2FCAA

The structure of bstrmb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
205
structure length
205
Chain Sequence
WDDFLAENADIAISNPADYKGKWNTVFGNDNPIHIEVGTGKGQFISGMAKQNPDINYIGIELFKSVIVTAVQKVKDSEAQNVKLLNIDADTLTDVFEPGEVKRVYLNFSDPWPKKRHEKRRLTYSHFLKKYEEVMGKGGSIHFKTDNRGLFEYSLKSFSEYGLLLTYVSLDLHNSNLEGNIMTEYEEKFSALGQPIYRAEVEWRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis TrmB, the tRNA (m7G46) methyltransferase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
total genus 65
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fcaA00
4MTLA 2VS1A 2OXTA 4MHTA 2WA2A 1WXXA 5K09A 5KQRA 3KR0A 5E2BA 4KRGA 2NXEA 4P7GA 4RYLA 1MJFA 3Q7EA 1G8AA 1KPIA 3KQWA 4YV0A 3VC1A 2OZVA 4E33A 1T43A 5T64A 3FUTA 3UJCA 1SVUA 1R8YA 1G60A 4GC5A 3K6RA 2CL5A 5CVVA 3THRA 4R8SA 2H11A 2HV9A 3GRZA 3PLAE 3X0DA 3HA3A 1JSXA 3OZRA 5E8RA 3SR4A 3T0IA 4EVIA 3BXOA 2O06A 3EVAA 3NVMB 3CCFA 3OFJA 5DSTA 3MCTA 3FTEA 3R6TA 4P7KA 4FSXA 2B2CA 5DT2A 2UYOA 4BY9E 3M33A 3OU7A 4PYMA 5K05A 1JG1A 1VP3A 3P2KA 3T7TA 3JWGA 2C7OA 4ER0A 1TPYA 5E1OA 2ZWAA 3U81A 1VIDA 4M36A 1NE2A 1DCTA 1RI3A 3SSOA 4EKIA 5CIYA 3EMBA 2I62A 1ZQ9A 4X1OA 1XDUA 2EG5A 5BXYA 2G70A 2P41A 3BGIA 3G7UA 3TOSA 5IKMA 3UJBA 4M37A 4FT2A 5CVJA 3SSNA 2AOTB 2IIPA 5DM4A 1ZKDA 3JWHA 4LWOA 1TW3A 4P7FA 4PGGA 3UJDA 2NXCA 3A27A 2XYRA 4E32A 2Y1WA 4QPNA 5E1DA 4YUVA 4BLWA 4WVLA 2OB2A 4YUYA 4V0RA 4ER3A 2ERCA 3UA3A 3LDFA 8MHTA 3BWBA 2PVCA 3A7DA 3B5IA 1RI4A 4C04A 5LR6A 5BW4A 4QDJA 5EHIA 3MAGA 3UJ6A 1VE3A 1G8SA 1RI5A 2C7PA 3KPJA 3LCCA 3B3GA 1OR8A 1Z3CA 4HC4A 4X61A 3HVIA 3LDGA 4X41A 3HP7A 4HSGA 2Y1XA 3EPPA 5EEHA 4AX8A 4OQDA 4Y30A 4QDKA 5K0CA 5KQSA 3NVKI 5FQOA 4E2XA 2UYHA 1B42A 1FP1D 1I1NA 1YFJA 3BT7A 3HCCA 4KDCA 3RODA 4PCAA 4KW7A 5HIMA 3MQ2A 3NDIA 3T7SA 2V74B 3DUWA 3M6VA 3P2EA 3OPNA 