 A;  4FVM A;  1NMD A;  5CHI A;  3FFI A;  3KWG A;  3J81 O; 
#chains in the Genus database with same CATH homology
 3MEC A;  4DFK A;  1EXQ A;  4DTM A;  2IC3 A;  4CEF A;  3SV4 A;  2HND A;  3SCX A;  3KD5 E;  1JXE A;  1S9G A;  1RDC A;  4BE2 A;  1S1V A;  4F2R A;  2KFN A;  4BE0 A;  3KD1 E;  4Z4I A;  4AIL C;  1QSY A;  2QK9 A;  2F8T A;  3O3F A;  1U47 A;  4AHC A;  3DYA A;  5J2N A;  2WOM A;  3O3G A;  1IG9 A;  2D0C A;  2ZQB A;  1TK0 A;  3AO2 A;  1EX4 A;  3PO5 A;  3ALY A;  4DSK A;  3L3U A;  4CF0 A;  2HMI A;  1TL3 A;  4BDP A;  3E01 A;  3VA3 A;  1BCM A;  1SKS A;  4KTZ A;  1KRP A;  3V9U A;  1EET A;  3P83 D;  4I2P A;  1S6P A;  4LSN A;  3NH2 A;  4DFP A;  4FJ8 A;  1YTU A;  3DOK A;  4ZHR A;  3PX0 A;  5HP1 A;  4OPJ A;  4E19 A;  3KK1 A;  3RMC A;  1WAF A;  4E7H A;  3THV A;  4B9N A;  4OLB A;  1U45 A;  3O4N A;  3OY9 A;  2KZZ A;  4O0J A;  2GV9 A;  1RT1 A;  3EZ5 A;  4FLW A;  3LAK A;  4J2A A;  3SYZ A;  3AVB A;  1UOC A;  4PQU A;  3AVK A;  1U4B A;  4ID5 A;  1RDD A;  2X74 A;  3DLG A;  1CZ9 A;  4LH4 A;  4RG8 A;  1WSF A;  1B92 A;  2HNY A;  4CF8 A;  4EP5 A;  3S3M A;  2FBT A;  4DTR A;  1NKE A;  1T7P A;  3TWH A;  1NJW A;  5HRO A;  2IS3 A;  4CFB A;  2G8V A;  3QEX A;  4ICL A;  3DLE A;  4F2S A;  4DS4 A;  3OYD A;  4DQS A;  1NJY A;  5D3G A;  4OKE A;  4LD0 A;  4CJV A;  5JS1 A;  1ZYQ A;  1YVU A;  4BE1 A;  5HRS A;  4WE1 A;  3BDP A;  4B9M A;  2BE2 A;  4DMN A;  3DMJ A;  1L3U A;  1RBS A;  3SQ2 A;  1QQC A;  2OZM A;  5CYQ A;  4B08 A;  4KRF A;  4CIG A;  4C8N A;  4CEA A;  4DTP A;  4Z4F A;  3ZSR A;  1ASV A;  1JLC A;  1YTA A;  3TAN A;  4IG0 A;  1C0T A;  3DLB A;  4LH5 A;  1BIU A;  3L2W A;  4ELV A;  1X1P A;  3T1A A;  2LSN A;  4FM0 A;  1HRH A;  1B9D A;  3G0Z A;  4CF2 A;  3KLF A;  3BGR A;  4E7I A;  4DTN A;  1XI1 A;  3L3V A;  3KLE A;  3QEP A;  3EY1 A;  1RBV A;  3MXM A;  3ZT1 A;  4AHT A;  4Z4G A;  2OPQ A;  2QKB A;  3ULD A;  1WSE A;  1Z26 A;  4CER A;  1NK5 A;  4JRQ A;  3CM6 A;  1TK8 A;  1S5J A;  1U48 A;  3VQA A;  2JGU A;  2OA8 A;  1Z25 A;  3PV8 A;  5SWM A;  4N76 A;  4QOZ B;  2D5R A;  3B6P A;  3CM5 A;  3SUN A;  4B9S A;  1RBU A;  4JS5 A;  3TAP