2FC0A

Wrn exonuclease, mn dgmp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fc0A00
2G8IA 4DSLA 4F2SA 4IFYA 2YKMA 2YNIA 3PUFA 1FK9A 4DFMA 1U47A 4CJLA 3VN5A 1K6YA 4CJWA 3O4QA 1RDBA 5HRPA 2HNYA 4CEZA 4FJHA 4FK4A 2D5RA 3OS0A 3DLGA 2B4JA 3DM2A 3OYEA 1RCHA 3AA4A 3KD5E 2B5JA 4FXDA 4N5SA 4CGIA 4CJEA 2HHQA 4DU4A 1SL0A 3MXMA 3SQ4A 1RILA 3V1QA 4JS4A 1KRPA 1S1TA 1BISA 1NK0A 4B9NA 4RG8A 3AV9A 1WN7A 1KCFA 3HK2A 1BQNA 2X6NA 4CGJA 3V9XA 3HP9A 4N41A 3AVLA 2Y1JA 2P1JA 4CHQA 3SI6A 1KFDA 2Z1IA 4CJTA 2IC3A 3PX6A 5KGXA 1SKSA 2E6LA 5EU7A 1T7PA 1NK4A 3AA3A 5CYMA 1JLFA 2GV9A 2XHBA 3U6FA 3SJJA 2F8SA 2FBTA 5CZ1A 3K57A 4DTXA 3L3UA 2B6AA 4CJQA 3O3GA 3ULDA 4Z4GA 1CXUA 4NCAA 1VSDA 5I42A 1S1XA 1Y97A 3RRGA 4M45A 3HPOA 4HUEA 5HLFA 4DQPA 4CFAA 3U3GA 2HB5A 3CFOA 1RT7A 2D0CA 1IKYA 2ZD1A 1T05A 1U04A 4KTZA 1ZYQA 4CHOA 1NK9A 3ZSVA 4E7LA 1D8YA 4FJIA 3L2QA 4FJ7A 3OS2A 3S3NA 4YFUA 3HM9A 3K5OA 3G0ZA 4O0JA 2BANA 3LALA 3DLRA 3K5LA 4DLEA 4LY7A 2G8VA 2Q3SA 2Y1IA 2G8HA 2IOCA 3LZIA 3LDSA 4M42A 1IKWA 4OGEA 3SPYA 1RDAA 5I3UA 4CEFA 3QIPA 4HUFA 1ZBHA 1CZBA 1B92A 2YNGA 4CF9A 3HVRA 4N76A 2FBYA 1JLGA 2X78A 4GW6A 4N56A 2G8WA 2KFZA 4I9QA 3SYZA 3M8QA 4LH4A 4AILC 1LAVA 3WNFA 2Z1JA 1FKPA 1NKBA 4CJFA 3VQCA 4GVMA 4CGFA 1BCOA 1XHXA 3AVFA 1A5VA 1J9AA 3TANA 1HYSA 4JLHA 4LSNA 4FLXA 2YKNA 1TVRA 4J2AA 5J2PA 5JS1A 2E4LA 3LP0A 4IG3A 3V9WA 3RWUA 1KVCA 1LWCA 1YTAA 1YVUA 2PY5A 3T19A 4CF2A 1Z26A 4Z4HA 4CCHA 4J2EA 4CFDA 1JLAA 1WAFA 1KVAA 4KO0A 3QEXA 2D0BA 1RDDA 3OYJA 4CEAA 2YNFA 4LD0A 3QEVA 3OYDA 2OPPA 2OPSA 4CHYA 3LZJA 3AO1A 4FJNA 4H8KA 4KB1A 1I3AA 3HYFA 4KI4A 1CLQA 4DS5A 3LP2A 4TSXA 4FLZA 4FJMA 3V1RA 4N47A 1EKEA 3KK3A 4B3OA 3VA0A 4M3ZA 3A2FA 3C94A 1JLEA 4E89A 1C6VA 1WNSA 2A1SA 3AA5X 4PY5A 1EX4A 2PYLA 3WNEA 2ATQA 3HPGA 4EZ9A 3NH1A 3V9ZA 2FC0A 4CJVA 5SZTA 4CJKA 3NF8A 4CEEA 2YHAA 4DU3A 3RRHA 4C8OA 4OPJA 3ZT2A 3SQ1A 3QERA 3SV3A 1UA0A 4FVMA 2QK9A 4QAGA 1NK5A 3DLHA 1YTUA 2HVIA 4B9SA 4C8MA 1A5XA 4Q5VA 1QTMA 4OPKA 3QEPA 4DSFA 4E7IA 3ZT1A 1ZBFA 2XY8A 3SUNA 4ELVA 1RTHA 5J1EA 4B08A 4FM2A 1HQEA 3K5MA 5HRRA 4DF4A 1VSLA 2RPIA 1D9DA 2KFNA 3NE6A 4C8NA 2HNDA 3NBPA 3HJFA 1C1CA 1NJXA 1VRUA 4ELUA 4KB0A 4AHTA 3C6UA 2HVHA 1S5JA 3V9UA 4KHQA 4FJGA 3ZSZA 3MXIA 4DSJA 2IDOA 1WAJA 4FYDA 3P83D 1TGOA 1TKDA 1C0TA 3KK1A 2XY7A 4BDPA 1NKCA 4FZYA 3IAYA 4DSEA 3SZ2A 3CQ8A 1RTIA 3SUPA 5C42A 3MEDA 3V6DA 4ZHRA 3CG7A 3V1OA 4E0DA 1NJWA 2QKBA 5K14A 3DLEA 4OVLA 4I9LA 1S9GA 2WOMA 4L8RB 1DTQA 3AO5A 5T7BA 2VG5A 4B8CA 1DLOA 2DFFA 3TAQA 1JKHA 3TAGA 3SQ2A 5J2NA 1NK6A 1JLCA 3QINA 3MXJA 2XY5A 4OLBA 4Z4EA 4CGDA 4RW8A 4DG1A 1FKOA 4FM0A 1WSIA 3RMDA 4RW9A 1RBSA 3KLEA 2NUBA 1RT2A 4M3UA 3K5NA 4MFBA 3OYLA 1RT1A 3QEIA 1ITGA 5KI6A 3LP3A 3TWHA 3MEGA 4FW1A 3KTQA 4Z4FA 3C6TA 5CY4A 3I0SA 3NF6A 3QEWA 2P51A 2YNHA 1NJYA 3AVGA 1REVA 4CEOA 3TABA 2PZSA 3L2WA 2IS3A 3O4NA 3HO1A 1NKEA 2HMIA 4CF8A 4OKJA 3V9SA 4ELTA 1RBVA 2RF2A 2WONA 3VQ8A 4IDKA 1TAQA 4M3RA 3OJUA 3EYZA 4FZXC 2KZZA 2P5OA 4H4OA 5DMRA 4F8RA 3AVAA 4BE1A 3OYMA 1TKXA 1JXBA 3UIQA 2HHTA 4EP5A 1W0HA 3PO4A 1C0UA 4Z0UA 4CGHA 2Z1HA 4OLAA 2DTUA 2ITGA 1U45A 2LSNA 4NYNA 1IO2A 3F9KA 4HVJA 1Q8IA 3JYTA 5KRSA 2HW3A 3TAEA 1YT3A 3TARA 1QQCA 1MU2A 2IAJA 3DLBA 1SKWA 1RNHA 3ISNC 1VSKA 3SPZA 4CF0A 4CK1A 3IS9A 2OA8A 4FJJA 4M3YA 3ZSYA 4AHVA 4CJ5A 3KLFA 4PQUA 4ZTJA 4AHCA 4B9VA 4Z4IA 4F3OA 4Z4CA 4NCBA 1WSGA 3PO5A 1HPZA 1WSFA 1KLNA 1QS4A 4B9LA 4KHUA 4IFVA 4KREA 1NK8A 1BI4A 1A5WA 2RKIA 3DI6A 2X6SA 3THVA 2OYQA 4EZ6A 2EX3A 1ASWA 4KHWA 4FCYA 1UWBA 3CYMA 4J2BA 5FRMA 1ASUA 3HT3A 3NGIA 4DU1A 4DTUA 1IKXA 2JLEA 1DTTA 1ZBIA 4O0IA 2O4IA 3NH2A 5CZ2A 4BE0A 3L8BA 2F96A 3EZ5A 3SQ0A 4FJ8A 3DYAA 4CJPA 4IKFA 3G10A 3OYKA 4O5BA 3SNNA 2XO7A 3D0PA 4H4MA 4HTUA 4GMJB 1EP4A 2OPRA 2XRIA 3LWLA 3QO9A 1O1WA 2F8TA 4CIEA 1JLQA 2OZSA 2HHSA 4BE2A 3DMJA 2DFEA 2FBXA 2KQ2A 3LP1A 1VK0A 4ZTFA 1X9WA 4M3WA 5D3GA 4FJLA 4DTMA 4YNQA 2QKKA 4CFCA 3QNNA 4FLVA 3DOKA 3RR7A 4KAZA 3E01A 2RN2A 3ITHA 5KRTA 4FLUA 4K8ZA 2EHGA 5SWMA 4F3TA 1NK7A 4BWJA 4B9MA 1S9EA 2I5JA 2BGGA 1HJRA 4CFBA 4CHZA 3TR8A 4I2PA 4Y1CA 1J54A 3HVTA 2ETJA 3TAPA 4G1QA 2D0AA 1RT4A 3NHGA 2O4GA 2VG6A 4CESA 1U49A 3ASMA 2G8UA 3OYFA 4B9UA 5HBMA 3PV8A 3QNOA 3KK2A 1Q9XA 3ZCMA 3K58A 4KFBA 4DF8A 5E41A 1L3VA 4QOZB 1BCMA 2E6MA 1C0MA 4CJ3A 1B9FA 1SL2A 1D5AA 1TL1A 4DTPA 4FJKA 2IGIA 3SV4A 1CXQA 4CERA 1BI4B 2YHBA 3D45A 1C1AA 1SL1A 1S1WA 3AO2A 3TI0A 3SUOA 3S3MA 5J2MA 4F4KA 4CJ4A 4OKEA 3OYNA 4HUGA 4M3TA 1HYVA 4CECA 3KLGA 1F21A 4KV8A 3NH0A 3EY1A 4FK0A 2AJQA 3NFAA 4FJXA 1NOZA 4LSLA 1BIUA 3FFIA 4K8XA 3V81A 4JRQA 1RTJA 1C1BA 2A1RA 4CHPA 1L3SA 1ZBUA 4DTJA 3VQPA 4DTNA 1U48A 4CF1A 3QESA 3AO4A 4NCGA 4B9TA 2JGUA 1HNIA 2ZQBA 4CEQA 3OJSA 2QXFA 3AVHA 2DY4A 4ICLA 3AVIA 1X1PA 4OJRA 4RW4A 3AVBA 1RBRA 1QSLA 3DRRA 3HPHA 4PA1A 1JXEA 4E19A 5C24A 1FXXA 2X74A 1XI1A 1X9SA 4DWIA 5J2QA 5FDLA 1KTQA 4CJRA 3HP6A 3DRPA 1IG9A 4KHSA 3KIOA 3L2VA 2KZMA 1RT5A 3MECA 3F73A 4FJ9A 2Z1GA 3KLIA 4AH9A 4M41A 4FLWA 3VQBA 4KI6A 3MEEA 4KTWA 4W5TA 4E3SA 4J2DA 5FROA 4W5OA 3NDKA 3ZSOA 4FJ5A 1TK5A 3KLHA 1J53A 3L2RA 2GUIA 4FM1A 4FLTA 3TAFA 3CM5A 4FLYA 1VSMA 2GBZA 3NAEA 1QHTA 4DFPA 3QETA 3RMCA 4QCLA 1KSPA 3T3FA 1HQUA 5JS2A 4FZZA 5DK5A 1ASVA 2OZMA 3NGYA 4DTSA 2VG7A 4AHSA 4E7KA 4DFJA 3ZSQA 3QIOA 3NGZA 4I2QA 1Q9YA 4PWDA 3H08A 1VSEA 4I7FA 1TK0A 2VWKA 3VQEA 2OPQA 4NYFA 3VQ5A 4CIGA 4HCBA 3ZSWA 3BGRA 4OKKA 3V4IA 3OYCA 3KJVA 3VQAA 3IG1A 4B8AB 3KD1E 4KTQA 2YV0X 3LANA 1GOAA 4W5RA 4DS4A 3OVNA 3OY9A 1T8EA 1QSSA 3VQDA 1W9HA 4W5NA 4DFKA 1L5UA 1JL1A 3LWMA 1KVBA 2BDPA 3IRXA 1BL3A 4RW6A 3VQ4A 3OS1A 2W42A 4DLGA 3LAMA 4ID1A 4CE9A 2G8FA 3AVCA 3AVNA 4AHUA 1HNVA 2XY6A 3M8SA 1VRTA 1S1UA 1QE1A 3SCXA 3K2PA 5HRNA 3OYHA 4DTRA 3NF7A 1VSHA 4KHNA 1IKVA 4E1MA 2PYJA 2P5GA 3AA2A 3TAMA 3QLHA 2KTQA 3WNGA 1TKZA 1SUQA 3RTVA 1T03A 3CM6A 3OYGA 2KW4A 4CGGA 3S3OA 3DOLA 3DRSA 1SKRA 1HYZA 1XHZA 1TAUA 1G15A 5HROA 1HMVA 4E7JA 4BACA 4IG0A 1RBTA 5KGWA 1TL3A 3VQQA 3JSMA 1N6QA 1VSFA 3P5JA 3K59A 4BDYA 1NJZA 4RW7A 2R7YA 3WNHA 1LV5A 3B6PA 1UA1A 1RT3A 4BWMA 1ZBLA 3BDPA 4IBNA 4JS5A 5C25A 1X9MA 1LAWA 4O44A 1BGXT 1SV5A 3LPUA 4O55A 1LW0A 3VQ7A 4CHNA 4Y1DA 3LPTA 4CEDA 4DSKA 1B9DA 4LH5A 1KFSA 4EP4A 3ZSXA 1IH7A 3L3VA 3ZT0A 3PX4A 3AVKA 4BDZA 1EXQA 1WSEA 4CEBA 2G8KA 2HHVA 3AO3A 1WSHA 3O3HA 3I8DA 3NCIA 4DQQA 1L3TA 4F2RA 1LWFA 4HHTA 1BIZA 3CFPA 4C8KA 3OYIA 5KTQA 4MQ3A 4CJSA 1TV6A 1WSJA 1RT6A 4DMNA 1EETA 1CZ9A 3AVMA 3OYAA 4C8LA 4DSIA 1LWEA 1LW2A 1RBUA 1GOBA 3KKSA 3P1GA 3ZT3A 3ZT4A 4E1NA 1JL2A 4CK3A 1R0AA 4KHYA 3NF9A 3M8RA 4DQIA 4XIUA 1BQMA 4O4GA 2HHXA 3U3YA 3S9HA 1WLJA 1XC9A 4PUOA 2FBVA 4E7HA 1D9FA 1VSJA 3I0RA 3T1AA 3M8PA 4FK2A 4CIFA 3ALYA 1TKTA 4DQSA 4CK2A 1RTDA 1S6QA 3RMAA 4UQGA 3C95A 5HRSA 3SUQA 3AVJA 1L3UA 3VQ9A 4Q0BA 4ID5A 3L2UA 1S6PA 1XWLA 3PX0A 3HL8A 3PY8A 4HCCA 5CYQA 1QSYA 3RR8A 5FRNA 1KLMA 3HXMA 3LAKA 1RDCA 1JLBA 3VA3A 1HRHA 3VQ6A 1GOCA 1UAXA 1TK8A 5HP1A 4WE1A 2DFHA 1I39A 1VSIA 4DTOA 1Z25A 1UOCA 1NOYA 3OYBA 4KKOA 2VWJA 4M3XA 1J5OA 4DQRA 3O3FA 2HHUA 3MAQA 1BHLA 4W5QA 4CJUA 2HHWA 3DLKA 4OGCA 1N5YA 1U4BA 4KRFA 4FW2A 3ZSRA 4JRPA 3RMBA 2ZE2A 4AHRA 1S1VA 4R5PA 2HNZA 3KKRA 2BE2A 3CFRA 3B6OA 4KPYA 3HSTB
chains in the Genus database with same CATH superfamily
4F2SA 4IFYA 3P31A 4EFHA 3O4QA 4WYBA 2HNYA 3DM2A 1TUYA 3AA4A 3KD5E 3J7ZO 4KH4A 4FXDA 1VQNN 4DV2K 3WXKA 4BRDA 2HHQA 1O13A 3MXMA 4JS4A 5H1SQ 2ZJPL 1NK0A 4RG8A 1KCFA 3CMEN 3CJ9A 3V9XA 2P1JA 5A2QO 2CGJA 5LJWA 4H0OA 2IC3A 5EU7A 1T7PA 2RE2A 5CYMA 1EQYA 2GV9A 3RSEA 5F0XA 1NGIA 5CZ1A 3K57A 4DTXA 1ATRA 4CJQA 3O3GA 3MCPA 1OVYA 4GV9A 2YHWA 1Q7YO 4NCAA 1Y97A 3RRGA 4M63C 4M45A 1N36K 3MX2A 1VAZA 3F9MA 2D0CA 1IKYA 2ZD1A 1T05A 4K41A 1NK9A 3ZSVA 2RHKA 4E7LA 3L2QA 2YJFA 3O4WA 4LF6K 3S3NA 1KXPA 5JVGL 3IMXA 4O0JA 3K5LA 4BC2A 3GL1A 3THXA 3LDSA 5I3UA 4CEFA 3IDHA 1BUPA 4HUFA 1ZBHA 4MDAA 4N56A 3SYZA 5LJVA 1MWKA 1XHXA 2P9LA 1J9AA 1NM1A 4LSNA 2D4WA 5J2PA 4IG3A 2FSJA 2P9KB 4CCHA 4CFDA 1JLAA 1W7AA 1KVAA 4A5AA 3G25A 2GWJA 2NRXA 4A57A 3N4PA 5BN9A 4B1WB 2OPPA 3LZJA 3AO1A 2VGMA 3H1QA 4FJNA 4KB1A 3RVCA 1EKEA 5AQHA 1JLEA 3EL2A 3ULEA 1WNSA 1EX4A 1V4TA 2JWLA 1OVQA 3HPGA 2GUPA 3KZBA 4EZ9A 3E9LA 4CEEA 3RRHA 3ZETB 5IT9O 3VF6A 1UA0A 4JI6K 5GADP 2O8DB 4C8MA 3QEPA 4FJHA 2WC9A 3SAHA 4FM2A 1HQEA 2KFNA 2RPIA 5JMVA 3GBTA 1NJXA 1VRUA 4KB0A 1S5JA 3V9UA 4OO1J 3OBYA 4JI1K 5KPRA 1SS6A 4BDPA 2XY7A 5M1KA 1K9MO 4FZYA 3IAYA 4DSEA 3SZ2A 3CQ8A 4BR9A 3ZYYX 3PIPL 4JI0K 4OX9K 4ZHRA 2E88A 4OVLA 4L8RB 3AO5A 4M7XA 3SQ2A 3MXJA 3BEXA 3CETA 4FOIA 4AM6A 1Z6RA 1WOQA 3RMDA 4RW9A 4K25A 1RBSA 3KLEA 3WXJA 4BR4A 2HF3A 4PKGA 1RT1A 4Z4FA 3KWGA 5CY4A 3C6TA 3I0SA 5B8HA 2ZF5O 4CEOA 3O4NA 2HMIA 4CF8A 3V9SA 3VEYA 3OJUA 1TAQA 4GKKK 4BC5A 3AVAA 4BE1A 1TKXA 3SBGA 1W0HA 4BR2A 4Z0UA 2E2NA 3JS6A 3J7YP 4FO0A 1XUPO 4JK8A 5JLHA 4YOXA 1U45A 2Q31A 1VQMN 3F9KA 3CMAN 1MU2A 3BUZB 3DLBA 1RNHA 1VSKA 3SPZA 4CK1A 4FJJA 3ZSYA 2BUPA 3D2FB 4IWVA 4PL7A 4KH5A 3FZKA 