2IH5A 4ISCA 2AOWA 2FCAA 4A6EA 4POOA 3M6WA 4Y2HA 2AOUA 3HA5A 5DXJA 3IYLW 2AOVA 2OKCA 3SX0A 1WG8A 2GS9A 1G55A 3I64A 4QQNA 2FK7A 3G5LA 4YMGA 3HVKA 3M6UA 3LKDA 3B3JA 2ZLBA 5EC8A 4C03A 5C0OE 2NP7A 5K0EA 4OA8A 4RTRA 1I4WA 4LECA 4JXJA 4LWPA 4RX1A 5E9WA 3EVCA 3DTNA 3DULA 4PIPA 3EMDA 4R8RA 5EVJA 3UJ9A 4YUWA 1AQJA 1SQGA 3CBGA 3KU1A 3UJ8A 3OCJA 4Z2YA 2AN3A 3UWPA 5ICCA 2QRVA 2AN4A 5DX0A 4ER7A 4BP1A 4YUXA 1RI1A 1EQAA 4E2YA 1YZ3A 2UYQA 4RTNA 1IM8A 2GLUA 3GXOA 5GIOE 4RTJA 1Q0TA 5DM2A 2ZZKA 2HTEA 3OU6A 3ELWA 4GEKA 4U7PB 3MCZA 5HIJA 3V97A 2A14A 3EEYA 4FT4A 2YX1A 2ZIGA 4EK9A 4KDRA 4GOMD 3KQQA 4ER5A 4P58A 2AZTA 3P9CA 1QYRA 5CVUA 5ERGB 3FUXA 3GU3A 2WK1A 4F85A 4GOND 2JHCA 4PYJA 3UJAA 3FUVA 3H2BA 5EIFA 4ER6A 2NXJA 1JQEA 4LG1A 5FA5A 1EAMA 3BWYA 3KPYA 9MHTA 4E31A 3G2PA 1AQIA 4DKJA 2B3TA 3HNRA 3KHKA 2GPYA 3LGAA 4IWNA 4AZSA 4U7TB 4BLUA 3G89A 1NBHA 3EGEA 1SUSA 3HA7A 3M4XA 4KVZA 3KQYA 2Z6QA 2P3OA 3GO4A 1SG9A 1QAQA 4GQBA 3LCVB 5CCBA 4AZVA 3DXXA 5DX1A 4IV0A 2E5WA 2PLWA 3VYWA 4RVGA 5KYGA 1AF7A 3VC2A 3BGVA 4EMSA 1O9HA 3C6KA 2AVNA 2ZSUA 3FRIA 3HCBA 1V39A 4FS8A 2P3LA 4PYKA 5DWQA 5EMMA 4FR0A 3EVBA 2ZVJA 4FGZA 3I53A 3I58A 2PXXA 4FP9A 3LHDA 4XCXA 4OBXA 5LQKA 4OBWA 1VLMA 1KPHA 4QVGA 1QAOA 5CUQA 5DTMA 4C05A 4HTFA 3EGVA 3KPWA 3NWEA 2P8JA 5DRYA 5FA8A 3TM5A 2P7HA 3DXZA 4C4AA 1YFLA 4RTOA 5FCDA 4PYOA 2KW5A 5DSXA 1M6EX 1U2ZA 3GGDA 2G71A 4RWZA 2P3QA 3CJRA 3DOUA 3G2OA 3GDHA 1JG4A 1HMYA 2NXNA 1VBFA 1XCLA 3JWIA 1FPQA 3QOWA 3R0QA 5D1NA 2AOUB 2YVLA 3G2MA 3TR6A 2CMGA 3CJQA 3O4FA 4E2ZA 3PT9A 4RVFA 5EKUA 1WS6A 1ZGAA 3FPHA 5F2OA 1AV6A 4UOEA 4R6WA 2LD4A 2O0LA 4E70A 3MTIA 3JWJA 4FSDA 5K0GA 5H02A 3GIWA 3ELDA 3KQSA 5EZSA 1QZZA 3M6XA 1P91A 1NW3A 1X1DA 3Q87B 2VZ9A 1JTFA 2XVAA 4EKGA 2HWKA 1L1EA 3ORHA 3TRKA 3KPUA 5D1HA 3R9XB 3BGDA 1P39A 