A;  1VSH A;  5CY4 A;  2QKK A;  4HUG A;  1RBR A;  3KKS A;  4JLH A;  4AHR A;  3IS9 A;  4ELT A;  3K5O A;  3M8R A;  3VA0 A;  3TAG A;  4FCY A;  1NJX A;  2P5O A;  1QSS A;  3VQ5 A;  3PO4 A;  2YNH A;  2BGG A;  3VQD A;  4RW9 A;  3AO3 A;  3TAR A;  2PZS A;  3L2Q A;  1U04 A;  4O4G A;  4BWJ A;  3VN5 A;  4DU3 A;  1RTI A;  2E6M A;  3ZSQ A;  4IBN A;  1VSL A;  3SI6 A;  4B9U A;  1IO2 A;  2G8W A;  2XRI A;  4YFU A;  3NE6 A;  4YNQ A;  2ITG A;  4CJL A;  3V9X A;  1CZB A;  3ITH A;  4KRE A;  2OYQ A;  3AVA A;  3HO1 A;  3I0S A;  3U3Y A;  3VQP A;  4CGF A;  1NJZ A;  4F3O A;  5J2Q A;  4CJP A;  4MFB A;  4KHN A;  1NK4 A;  3LAN A;  3D0P A;  3ZSV A;  3DM2 A;  3NF9 A;  4DSE A;  4FM2 A;  1XWL A;  4E0D A;  2O4G A;  1QE1 A;  2DFH A;  1T03 A;  2W42 A;  4CGH A;  5KI6 A;  3V9Z A;  3SNN A;  1J5O A;  3NAE A;  1D9F A;  2GUI A;  1LAV A;  4KI6 A;  1RDA A;  4RW6 A;  3V1Q A;  2B6A A;  5FRO A;  4FXD A;  1TAQ A;  3VQ9 A;  3WNF A;  3SUP A;  1ZBI A;  4BWM A;  4N41 A;  4M3X A;  4CIE A;  3ZCM A;  2G8H A;  4NCG A;  1EP4 A;  3ZT3 A;  4LSL A;  2D0A A;  4FM1 A;  3ZT4 A;  4B8C A;  3AVM A;  4FLY A;  3OJU A;  1ZBU A;  4DF4 A;  3PX4 A;  2ZD1 A;  1WN7 A;  4H4M A;  3VQB A;  3RR7 A;  1S1W A;  4W5N A;  1D9D A;  3LP2 A;  3CG7 A;  2ATQ A;  1T8E A;  1BI4 B;  4K8X A;  1IKW A;  2Z1G A;  2VWK A;  4OLA A;  3QES A;  4DS5 A;  1HPZ A;  4IKF A;  4CHN A;  4DF8 A;  5FDL A;  4CF9 A;  1J53 A;  3V6D A;  3LZI A;  3B6O A;  4RW8 A;  3KKR A;  1C0M A;  1WNS A;  4W5O A;  3NF8 A;  5HBM A;  3OYA A;  5DK5 A;  4IG3 A;  3AO5 A;  3QEI A;  1U49 A;  1SKW A;  4KB1 A;  4PWD A;  4E89 A;  3AVL A;  1CLQ A;  4HUF A;  4CHO A;  4OGE A;  1J54 A;  1LWE A;  4DG1 A;  1NKC A;  5I3U A;  3TAE A;  1ASU A;  4B9T A;  2AJQ A;  2RKI A;  2PY5 A;  4I7F A;  1SKR A;  3HJF A;  3OYE A;  4J2D A;  3AV9 A;  5J2P A;  3LWL A;  1B9F A;  1HYS A;  5DMR A;  1RT2 A;  1WAJ A;  3ZSW A;  1RT4 A;  4M3W A;  4IFV A;  3DOL A;  5FRM A;  4O5B A;  2Y1J A;  4N5S A;  1DLO A;  1ASW A;  3CFR A;  4FZX C;  2DY4 A;  1TK5 A;  3M8Q A;  1O1W A;  4O44 A;  4QAG A;  4FK2 A;  3O4Q A;  3OVN A;  3K5M A;  2HB5 A;  1SL0 A;  1JXB A;  2IAJ A;  