4KREA 1BI4A 1A5WA 3CQXA 2EX3A 1ASWA 3D2EA 4FCYA 2QEXN 4GV3A 1UWBA 3H46O 2HBKA 1ASUA 2JLEA 2O4IA 4BVOA 5FPMA 3SQ0A 2FSNA 2PFUA 2O8BA 4O5BA 3D0PA 4HTUA 2OPRA 4DUYK 3QO9A 3CF5L 4JD2A 2KQ2A 1N8RO 5D3GA 4B1YB 4CFCA 3BZCA 1QVFM 1GLFO 2EHGA 5AQIA 4F3TA 1NK7A 1T6CA 4BWJA 2I5JA 2BGGA 1HJRA 3AGRA 3K9KA 4LFAK 5C10A 5EY4A 1J54A 1VHXA 4A2AA 3NHGA 2O4GA 3SMSA 2G8UA 5HBMA 3QNOA 1QQNA 3TTCA 1YIJN 1NGCA 1ATSA 4IOCL 4QOZB 4JKGB 1TL1A 1D5AA 4FJKA 1T6DA 2NRHA 3SV4A 1CXQA 3D45A 4OPAA 3AO2A 3D7EO 4FWSA 5J2MA 4F4KA 3OYNA 4M3TA 4CECA 4JKAA 1W97L 3PSIA 3NFAA 4FJXA 5AQVA 1C1BA 3M6GA 3VQPA 3AO4A 2VWBA 2E1ZA 3AVHA 4DR3K 1XI1A 2UUCK 5J2QA 3HP6A 5AQKA 4LF4K 3THYB 4RWTA 4FWQA 3MEEA 3CCRN 1K8KB 3KLHA 4ISFA 2A41A 4FLYA 1FJGK 4NB4A 4DFPA 3C0BA 3U4LA 3FE1A 4E7KA 2PAVA 3VTHA 3J81O 4DFJA 3NGZA 4LF9K 4PWDA 3H08A 3VQ5A 2FF3B 4HCBA 4OKKA 3DJCA 3OYCA 3KJVA 4Z94A 4W5RA 4DS4A 3OVNA 3OY9A 4W5NA 2GELA 3ZEUA 3PIOL 2BDPA 2UXBK 4BR7A 3FZMA 3AVCA 4AHUA 1X9JA 4BRNA 1S1UA 3CC4N 1NMNA 3OYHA 1VSHA 2PYJA 4GV6A 3QLHA 1T03A 3CM6A 4H03B 1XHZA 1G15A 5HROA 4CW7B 2A40A 3VPZA 1RBTA 3VQQA 5AR0A 1RT3A 3U8XA 3BDPA 1NWKA 4IBNA 5C25A 2I7PA 4O44A 1XQSC 2VYPA 4O55A 3ZX0A 3VQ7A 1GLEG 2QA4N 3H1VX 4CVNE 3W0LA 3SK3A 2WTUA 1VQ7N 3PX4A 1EXQA 2G8KA 4YOWA 3I8DA 3NCIA 4JKFA 5KTQA 4MQ3A 1NNEA 1TV6A 1WSJA 1EETA 2WUSA 2W41A 3OYAA 2FLOA 1LWEA 3ZT4A 3M1FA 4DQIA 4BVPA 4YDUA 3T1HK 5BREA 5BPMA 4PHTX 2A3ZA 4CK2A 3RMAA 1E4GT 4Q0BA 3L2UA 1XWLA 1YJ9N 1ZXOA 3WXMB 1QZ5A 3PY8A 1NGBA 1MWMA 3A5NC 3VA3A 3TTDA 1UAXA 4WE1A 4DTOA 1OKJA 1UOCA 4WQ5A 1NOYA 3QFUA 4KKOA 4M3XA 4JKEA 3A5MC 2HHWA 1N5YA 4CZLA 3RMBA 1X3MA 2HNZA 3KKRA 3C65A 3B6OA 5LMNK 4DSLA 2ZJRL 2YKMA 2YNIA 1ILYA 2YHYA 1U47A 4IEIA 3VN5A 1K6YA 1RDBA 3EE9A 3OYEA 2V7ZA 1RCHA 4N5SA 5C15A 1SL0A 1RILA 3V1QA 1BISA 1VQ8N 4B9NA 1BQNA 4FPBA 1ESVA 5AQFA 2Y1JA 5AFUA 2Z1IA 3PX6A 4ILJA 5KGXA 1SKSA 1NK4A 1JLFA 3U6FA 3SAGA 3SJJA 2OTLN 2QWQA 3ULDA 4IO8A 4JI4K 1OH5A 5TKWA 5I42A 1S1XA 5E26A 4DV4K 1I94K 3O5BA 3CCUN 3O8MA 3AAQA 5AQNA 3U3GA 2NRRA 4KTZA 4CHOA 1D8YA 4FJ7A 5AZIB 4LY7A 2Y1IA 2G8HA 2IOCA 1RDAA 3QIPA 1B92A 4N76A 3HVRA 2ZGYA 3GDQA 2ZGZA 3M8QA 5BPLA 1FKPA 2AA4A 1XMOK 4BGBA 1BCOA 3AVFA 1QQMA 3CQYA 1A5VA 4FLXA 3JAMO 4DV1K 2YKNA 1TVRA 5JS1A 3LP0A 1YTAA 4JKDA 4L3QA 4AM7A 2ASMA 3T19A 4CF2A 3QEXA 5GAHP 3BY5A 1RDDA 2E2PA 1IV0A 3VGKA 3RSEB 4BR5A 4CHYA 4H8KA 4KI4A 1CLQA 2IVOA 4TSXA 4B3OA 3KK3A 4JN4A 4M3ZA 2ASPA 3ENBA 2ZM6K 3TTFA 2PYLA 2ATQA 3V9ZA 1YJNN 3CI5A 4DU3A 4DR1K 4OPJA 4DV6K 4I6MA 2HVIA 3ZT1A 3THXB 3KHYA 1RTHA 5J1EA 1D9DA 4CZJA 2P9SB 3NE6A 4FSVA 3UKUB 2HNDA 2HMPA 3HJFA 3VMFB 1QZ6A 4AHTA 4JI7K 1D4XA 4GVEA 4KHQA 1VQLN 3MXIA 1VQ5N 2IDOA 3IFRA 4FYDA 3P83D 1NKCA 3G6EN 1RTIA 1CZAN 3SUPA 4E0DA 4IZ9A 4JV5K 5T7BA 1HNZK 1NK6A 1DLOA 2DFFA 1JKHA 1HJOA 4OLBA 2XY5A 3U9ZA 4CGDA 4PL8A 4RW8A 1GLAG 1WSIA 3NMUA 3QBXA 3ULEB 3TPQA 2HBMA 3K5NA 4MFBA 3H45C 5KI6A 3VF4A 3TSPA 3LP3A 2P9IB 4FW1A 3R9PA 3EKSA 1IBKK 3PLAA 3DXMA 2YNHA 4MLEA 3FR0A 2V51B 3HO1A 3CHWA 4OKJA 1RBVA 3J8AA 4M3RA 2CH6A 4JNEA 5I9EB 5BRHA 4F8RA 4O8KA 1HR0K 4EP5A 4X65K 3ATUA 4CGHA 4OLAA 4DHYA 3AY9A 4HVJA 5JVHL 5KRSA 2HW3A 1WBBA 3HZ6A 4BRAA 3LDNA 3HOTA 3IS9A 2NNWA 2E2QA 4FOEA 3S41A 4NCBA 1WSGA 2P9UB 3WQTA 1KLNA 1QS4A 2RKIA 4EZ6A 2IIRA 2NRZA 4IFEA 4IJNA 5FLXO 3VGLA 2UXCK 4J2BA 5FRMA 4DU1A 2O8EA 1IKXA 1DTTA 3C7NA 1ZBIA 3HTVA 5CZ2A 2F96A 3KK7A 2E1YA 5M1FA 2E2OA 4GMJB 4AQYK 4CIEA 4BE2A 4M3WA 1VQPN 1VK0A 3CD6N 4FJLA 4DTMA 4B3RK 1QQOA 3CJ7A 4FLVA 3DOKA 4KBOA 2NLXA 2RN2A 3E01A 4WQ4C 5KRTA 4CBXA 4B9MA 4CFBA 5AQYA 5BR8K 1EO1A 1WUAA 2YJEA 4ISEA 3LM2A 4B3SK 5HL7L 2VG6A 1WB9A 4NO7A 4B9UA 4WCEL 2E5LK 3KK2A 4YDUC 1Q9XA 3E66A 4DF8A 4IOAL 3ID8A 1BCMA 3O9SA 1C0MA 1T44A 5C0YA 1IG8A 3SBTA 1SL1A 1BI4B 2YHBA 4CD1A 3TI0A 1NMDA 1F21A 3NH0A 2GX9A 3EY1A 1NOZA 4K8XA 1VQ4N 5BPNA 5KPZA 1L3SA 3DLLL 4DTJA 1U48A 4WQ5C 4CF1A 3QESA 3T1YK 4NCGA 2ZQBA 1HNIA 4JI8K 3AVIA 4RW4A 1QSLA 3DRRA 3EE8A 1FXXA 2X74A 1IG9A 1LCUA 1RT5A 3F73A 2Z1GA 4AH9A 4KI6A 4KTWA 1ZBSA 1TK5A 1J53A 4GNIA 3R3LA 2Q2RA 5JS2A 1EWQA 4NLBA 3NGYA 4AHSA 3ZSQA 2GTDA 4DCHA 1VSEA 3O1BA 5HOOA 2A42A 4NYFA 1E3MA 2UUBK 3ZSWA 3VQAA 3IG1A 3JXUA 4XH4A 2QI2A 1JL1A 3GG4A 4E1JA 3LWMA 4QS9A 1KVBA 3IRXA 3TSQA 4RW6A 5GIOA 1KAXA 4CE9A 4ID1A 1HUXA 1HKCA 1HNVA 3AVNA 4FWPA 1QE1A 5M1QA 4BY9C 4KHNA 3TAMA 2KTQA 3WNGA 1TKZA 1SUQA 4F9OA 1ZC6A 3OYGA 1M1KO 4CGGA 3QDKA 3S3OA 3DRSA 1SKRA 1HYZA 4H5TA 2O8FB 2H3GX 2P9PB 3ZETA 3WQUA 5KGWA 1JCGA 3BP8A 1NJZA 3VEWA 3K59A 4BDYA 4RW7A 4JK7A 3QBWA 3WNHA 4IEEA 4BWMA 1KD1O 4JS5A 1E4FT 3LPUA 1NJIO 1LW0A 3T7ZA 4CHNA 3MN5A 2P9NA 5EXWA 3Q7CA 4DSKA 2QW9A 1NGJA 5JICA 4G9ZA 1N33K 3O3HA 4LF7K 3LL3A 2JWKA 5ADXH 1LWFA 1U6ZA 4HHTA 4C8KA 3OYIA 4O8UA 4JYAK 3HM8A 1N32K 5KPTA 1YHQN 3BF1A 3ZEUB 3KKSA 3P1GA 1JL2A 1H1VA 3M8RA 3AGKA 4O4GA 2HHXA 1WLJA 1NGDA 4AF1A 4PUOA 4EAHD 1BWFO 1D9FA 1VSJA 2PBDA 3CCJN 3T1AA 4FK2A 4CIFA 1S6QA 4YOTA 5HRSA 4JHDB 4A59A 3VQ9A 4ID5A 1RDWX 3PX0A 3HL8A 3A0IX 1QSYA 5FRNA 3QMLA 5IWAK 3HXMA 1JLBA 1XC3A 1HRHA 2DFHA 1I39A 4FWRA 4U7BA 2ASOA 3AAPA 3MAQA 1BHLA 5C12A 4CJUA 4KHPK 3L0QA 4KRFA 4FW2A 1YJWN 4BR0A 4BRKA 3ZSRA 1YITN 1C0GA 1K8AO 4CZFA 1S1VA 4R5PA 4BG9A 2BE2A 4WF9L 4GY2B 3HSTB 2G8IA 4DUZK 1KQSM 4DR7K 4BRCA 3D2FA 2FF6A 1GLJO 4CJWA 3OHRA 2D5RA 4FL9A 3DLGA 1DKGD 1HNWK 4CGIA 4CJEA 5AQLA 3SQ4A 3MWTA 3T69A 4XH1A 1WN7A 3HK2A 4CGJA 1LOTB 3HP9A 3SI6A 1KFDA 3O9TA 2KLAA 2E6LA 3O80A 1Z05A 3SJHA 3AA3A 4GKJK 2XHBA 2F8SA 2FBTA 4C1NI 3L3UA 2B6AA 2BH1A 1HX1A 4BROA 2D1KA 3HPOA 3ZLJA 5HLFA 4DQPA 2UUAK 3CFOA 1RT7A 2YI1A 3A5LC 1U04A 3HI0A 1ZYQA 3OW2M 4WFBL 3CXCM 4YFUA 3G0ZA 2BANA 2E8AA 3DLRA 4DLEA 1U2VA 1J6ZA 4B1VA 4OGEA 4JKGA 1CZBA 4CF9A 4DB3A 3E9OA 2WFBA 1JLGA 2ITMA 4I9QA 4BRFA 4LH4A 1LAVA 2Z1JA 4CJFA 5AQOA 3VQCA 1ATNA 3TANA 1HYSA 4JLHA 3B8AX 5BR9A 3THWA 4J2AA 4RCHA 3RWUA 1KVCA 1LWCA 1YVUA 4FWNA 4FWLA 1NGHA 1Z26A 4JI2K 4KO0A 4JI3K 5GIPA 3VF2A 4CD3A 5FPDA 3IKMA 3NVMA 1P8ZA 4LD0A 3QEVA 3OYDA 5BN8A 2OPSA 4DS5A 1X3NA 3UE5A 3L4IA 3THYA 3VETA 3AA5X 3EO3A 3WNEA 3A8YA 3NH1A 4CJVA 5SZTA 4IDHA 3NF8A 4C8OA 3SQ1A 5JLFA 3SV3A 2OTJN 2QK9A 4QAGA 3DLHA 4OPKA 1HNXK 4DSFA 1FW6A 5AJ3K 1ZBFA 3SUNA 4JI5K 3K5MA 1MA9B 5HRRA 5CE3A 3WEEA 4C8NA 5AQWA 3NBPA 5AFUH 4ELUA 1HKBA 3C6UA 4PKHA 1MDUB 3ID6A 4R79A 4FJGA 4DKWA 3MWPA 3SLCA 1NGGA 1WAJA 2F9TA 1C0TA 5BRFA 5C42A 3CG7A 2QKBA 1NJWA 5K14A 1S9GA 2FXUA 1DTQA 2VG5A 3ENHA 3TAQA 3TAGA 5J2NA 2Q0RA 4OPHA 3I8BA 2NUBA 2QWRA 1RT2A 1EWRA 5TKYA 3OYLA 3KTQA 4YORA 3F5TA 2PZSA 3TABA 3P38A 3Q7BA 1NKEA 3CCEN 2RF2A 2WONA 3VQ8A 1N34K 2KZZA 3EYZA 2P5OA 3FGUA 3LDOA 4H5VA 4JKCA 5DMRA 3UIQA 2HHTA 3W3DA 2Z1HA 4BQZA 2FSKA 1IO2A 3LDPA 3VEZA 1Q8IA 3JYTA 3TAEA 1JJ2M 1SKWA 4DR6K 2O8CA 1OH8A 4M3YA 4AHVA 4CJ5A 2GWKA 3KLFA 3O1WA 4AHCA 4Z4IA 4F3OA 4Z4CA 2HF4A 3A5OC 1WSFA 2W6KA 3DI6A 1GLDG 3THVA 1Q18A 3HT3A 3FZHA 4O0IA 3NH2A 5LY3A 4YOYA 3L8BA 3DXKA 5C2DA 3I55N 4C1NK 3MCAB 4CJPA 3G10A 3SNNA 3DXMB 4H4MA 1T3VA 1EP4A 4CJ7A 3SMPA 3LWLA 3G4SN 1JLQA 2OZSA 2HHSA 3DMJA 2DFEA 2FBXA 4JEPA 1J5EK 4H5WA 4YNQA 2QKKA 4DR2K 4K8ZA 3E1YA 5EVZA 5SWMA 4JAXA 5GAGP 1S9EA 3E9PA 2UU9K 4CZHA 5GAEP 4JKBA 2IVPA 3TR8A 4I2PA 4Y1CA 4HWIA 2I7NA 2ETJA 3TAPA 1RT4A 1U49A 4BC4A 5AZJA 3PV8A 3EN9A 3ZCMA 1SQKA 4KFBA 5AQTA 5E41A 1L3VA 4BREA 3ATVA 3MMVA 3UKRA 4CJ3A 1IBLK 1B9FA 2IGIA 1GLCG 4H0TB 1C1AA 4K0KK 3S3MA 1KAYA 3SUOA 2VGNA 1TYQA 4HUGA 5LL6Z 3ENOA 2O8EB 3KLGA 3C7NB 2P9LB 1S22A 3HOSA 3LM9A 4LSLA 5LMUK 4PY5A 4QS8A 4CHPA 1ZBUA 4X66K 3CPEA 4NXNK 2JGUA 4CEQA 2DY4A 2QXFA 1Q81O 4ICLA 4PKIA 1RBRA 4IJAA 3HPHA 4E19A 4ISGA 4EHTA 5C24A 3CCLN 1X9SA 1KTQA 4CJRA 3DRPA 4KHSA 3VTIA 3KIOA 3L2VA 4FWMA 3MECA 4FJ9A 3KLIA 4FLWA 5AZIA 3CCQN 4CI6A 4E3SA 4J2DA 4W5OA 3VOVA 3VESA 3NDKA 4B3MK 2QXLA 4BRQA 4FM1A 5E84A 2GUIA 3CJBA 4FPAA 2GBZA 1QHTA 3QETA 3RMCA 1KSPA 1S72N 1HQUA 3WXIA 4FZZA 4EHUA 3VEOA 2VG7A 4BRHA 1TK0A 4DV5K 2OPQA 2VCPA 4J8FA 4B8AB 3KD1E 4KTQA 4DV0K 1GOAA 3R6MA 4MO5A 4LFBK 1QSSA 1Y64A 2D0PA 2ZWHA 1L5UA 4H0PA 2OANA 3MX5A 3OS1A 2G8FA 3L4QA 3QB0A 2XY6A 4B1ZA 3M8SA 2V7YA 3SCXA 5FPNA 2P5GA 1XNQK 3PSFA 2KW4A 1YI2N 3H3OB 1K73O 1HMVA 4E7JA 4BACA 1Q86O 1LV5A 1IJJA 3B6PA 3ZX3A 3DWLA 1LAWA 1BGXT 2P9SA 2A6AA 3UKUA 3SAFA 4JK9A 4CEDA 3I56N 1B9DA 4LH5A 4LF5K 1IH7A 4O5FA 3L3VA 3AVKA 4BDZA 1WSEA 4CEBA 2HBJA 2HHVA 4DQQA 4F2RA 1BIZA 4CJSA 1CZ9A 5DM7L 4C8LA 4DSIA 1LW2A 1RBUA 1GOBA 4E1NA 3K0SA 1R0AA 2NRVA 4XIUA 1KC8O 4BRIA 3CCMN 3HBTA 1TKTA 3OTOK 3O6WA 3D2EB 1L3UA 3SUQA 4H0XB 2YHXA 2P9IA 1S6PA 3O9RA 4RTFD 3CIPA 4BQLA 4HCCA 3RR8A 5KQ8A 3O08A 2F4VK 1M90O 3VQ6A 1GOCA 2O8BB 1TK8A 1OH6A 3J7AP 5HP1A 1G99A 3OYBA 2VWJA 1J5OA 4JD2B 3O3FA 4W5QA 1RFQA 2P9NB 4H5NA 3I33A 3DLKA 4OGCA 3VEXA 3WT0A 3TSUA 2HBLA 4JRPA 2ZE2A 4AHRA 1VSFA 4KPYA 4NLCA 3OBWA 1GLBG 3PUFA 1FK9A 2VQEK 5AQQA 4DFMA 4EIAA 4BRGA 4CJLA 5M1NA 5HRPA 1QVGM 4CEZA 2P9UA 4FK4A 3OS0A 2B4JA 4B1UB 2B5JA 3GE1A 4A5BA 4DU4A 4ILHA 