5FHQA 4RVHA 2QYOA 2PV0A 3KQVA 3GRYA 3FYCA 3I9FA 4ZTBA 3LBYA 1JG2A 3AY0A 4DMGA 2IBTA 4OX9Y 4PIMA 3G8AA 5CM2Z 3FPEA 3MHTA 1EG2A 2IDJA 2ZBQA 3B89A 2JHAA 3A26A 4V0QA 5ICGA 4EQZA 2XBMA 2HMYB 3PFHA 4QQKA 5DM1A 2G72A 2GA9A 4HRAA 3O31A 2YXLA 4HTFB 2O05A 3GWZA 2ZTHA 3P2IA 1L3BA 1ZHFA 1UIRA 3C6MA 3KPVA 2OY0A 3TFWA 3PFGA 2IDKA 2WA1A 2H00A 3IEIA 3DXYA 3FRHA 3DP7A 1P1CA 2ZWVA 4K6MA 2PJDA 5K0LA 3UJ7A 2ZBRA 3KQMA 3ELYA 1EJ0A 4MIKA 4KIFA 1DUSA 1NBIA 4E30A 5F2KA 4CKBA 1WZNA 2QRVB 3KR1A 1YZHA 3O7WA 1NV9A 4IV8A 2YQZA 3KR2A 4CKCA 1FJXA 2EJUA 2H1RA 3FZGA 5GM2A 4YUZA 5E9JA 1M6YA 3LPMA 3VSEA 1NW5A 1UWVA 5FWDA 5EPEA 3UZUA 2OPBA 5LQNA 3NJRA 2YR0A 2ZZMA 2QM3A 1EJ6A 5IH3A 3AJDA 5BP7A 5ICEA 2GH1A 3ME5A 3HEMA 1ORHA 3EVZA 3GRRA 3TMAA 3TQSA 2PWYA 5GINE 5HFJA 3D2LA 3SVZA 5E8JA 2B25A 3BWCA 2PXAA 5CD1A 4AZWA 1PJZA 3SM3A 1JSZA 2IPXA 3HCAA 2UYCA 1N7JA 2P35A 1H1DA 4B17A 3GRUA 4OA5A 1X1AA 3G88A 5FUBA 4C08A 5HEKA 5LQUA 2IH2A 3LECA 3EVGA 2ZFUA 2I7CA 2DULA 4GOOD 5P8WA 1DL5A 3CGGA 4P7JA 1SQFA 3P9IA 3FYDA 1NW6A 3C0KA 5E2AA 5ICFA 5K01A 7MHTA 3R3HA 4G56A 4X63A 1PRYA 3KQOA 4DA4A 1YB2A 1X19A 5K0FA 10MHA 2P1DA 1SUIA 3FUWA 1I9GA 4PYIA 2PT6A 2VP3A 3B3FA 5EKXA 3GJYA 2HR1A 2FYTA 1NT2A 2R6ZA 4QVKA 4F86A 1ZG3A 1R6AA 3EVDA 3TKYA 5K8VA 3MB5A 4RVDA 5DXAA 1G38A 1XDZA 4IKPA 4DZRA 5F2NA 2PX4A 3NMUF 3KQTA 2ZW9A 5EMJA 3LDUA 5LQRA 3DR5A 3LKZA 1Y8CA 2B9EA 2I9KA 1BKYA 3PTAA 2N47A 2VDVE 2I6GA 2PXCA 1WXWA 3EVFA 4FZVA 5CVDA 3TLJA 4RTSA 4GUAA 3THSA 3SMQA 2IBSA 5EIWA 1YF3A 1L3CA 4MQ4A 3P9NA 1F3LA 2BM8A 5CCXA 5M5BA 5JR3A 4NECA 3FUUA 4GBED 3G2QA 1R00A 2FPOA 1UFKA 3PB3A 3QOXA 4QPPA 4GC9A 3KQPA 3ID6C 2CKDA 4XUCA 1VL5A 5EOVA 1NV8A 5HIIA 3RIEA 4CXMA 3ER8A 1RJDA 2PY6A 2CWWA 1KR5A 3MERA 5LSAA 1KPGA 1KYWA 4XUDA 4RTKA 4PYQA 2JJQA 3A4TA 4M7RA 3GCZA 5HIKA 1TW2A 