2G8U A;  3OYK A;  2QXF A;  3TI0 A;  3QO9 A;  2R7Y A;  4CGG A;  3MXJ A;  1DTQ A;  1WLJ A;  4W5T A;  4CJT A;  1I39 A;  1RIL A;  4FJI A;  4OJR A;  3LDS A;  1NK7 A;  3S3N A;  3JYT A;  2I5J A;  4Y1D A;  2EHG A;  3DRP A;  4E1M A;  4O0I A;  4H8K A;  1RTH A;  3EYZ A;  4M45 A;  4M41 A;  3MEG A;  4JRP A;  4E7L A;  4FJG A;  1HYV A;  4FLV A;  1HNV A;  4DTS A;  1A5W A;  4M3Y A;  2Z1J A;  4NYN A;  4IDK A;  4AH9 A;  5C42 A;  4EZ9 A;  3G10 A;  3AVI A;  4GW6 A;  2X78 A;  3AO1 A;  4PY5 A;  1Q9X A;  4FYD A;  1CXQ A;  3TAM A;  4EP4 A;  3K2P A;  3D45 A;  1ITG A;  2A1S A;  1SV5 A;  1C6V A;  3I0R A;  4OKK A;  4CFD A;  3NF7 A;  3K59 A;  3CQ8 A;  3DLR A;  1SL2 A;  4N56 A;  4DTO A;  4DQP A;  1IKY A;  3RTV A;  3V4I A;  4Q0B A;  1RTJ A;  3LAL A;  3CYM A;  3C6T A;  1EKE A;  1K6Y A;  1F21 A;  1LW0 A;  4H4O A;  3QLH A;  4K8Z A;  3AVG A;  4FK0 A;  3PUF A;  4CFC A;  3OYN A;  3OS0 A;  3F73 A;  1NK9 A;  1JL2 A;  2VG5 A;  2Q3S A;  4KTW A;  1HJR A;  3LP0 A;  5SZT A;  3KK3 A;  3NHG A;  4DWI A;  1VSK A;  1TAU A;  3V81 A;  4FK4 A;  1X9W A;  3VQE A;  3LPT A;  3L2U A;  4J2B A;  2RPI A;  3HVT A;  3V9W A;  4KHU A;  4KPY A;  3I8D A;  1VRT A;  2P1J A;  3NFA A;  3ZSZ A;  2F8S A;  2HW3 A;  2NUB A;  3VQQ A;  1HQU A;  1XHX A;  4E7K A;  2OPS A;  4FJ5 A;  1ZBH A;  3NF6 A;  3C95 A;  4IFY A;  3ZT2 A;  4B9L A;  4OKJ A;  2HHU A;  4Q5V A;  1BQN A;  2ZE2 A;  4CED A;  2VWJ A;  4F8R A;  2KFZ A;  2EX3 A;  3OS1 A;  1KFD A;  4KO0 A;  4C8M A;  3IG1 A;  4CJ5 A;  3L2V A;  3OS2 A;  1IKV A;  3M8S A;  1NK8 A;  5FRN A;  3AVF A;  2YHB A;  1BHL A;  2OPP A;  5KRS A;  3CFP A;  2P5G A;  2HVI A;  4I9L A;  2D0B A;  3O3H A;  3RWU A;  4Y1C A;  4DQR A;  4CEE A;  5KRT A;  1CXU A;  1TKX A;  5HLF A;  3QNO A;  4FW2 A;  3SQ4 A;  1UA0 A;  4DSL A;  4AHV A;  3MED A;  4KHS A;  1NOZ A;  3QIO A;  2HVH A;  2PYJ A;  1RT6 A;  3MEE A;  3RMA A;  2HHV A;  2Z1I A;  4DSJ A;  3OYC A;  4FJK A;  1RBT A;  2JLE A;  4MQ3 A;  3MAQ A;  3OYG A;  4L8R B;  3LZJ A;  1LV5 A;  2FBY A;  4F3T A;  1REV A;  4ZTJ A;  4Z0U A;  4HTU A;  4BAC A;  3C6U A;  2VG6 A;  1BL3 A;  4CGI A;  1BGX T;  3HP9 A;  3OYF