1KRPA 1S1TA 1QHAA 4YY3K 3AV9A 4M7YA 4B1XB 2X6NA 3CCSN 4N41A 3AVLA 4CHQA 2P9KA 4CJTA 2NRTA 1BA1A 1GLLO 3MDQA 5M1OA 4LF8K 3O9UA 2KKZA 3BZKA 1IBMK 4Z4GA 1CXUA 3VEVA 1VSDA 1BOTO 2QTDA 2IVNA 1JCFA 4QS7A 4HUEA 4CFAA 2HB5A 3O9QA 1NGFA 3HSCA 4LFCK 4B9QA 3H6EA 4FJIA 3WUHA 3OS2A 3HM9A 3CC7N 3K5OA 3K9JA 3LALA 3CCVN 2O8DA 2BTFA 2G8VA 1NU0A 4V19S 2Q3SA 3LZIA 4M42A 1IKWA 3SPYA 3NVKA 1YF5L 4IXCA 2YNGA 2FBYA 4GW6A 2X78A 2G8WA 2KFZA 4AILC 3WNFA 1NKBA 4CGFA 4GVMA 2KHOA 2EWSA 2E4LA 3V9WA 2PY5A 4J2EA 2GEMA 4Z4HA 1WAFA 2D0BA 3EEQA 3OYJA 4CEAA 2YNFA 3MN6A 5AQJA 1R59O 3EZWA 1I3AA 3HYFA 5AQZA 3AARA 3LP2A 4FLZA 4FJMA 4IOXA 4N47A 3V1RA 3VA0A 2YX6A 3A2FA 3C94A 4E89A 2J4RA 1C6VA 5AQSA 2A1SA 5M1PA 1VQ6N 2FC0A 2CH5A 4CJKA 3CJAA 3R1XA 2YHAA 3ZT2A 3H3NO 3QERA 4FVMA 1NK5A 1YTUA 4B9SA 4Q5VA 1A5XA 5EOYA 1QTMA 1U2VB 4CZEA 4B3TK 4E7IA 2XY8A 4ELVA 4B08A 4DF4A 1VSLA 2AP1A 1C1CA 4IO9L 2HVHA 3R8EA 3ZSZA 4A61A 3M5RA 4CZKA 4DSJA 4DR4K 1NGEA 1TGOA 4FWKA 3KK1A 1TKDA 1P90A 3THWB 3G71N 3MEDA 3V6DA 3V1OA 4YHHK 5ADXA 4YOVA 3DLEA 3KWIA 4I9LA 4WFAL 2WOMA 3FLCO 4B8CA 3BF3A 4Z4EA 1JLCA 3QINA 4XEIA 4DG1A 1FKOA 2O8FA 5FPEA 2P9PA 4M3UA 4BRMA 4CZIA 3QEIA 1ITGA 4YOUA 3TWHA 3MEGA 3QEWA 3NF6A 2P51A 1NJYA 3AVGA 1REVA 2QWMA 3L2WA 2IS3A 4DQ8A 4ELTA 2UXDK 1YAGA 3C6AA 4IDKA 2DPNA 4CZMA 4FZXC 4H4OA 3LDLA 3OYMA 1XMQK 3WEEB 1JXBA 3PO4A 1C0UA 4MLHA 5AQXA 3HRGA 2DTUA 2ITGA 2LSNA 4NYNA 5F1XA 3CJ1A 3C6HA 1NBWA 3QICA 1YT3A 5MLCQ 1QQCA 2IAJA 1DT9A 4DV3K 3TARA 5AQGA 4K43A 5ELZA 3ISNC 3EKUA 4C23A 4A2BA 4CF0A 2OA8A 4PQUA 3CERA 4ZTJA 4B9VA 1VQ9N 3PO5A 2F7TA 1HPZA 4BRPA 4B9LA 4KHUA 4IFVA 5AQMA 1NK8A 3KVGA 2OYQA 1BA0A 1YVNA 2X6SA 1OH7A 1YUWA 4KHWA 4JHDA 3CYMA 3NGIA 4DTUA 3TU5A 4BE0A 3EZ5A 3ZX2A 4FJ8A 3DYAA 4IKFA 5GINA 5AQPA 3OYKA 2XO7A 2XRIA 2W6LA 1SZ2A 1O1WA 2F8TA 2UYTA 1YXQA 4LC9B 3LP1A 1X9WA 4ZTFA 1HPMA 2QWPA 3QNNA 3RR7A 4KAZA 3ITHA 4FLUA 4FWOA 4CZGA 4WQ4A 2QM1A 4CHZA 3FZFA 3HVTA 4KH6A 3WXLA 4G1QA 2D0AA 1K8KA 4CESA 3ASMA 4BGAA 3OYFA 2O8CB 1RGIA 4NXMK 3K58A 4Y0WA 2Q0UA 2E6MA 5C2FA 1C0FA 3CJCA 1SL2A 5CR4A 4U67L 4DTPA 4CERA 1S1WA 4CJ4A 4OKEA 1HYVA 4H0YB 4KV8A 4FK0A 2AJQA 4JKHA 1BIUA 3DXKB 3FFIA 3V81A 4JRQA 1RTJA 1HLUA 2A1RA 5AQUA 1NLVA 4DTNA 3CPWM 4B9TA 3OJSA 3GOIA 2QWOA 2Q1NA 1X1PA 4OJRA 1V4SA 3AVBA 5CHIA 4PA1A 1JXEA 1BO5O 4DWIA 5FDLA 2KZMA 3F2KA 1DEJA 4M41A 1BG3A 3VQBA 2CGKA 3FFKB 4W5TA 4CBUA 4ILGB 4UY8O 5FROA 3VERA 3ZSOA 4FJ5A 1VQON 3L2RA 4FLTA 4X62K 3MK6A 5AZJB 3TAFA 4I6MB 3CM5A 1VSMA 3NAEA 4QCLA 3T3FA 5DK5A 1ASVA 2OZMA 4WFNL 4DTSA 1HKGA 3UKRB 2QWLA 1Q9YA 3QIOA 4I2QA 5DM6L 3P39A 4I7FA 2CGLA 4FVUA 2VWKA 3VQEA 3J80O 4CIGA 3BGRA 2OCEA 5EX5A 3V4IA 1TYQB 1NG9A 2YV0X 3LANA 3OA9A 1T8EA 3VQDA 1W9HA 4DFKA 2HSTA 1BL3A 3QFPA 3VQ4A 2W42A 4X64K 3LAMA 4DLGA 1BU6O 1VRTA 3K2PA 3D6RA 4BC3A 5HRNA 4DTRA 3NF7A 3U9DA 2YCHA 1IKVA 4E1MA 1JCEA 2NZTA 3AA2A 1RDUA 3UB5A 3VENA 3RTVA 3M3ZA 3DOLA 3P4IA 1S3XA 1TAUA 1KAZA 3MN7A 1BDGA 2WBNA 4IG0A 3JSMA 1N6QA 1TL3A 3P5JA 1XNRK 2R7YA 1UA1A 4CBWA 3CC2N 3IUCA 1ZBLA 1X9MA 1SV5A 4HTLA 4MDBA 4K42A 4Y1DA 3LPTA 4XH5A 3DAWA 4DR5K 1KFSA 1Q82O 4EP4A 3ZSXA 4A62A 3L6QA 3ZT0A 3FZLA 4BG8A 3AO3A 1WSHA 4H0VB 4BRLA 2VQFK 1L3TA 2F9WA 3CFPA 4DV7K 1WBDA 1VQKN 1RT6A 2D0OA 4DMNA 2HOEA 3AVMA 3MN9A 2ZJQL 2Q36A 1NGAA 3ZT3A 4CK3A 1W2BM 3LDQA 4KHYA 3NF9A 1SAZA 2V52B 1BQMA 3U3YA 3S9HA 1XC9A 2FBVA 4E7HA 5KQDA 2HHHK 3I0RA 3M8PA 3ALYA 5BRDA 4DQSA 1RTDA 4UQGA 3C95A 3AVJA 2Q97A 2A5XA 2QWNA 5CYQA 3VGMA 1KLMA 2E20A 3LAKA 1RDCA 4H5RA 3N4QA 1VSIA 2NRWA 1Z25A 1DGKN 2W40A 5F2RA 4DQRA 5AQRA 2HHUA 4MO4A 1TUUA 1U4BA 3CFRA 4FM0A
chains in the Genus database with same CATH topology
2G8IA 4DSLA 4F2SA 4IFYA 2YKMA 2YNIA 3PUFA 1FK9A 4DFMA 1U47A 4CJLA 3VN5A 1K6YA 4CJWA 3O4QA 1RDBA 5HRPA 2HNYA 4CEZA 4FJHA 4FK4A 2D5RA 3OS0A 3DLGA 2B4JA 3DM2A 3OYEA 1RCHA 3AA4A 3KD5E 2B5JA 4FXDA 4N5SA 4CGIA 4CJEA 2HHQA 4DU4A 1SL0A 3MXMA 3SQ4A 1RILA 3V1QA 4JS4A 1KRPA 1S1TA 1BISA 1NK0A 4B9NA 4RG8A 3AV9A 1WN7A 1KCFA 3HK2A 1BQNA 2X6NA 4CGJA 3V9XA 3HP9A 4N41A 3AVLA 2Y1JA 2P1JA 4CHQA 3SI6A 1KFDA 2Z1IA 4CJTA 2IC3A 3PX6A 5KGXA 1SKSA 2E6LA 5EU7A 1T7PA 1NK4A 3AA3A 5CYMA 1JLFA 2GV9A 2XHBA 3U6FA 3SJJA 2F8SA 2FBTA 5CZ1A 3K57A 4DTXA 3L3UA 2B6AA 4CJQA 3O3GA 3ULDA 4Z4GA 1CXUA 4NCAA 1VSDA 5I42A 1S1XA 1Y97A 3RRGA 4M45A 3HPOA 4HUEA 5HLFA 4DQPA 4CFAA 3U3GA 2HB5A 3CFOA 1RT7A 2D0CA 1IKYA 2ZD1A 1T05A 1U04A 4KTZA 1ZYQA 4CHOA 1NK9A 3ZSVA 4E7LA 1D8YA 4FJIA 3L2QA 4FJ7A 3OS2A 3S3NA 4YFUA 3HM9A 3K5OA 3G0ZA 4O0JA 2BANA 3LALA 3DLRA 3K5LA 4DLEA 4LY7A 2G8VA 2Q3SA 2Y1IA 2G8HA 2IOCA 3LZIA 3LDSA 4M42A 1IKWA 4OGEA 3SPYA 1RDAA 5I3UA 4CEFA 3QIPA 4HUFA 1ZBHA 1CZBA 1B92A 2YNGA 4CF9A 3HVRA 4N76A 2FBYA 1JLGA 2X78A 4GW6A 4N56A 2G8WA 2KFZA 4I9QA 3SYZA 3M8QA 4LH4A 4AILC 1LAVA 3WNFA 2Z1JA 1FKPA 1NKBA 4CJFA 3VQCA 4GVMA 4CGFA 1BCOA 1XHXA 3AVFA 1A5VA 1J9AA 3TANA 1HYSA 4JLHA 4LSNA 4FLXA 2YKNA 1TVRA 4J2AA 5J2PA 5JS1A 2E4LA 3LP0A 4IG3A 3V9WA 3RWUA 1KVCA 1LWCA 1YTAA 1YVUA 2PY5A 3T19A 4CF2A 1Z26A 4Z4HA 4CCHA 4J2EA 4CFDA 1JLAA 1WAFA 1KVAA 4KO0A 3QEXA 2D0BA 1RDDA 3OYJA 4CEAA 2YNFA 4LD0A 3QEVA 3OYDA 2OPPA 2OPSA 4CHYA 3LZJA 3AO1A 4FJNA 4H8KA 4KB1A 1I3AA 3HYFA 4KI4A 1CLQA 4DS5A 3LP2A 4TSXA 4FLZA 4FJMA 3V1RA 4N47A 1EKEA 3KK3A 4B3OA 3VA0A 4M3ZA 3A2FA 3C94A 1JLEA 4E89A 1C6VA 1WNSA 2A1SA 3AA5X 4PY5A 1EX4A 2PYLA 3WNEA 2ATQA 3HPGA 4EZ9A 3NH1A 3V9ZA 2FC0A 4CJVA 5SZTA 4CJKA 3NF8A 4CEEA 2YHAA 4DU3A 3RRHA 4C8OA 4OPJA 3ZT2A 3SQ1A 3QERA 3SV3A 1UA0A 4FVMA 2QK9A 4QAGA 1NK5A 3DLHA 1YTUA 2HVIA 4B9SA 4C8MA 1A5XA 4Q5VA 1QTMA 4OPKA 3QEPA 4DSFA 4E7IA 3ZT1A 1ZBFA 2XY8A 3SUNA 4ELVA 1RTHA 5J1EA 4B08A 4FM2A 1HQEA 3K5MA 5HRRA 4DF4A 1VSLA 2RPIA 1D9DA 2KFNA 3NE6A 4C8NA 2HNDA 3NBPA 3HJFA 1C1CA 1NJXA 1VRUA 4ELUA 4KB0A 4AHTA 3C6UA 2HVHA 1S5JA 3V9UA 4KHQA 4FJGA 3ZSZA 3MXIA 4DSJA 2IDOA 1WAJA 4FYDA 3P83D 1TGOA 1TKDA 1C0TA 3KK1A 2XY7A 4BDPA 1NKCA 4FZYA 3IAYA 4DSEA 3SZ2A 3CQ8A 1RTIA 3SUPA 5C42A 3MEDA 3V6DA 4ZHRA 3CG7A 3V1OA 4E0DA 1NJWA 2QKBA 5K14A 3DLEA 4OVLA 4I9LA 1S9GA 2WOMA 4L8RB 1DTQA 3AO5A 5T7BA 2VG5A 4B8CA 1DLOA 2DFFA 3TAQA 1JKHA 3TAGA 3SQ2A 5J2NA 1NK6A 1JLCA 3QINA 3MXJA 2XY5A 4OLBA 4Z4EA 4CGDA 4RW8A 4DG1A 1FKOA 4FM0A 1WSIA 3RMDA 4RW9A 1RBSA 3KLEA 2NUBA 1RT2A 4M3UA 3K5NA 4MFBA 3OYLA 1RT1A 3QEIA 1ITGA 5KI6A 3LP3A 3TWHA 3MEGA 4FW1A 3KTQA 4Z4FA 3C6TA 5CY4A 3I0SA 3NF6A 3QEWA 2P51A 2YNHA 1NJYA 3AVGA 1REVA 4CEOA 3TABA 2PZSA 3L2WA 2IS3A 3O4NA 3HO1A 1NKEA 2HMIA 4CF8A 4OKJA 3V9SA 4ELTA 1RBVA 2RF2A 2WONA 3VQ8A 4IDKA 1TAQA 4M3RA 3OJUA 3EYZA 4FZXC 2KZZA 2P5OA 4H4OA 5DMRA 4F8RA 3AVAA 4BE1A 3OYMA 1TKXA 1JXBA 3UIQA 2HHTA 4EP5A 1W0HA 3PO4A 1C0UA 4Z0UA 4CGHA 2Z1HA 4OLAA 2DTUA 2ITGA 1U45A 2LSNA 4NYNA 1IO2A 3F9KA 4HVJA 1Q8IA 3JYTA 5KRSA 2HW3A 3TAEA 1YT3A 3TARA 1QQCA 1MU2A 2IAJA 3DLBA 1SKWA 1RNHA 3ISNC 1VSKA 3SPZA 4CF0A 4CK1A 3IS9A 2OA8A 4FJJA 4M3YA 3ZSYA 4AHVA 4CJ5A 3KLFA 4PQUA 4ZTJA 4AHCA 4B9VA 4Z4IA 4F3OA 4Z4CA 4NCBA 1WSGA 3PO5A 1HPZA 1WSFA 1KLNA 1QS4A 4B9LA 4KHUA 4IFVA 4KREA 1NK8A 1BI4A 1A5WA 2RKIA 3DI6A 2X6SA 3THVA 2OYQA 4EZ6A 2EX3A 1ASWA 4KHWA 4FCYA 1UWBA 3CYMA 4J2BA 5FRMA 1ASUA 3HT3A 3NGIA 4DU1A 4DTUA 1IKXA 2JLEA 1DTTA 1ZBIA 4O0IA 2O4IA 3NH2A 5CZ2A 4BE0A 3L8BA 2F96A 3EZ5A 3SQ0A 4FJ8A 3DYAA 4CJPA 4IKFA 3G10A 3OYKA 4O5BA 3SNNA 2XO7A 3D0PA 4H4MA 4HTUA 4GMJB 1EP4A 2OPRA 2XRIA 3LWLA 3QO9A 1O1WA 2F8TA 4CIEA 1JLQA 2OZSA 2HHSA 4BE2A 3DMJA 2DFEA 2FBXA 2KQ2A 3LP1A 1VK0A 4ZTFA 1X9WA 4M3WA 5D3GA 4FJLA 4DTMA 4YNQA 2QKKA 4CFCA 3QNNA 4FLVA 3DOKA 3RR7A 4KAZA 3E01A 2RN2A 3ITHA 5KRTA 4FLUA 4K8ZA 2EHGA 5SWMA 4F3TA 1NK7A 4BWJA 4B9MA 1S9EA 2I5JA 2BGGA 1HJRA 4CFBA 4CHZA 3TR8A 4I2PA 4Y1CA 1J54A 3HVTA 2ETJA 3TAPA 4G1QA 2D0AA 1RT4A 3NHGA 2O4GA 2VG6A 4CESA 1U49A 3ASMA 2G8UA 3OYFA 4B9UA 5HBMA 3PV8A 3QNOA 3KK2A 1Q9XA 3ZCMA 3K58A 4KFBA 4DF8A 5E41A 1L3VA 4QOZB 1BCMA 2E6MA 1C0MA 4CJ3A 1B9FA 1SL2A 1D5AA 1TL1A 4DTPA 4FJKA 2IGIA 3SV4A 1CXQA 4CERA 1BI4B 2YHBA 3D45A 1C1AA 1SL1A 1S1WA 3AO2A 3TI0A 3SUOA 3S3MA 5J2MA 4F4KA 4CJ4A 4OKEA 3OYNA 4HUGA 4M3TA 1HYVA 4CECA 3KLGA 1F21A 4KV8A 3NH0A 3EY1A 4FK0A 2AJQA 3NFAA 4FJXA 1NOZA 4LSLA 1BIUA 3FFIA 4K8XA 3V81A 4JRQA 1RTJA 1C1BA 2A1RA 4CHPA 1L3SA 1ZBUA 4DTJA 3VQPA 4DTNA 1U48A 4CF1A 3QESA 3AO4A 4NCGA 4B9TA 2JGUA 1HNIA 2ZQBA 4CEQA 3OJSA 2QXFA 3AVHA 2DY4A 4ICLA 3AVIA 1X1PA 4OJRA 4RW4A 3AVBA 1RBRA 1QSLA 3DRRA 3HPHA 4PA1A 1JXEA 4E19A 5C24A 1FXXA 2X74A 1XI1A 1X9SA 4DWIA 5J2QA 5FDLA 1KTQA 4CJRA 3HP6A 3DRPA 1IG9A 4KHSA 3KIOA 3L2VA 2KZMA 1RT5A 3MECA 3F73A 4FJ9A 2Z1GA 3KLIA 4AH9A 4M41A 4FLWA 3VQBA 4KI6A 3MEEA 4KTWA 4W5TA 4E3SA 4J2DA 5FROA 4W5OA 3NDKA 3ZSOA 4FJ5A 1TK5A 3KLHA 1J53A 3L2RA 2GUIA 4FM1A 4FLTA 3TAFA 3CM5A 4FLYA 1VSMA 2GBZA 3NAEA 1QHTA 4DFPA 3QETA 3RMCA 4QCLA 1KSPA 3T3FA 1HQUA 5JS2A 4FZZA 5DK5A 1ASVA 2OZMA 3NGYA 4DTSA 2VG7A 4AHSA 4E7KA 4DFJA 3ZSQA 3QIOA 3NGZA 4I2QA 1Q9YA 4PWDA 3H08A 1VSEA 4I7FA 1TK0A 2VWKA 3VQEA 2OPQA 4NYFA 