4L7VA 2ADMA 3DLCA 3E7PA 3OE4A 4DM3A 2HNKA 2BH2A 4DCMA 1KXZA 1IXKA 3EGIA 3FTCA 4C07A 2G8NA 5T6BA 5MHTA 3PX2A 1NW8A 1JTEA 2BR4A 2UZ4A 4DCGA 2ZCJA 5GIPE 1N7IA 4HH4A 4PGHA 2ZULA 3G8BA 2AN5A 2ZIFA 1ORIA 3MTEA 1Q0SA 3FPGA 3CC8A 2BM9A 5HILA 3P9KA 4YV1A 5B1SA 4BLVA 3GRVA 3AXSA 1BOOA 3OFKA 3TM4A 2PGXA 5U4XA 4AZTA 2VDWA 3SXJA 4PCLA 3C3YA 5EMKA 3LBFA 2IGTA 3LX6A 3OZTA 2GB4A 5JUWA 1JG3A 2FK8A 3A25A 2ZIEA 5K0NA 3T7RA 2P7IA 2AOTA 3DMHA 2EJTA 2K4MA 3GNLA 3HVJA 5EGSA 2ONYA 1IY9A 1XVAA 4ATNA 4KWCA 2B78A 2QE6A 3E05A 3BUSA 3SSMA 1WY7A 1XDSA 3A7EA 5C9ZA 2JH8A 5FWAA 5K03A 2XVMA 3FTDA 5LQAA 1BC5A 2PSSA 5GOZA 4CTJA 2NP6A 2OO3A 4PNEA 1JQDA 1RI2A 2AOXA 4RTLA 4HGYA 1M0EA 5EEGA 3TPZA 1MHTA 1XCJA 3M70A 4YV2A 5E1BA 2PX5A 3F4KA 3PS9A 4GOLD 2O57A 3EEOA 4AUKA 5DPMA 3ERCA 3BZBA 2O07A 3DMFA 2ESRA 3BKWA 2QY6A 3S68A 2C7QA 3OE5A 3FPJA 1L9KA 5DX8A 1RJGA 2IP2A 2Q41A 4RTQA 5LQJA 3DH0A 4RTPA 4WXHA 2ZZNA 3MGGA 4PONA 3REOA 3P8ZA 3LSTA 2YXEA 2PT9A 3B7PA 1QANA 1ZGJA 5EZQA 1R18A 5KVAA 3RW9A 4CKEA 4M38A 4RSRA 5DTQA 1F38A 3ANXA 5C1IA 2PX8A 5FTWA 5E1MA 3CJTA 2G1PA 5DLYA 1FBNA 1VPTA 2ONZA 3V8VA 1KYZA 5HOQA 3IHTA 5GP1A 1L3IA 4MWZA 5EQJB 5HZMA 2OBFA 2F8LA 5KS2A 5K0BA 5DM0A 3ER9A 2C7RA 2AS0A 3PVCA 2DPMA 2EFJA 2OB1A 5CVEA 3UA4A 5EMLA 3AWIA 3ELUA 3UBTA 5E9QA 2PKWA 1EIZA 2YUIA 1X1BA 2AVDA 3NDJA 1D2GA 1D2HA 2YXDA 3P71T 1XXLA 1R8XA 5LQCA 3NW9A 2Z6AA 4OQEA 1D2CA 2JHPA 2BR3A 3CKKA 3KKZA 3BWMA 5DTRA 2IFTA 2GAFA 3I5UA 1R74A 4RV9A 3UFBA 4R6XA 1FP2A 3E23A 1INLA 3P97A 4XUEA 1HNNA 3QV2A 4GF5A 4YMHA 4KIGA 4CWAA 4H0NA 2XYVA 5FQNA 4X60A 5BW5A 3AXTA 1BHJA 2ORED 5FHRA 3TKAA 4QTUB 4PINA 1QAMA 2Z6UA 1RJEA 5EG5A 3NTVA 1G6Q1 3K0BA 3HM2A 4PWYA 4PYLA 4HGZA 1KIAA 3BKXA 2FHPA 3HVHA 3PX3A 2PWPA 2EX4A 5FADA 4O29A 4CTKA 1O9GA 1VQ1A 2AR0A 3LCUA 5FULA 2BZGA 3LL7A 