A;  1TVR A;  2YKM A;  3PX6 A;  3ZSX A;  5E41 A;  3RRG A;  1S9E A;  2YNG A;  3A2F A;  3UIQ A;  3LP3 A;  1WSH A;  3U6F A;  4KAZ A;  3HYF A;  3ISN C;  4HVJ A;  3LP1 A;  5KGW A;  1NK6 A;  3LAM A;  1TGO A;  3V1R A;  1RT7 A;  1QTM A;  4CK2 A;  1TKZ A;  5HRN A;  1RT5 A;  3ZT0 A;  4ELU A;  1KCF A;  3SPY A;  1I3A A;  4CIF A;  3RMB A;  1TKT A;  4E3S A;  1BIZ A;  1BIS A;  4M3T A;  1X9S A;  1SL1 A;  2YHA A;  3AVN A;  3NBP A;  3OYM A;  1S1U A;  4FLT A;  3RR8 A;  3WNG A;  2ETJ A;  4C8K A;  1S6Q A;  3NGY A;  1UA1 A;  4CEO A;  4OGC A;  4HCC A;  4EZ6 A;  3KK2 A;  4B3O A;  3VQ4 A;  4KKO A;  2YNI A;  3KJV A;  3C94 A;  3NGI A;  1KLN A;  5KGX A;  3T3F A;  4J2E A;  4N47 A;  1KVA A;  1TKD A;  1YT3 A;  5EU7 A;  3QER A;  3SQ0 A;  4CJS A;  4DFJ A;  1GOC A;  1RT3 A;  5T7B A;  3DLH A;  5K14 A;  2Y1I A;  3QNN A;  1JLE A;  3AA2 A;  4RW7 A;  3ZSO A;  2XY5 A;  1XC9 A;  1T05 A;  3TR8 A;  3AVJ A;  1W9H A;  3DLK A;  2YNF A;  4HUE A;  4CHP A;  2OPR A;  3NH1 A;  3TAF A;  4DSI A;  3SQ1 A;  4CFA A;  1C1A A;  1SUQ A;  3SPZ A;  1S1T A;  2E4L A;  4CEQ A;  3U3G A;  4DFM A;  2XHB A;  3KTQ A;  1L3T A;  4KTQ A;  4FLZ A;  3JSM A;  1TL1 A;  4DTJ A;  1C0U A;  2G8K A;  3HST B;  3TAB A;  4DQI A;  1JLB A;  2FC0 A;  2DFE A;  5CZ2 A;  1GOA A;  1J9A A;  1KVC A;  4Z4E A;  3CFO A;  3KLI A;  5J2M A;  2G8I A;  1FKP A;  4LY7 A;  1WSI A;  4E7J A;  5CYM A;  5J1E A;  4DTU A;  4KB0 A;  2O4I A;  1D5A A;  1VSE A;  4FJM A;  3VQC A;  3HT3 A;  4DSF A;  3HPH A;  3HXM A;  4KI4 A;  4GVM A;  3OYI A;  4FJJ A;  1VRU A;  4FJL A;  1A5X A;  4GMJ B;  3KLG A;  1VK0 A;  4DU1 A;  1KTQ A;  1NKB A;  4FJ9 A;  5JS2 A;  3T19 A;  4CJQ A;  1L3S A;  4FJN A;  4CEC A;  3RMD A;  4ZTF A;  1KLM A;  3DRR A;  3HPG A;  4B9V A;  3P1G A;  1TV6 A;  3H08 A;  1L3V A;  4NCB A;  2Z1H A;  3SZ2 A;  3QEV A;  3ZSY A;  1W0H A;  3K58 A;  4KHW A;  1C1C A;  3DRS A;  4UQG A;  1JLQ A;  2YV0 X;  3NGZ A;  3K5L A;  4HHT A;  2IDO A;  2X6S A;  2KQ2 A;  5HRP A;  4DTX A;  4CJF A;  1KFS A;  4M3Z A;  2DTU A;  1Q9Y A;  3KIO A;  1FKO A;  1RNH A;  1WSJ A;  4CEB A;  3MXI A;  1KSP A;  2HHX A;  2IGI A;  4CHZ A;  