3VQ5A 4CIGA 4HCBA 3ZSWA 3BGRA 4OKKA 3V4IA 3OYCA 3KJVA 3VQAA 3IG1A 4B8AB 3KD1E 4KTQA 2YV0X 3LANA 1GOAA 4W5RA 4DS4A 3OVNA 3OY9A 1T8EA 1QSSA 3VQDA 1W9HA 4W5NA 4DFKA 1L5UA 1JL1A 3LWMA 1KVBA 2BDPA 3IRXA 1BL3A 4RW6A 3VQ4A 3OS1A 2W42A 4DLGA 3LAMA 4ID1A 4CE9A 2G8FA 3AVCA 3AVNA 4AHUA 1HNVA 2XY6A 3M8SA 1VRTA 1S1UA 1QE1A 3SCXA 3K2PA 5HRNA 3OYHA 4DTRA 3NF7A 1VSHA 4KHNA 1IKVA 4E1MA 2PYJA 2P5GA 3AA2A 3TAMA 3QLHA 2KTQA 3WNGA 1TKZA 1SUQA 3RTVA 1T03A 3CM6A 3OYGA 2KW4A 4CGGA 3S3OA 3DOLA 3DRSA 1SKRA 1HYZA 1XHZA 1TAUA 1G15A 5HROA 1HMVA 4E7JA 4BACA 4IG0A 1RBTA 5KGWA 1TL3A 3VQQA 3JSMA 1N6QA 1VSFA 3P5JA 3K59A 4BDYA 1NJZA 4RW7A 2R7YA 3WNHA 1LV5A 3B6PA 1UA1A 1RT3A 4BWMA 1ZBLA 3BDPA 4IBNA 4JS5A 5C25A 1X9MA 1LAWA 4O44A 1BGXT 1SV5A 3LPUA 4O55A 1LW0A 3VQ7A 4CHNA 4Y1DA 3LPTA 4CEDA 4DSKA 1B9DA 4LH5A 1KFSA 4EP4A 3ZSXA 1IH7A 3L3VA 3ZT0A 3PX4A 3AVKA 4BDZA 1EXQA 1WSEA 4CEBA 2G8KA 2HHVA 3AO3A 1WSHA 3O3HA 3I8DA 3NCIA 4DQQA 1L3TA 4F2RA 1LWFA 4HHTA 1BIZA 3CFPA 4C8KA 3OYIA 5KTQA 4MQ3A 4CJSA 1TV6A 1WSJA 1RT6A 4DMNA 1EETA 1CZ9A 3AVMA 3OYAA 4C8LA 4DSIA 1LWEA 1LW2A 1RBUA 1GOBA 3KKSA 3P1GA 3ZT3A 3ZT4A 4E1NA 1JL2A 4CK3A 1R0AA 4KHYA 3NF9A 3M8RA 4DQIA 4XIUA 1BQMA 4O4GA 2HHXA 3U3YA 3S9HA 1WLJA 1XC9A 4PUOA 2FBVA 4E7HA 1D9FA 1VSJA 3I0RA 3T1AA 3M8PA 4FK2A 4CIFA 3ALYA 1TKTA 4DQSA 4CK2A 1RTDA 1S6QA 3RMAA 4UQGA 3C95A 5HRSA 3SUQA 3AVJA 1L3UA 3VQ9A 4Q0BA 4ID5A 3L2UA 1S6PA 1XWLA 3PX0A 3HL8A 3PY8A 4HCCA 5CYQA 1QSYA 3RR8A 5FRNA 1KLMA 3HXMA 3LAKA 1RDCA 1JLBA 3VA3A 1HRHA 3VQ6A 1GOCA 1UAXA 1TK8A 5HP1A 4WE1A 2DFHA 1I39A 1VSIA 4DTOA 1Z25A 1UOCA 1NOYA 3OYBA 4KKOA 2VWJA 4M3XA 1J5OA 4DQRA 3O3FA 2HHUA 3MAQA 1BHLA 4W5QA 4CJUA 2HHWA 3DLKA 4OGCA 1N5YA 1U4BA 4KRFA 4FW2A 3ZSRA 4JRPA 3RMBA 2ZE2A 4AHRA 1S1VA 4R5PA 2HNZA 3KKRA 2BE2A 3CFRA 3B6OA 4KPYA 3HSTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8I A;  4DSL A;  4F2S A;  4IFY A;  2YKM A;  2YNI A;  3PUF A;  1FK9 A;  4DFM A;  1U47 A;  4CJL A;  3VN5 A;  1K6Y A;  4CJW A;  3O4Q A;  1RDB A;  5HRP A;  2HNY A;  4CEZ A;  4FJH A;  4FK4 A;  2D5R A;  3OS0 A;  3DLG A;  2B4J A;  3DM2 A;  3OYE A;  1RCH A;  3AA4 A;  3KD5 E;  2B5J A;  4FXD A;  4N5S A;  4CGI A;  4CJE A;  2HHQ A;  4DU4 A;  1SL0 A;  3MXM A;  3SQ4 A;  1RIL A;  3V1Q A;  4JS4 A;  1KRP A;  1S1T A;  1BIS A;  1NK0 A;  4B9N A;  4RG8 A;  3AV9 A;  1WN7 A;  1KCF A;  3HK2 A;  1BQN A;  2X6N A;  4CGJ A;  3V9X A;  3HP9 A;  4N41 A;  3AVL A;  2Y1J A;  2P1J A;  4CHQ A;  3SI6 A;  1KFD A;  2Z1I A;  4CJT A;  2IC3 A;  3PX6 A;  5KGX A;  1SKS A;  2E6L A;  5EU7 A;  1T7P A;  1NK4 A;  3AA3 A;  5CYM A;  1JLF A;  2GV9 A;  2XHB A;  3U6F A;  3SJJ A;  2F8S A;  2FBT A;  5CZ1 A;  3K57 A;  4DTX A;  3L3U A;  2B6A A;  4CJQ A;  3O3G A;  3ULD A;  4Z4G A;  1CXU A;  4NCA A;  1VSD A;  5I42 A;  1S1X A;  1Y97 A;  3RRG A;  4M45 A;  3HPO A;  4HUE A;  5HLF A;  4DQP A;  4CFA A;  3U3G A;  2HB5 A;  3CFO A;  1RT7 A;  2D0C A;  1IKY A;  2ZD1 A;  1T05 A;  1U04 A;  4KTZ A;  1ZYQ A;  4CHO A;  1NK9 A;  3ZSV A;  4E7L A;  1D8Y A;  4FJI A;  3L2Q A;  4FJ7 A;  3OS2 A;  3S3N A;  4YFU A;  3HM9 A;  3K5O A;  3G0Z A;  4O0J A;  2BAN A;  3LAL A;  3DLR A;  3K5L A;  4DLE A;  4LY7 A;  2G8V A;  2Q3S A;  2Y1I A;  2G8H A;  2IOC A;  3LZI A;  3LDS A;  4M42 A;  1IKW A;  4OGE A;  3SPY A;  1RDA A;  5I3U A;  4CEF A;  3QIP A;  4HUF A;  1ZBH A;  1CZB A;  1B92 A;  2YNG A;  4CF9 A;  3HVR A;  4N76 A;  2FBY A;  1JLG A;  2X78 A;  4GW6 A;  4N56 A;  2G8W A;  2KFZ A;  4I9Q A;  3SYZ A;  3M8Q A;  4LH4 A;  4AIL C;  1LAV A;  3WNF A;  2Z1J A;  1FKP A;  1NKB A;  4CJF A;  3VQC A;  4GVM A;  4CGF A;  1BCO A;  1XHX A;  3AVF A;  1A5V A;  1J9A A;  3TAN A;  1HYS A;  4JLH A;  4LSN A;  4FLX A;  2YKN A;  1TVR A;  4J2A A;  5J2P A;  5JS1 A;  2E4L A;  3LP0 A;  4IG3 A;  3V9W A;  3RWU A;  1KVC A;  1LWC A;  1YTA A;  1YVU A;  2PY5 A;  3T19 A;  4CF2 A;  1Z26 A;  4Z4H A;  4CCH A;  4J2E A;  4CFD A;  1JLA A;  1WAF A;  1KVA A;  4KO0 A;  3QEX A;  2D0B A;  1RDD A;  3OYJ A;  4CEA A;  2YNF A;  4LD0 A;  3QEV A;  3OYD A;  2OPP A;  2OPS A;  4CHY A;  3LZJ A;  3AO1 A;  4FJN A;  4H8K A;  4KB1 A;  1I3A A;  3HYF A;  4KI4 A;  1CLQ A;  4DS5 A;  3LP2 A;  4TSX A;  4FLZ A;  4FJM A;  3V1R A;  4N47 A;  1EKE A;  3KK3 A;  4B3O A;  3VA0 A;  4M3Z A;  3A2F A;  3C94 A;  1JLE A;  4E89 A;  1C6V A;  1WNS A;  2A1S A;  3AA5 X;  4PY5 A;  1EX4 A;  2PYL A;  3WNE A;  2ATQ A;  3HPG A;  4EZ9 A;  3NH1 A;  3V9Z A;  2FC0 A;  4CJV A;  5SZT A;  4CJK A;  3NF8 A;  4CEE A;  2YHA A;  4DU3 A;  3RRH A;  4C8O A;  4OPJ A;  3ZT2 A;  3SQ1 A;  3QER A;  3SV3 A;  1UA0 A;  4FVM A;  2QK9 A;  4QAG A;  1NK5 A;  3DLH A;  1YTU A;  2HVI A;  4B9S A;  4C8M A;  1A5X A;  4Q5V A;  1QTM A;  4OPK A;  3QEP A;  4DSF A;  4E7I A;  3ZT1 A;  1ZBF A;  2XY8 A;  3SUN A;  4ELV A;  1RTH A;  5J1E A;  4B08 A;  4FM2 A;  1HQE A;  3K5M A;  5HRR A;  4DF4 A;  1VSL A;  2RPI A;  1D9D A;  2KFN A;  3NE6 A;  4C8N A;  2HND A;  3NBP A;  3HJF A;  1C1C A;  1NJX A;  1VRU A;  4ELU A;  4KB0 A;  4AHT A;  3C6U A;  2HVH A;  1S5J A;  3V9U A;  4KHQ A;  4FJG A;  3ZSZ A;  3MXI A;  4DSJ A;  2IDO A;  1WAJ A;  4FYD A;  3P83 D;  1TGO A;  1TKD A;  1C0T A;  3KK1 A;  2XY7 A;  4BDP A;  1NKC A;  4FZY A;  3IAY A;  4DSE A;  3SZ2 A;  3CQ8 A;  1RTI A;  3SUP A;  5C42 A;  3MED A;  3V6D A;  4ZHR A;  3CG7 A;  3V1O A;  4E0D A;  1NJW A;  2QKB A;  5K14 A;  3DLE A;  4OVL A;  4I9L A;  1S9G A;  2WOM A;  4L8R B;  1DTQ A;  3AO5 A;  5T7B A;  2VG5 A;  4B8C A;  1DLO A;  2DFF A;  3TAQ A;  1JKH A;  3TAG A;  3SQ2 A;  5J2N A;  1NK6 A;  1JLC A;  3QIN A;  3MXJ A;  2XY5 A;  4OLB A;  4Z4E A;  4CGD A;  4RW8 A;  4DG1 A;  1FKO A;  4FM0 A;  1WSI A;  3RMD A;  4RW9 A;  1RBS A;  3KLE A;  2NUB A;  1RT2 A;  4M3U A;  3K5N A;  4MFB A;  3OYL A;  1RT1 A;  3QEI A;  1ITG A;  5KI6 A;  3LP3 A;  3TWH A;  3MEG A;  4FW1 A;  3KTQ A;  4Z4F A;  3C6T A;  5CY4 A;  3I0S A;  3NF6 A;  3QEW A;  2P51 A;  2YNH A;  1NJY A;  3AVG A;  1REV A;  4CEO A;  3TAB A;  2PZS A;  3L2W A;  2IS3 A;  3O4N A;  3HO1 A;  1NKE A;  2HMI A;  4CF8 A;  4OKJ A;  3V9S A;  4ELT A;  1RBV A;  2RF2 A;  2WON A;  3VQ8 A;  4IDK A;  1TAQ A;  4M3R A;  3OJU A;  3EYZ A;  4FZX C;  2KZZ A;  2P5O A;  4H4O A;  5DMR A;  4F8R A;  3AVA A;  4BE1 A;  3OYM A;  1TKX A;  1JXB A;  3UIQ A;  2HHT A;  4EP5 A;  1W0H A;  3PO4 A;  1C0U A;  4Z0U A;  4CGH A;  2Z1H A;  4OLA A;  2DTU A;  2ITG A;  1U45 A;  2LSN A;  4NYN A;  1IO2 A;  3F9K A;  4HVJ A;  1Q8I A;  3JYT A;  5KRS A;  2HW3 A;  3TAE A;  1YT3 A;  3TAR A;  1QQC A;  1MU2 A;  2IAJ A;  3DLB A;  1SKW A;  1RNH A;  3ISN C;  1VSK A;  3SPZ A;  4CF0 A;  4CK1 A;  3IS9 A;  2OA8 A;  4FJJ A;  4M3Y A;  3ZSY A;  4AHV A;  4CJ5 A;  3KLF A;  4PQU A;  4ZTJ A;  4AHC A;  4B9V A;  4Z4I A;  4F3O A;  4Z4C A;  4NCB A;  1WSG A;  3PO5 A;  1HPZ A;  1WSF A;  1KLN A;  1QS4 A;  4B9L A;  4KHU A;  4IFV A;  4KRE A;  1NK8 A;  1BI4 A;  1A5W A;  2RKI A;  3DI6 A;  2X6S A;  3THV A;  2OYQ A;  4EZ6 A;  2EX3 A;  1ASW A;  4KHW A;  4FCY A;  1UWB A;  3CYM A;  4J2B A;  5FRM A;  1ASU A;  3HT3 A;  3NGI A;  4DU1 A;  4DTU A;  1IKX A;  2JLE A;  1DTT A;  1ZBI A;  4O0I A;  2O4I A;  3NH2 A;  5CZ2 A;  4BE0 A;  3L8B A;  2F96 A;  3EZ5 A;  3SQ0 A;  4FJ8 A;  3DYA A;  4CJP A;  4IKF A;  3G10 A;  3OYK A;  4O5B A;  3SNN A;  2XO7 A;  3D0P A;  4H4M A;  4HTU A;  4GMJ B;  1EP4 A;  2OPR A;  2XRI A;  3LWL A;  3QO9 A;  1O1W A;  2F8T A;  4CIE A;  1JLQ A;  2OZS A;  2HHS A;  4BE2 A;  3DMJ A;  2DFE A;  2FBX A;  2KQ2 A;  3LP1 A;  1VK0 A;  4ZTF A;  1X9W A;  4M3W A;  5D3G A;  4FJL A;  4DTM A;  4YNQ A;  2QKK A;  4CFC A;  3QNN A;  4FLV A;  3DOK A;  3RR7 A;  4KAZ A;  3E01 A;  2RN2 A;  3ITH A;  5KRT A;  4FLU A;  4K8Z A;  2EHG A;  5SWM A;  4F3T A;  1NK7 A;  4BWJ A;  4B9M A;  1S9E A;  2I5J A;  2BGG A;  1HJR A;  4CFB A;  4CHZ A;  3TR8 A;  4I2P A;  4Y1C A;  1J54 A;  3HVT A;  2ETJ A;  3TAP A;  4G1Q A;  2D0A A;  1RT4 A;  3NHG A;  2O4G A;  2VG6 A;  4CES A;  1U49 A;  3ASM A;  2G8U A;  3OYF A;  4B9U A;  5HBM A;  3PV8 A;  3QNO A;  3KK2 A;  1Q9X A;  3ZCM A;  3K58 A;  4KFB A;  4DF8 A;  5E41 A;  1L3V A;  4QOZ B;  1BCM A;  2E6M A;  1C0M A;  4CJ3 A;  1B9F A;  1SL2 A;  1D5A A;  1TL1 A;  4DTP A;  4FJK A;  2IGI A;  3SV4 A;  1CXQ A;  4CER A;  1BI4 B;  2YHB A;  3D45 A;  1C1A A;  1SL1 A;  1S1W A;  3AO2 A;  3TI0 A;  3SUO A;  3S3M A;  5J2M A;  4F4K A;  4CJ4 A;  4OKE A;  3OYN A;  4HUG A;  4M3T A;  1HYV A;  4CEC A;  3KLG A;  1F21 A;  4KV8 A;  3NH0 A;  3EY1 A;  4FK0 A;  2AJQ A;  3NFA A;  4FJX A;  1NOZ A;  4LSL A;  1BIU A;  3FFI A;  4K8X A;  3V81 A;  4JRQ A;  1RTJ A;  1C1B A;  2A1R A;  4CHP A;  1L3S A;  1ZBU A;  4DTJ A;  3VQP A;  4DTN A;  1U48 A;  4CF1 A;  3QES A;  3AO4 A;  4NCG A;  4B9T A;  2JGU A;  1HNI A;  2ZQB A;  4CEQ A;  3OJS A;  2QXF A;  3AVH A;  2DY4 A;  4ICL A;  3AVI A;  1X1P A;  4OJR A;  4RW4 A;  3AVB A;  1RBR A;  1QSL A;  3DRR A;  3HPH A;  4PA1 A;  1JXE A;  4E19 A;  5C24 A;  1FXX A;  2X74 A;  1XI1 A;  1X9S A;  4DWI A;  5J2Q A;  5FDL A;  1KTQ A;  4CJR A;  3HP6 A;  3DRP A;  1IG9 A;  4KHS A;  3KIO A;  3L2V A;  2KZM A;  1RT5 A;  3MEC A;  3F73 A;  4FJ9 A;  2Z1G A;  3KLI A;  4AH9 A;  4M41 A;  4FLW A;  3VQB A;  4KI6 A;  3MEE A;  4KTW A;  4W5T A;  4E3S A;  4J2D A;  5FRO A;  4W5O A;  3NDK A;  3ZSO A;  4FJ5 A;  1TK5 A;  3KLH A;  1J53 A;  3L2R A;  2GUI A;  4FM1 A;  4FLT A;  3TAF A;  3CM5 A;  4FLY A;  1VSM A;  2GBZ A;  3NAE A;  1QHT A;  4DFP A;  3QET A;  3RMC A;  4QCL A;  1KSP A;  3T3F A;  1HQU A;  5JS2 A;  4FZZ A;  5DK5 A;  1ASV A;  2OZM A;  3NGY A;  4DTS A;  2VG7 A;  4AHS A;  4E7K A;  4DFJ A;  3ZSQ A;  3QIO A;  3NGZ A;  4I2Q A;  1Q9Y A;  4PWD A;  3H08 A;  1VSE A;  4I7F A;  1TK0 A;  2VWK A;  3VQE A;  2OPQ A;  4NYF A;  3VQ5 A;  4CIG A;  4HCB A;  3ZSW A;  3BGR A;  4OKK A;  3V4I A;  3OYC A;  3KJV A;  3VQA A;  3IG1 A;  4B8A B;  3KD1 E;  4KTQ A;  2YV0 X;  3LAN A;  1GOA A;  4W5R A;  4DS4 A;  3OVN A;  3OY9 A;  1T8E A;  1QSS A;  3VQD A;  1W9H A;  4W5N A;  4DFK A;  1L5U A;  1JL1 A;  3LWM A;  1KVB A;  2BDP A;  3IRX A;  1BL3 A;  4RW6 A;  3VQ4 A;  3OS1 A;  2W42 A;  4DLG A;  3LAM A;  4ID1 A;  4CE9 A;  2G8F A;  3AVC A;  3AVN A;  4AHU A;  1HNV A;  2XY6 A;  3M8S A;  1VRT A;  1S1U A;  1QE1 A;  3SCX A;  3K2P A;  5HRN A;  3OYH A;  4DTR A;  3NF7 A;  1VSH A;  4KHN A;  1IKV A;  4E1M A;  2PYJ A;  2P5G A;  3AA2 A;  3TAM A;  3QLH A;  2KTQ A;  3WNG A;  1TKZ A;  1SUQ A;  3RTV A;  1T03 A;  3CM6 A;  3OYG A;  2KW4 A;  4CGG A;  3S3O A;  3DOL A;  3DRS A;  1SKR A;  1HYZ A;  1XHZ A;  1TAU A;  1G15 A;  5HRO A;  1HMV A;  4E7J A;  4BAC A;  4IG0 A;  1RBT A;  5KGW A;  1TL3 A;  3VQQ A;  3JSM A;  1N6Q A;  1VSF A;  3P5J A;  3K59 A;  4BDY A;  1NJZ A;  4RW7 A;  2R7Y A;  3WNH A;  1LV5 A;  3B6P A;  1UA1 A;  1RT3 A;  4BWM A;  1ZBL A;  3BDP A;  4IBN A;  4JS5 A;  5C25 A;  1X9M A;  1LAW A;  4O44 A;  1BGX T;  1SV5 A;  3LPU A;  4O55 A;  1LW0 A;  3VQ7 A;  4CHN A;  4Y1D A;  3LPT A;  4CED A;  4DSK A;  1B9D A;  4LH5 A;  1KFS A;  4EP4 A;  3ZSX A;  1IH7 A;  3L3V A;  3ZT0 A;  3PX4 A;  3AVK A;  4BDZ A;  1EXQ A;  1WSE A;  4CEB A;  2G8K A;  2HHV A;  3AO3 A;  1WSH A;  3O3H A;  3I8D A;  3NCI A;  4DQQ A;  1L3T A;  4F2R A;  1LWF A;  4HHT A;  1BIZ A;  3CFP A;  4C8K A;  3OYI A;  5KTQ A;  4MQ3 A;  4CJS A;  1TV6 A;  1WSJ A;  1RT6 A;  4DMN A;  1EET A;  1CZ9 A;  3AVM A;  3OYA A;  4C8L A;  4DSI A;  1LWE A;  1LW2 A;  1RBU A;  1GOB A;  3KKS A;  3P1G A;  3ZT3 A;  3ZT4 A;  4E1N A;  1JL2 A;  4CK3 A;  1R0A A;  4KHY A;  3NF9 A;  3M8R A;  4DQI A;  4XIU A;  1BQM A;  4O4G A;  2HHX A;  3U3Y A;  3S9H A;  1WLJ A;  1XC9 A;  4PUO A;  2FBV A;  4E7H A;  1D9F A;  1VSJ A;  3I0R A;  3T1A A;  3M8P A;  4FK2 A;  4CIF A;  3ALY A;  1TKT A;  4DQS A;  4CK2 A;  1RTD A;  1S6Q A;  3RMA A;  4UQG A;  3C95 A;  5HRS A;  3SUQ A;  3AVJ A;  1L3U A;  3VQ9 A;  4Q0B A;  4ID5 A;  3L2U A;  1S6P A;  1XWL A;  3PX0 A;  3HL8 A;  3PY8 A;  4HCC A;  5CYQ A;  1QSY A;  3RR8 A;  5FRN A;  1KLM A;  3HXM A;  3LAK A;  1RDC A;  1JLB A;  3VA3 A;  1HRH A;  3VQ6 A;  1GOC A;  1UAX A;  1TK8 A;  5HP1 A;  4WE1 A;  2DFH A;  1I39 A;  1VSI A;  4DTO A;  1Z25 A;  1UOC A;  1NOY A;  3OYB A;  4KKO A;  2VWJ A;  4M3X A;  1J5O A;  4DQR A;  3O3F A;  2HHU A;  3MAQ A;  1BHL A;  4W5Q A;  4CJU A;  2HHW A;  3DLK A;  4OGC A;  1N5Y A;  1U4B A;  4KRF A;  4FW2 A;  3ZSR A;  4JRP A;  3RMB A;  2ZE2 A;  4AHR A;  1S1V A;  4R5P A;  2HNZ A;  3KKR A;  2BE2 A;  3CFR A;  3B6O A;  4KPY A;  3HST B; 
#chains in the Genus database with same CATH topology
 4F2S A;  4IFY A;  3P31 A;  4EFH A;  3O4Q A;  4WYB A;  2HNY A;  3DM2 A;  1TUY A;  3AA4 A;  3KD5 E;  3J7Z O;  4KH4 A;  4FXD A;  1VQN N;  4DV2 K;  3WXK A;  4BRD A;  2HHQ A;  1O13 A;  3MXM A;  4JS4 A;  5H1S Q;  2ZJP L;  1NK0 A;  4RG8 A;  1KCF A;  3CME N;  3CJ9 A;  3V9X A;  2P1J A;  5A2Q O;  2CGJ A;  5LJW A;  4H0O A;  2IC3 A;  5EU7 A;  1T7P A;  2RE2 A;  5CYM A;  1EQY A;  2GV9 A;  3RSE A;  5F0X A;  1NGI A;  5CZ1 A;  3K57 A;  4DTX A;  1ATR A;  4CJQ A;  3O3G A;  3MCP A;  1OVY A;  4GV9 A;  2YHW A;  1Q7Y O;  4NCA A;  1Y97 A;  3RRG A;  4M63 C;  4M45 A;  1N36 K;  3MX2 A;  1VAZ A;  3F9M A;  2D0C A;  1IKY A;  2ZD1 A;  1T05 A;  4K41 A;  1NK9 A;  3ZSV A;  2RHK A;  4E7L A;  3L2Q A;  2YJF A;  3O4W A;  4LF6 K;  3S3N A;  1KXP A;  5JVG L;  3IMX A;  4O0J A;  3K5L A;  4BC2 A;  3GL1 A;  3THX A;  3LDS A;  5I3U A;  4CEF A;  3IDH A;  1BUP A;  4HUF A;  1ZBH A;  4MDA A;  4N56 A;  3SYZ A;  5LJV A;  1MWK A;  1XHX A;  2P9L A;  1J9A A;  1NM1 A;  4LSN A;  2D4W A;  5J2P A;  4IG3 A;  2FSJ A;  2P9K B;  4CCH A;  4CFD A;  1JLA A;  1W7A A;  1KVA A;  4A5A A;  3G25 A;  2GWJ A;  2NRX A;  4A57 A;  3N4P A;  5BN9 A;  4B1W B;  2OPP A;  3LZJ A;  3AO1 A;  2VGM A;  3H1Q A;  4FJN A;  4KB1 A;  3RVC A;  1EKE A;  5AQH A;  1JLE A;  3EL2 A;  3ULE A;  1WNS A;  1EX4 A;  1V4T A;  2JWL A;  1OVQ A;  3HPG A;  2GUP A;  3KZB A;  4EZ9 A;  3E9L A;  4CEE A;  3RRH A;  3ZET B;  5IT9 O;  3VF6 A;  1UA0 A;  4JI6 K;  5GAD P;  2O8D B;  4C8M A;  3QEP A;  4FJH A;  2WC9 A;  3SAH A;  4FM2 A;  1HQE A;  2KFN A;  2RPI A;  5JMV A;  3GBT A;  1NJX A;  1VRU A;  4KB0 A;  1S5J A;  3V9U A;  4OO1 J;  3OBY A;  4JI1 K;  5KPR A;  1SS6 A;  4BDP A;  2XY7 A;  5M1K A;  1K9M O;  4FZY A;  3IAY A;  4DSE A;  3SZ2 A;  3CQ8 A;  4BR9 A;  3ZYY X;  3PIP L;  4JI0 K;  4OX9 K;  4ZHR A;  2E88 A;  4OVL A;  4L8R B;  3AO5 A;  4M7X A;  3SQ2 A;  3MXJ A;  3BEX A;  3CET A;  4FOI A;  4AM6 A;  1Z6R A;  1WOQ A;  3RMD A;  4RW9 A;  4K25 A;  1RBS A;  3KLE A;  3WXJ A;  4BR4 A;  2HF3 A;  4PKG A;  1RT1 A;  4Z4F A;  3KWG A;  5CY4 A;  3C6T A;  3I0S A;  5B8H A;  2ZF5 O;  4CEO A;  3O4N A;  2HMI A;  4CF8 A;  3V9S A;  3VEY A;  3OJU A;  1TAQ A;  4GKK K;  4BC5 A;  3AVA A;  4BE1 A;  1TKX A;  3SBG A;  1W0H A;  4BR2 A;  4Z0U A;  2E2N A;  3JS6 A;  3J7Y P;  4FO0 A;  1XUP O;  4JK8 A;  5JLH A;  4YOX A;  1U45 A;  2Q31 A;  1VQM N;  3F9K A;  3CMA N;  1MU2 A;  3BUZ B;  3DLB A;  1RNH A;  1VSK A;  3SPZ A;  4CK1 A;  4FJJ A;  3ZSY A;  2BUP A;  3D2F B;  4IWV A;  4PL7 A;  4KH5 A;  3FZK A;  4KRE A;  1BI4 A;  1A5W A;  3CQX A;  2EX3 A;  1ASW A;  3D2E A;  4FCY A;  2QEX N;  4GV3 A;  1UWB A;  3H46 O;  2HBK A;  1ASU A;  2JLE A;  2O4I A;  4BVO A;  5FPM A;  3SQ0 A;  2FSN A;  2PFU A;  2O8B A;  4O5B A;  3D0P A;  4HTU A;  2OPR A;  4DUY K;  3QO9 A;  3CF5 L;  4JD2 A;  2KQ2 A;  1N8R O;  5D3G A;  4B1Y B;  4CFC A;  3BZC A;  1QVF M;  1GLF O;  2EHG A;  5AQI A;  4F3T A;  1NK7 A;  1T6C A;  4BWJ A;  2I5J A;  2BGG A;  1HJR A;  3AGR A;  3K9K A;  4LFA K;  5C10 A;  5EY4 A;  1J54 A;  1VHX A;  4A2A A;  3NHG A;  2O4G A;  3SMS A;  2G8U A;  5HBM A;  3QNO A;  1QQN A;  3TTC A;  1YIJ N;  1NGC A;  1ATS A;  4IOC L;  4QOZ B;  4JKG B;  1TL1 A;  1D5A A;  4FJK A;  1T6D A;  2NRH A;  3SV4 A;  1CXQ A;  3D45 A;  4OPA A;  3AO2 A;  3D7E O;  4FWS A;  5J2M A;  4F4K A;  3OYN A;  4M3T A;  4CEC A;  4JKA A;  1W97 L;  3PSI A;  3NFA A;  4FJX A;  5AQV A;  1C1B A;  3M6G A;  3VQP A;  3AO4 A;  2VWB A;  2E1Z A;  3AVH A;  4DR3 K;  1XI1 A;  2UUC K;  5J2Q A;  3HP6 A;  5AQK A;  4LF4 K;  3THY B;  4RWT A;  4FWQ A;  3MEE A;  3CCR N;  1K8K B;  3KLH A;  4ISF A;  2A41 A;  4FLY A;  1FJG K;  4NB4 A;  4DFP A;  3C0B A;  3U4L A;  3FE1 A;  4E7K A;  2PAV A;  3VTH A;  3J81 O;  4DFJ A;  3NGZ A;  4LF9 K;  4PWD A;  3H08 A;  3VQ5 A;  2FF3 B;  4HCB A;  4OKK A;  3DJC A;  3OYC A;  3KJV A;  4Z94 A;  4W5R A;  4DS4 A;  3OVN A;  3OY9 A;  4W5N A;  2GEL A;  3ZEU A;  3PIO L;  2BDP A;  2UXB K;  4BR7 A;  3FZM A;  3AVC A;  4AHU A;  1X9J A;  4BRN A;  1S1U A;  3CC4 N;  1NMN A;  3OYH A;  1VSH A;  2PYJ A;  4GV6 A;  3QLH A;  1T03 A;  3CM6 A;  4H03 B;  1XHZ A;  1G15 A;  5HRO A;  4CW7 B;  2A40 A;  3VPZ A;  1RBT A;  3VQQ A;  5AR0 A;  1RT3 A;  3U8X A;  3BDP A;  1NWK A;  4IBN A;  5C25 A;  2I7P A;  4O44 A;  1XQS C;  2VYP A;  4O55 A;  3ZX0 A;  3VQ7 A;  1GLE G;  2QA4 N;  3H1V X;  4CVN E;  3W0L A;  3SK3 A;  2WTU A;  1VQ7 N;  3PX4 A;  1EXQ A;  2G8K A;  4YOW A;  3I8D A;  3NCI A;  4JKF A;  5KTQ A;  4MQ3 A;  1NNE A;  1TV6 A;  1WSJ A;  1EET A;  2WUS A;  2W41 A;  3OYA A;  2FLO A;  1LWE A;  3ZT4 A;  3M1F A;  4DQI A;  4BVP A;  4YDU A;  3T1H K;  5BRE A;  5BPM A;  4PHT X;  2A3Z A;  4CK2 A;  3RMA A;  1E4G T;  4Q0B A;  3L2U A;  1XWL A;  1YJ9 N;  1ZXO A;  3WXM B;  1QZ5 A;  3PY8 A;  1NGB A;  1MWM A;  3A5N C;  3VA3 A;  3TTD A;  1UAX A;  4WE1 A;  4DTO A;  1OKJ A;  1UOC A;  4WQ5 A;  1NOY A;  3QFU A;  4KKO A;  4M3X A;  4JKE A;  3A5M C;  2HHW A;  1N5Y A;  4CZL A;  3RMB A;  1X3M A;  2HNZ A;  3KKR A;  3C65 A;  3B6O A;  5LMN K;  4DSL A;  2ZJR L;  2YKM A;  2YNI A;  1ILY A;  2YHY A;  1U47 A;  4IEI A;  3VN5 A;  1K6Y A;  1RDB A;  3EE9 A;  3OYE A;  2V7Z A;  1RCH A;  4N5S A;  5C15 A;  1SL0 A;  1RIL A;  3V1Q A;  1BIS A;  1VQ8 N;  4B9N A;  1BQN A;  4FPB A;  1ESV A;  