4BDZ A;  3QIP A;  3VQ8 A;  3HM9 A;  3TAQ A;  3HPO A;  1BQM A;  2FBX A;  5HRR A;  4CJ4 A;  2RN2 A;  2XY8 A;  3OJS A;  1D8Y A;  3HVR A;  2E6L A;  2HHW A;  2YKN A;  4FJ7 A;  1VSD A;  3M8P A;  4Z4C A;  4DLE A;  4FLU A;  1ZBL A;  4NCA A;  4QCL A;  1QS4 A;  4CE9 A;  1JLG A;  2WON A;  1QSL A;  4CCH A;  3K5N A;  4KHQ A;  3LWM A;  1HMV A;  4KFB A;  4FJX A;  4FJH A;  1VSJ A;  3AA4 A;  4G1Q A;  3F9K A;  4W5R A;  4JS4 A;  1A5V A;  1KVB A;  1LWF A;  3AVC A;  4CJU A;  1RDB A;  2P51 A;  3QIN A;  4AHS A;  3OYL A;  1LAW A;  3KLH A;  3V9S A;  4CJR A;  3SV3 A;  4Z4H A;  3RRH A;  2DFF A;  4CHY A;  5I42 A;  2HHQ A;  3AA5 X;  4FZY A;  1XHZ A;  4M42 A;  4OPK A;  4CHQ A;  3P5J A;  3NCI A;  2F96 A;  1RCH A;  2HNZ A;  2X6N A;  4KV8 A;  4OVL A;  3SUQ A;  3VQ7 A;  3IAY A;  4BDY A;  1RTD A;  1QHT A;  1R0A A;  1HNI A;  4CJ3 A;  4FW1 A;  1JL1 A;  3HK2 A;  2VG7 A;  2KTQ A;  1LW2 A;  3ASM A;  1FXX A;  3QEW A;  3QET A;  2XY6 A;  3S3O A;  1HYZ A;  3HP6 A;  3AVH A;  1NK0 A;  3NDK A;  3HL8 A;  4I2Q A;  3K57 A;  4DU4 A;  4CF1 A;  3LPU A;  4B8A B;  1L5U A;  5CZ1 A;  4W5Q A;  3SJJ A;  5KTQ A;  4DQQ A;  4I9Q A;  4XIU A;  2G8F A;  4CJE A;  1IH7 A;  3NH0 A;  2PYL A;  1MU2 A;  2A1R A;  1BCO A;  1Y97 A;  4C8L A;  4PUO A;  3SUO A;  4ID1 A;  1VSM A;  2HHS A;  4AHU A;  1UAX A;  3L8B A;  2HHT A;  1GOB A;  2KW4 A;  3OYH A;  1G15 A;  4F4K A;  3IRX A;  4C8O A;  2XO7 A;  1WSG A;  1JLA A;  2OZS A;  4DLG A;  2KZM A;  4HCB A;  4O55 A;  4CGD A;  4NYF A;  1DTT A;  4CEZ A;  3AO4 A;  1S1X A;  3OYJ A;  1UWB A;  4M3R A;  3S9H A;  1N6Q A;  1LWC A;  2BDP A;  2B4J A;  4TSX A;  5C25 A;  3OYB A;  4FLX A;  1IKX A;  4CK1 A;  3V1O A;  1N5Y A;  1NOY A;  1X9M A;  1Q8I A;  1FK9 A;  1VSF A;  5C24 A;  3DI6 A;  1BI4 A;  2FBV A;  3AA3 A;  4PA1 A;  2RF2 A;  4CK3 A;  4RW4 A;  4CGJ A;  3WNH A;  1HQE A;  2XY7 A;  3PY8 A;  2BAN A;  3VQ6 A;  4E1N A;  1VSI A;  4CJW A;  2B5J A;  4M3U A;  4R5P A;  4FVM A;  4CJK A;  1JLF A;  3L2R A;  2IOC A;  4KHY A;  3WNE A;  3FFI A;  4CES A;  1ZBF A;  1C1B A;  1JKH A;  2GBZ A;  4FZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...