5AQF A;  2Y1J A;  5AFU A;  2Z1I A;  3PX6 A;  4ILJ A;  5KGX A;  1SKS A;  1NK4 A;  1JLF A;  3U6F A;  3SAG A;  3SJJ A;  2OTL N;  2QWQ A;  3ULD A;  4IO8 A;  4JI4 K;  1OH5 A;  5TKW A;  5I42 A;  1S1X A;  5E26 A;  4DV4 K;  1I94 K;  3O5B A;  3CCU N;  3O8M A;  3AAQ A;  5AQN A;  3U3G A;  2NRR A;  4KTZ A;  4CHO A;  1D8Y A;  4FJ7 A;  5AZI B;  4LY7 A;  2Y1I A;  2G8H A;  2IOC A;  1RDA A;  3QIP A;  1B92 A;  4N76 A;  3HVR A;  2ZGY A;  3GDQ A;  2ZGZ A;  3M8Q A;  5BPL A;  1FKP A;  2AA4 A;  1XMO K;  4BGB A;  1BCO A;  3AVF A;  1QQM A;  3CQY A;  1A5V A;  4FLX A;  3JAM O;  4DV1 K;  2YKN A;  1TVR A;  5JS1 A;  3LP0 A;  1YTA A;  4JKD A;  4L3Q A;  4AM7 A;  2ASM A;  3T19 A;  4CF2 A;  3QEX A;  5GAH P;  3BY5 A;  1RDD A;  2E2P A;  1IV0 A;  3VGK A;  3RSE B;  4BR5 A;  4CHY A;  4H8K A;  4KI4 A;  1CLQ A;  2IVO A;  4TSX A;  4B3O A;  3KK3 A;  4JN4 A;  4M3Z A;  2ASP A;  3ENB A;  2ZM6 K;  3TTF A;  2PYL A;  2ATQ A;  3V9Z A;  1YJN N;  3CI5 A;  4DU3 A;  4DR1 K;  4OPJ A;  4DV6 K;  4I6M A;  2HVI A;  3ZT1 A;  3THX B;  3KHY A;  1RTH A;  5J1E A;  1D9D A;  4CZJ A;  2P9S B;  3NE6 A;  4FSV A;  3UKU B;  2HND A;  2HMP A;  3HJF A;  3VMF B;  1QZ6 A;  4AHT A;  4JI7 K;  1D4X A;  4GVE A;  4KHQ A;  1VQL N;  3MXI A;  1VQ5 N;  2IDO A;  3IFR A;  4FYD A;  3P83 D;  1NKC A;  3G6E N;  1RTI A;  1CZA N;  3SUP A;  4E0D A;  4IZ9 A;  4JV5 K;  5T7B A;  1HNZ K;  1NK6 A;  1DLO A;  2DFF A;  1JKH A;  1HJO A;  4OLB A;  2XY5 A;  3U9Z A;  4CGD A;  4PL8 A;  4RW8 A;  1GLA G;  1WSI A;  3NMU A;  3QBX A;  3ULE B;  3TPQ A;  2HBM A;  3K5N A;  4MFB A;  3H45 C;  5KI6 A;  3VF4 A;  3TSP A;  3LP3 A;  2P9I B;  4FW1 A;  3R9P A;  3EKS A;  1IBK K;  3PLA A;  3DXM A;  2YNH A;  4MLE A;  3FR0 A;  2V51 B;  3HO1 A;  3CHW A;  4OKJ A;  1RBV A;  3J8A A;  4M3R A;  2CH6 A;  4JNE A;  5I9E B;  5BRH A;  4F8R A;  4O8K A;  1HR0 K;  4EP5 A;  4X65 K;  3ATU A;  4CGH A;  4OLA A;  4DHY A;  3AY9 A;  4HVJ A;  5JVH L;  5KRS A;  2HW3 A;  1WBB A;  3HZ6 A;  4BRA A;  3LDN A;  3HOT A;  3IS9 A;  2NNW A;  2E2Q A;  4FOE A;  3S41 A;  4NCB A;  1WSG A;  2P9U B;  3WQT A;  1KLN A;  1QS4 A;  2RKI A;  4EZ6 A;  2IIR A;  2NRZ A;  4IFE A;  4IJN A;  5FLX O;  3VGL A;  2UXC K;  4J2B A;  5FRM A;  4DU1 A;  2O8E A;  1IKX A;  1DTT A;  3C7N A;  1ZBI A;  3HTV A;  5CZ2 A;  2F96 A;  3KK7 A;  2E1Y A;  5M1F A;  2E2O A;  4GMJ B;  4AQY K;  4CIE A;  4BE2 A;  4M3W A;  1VQP N;  1VK0 A;  3CD6 N;  4FJL A;  4DTM A;  4B3R K;  1QQO A;  3CJ7 A;  4FLV A;  3DOK A;  4KBO A;  2NLX A;  2RN2 A;  3E01 A;  4WQ4 C;  5KRT A;  4CBX A;  4B9M A;  4CFB A;  5AQY A;  5BR8 K;  1EO1 A;  1WUA A;  2YJE A;  4ISE A;  3LM2 A;  4B3S K;  5HL7 L;  2VG6 A;  1WB9 A;  4NO7 A;  4B9U A;  4WCE L;  2E5L K;  3KK2 A;  4YDU C;  1Q9X A;  3E66 A;  4DF8 A;  4IOA L;  3ID8 A;  1BCM A;  3O9S A;  1C0M A;  1T44 A;  5C0Y A;  1IG8 A;  3SBT A;  1SL1 A;  1BI4 B;  2YHB A;  4CD1 A;  3TI0 A;  1NMD A;  1F21 A;  3NH0 A;  2GX9 A;  3EY1 A;  1NOZ A;  4K8X A;  1VQ4 N;  5BPN A;  5KPZ A;  1L3S A;  3DLL L;  4DTJ A;  1U48 A;  4WQ5 C;  4CF1 A;  3QES A;  3T1Y K;  4NCG A;  2ZQB A;  1HNI A;  4JI8 K;  3AVI A;  4RW4 A;  1QSL A;  3DRR A;  3EE8 A;  1FXX A;  2X74 A;  1IG9 A;  1LCU A;  1RT5 A;  3F73 A;  2Z1G A;  4AH9 A;  4KI6 A;  4KTW A;  1ZBS A;  1TK5 A;  1J53 A;  4GNI A;  3R3L A;  2Q2R A;  5JS2 A;  1EWQ A;  4NLB A;  3NGY A;  4AHS A;  3ZSQ A;  2GTD A;  4DCH A;  1VSE A;  3O1B A;  5HOO A;  2A42 A;  4NYF A;  1E3M A;  2UUB K;  3ZSW A;  3VQA A;  3IG1 A;  3JXU A;  4XH4 A;  2QI2 A;  1JL1 A;  3GG4 A;  4E1J A;  3LWM A;  4QS9 A;  1KVB A;  3IRX A;  3TSQ A;  4RW6 A;  5GIO A;  1KAX A;  4CE9 A;  4ID1 A;  1HUX A;  1HKC A;  1HNV A;  3AVN A;  4FWP A;  1QE1 A;  5M1Q A;  4BY9 C;  4KHN A;  3TAM A;  2KTQ A;  3WNG A;  1TKZ A;  1SUQ A;  4F9O A;  1ZC6 A;  3OYG A;  1M1K O;  4CGG A;  3QDK A;  3S3O A;  3DRS A;  1SKR A;  1HYZ A;  4H5T A;  2O8F B;  2H3G X;  2P9P B;  3ZET A;  3WQU A;  5KGW A;  1JCG A;  3BP8 A;  1NJZ A;  3VEW A;  3K59 A;  4BDY A;  4RW7 A;  4JK7 A;  3QBW A;  3WNH A;  4IEE A;  4BWM A;  1KD1 O;  4JS5 A;  1E4F T;  3LPU A;  1NJI O;  1LW0 A;  3T7Z A;  4CHN A;  3MN5 A;  2P9N A;  5EXW A;  3Q7C A;  4DSK A;  2QW9 A;  1NGJ A;  5JIC A;  4G9Z A;  1N33 K;  3O3H A;  4LF7 K;  3LL3 A;  2JWK A;  5ADX H;  1LWF A;  1U6Z A;  4HHT A;  4C8K A;  3OYI A;  4O8U A;  4JYA K;  3HM8 A;  1N32 K;  5KPT A;  1YHQ N;  3BF1 A;  3ZEU B;  3KKS A;  3P1G A;  1JL2 A;  1H1V A;  3M8R A;  3AGK A;  4O4G A;  2HHX A;  1WLJ A;  1NGD A;  4AF1 A;  4PUO A;  4EAH D;  1BWF O;  1D9F A;  1VSJ A;  2PBD A;  3CCJ N;  3T1A A;  4FK2 A;  4CIF A;  1S6Q A;  4YOT A;  5HRS A;  4JHD B;  4A59 A;  3VQ9 A;  4ID5 A;  1RDW X;  3PX0 A;  3HL8 A;  3A0I X;  1QSY A;  5FRN A;  3QML A;  5IWA K;  3HXM A;  1JLB A;  1XC3 A;  1HRH A;  2DFH A;  1I39 A;  4FWR A;  4U7B A;  2ASO A;  3AAP A;  3MAQ A;  1BHL A;  5C12 A;  4CJU A;  4KHP K;  3L0Q A;  4KRF A;  4FW2 A;  1YJW N;  4BR0 A;  4BRK A;  3ZSR A;  1YIT N;  1C0G A;  1K8A O;  4CZF A;  1S1V A;  4R5P A;  4BG9 A;  2BE2 A;  4WF9 L;  4GY2 B;  3HST B;  2G8I A;  4DUZ K;  1KQS M;  4DR7 K;  4BRC A;  3D2F A;  2FF6 A;  1GLJ O;  4CJW A;  3OHR A;  2D5R A;  4FL9 A;  3DLG A;  1DKG D;  1HNW K;  4CGI A;  4CJE A;  5AQL A;  3SQ4 A;  3MWT A;  3T69 A;  4XH1 A;  1WN7 A;  3HK2 A;  4CGJ A;  1LOT B;  3HP9 A;  3SI6 A;  1KFD A;  3O9T A;  2KLA A;  2E6L A;  3O80 A;  1Z05 A;  3SJH A;  3AA3 A;  4GKJ K;  2XHB A;  2F8S A;  2FBT A;  4C1N I;  3L3U A;  2B6A A;  2BH1 A;  1HX1 A;  4BRO A;  2D1K A;  3HPO A;  3ZLJ A;  5HLF A;  4DQP A;  2UUA K;  3CFO A;  1RT7 A;  2YI1 A;  3A5L C;  1U04 A;  3HI0 A;  1ZYQ A;  3OW2 M;  4WFB L;  3CXC M;  4YFU A;  3G0Z A;  2BAN A;  2E8A A;  3DLR A;  4DLE A;  1U2V A;  1J6Z A;  4B1V A;  4OGE A;  4JKG A;  1CZB A;  4CF9 A;  4DB3 A;  3E9O A;  2WFB A;  1JLG A;  2ITM A;  4I9Q A;  4BRF A;  4LH4 A;  1LAV A;  2Z1J A;  4CJF A;  5AQO A;  3VQC A;  1ATN A;  3TAN A;  1HYS A;  4JLH A;  3B8A X;  5BR9 A;  3THW A;  4J2A A;  4RCH A;  3RWU A;  1KVC A;  1LWC A;  1YVU A;  4FWN A;  4FWL A;  1NGH A;  1Z26 A;  4JI2 K;  4KO0 A;  4JI3 K;  5GIP A;  3VF2 A;  4CD3 A;  5FPD A;  3IKM A;  3NVM A;  1P8Z A;  4LD0 A;  3QEV A;  3OYD A;  5BN8 A;  2OPS A;  4DS5 A;  1X3N A;  3UE5 A;  3L4I A;  3THY A;  3VET A;  3AA5 X;  3EO3 A;  3WNE A;  3A8Y A;  3NH1 A;  4CJV A;  5SZT A;  4IDH A;  3NF8 A;  4C8O A;  3SQ1 A;  5JLF A;  3SV3 A;  2OTJ N;  2QK9 A;  4QAG A;  3DLH A;  4OPK A;  1HNX K;  4DSF A;  1FW6 A;  5AJ3 K;  1ZBF A;  3SUN A;  4JI5 K;  3K5M A;  1MA9 B;  5HRR A;  5CE3 A;  3WEE A;  4C8N A;  5AQW A;  3NBP A;  5AFU H;  4ELU A;  1HKB A;  3C6U A;  4PKH A;  1MDU B;  3ID6 A;  4R79 A;  4FJG A;  4DKW A;  3MWP A;  3SLC A;  1NGG A;  1WAJ A;  2F9T A;  1C0T A;  5BRF A;  5C42 A;  3CG7 A;  2QKB A;  1NJW A;  5K14 A;  1S9G A;  2FXU A;  1DTQ A;  2VG5 A;  3ENH A;  3TAQ A;  3TAG A;  5J2N A;  2Q0R A;  4OPH A;  3I8B A;  2NUB A;  2QWR A;  1RT2 A;  1EWR A;  5TKY A;  3OYL A;  3KTQ A;  4YOR A;  3F5T A;  2PZS A;  3TAB A;  3P38 A;  3Q7B A;  1NKE A;  3CCE N;  2RF2 A;  2WON A;  3VQ8 A;  1N34 K;  2KZZ A;  3EYZ A;  2P5O A;  3FGU A;  3LDO A;  4H5V A;  4JKC A;  5DMR A;  3UIQ A;  2HHT A;  3W3D A;  2Z1H A;  4BQZ A;  2FSK A;  1IO2 A;  3LDP A;  3VEZ A;  1Q8I A;  3JYT A;  3TAE A;  1JJ2 M;  1SKW A;  4DR6 K;  2O8C A;  1OH8 A;  4M3Y A;  4AHV A;  4CJ5 A;  2GWK A;  3KLF A;  3O1W A;  4AHC A;  4Z4I A;  4F3O A;  4Z4C A;  2HF4 A;  3A5O C;  1WSF A;  2W6K A;  3DI6 A;  1GLD G;  3THV A;  1Q18 A;  3HT3 A;  3FZH A;  4O0I A;  3NH2 A;  5LY3 A;  4YOY A;  3L8B A;  3DXK A;  5C2D A;  3I55 N;  4C1N K;  3MCA B;  4CJP A;  3G10 A;  3SNN A;  3DXM B;  4H4M A;  1T3V A;  1EP4 A;  4CJ7 A;  3SMP A;  3LWL A;  3G4S N;  1JLQ A;  2OZS A;  2HHS A;  3DMJ A;  2DFE A;  2FBX A;  4JEP A;  1J5E K;  4H5W A;  4YNQ A;  2QKK A;  4DR2 K;  4K8Z A;  3E1Y A;  5EVZ A;  5SWM A;  4JAX A;  5GAG P;  1S9E A;  3E9P A;  2UU9 K;  4CZH A;  5GAE P;  4JKB A;  2IVP A;  3TR8 A;  4I2P A;  4Y1C A;  4HWI A;  2I7N A;  2ETJ A;  3TAP A;  1RT4 A;  1U49 A;  4BC4 A;  5AZJ A;  3PV8 A;  3EN9 A;  3ZCM A;  1SQK A;  4KFB A;  5AQT A;  5E41 A;  1L3V A;  4BRE A;  3ATV A;  3MMV A;  3UKR A;  4CJ3 A;  1IBL K;  1B9F A;  2IGI A;  1GLC G;  4H0T B;  1C1A A;  4K0K K;  3S3M A;  1KAY A;  3SUO A;  2VGN A;  1TYQ A;  4HUG A;  5LL6 Z;  3ENO A;  2O8E B;  3KLG A;  3C7N B;  2P9L B;  1S22 A;  3HOS A;  3LM9 A;  4LSL A;  5LMU K;  4PY5 A;  4QS8 A;  4CHP A;  1ZBU A;  4X66 K;  3CPE A;  4NXN K;  2JGU A;  4CEQ A;  2DY4 A;  2QXF A;  1Q81 O;  4ICL A;  4PKI A;  1RBR A;  4IJA A;  3HPH A;  4E19 A;  4ISG A;  4EHT A;  5C24 A;  3CCL N;  1X9S A;  1KTQ A;  4CJR A;  3DRP A;  4KHS A;  3VTI A;  3KIO A;  3L2V A;  4FWM A;  3MEC A;  4FJ9 A;  3KLI A;  4FLW A;  5AZI A;  3CCQ N;  4CI6 A;  4E3S A;  4J2D A;  4W5O A;  3VOV A;  3VES A;  3NDK A;  4B3M K;  2QXL A;  4BRQ A;  4FM1 A;  5E84 A;  2GUI A;  3CJB A;  4FPA A;  2GBZ A;  1QHT A;  3QET A;  3RMC A;  1KSP A;  1S72 N;  1HQU A;  3WXI A;  4FZZ A;  4EHU A;  3VEO A;  2VG7 A;  4BRH A;  1TK0 A;  4DV5 K;  2OPQ A;  2VCP A;  4J8F A;  4B8A B;  3KD1 E;  4KTQ A;  4DV0 K;  1GOA A;  3R6M A;  4MO5 A;  4LFB K;  1QSS A;  1Y64 A;  2D0P A;  2ZWH A;  1L5U A;  4H0P A;  2OAN A;  3MX5 A;  3OS1 A;  2G8F A;  3L4Q A;  3QB0 A;  2XY6 A;  4B1Z A;  3M8S A;  2V7Y A;  3SCX A;  5FPN A;  2P5G A;  1XNQ K;  3PSF A;  2KW4 A;  1YI2 N;  3H3O B;  1K73 O;  1HMV A;  4E7J A;  4BAC A;  1Q86 O;  1LV5 A;  1IJJ A;  3B6P A;  3ZX3 A;  3DWL A;  1LAW A;  1BGX T;  2P9S A;  2A6A A;  3UKU A;  3SAF A;  4JK9 A;  4CED A;  3I56 N;  1B9D A;  4LH5 A;  4LF5 K;  1IH7 A;  4O5F A;  3L3V A;  3AVK A;  4BDZ A;  1WSE A;  4CEB A;  2HBJ A;  2HHV A;  4DQQ A;  4F2R A;  1BIZ A;  4CJS A;  1CZ9 A;  5DM7 L;  4C8L A;  4DSI A;  1LW2 A;  1RBU A;  1GOB A;  4E1N A;  3K0S A;  1R0A A;  2NRV A;  4XIU A;  1KC8 O;  4BRI A;  3CCM N;  3HBT A;  1TKT A;  3OTO K;  3O6W A;  3D2E B;  1L3U A;  3SUQ A;  4H0X B;  2YHX A;  2P9I A;  1S6P A;  3O9R A;  4RTF D;  3CIP A;  4BQL A;  4HCC A;  3RR8 A;  5KQ8 A;  3O08 A;  2F4V K;  1M90 O;  3VQ6 A;  1GOC A;  2O8B B;  1TK8 A;  1OH6 A;  3J7A P;  5HP1 A;  1G99 A;  3OYB A;  2VWJ A;  1J5O A;  4JD2 B;  3O3F A;  4W5Q A;  1RFQ A;  2P9N B;  4H5N A;  3I33 A;  3DLK A;  4OGC A;  3VEX A;  3WT0 A;  3TSU A;  2HBL A;  4JRP A;  2ZE2 A;  4AHR A;  1VSF A;  4KPY A;  4NLC A;  3OBW A;  1GLB G;  3PUF A;  1FK9 A;  2VQE K;  5AQQ A;  4DFM A;  4EIA A;  4BRG A;  4CJL A;  5M1N A;  5HRP A;  1QVG M;  4CEZ A;  2P9U A;  4FK4 A;  3OS0 A;  2B4J A;  4B1U B;  2B5J A;  3GE1 A;  4A5B A;  4DU4 A;  4ILH A;  1KRP A;  1S1T A;  1QHA A;  4YY3 K;  3AV9 A;  4M7Y A;  4B1X B;  2X6N A;  3CCS N;  4N41 A;  3AVL A;  4CHQ A;  2P9K A;  4CJT A;  2NRT A;  1BA1 A;  1GLL O;  3MDQ A;  5M1O A;  4LF8 K;  3O9U A;  2KKZ A;  3BZK A;  1IBM K;  4Z4G A;  1CXU A;  3VEV A;  1VSD A;  1BOT O;  2QTD A;  2IVN A;  1JCF A;  4QS7 A;  4HUE A;  4CFA A;  2HB5 A;  3O9Q A;  1NGF A;  3HSC A;  4LFC K;  4B9Q A;  3H6E A;  4FJI A;  3WUH A;  3OS2 A;  3HM9 A;  3CC7 N;  3K5O A;  3K9J A;  3LAL A;  3CCV N;  2O8D A;  2BTF A;  2G8V A;  1NU0 A;  4V19 S;  2Q3S A;  3LZI A;  4M42 A;  1IKW A;  3SPY A;  3NVK A;  1YF5 L;  4IXC A;  2YNG A;  2FBY A;  4GW6 A;  2X78 A;  2G8W A;  2KFZ A;  4AIL C;  3WNF A;  1NKB A;  4CGF A;  4GVM A;  2KHO A;  2EWS A;  2E4L A;  3V9W A;  2PY5 A;  4J2E A;  2GEM A;  4Z4H A;  1WAF A;  2D0B A;  3EEQ A;  3OYJ A;  4CEA A;  2YNF A;  3MN6 A;  5AQJ A;  1R59 O;  3EZW A;  1I3A A;  3HYF A;  5AQZ A;  3AAR A;  3LP2 A;  4FLZ A;  4FJM A;  4IOX A;  4N47 A;  3V1R A;  3VA0 A;  2YX6 A;  3A2F A;  3C94 A;  4E89 A;  2J4R A;  1C6V A;  5AQS A;  2A1S A;  5M1P A;  1VQ6 N;  2FC0 A;  2CH5 A;  4CJK A;  3CJA A;  3R1X A;  2YHA A;  3ZT2 A;  3H3N O;  3QER A;  4FVM A;  1NK5 A;  1YTU A;  4B9S A;  4Q5V A;  1A5X A;  5EOY A;  1QTM A;  1U2V B;  4CZE A;  4B3T K;  4E7I A;  2XY8 A;  4ELV A;  4B08 A;  4DF4 A;  1VSL A;  2AP1 A;  1C1C A;  4IO9 L;  2HVH A;  3R8E A;  3ZSZ A;  4A61 A;  3M5R A;  4CZK A;  4DSJ A;  4DR4 K;  1NGE A;  1TGO A;  4FWK A;  3KK1 A;  1TKD A;  1P90 A;  3THW B;  3G71 N;  3MED A;  3V6D A;  3V1O A;  4YHH K;  5ADX A;  4YOV A;  3DLE A;  3KWI A;  4I9L A;  4WFA L;  2WOM A;  3FLC O;  4B8C A;  3BF3 A;  4Z4E A;  1JLC A;  3QIN A;  4XEI A;  4DG1 A;  1FKO A;  2O8F A;  5FPE A;  2P9P A;  4M3U A;  4BRM A;  4CZI A;  3QEI A;  1ITG A;  4YOU A;  3TWH A;  3MEG A;  3QEW A;  3NF6 A;  2P51 A;  1NJY A;  3AVG A;  1REV A;  2QWM A;  3L2W A;  2IS3 A;  4DQ8 A;  4ELT A;  2UXD K;  1YAG A;  3C6A A;  4IDK A;  2DPN A;  4CZM A;  4FZX C;  4H4O A;  3LDL A;  3OYM A;  1XMQ K;  3WEE B;  1JXB A;  3PO4 A;  1C0U A;  4MLH A;  5AQX A;  3HRG A;  2DTU A;  2ITG A;  2LSN A;  4NYN A;  5F1X A;  3CJ1 A;  3C6H A;  1NBW A;  3QIC A;  1YT3 A;  5MLC Q;  1QQC A;  2IAJ A;  1DT9 A;  4DV3 K;  3TAR A;  5AQG A;  4K43 A;  5ELZ A;  3ISN C;  3EKU A;  4C23 A;  4A2B A;  4CF0 A;  2OA8 A;  4PQU A;  3CER A;  4ZTJ A;  4B9V A;  1VQ9 N;  3PO5 A;  2F7T A;  1HPZ A;  4BRP A;  4B9L A;  4KHU A;  4IFV A;  5AQM A;  1NK8 A;  3KVG A;  2OYQ A;  1BA0 A;  1YVN A;  2X6S A;  1OH7 A;  1YUW A;  4KHW A;  4JHD A;  3CYM A;  3NGI A;  4DTU A;  3TU5 A;  4BE0 A;  3EZ5 A;  3ZX2 A;  4FJ8 A;  3DYA A;  4IKF A;  5GIN A;  5AQP A;  3OYK A;  2XO7 A;  2XRI A;  2W6L A;  1SZ2 A;  1O1W A;  2F8T A;  2UYT A;  1YXQ A;  4LC9 B;  3LP1 A;  1X9W A;  4ZTF A;  1HPM A;  2QWP A;  3QNN A;  3RR7 A;  4KAZ A;  3ITH A;  4FLU A;  4FWO A;  4CZG A;  4WQ4 A;  2QM1 A;  4CHZ A;  3FZF A;  3HVT A;  4KH6 A;  3WXL A;  4G1Q A;  2D0A A;  1K8K A;  4CES A;  3ASM A;  4BGA A;  3OYF A;  2O8C B;  1RGI A;  4NXM K;  3K58 A;  4Y0W A;  2Q0U A;  2E6M A;  5C2F A;  1C0F A;  3CJC A;  1SL2 A;  5CR4 A;  4U67 L;  4DTP A;  4CER A;  1S1W A;  4CJ4 A;  4OKE A;  1HYV A;  4H0Y B;  4KV8 A;  4FK0 A;  2AJQ A;  4JKH A;  1BIU A;  3DXK B;  3FFI A;  3V81 A;  4JRQ A;  1RTJ A;  1HLU A;  2A1R A;  5AQU A;  1NLV A;  4DTN A;  3CPW M;  4B9T A;  3OJS A;  3GOI A;  2QWO A;  2Q1N A;  1X1P A;  4OJR A;  1V4S A;  3AVB A;  5CHI A;  4PA1 A;  1JXE A;  1BO5 O;  4DWI A;  5FDL A;  2KZM A;  3F2K A;  1DEJ A;  4M41 A;  1BG3 A;  3VQB A;  2CGK A;  3FFK B;  4W5T A;  4CBU A;  4ILG B;  4UY8 O;  5FRO A;  3VER A;  3ZSO A;  4FJ5 A;  1VQO N;  3L2R A;  4FLT A;  4X62 K;  3MK6 A;  5AZJ B;  3TAF A;  4I6M B;  3CM5 A;  1VSM A;  3NAE A;  4QCL A;  3T3F A;  5DK5 A;  1ASV A;  2OZM A;  4WFN L;  4DTS A;  1HKG A;  3UKR B;  2QWL A;  1Q9Y A;  3QIO A;  4I2Q A;  5DM6 L;  3P39 A;  4I7F A;  2CGL A;  4FVU A;  2VWK A;  3VQE A;  3J80 O;  4CIG A;  3BGR A;  2OCE A;  5EX5 A;  3V4I A;  1TYQ B;  1NG9 A;  2YV0 X;  3LAN A;  3OA9 A;  1T8E A;  3VQD A;  1W9H A;  4DFK A;  2HST A;  1BL3 A;  3QFP A;  3VQ4 A;  2W42 A;  4X64 K;  3LAM A;  4DLG A;  1BU6 O;  1VRT A;  3K2P A;  3D6R A;  4BC3 A;  5HRN A;  4DTR A;  3NF7 A;  3U9D A;  2YCH A;  1IKV A;  4E1M A;  1JCE A;  2NZT A;  3AA2 A;  1RDU A;  3UB5 A;  3VEN A;  3RTV A;  3M3Z A;  3DOL A;  3P4I A;  1S3X A;  1TAU A;  1KAZ A;  3MN7 A;  1BDG A;  2WBN A;  4IG0 A;  3JSM A;  1N6Q A;  1TL3 A;  3P5J A;  1XNR K;  2R7Y A;  1UA1 A;  4CBW A;  3CC2 N;  3IUC A;  1ZBL A;  1X9M A;  1SV5 A;  4HTL A;  4MDB A;  4K42 A;  4Y1D A;  3LPT A;  4XH5 A;  3DAW A;  4DR5 K;  1KFS A;  1Q82 O;  4EP4 A;  3ZSX A;  4A62 A;  3L6Q A;  3ZT0 A;  3FZL A;  4BG8 A;  3AO3 A;  1WSH A;  4H0V B;  4BRL A;  2VQF K;  1L3T A;  2F9W A;  3CFP A;  4DV7 K;  1WBD A;  1VQK N;  1RT6 A;  2D0O A;  4DMN A;  2HOE A;  3AVM A;  3MN9 A;  2ZJQ L;  2Q36 A;  1NGA A;  3ZT3 A;  4CK3 A;  1W2B M;  3LDQ A;  4KHY A;  3NF9 A;  1SAZ A;  2V52 B;  1BQM A;  3U3Y A;  3S9H A;  1XC9 A;  2FBV A;  4E7H A;  5KQD A;  2HHH K;  3I0R A;  3M8P A;  3ALY A;  5BRD A;  4DQS A;  1RTD A;  4UQG A;  3C95 A;  3AVJ A;  2Q97 A;  2A5X A;  2QWN A;  5CYQ A;  3VGM A;  1KLM A;  2E20 A;  3LAK A;  1RDC A;  4H5R A;  3N4Q A;  1VSI A;  2NRW A;  1Z25 A;  1DGK N;  2W40 A;  5F2R A;  4DQR A;  5AQR A;  2HHU A;  4MO4 A;  1TUU A;  1U4B A;  3CFR A;  4FM0 A; 
#chains in the Genus database with same CATH homology
 2G8I A;  4DSL A;  4F2S A;  4IFY A;  2YKM A;  2YNI A;  3PUF A;  1FK9 A;  4DFM A;  1U47 A;  4CJL A;  3VN5 A;  1K6Y A;  4CJW A;  3O4Q A;  1RDB A;  5HRP A;  2HNY A;  4CEZ A;  4FJH A;  4FK4 A;  2D5R A;  3OS0 A;  3DLG A;  2B4J A;  3DM2 A;  3OYE A;  1RCH A;  3AA4 A;  3KD5 E;  2B5J A;  4FXD A;  4N5S A;  4CGI A;  4CJE A;  2HHQ A;  4DU4 A;  1SL0 A;  3MXM A;  3SQ4 A;  1RIL A;  3V1Q A;  4JS4 A;  1KRP A;  1S1T A;  1BIS A;  1NK0 A;  4B9N A;  4RG8 A;  3AV9 A;  1WN7 A;  1KCF A;  3HK2 A;  1BQN A;  2X6N A;  4CGJ A;  3V9X A;  3HP9 A;  4N41 A;  3AVL A;  2Y1J A;  2P1J A;  4CHQ A;  3SI6 A;  1KFD A;  2Z1I A;  4CJT A;  2IC3 A;  3PX6 A;  5KGX A;  1SKS A;  2E6L A;  5EU7 A;  1T7P A;  1NK4 A;  3AA3 A;  5CYM A;  1JLF A;  2GV9 A;  2XHB A;  3U6F A;  3SJJ A;  2F8S A;  2FBT A;  5CZ1 A;  3K57 A;  4DTX A;  3L3U A;  2B6A A;  4CJQ A;  3O3G A;  3ULD A;  4Z4G A;  1CXU A;  4NCA A;  1VSD A;  5I42 A;  1S1X A;  1Y97 A;  3RRG A;  4M45 A;  3HPO A;  4HUE A;  5HLF A;  4DQP A;  4CFA A;  3U3G A;  2HB5 A;  3CFO A;  1RT7 A;  2D0C A;  1IKY A;  2ZD1 A;  1T05 A;  1U04 A;  4KTZ A;  1ZYQ A;  4CHO A;  1NK9 A;  3ZSV A;  4E7L A;  1D8Y A;  4FJI A;  3L2Q A;  4FJ7 A;  3OS2 A;  3S3N A;  4YFU A;  3HM9 A;  3K5O A;  3G0Z A;  4O0J A;  2BAN A;  3LAL A;  3DLR A;  3K5L A;  4DLE A;  4LY7 A;  2G8V A;  2Q3S A;  2Y1I A;  2G8H A;  2IOC A;  3LZI A;  3LDS A;  4M42 A;  1IKW A;  4OGE A;  3SPY A;  1RDA A;  5I3U A;  4CEF A;  3QIP A;  4HUF A;  1ZBH A;  1CZB A;  1B92 A;  2YNG A;  4CF9 A;  3HVR A;  4N76 A;  2FBY A;  1JLG A;  2X78 A;  4GW6 A;  4N56 A;  2G8W A;  2KFZ A;  4I9Q A;  3SYZ A;  3M8Q A;  4LH4 A;  4AIL C;  1LAV A;  3WNF A;  2Z1J A;  1FKP A;  1NKB A;  4CJF A;  3VQC A;  4GVM A;  4CGF A;  1BCO A;  1XHX A;  3AVF A;  1A5V A;  1J9A A;  3TAN A;  1HYS A;  4JLH A;  4LSN A;  4FLX A;  2YKN A;  1TVR A;  4J2A A;  5J2P A;  5JS1 A;  2E4L A;  3LP0 A;  4IG3 A;  3V9W A;  3RWU A;  1KVC A;  1LWC A;  1YTA A;  1YVU A;  2PY5 A;  3T19 A;  4CF2 A;  1Z26 A;  4Z4H A;  4CCH A;  4J2E A;  4CFD A;  1JLA A;  1WAF A;  1KVA A;  4KO0 A;  3QEX A;  2D0B A;  1RDD A;  3OYJ A;  4CEA A;  2YNF A;  4LD0 A;  3QEV A;  3OYD A;  2OPP A;  2OPS A;  4CHY A;  3LZJ A;  3AO1 A;  4FJN A;  4H8K A;  4KB1 A;  1I3A A;  3HYF A;  4KI4 A;  1CLQ A;  4DS5 A;  3LP2 A;  4TSX A;  4FLZ A;  4FJM A;  3V1R A;  4N47 A;  1EKE A;  3KK3 A;  4B3O A;  3VA0 A;  4M3Z A;  3A2F A;  3C94 A;  1JLE A;  4E89 A;  1C6V A;  1WNS A;  2A1S A;  3AA5 X;  4PY5 A;  1EX4 A;  2PYL A;  3WNE A;  2ATQ A;  3HPG A;  4EZ9 A;  3NH1 A;  3V9Z A;  2FC0 A;  4CJV A;  5SZT A;  4CJK A;  3NF8 A;  4CEE A;  2YHA A;  4DU3 A;  3RRH A;  4C8O A;  4OPJ A;  3ZT2 A;  3SQ1 A;  3QER A;  3SV3 A;  1UA0 A;  4FVM A;  2QK9 A;  4QAG A;  1NK5 A;  3DLH A;  1YTU A;  2HVI A;  4B9S A;  4C8M A;  1A5X A;  4Q5V A;  1QTM A;  4OPK A;  3QEP A;  4DSF A;  4E7I A;  3ZT1 A;  1ZBF A;  2XY8 A;  3SUN A;  4ELV A;  1RTH A;  5J1E A;  4B08 A;  4FM2 A;  1HQE A;  3K5M A;  5HRR A;  4DF4 A;  1VSL A;  2RPI A;  1D9D A;  2KFN A;  3NE6 A;  4C8N A;  2HND A;  3NBP A;  3HJF A;  1C1C A;  1NJX A;  1VRU A;  4ELU A;  4KB0 A;  4AHT A;  3C6U A;  2HVH A;  1S5J A;  3V9U A;  4KHQ A;  4FJG A;  3ZSZ A;  3MXI A;  4DSJ A;  2IDO A;  1WAJ A;  4FYD A;  3P83 D;  1TGO A;  1TKD A;  1C0T A;  3KK1 A;  2XY7 A;  4BDP A;  1NKC A;  4FZY A;  3IAY A;  4DSE A;  3SZ2 A;  3CQ8 A;  1RTI A;  3SUP A;  5C42 A;  3MED A;  3V6D A;  4ZHR A;  3CG7 A;  3V1O A;  4E0D A;  1NJW A;  2QKB A;  5K14 A;  3DLE A;  4OVL A;  4I9L A;  1S9G A;  2WOM A;  4L8R B;  1DTQ A;  3AO5 A;  5T7B A;  2VG5 A;  4B8C A;  1DLO A;  2DFF A;  3TAQ A;  1JKH A;  3TAG A;  3SQ2 A;  5J2N A;  1NK6 A;  1JLC A;  3QIN A;  3MXJ A;  2XY5 A;  4OLB A;  4Z4E A;  4CGD A;  4RW8 A;  4DG1 A;  1FKO A;  4FM0 A;  1WSI A;  3RMD A;  4RW9 A;  1RBS A;  3KLE A;  2NUB A;  1RT2 A;  4M3U A;  3K5N A;  4MFB A;  3OYL A;  1RT1 A;  3QEI A;  1ITG A;  5KI6 A;  3LP3 A;  3TWH A;  3MEG A;  4FW1 A;  3KTQ A;  4Z4F A;  3C6T A;  5CY4 A;  3I0S A;  3NF6 A;  3QEW A;  2P51 A;  2YNH A;  1NJY A;  3AVG A;  1REV A;  4CEO A;  3TAB A;  2PZS A;  3L2W A;  2IS3 A;  3O4N A;  3HO1 A;  1NKE A;  2HMI A;  4CF8 A;  4OKJ A;  3V9S A;  4ELT A;  1RBV A;  2RF2 A;  2WON A;  3VQ8 A;  4IDK A;  1TAQ A;  4M3R A;  3OJU A;  3EYZ A;  4FZX C;  2KZZ A;  2P5O A;  4H4O A;  5DMR A;  4F8R A;  3AVA A;  4BE1 A;  3OYM A;  1TKX A;  1JXB A;  3UIQ A;  2HHT A;  4EP5 A;  1W0H A;  3PO4 A;  1C0U A;  4Z0U A;  4CGH A;  2Z1H A;  4OLA A;  2DTU A;  2ITG A;  1U45 A;  2LSN A;  4NYN A;  1IO2 A;  3F9K A;  4HVJ A;  1Q8I A;  3JYT A;  5KRS A;  2HW3 A;  3TAE A;  1YT3 A;  3TAR A;  1QQC A;  1MU2 A;  2IAJ A;  3DLB A;  1SKW A;  1RNH A;  3ISN C;  1VSK A;  3SPZ A;  4CF0 A;  4CK1 A;  3IS9 A;  2OA8 A;  4FJJ A;  4M3Y A;  3ZSY A;  4AHV A;  4CJ5 A;  3KLF A;  4PQU A;  4ZTJ A;  4AHC A;  4B9V A;  4Z4I A;  4F3O A;  4Z4C A;  4NCB A;  1WSG A;  3PO5 A;  1HPZ A;  1WSF A;  1KLN A;  1QS4 A;  4B9L A;  4KHU A;  4IFV A;  4KRE A;  1NK8 A;  1BI4 A;  1A5W A;  2RKI A;  3DI6 A;  2X6S A;  3THV A;  2OYQ A;  4EZ6 A;  2EX3 A;  1ASW A;  4KHW A;  4FCY A;  1UWB A;  3CYM A;  4J2B A;  5FRM A;  1ASU A;  3HT3 A;  3NGI A;  4DU1 A;  4DTU A;  1IKX A;  2JLE A;  1DTT A;  1ZBI A;  4O0I A;  2O4I A;  3NH2 A;  5CZ2 A;  4BE0 A;  3L8B A;  2F96 A;  3EZ5 A;  3SQ0 A;  4FJ8 A;  3DYA A;  4CJP A;  4IKF A;  3G10 A;  3OYK A;  4O5B A;  3SNN A;  2XO7 A;  3D0P A;  4H4M A;  4HTU A;  4GMJ B;  1EP4 A;  2OPR A;  2XRI A;  3LWL A;  3QO9 A;  1O1W A;  2F8T A;  4CIE A;  1JLQ A;  2OZS A;  2HHS A;  4BE2 A;  3DMJ A;  2DFE A;  2FBX A;  2KQ2 A;  3LP1 A;  1VK0 A;  4ZTF A;  1X9W A;  4M3W A;  5D3G A;  4FJL A;  4DTM A;  4YNQ A;  2QKK A;  4CFC A;  3QNN A;  4FLV A;  3DOK A;  3RR7 A;  4KAZ A;  3E01 A;  2RN2 A;  3ITH A;  5KRT A;  4FLU A;  4K8Z A;  2EHG A;  5SWM A;  4F3T A;  1NK7 A;  4BWJ A;  4B9M A;  1S9E A;  2I5J A;  2BGG A;  1HJR A;  4CFB A;  4CHZ A;  3TR8 A;  4I2P A;  4Y1C A;  1J54 A;  3HVT A;  2ETJ A;  3TAP A;  4G1Q A;  2D0A A;  1RT4 A;  3NHG A;  2O4G A;  2VG6 A;  4CES A;  1U49 A;  3ASM A;  2G8U A;  3OYF A;  4B9U A;  5HBM A;  3PV8 A;  3QNO A;  3KK2 A;  1Q9X A;  3ZCM A;  3K58 A;  4KFB A;  4DF8 A;  5E41 A;  1L3V A;  4QOZ B;  1BCM A;  2E6M A;  1C0M A;  4CJ3 A;  1B9F A;  1SL2 A;  1D5A A;  1TL1 A;  4DTP A;  4FJK A;  2IGI A;  3SV4 A;  1CXQ A;  4CER A;  1BI4 B;  2YHB A;  3D45 A;  1C1A A;  1SL1 A;  1S1W A;  3AO2 A;  3TI0 A;  3SUO A;  3S3M A;  5J2M A;  4F4K A;  4CJ4 A;  4OKE A;  3OYN A;  4HUG A;  4M3T A;  1HYV A;  4CEC A;  3KLG A;  1F21 A;  4KV8 A;  3NH0 A;  3EY1 A;  4FK0 A;  2AJQ A;  3NFA A;  4FJX A;  1NOZ A;  4LSL A;  1BIU A;  3FFI A;  4K8X A;  3V81 A;  4JRQ A;  1RTJ A;  1C1B A;  2A1R A;  4CHP A;  1L3S A;  1ZBU A;  4DTJ A;  3VQP A;  4DTN A;  1U48 A;  4CF1 A;  3QES A;  3AO4 A;  4NCG A;  4B9T A;  2JGU A;  1HNI A;  2ZQB A;  4CEQ A;  3OJS A;  2QXF A;  3AVH A;  2DY4 A;  4ICL A;  3AVI A;  1X1P A;  4OJR A;  4RW4 A;  3AVB A;  1RBR A;  1QSL A;  3DRR A;  3HPH A;  4PA1 A;  1JXE A;  4E19 A;  5C24 A;  1FXX A;  2X74 A;  1XI1 A;  1X9S A;  4DWI A;  5J2Q A;  5FDL A;  1KTQ A;  4CJR A;  3HP6 A;  3DRP A;  1IG9 A;  4KHS A;  3KIO A;  3L2V A;  2KZM A;  1RT5 A;  3MEC A;  3F73 A;  4FJ9 A;  2Z1G A;  3KLI A;  4AH9 A;  4M41 A;  4FLW A;  3VQB A;  4KI6 A;  3MEE A;  4KTW A;  4W5T A;  4E3S A;  4J2D A;  5FRO A;  4W5O A;  3NDK A;  3ZSO A;  4FJ5 A;  1TK5 A;  3KLH A;  1J53 A;  3L2R A;  2GUI A;  4FM1 A;  4FLT A;  3TAF A;  3CM5 A;  4FLY A;  1VSM A;  2GBZ A;  3NAE A;  1QHT A;  4DFP A;  3QET A;  3RMC A;  4QCL A;  1KSP A;  3T3F A;  1HQU A;  5JS2 A;  4FZZ A;  5DK5 A;  1ASV A;  2OZM A;  3NGY A;  4DTS A;  2VG7 A;  4AHS A;  4E7K A;  4DFJ A;  3ZSQ A;  3QIO A;  3NGZ A;  4I2Q A;  1Q9Y A;  4PWD A;  3H08 A;  1VSE A;  4I7F A;  1TK0 A;  2VWK A;  3VQE A;  2OPQ A;  4NYF A;  3VQ5 A;  4CIG A;  4HCB A;  3ZSW A;  3BGR A;  4OKK A;  3V4I A;  3OYC A;  3KJV A;  3VQA A;  3IG1 A;  4B8A B;  3KD1 E;  4KTQ A;  2YV0 X;  3LAN A;  1GOA A;  4W5R A;  4DS4 A;  3OVN A;  3OY9 A;  1T8E A;  1QSS A;  3VQD A;  1W9H A;  4W5N A;  4DFK A;  1L5U A;  1JL1 A;  3LWM A;  1KVB A;  2BDP A;  3IRX A;  1BL3 A;  4RW6 A;  3VQ4 A;  3OS1 A;  2W42 A;  4DLG A;  3LAM A;  4ID1 A;  4CE9 A;  2G8F A;  3AVC A;  3AVN A;  4AHU A;  1HNV A;  2XY6 A;  3M8S A;  1VRT A;  1S1U A;  1QE1 A;  3SCX A;  3K2P A;  5HRN A;  3OYH A;  4DTR A;  3NF7 A;  1VSH A;  4KHN A;  1IKV A;  4E1M A;  2PYJ A;  2P5G A;  3AA2 A;  3TAM A;  3QLH A;  2KTQ A;  3WNG A;  1TKZ A;  1SUQ A;  3RTV A;  1T03 A;  3CM6 A;  3OYG A;  2KW4 A;  4CGG A;  3S3O A;  3DOL A;  3DRS A;  1SKR A;  1HYZ A;  1XHZ A;  1TAU A;  1G15 A;  5HRO A;  1HMV A;  4E7J A;  4BAC A;  4IG0 A;  1RBT A;  5KGW A;  1TL3 A;  3VQQ A;  3JSM A;  1N6Q A;  1VSF A;  3P5J A;  3K59 A;  4BDY A;  1NJZ A;  4RW7 A;  2R7Y A;  3WNH A;  1LV5 A;  3B6P A;  1UA1 A;  1RT3 A;  4BWM A;  1ZBL A;  3BDP A;  4IBN A;  4JS5 A;  5C25 A;  1X9M A;  1LAW A;  4O44 A;  1BGX T;  1SV5 A;  3LPU A;  4O55 A;  1LW0 A;  3VQ7 A;  4CHN A;  4Y1D A;  3LPT A;  4CED A;  4DSK A;  1B9D A;  4LH5 A;  1KFS A;  4EP4 A;  3ZSX A;  1IH7 A;  3L3V A;  3ZT0 A;  3PX4 A;  3AVK A;  4BDZ A;  1EXQ A;  1WSE A;  4CEB A;  2G8K A;  2HHV A;  3AO3 A;  1WSH A;  3O3H A;  3I8D A;  3NCI A;  4DQQ A;  1L3T A;  4F2R A;  1LWF A;  4HHT A;  1BIZ A;  3CFP A;  4C8K A;  3OYI A;  5KTQ A;  4MQ3 A;  4CJS A;  1TV6 A;  1WSJ A;  1RT6 A;  4DMN A;  1EET A;  1CZ9 A;  3AVM A;  3OYA A;  4C8L A;  4DSI A;  1LWE A;  1LW2 A;  1RBU A;  1GOB A;  3KKS A;  3P1G A;  3ZT3 A;  3ZT4 A;  4E1N A;  1JL2 A;  4CK3 A;  1R0A A;  4KHY A;  3NF9 A;  3M8R A;  4DQI A;  4XIU A;  1BQM A;  4O4G A;  2HHX A;  3U3Y A;  3S9H A;  1WLJ A;  1XC9 A;  4PUO A;  2FBV A;  4E7H A;  1D9F A;  1VSJ A;  3I0R A;  3T1A A;  3M8P A;  4FK2 A;  4CIF A;  3ALY A;  1TKT A;  4DQS A;  4CK2 A;  1RTD A;  1S6Q A;  3RMA A;  4UQG A;  3C95 A;  5HRS A;  3SUQ A;  3AVJ A;  1L3U A;  3VQ9 A;  4Q0B A;  4ID5 A;  3L2U A;  1S6P A;  1XWL A;  3PX0 A;  3HL8 A;  3PY8 A;  4HCC A;  5CYQ A;  1QSY A;  3RR8 A;  5FRN A;  1KLM A;  3HXM A;  3LAK A;  1RDC A;  1JLB A;  3VA3 A;  1HRH A;  3VQ6 A;  1GOC A;  1UAX A;  1TK8 A;  5HP1 A;  4WE1 A;  2DFH A;  1I39 A;  1VSI A;  4DTO A;  1Z25 A;  1UOC A;  1NOY A;  3OYB A;  4KKO A;  2VWJ A;  4M3X A;  1J5O A;  4DQR A;  3O3F A;  2HHU A;  3MAQ A;  1BHL A;  4W5Q A;  4CJU A;  2HHW A;  3DLK A;  4OGC A;  1N5Y A;  1U4B A;  4KRF A;  4FW2 A;  3ZSR A;  4JRP A;  3RMB A;  2ZE2 A;  4AHR A;  1S1V A;  4R5P A;  2HNZ A;  3KKR A;  2BE2 A;  3CFR A;  3B6O A;  4KPY A;  3HST B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...