3EVEA 1VP9A 2P40A 2NYUA 3CVOA 1NW7A 3HTXA 1NKVA 5K0JA 1XTPA 3IV6A 3NWBA 2PX2A 5GM1A 5T67A 3DMGA 1N2XA 1JQ3A 4E2WA 3E8SA 4PYNA 3HCFA 1O54A 4QTTB 4A6DA 4RTMA 2ZBPA 4R05A 2VDUE 3OZSA 2YTZA 2R3SA 1XJ5A 3C3PA 1KP9A 2CMHA 3R24A 4HG2A 2XYQA 3OU2A 1KHHA 3HCDA 2IH4A 1P1BA 5DRTA 4DQ0A 2PBFA 2V7EA 5GWXA 3KR9A 1JR4A 5EHGA 2JG3A 4C06A 4BP3A 3WSTA 1X1CA 3SGLA 3L8DA 1SKMA 5G02A 3FPFA 3FTFA 1YUBA 2JH9A 4DF3A 1RJFA 3HCEA 2NNWB 4F84A 3DLIA 2FRXA 2OYRA 3G5TA 2BR5A
chains in the Genus database with same CATH superfamily
4OUDB 4PTLA 3GA5A 2WA2A 5KQRA 1ZHHA 4KRGA 1P74A 4BMZA 3PPVA 5FNZA 5A4JA 5LIRA 2QQ5A 1CQWA 3AKCA 1SHKA 1I9CA 3AERB 5J59A 1W52X 3QU5A 3WGIA 4I6EA 1N3BA 3ZDYB 2C42A 4URHA 2C54A 2IODA 2QLTA 1AS2A 2HPVA 4OGKA 4GSYA 5FF9A 4GE0A 1L5WA 1JDBB 1Y1KE 4FFLA 1WAMA 3O1LA 2O6LA 1IC6A 4JKIA 3FKSA 1D07A 3NPAA 4V1CA 3UJNA 1G20E 1B43A 3R6TA 5GONA 3MQFA 3EIUA 3L41A 2PRJA 4MINA 4FSXA 3UK6A 2J8ZA 4QUHA 5HTKA 5ITZB 1B6RA 3GAAA 4JYMA 1MU0A 4JENA 3QX8A 5IT4A 3FUCA 4HFMA 4TXJA 3WK8A 2ZWAA 4X1KA 1RVV1 2OL4A 3X1WA 4OHXA 4O2LA 4RQUA 4GL2A 3OECA 3TCXB 2QUZA 5CB4F 2RGUA 1ZM3A 4WOKA 4HLNA 2OFPA 5EWMA 3B7WA 3EXIB 2YJGA 4KIWA 5TEVA 5JATA 1WQ4A 1YQEA 1EE2A 1KEWA 4KBFA 3RR2A 1JLLA 1IIRA 1A7JA 1NL3A 2J7PA 2CV0A 1I3KA 1XZBA 4M1OA 4PAOA 3O0TA 3RTAA 4AY3A 2BFAA 3JWHA 1ZVJA 5JXJA 5GMOA 2FOLA 3WLTA 3DVAB 4CR7A 4UCXA 2UZ1A 1OTXA 2ZIAA 4ZKEA 2NXCA 3W9BA 1MX5A 4UBKA 4YUVA 3ND7A 2XMRA 4WVLA 4KKVA 3K0FA 4I4IA 4BXOB 3E58A 1IB6A 1LKZA 1SR8A 4RIGA 4AWAA 1L5OA 2PVCA 3IDQA 3EHDA 2CV2A 1ES9A 3AY7A 4GICA 1JJVA 2O7NA 2UZIR 3MWGA 4QDJA 2B7LA 2I3ZA 3QELA 3EH2A 4H7DA 4O4LB 4EJSA 3NXKA 3W7AA 1F2TB 3WAKA 3PTZA 5EE9A 2BI7A 5KQSA 2A9VA 3FWHA 4MYDA 4NH0A 2ZRPA 2IPMA 4HGNA 4O3FA 4B71A 1T9HA 4BRZA 2DUNA 4EENA 2JLZA 4KR6A 1QE5A 4BGIA 2IYAA 1SBZA 2QT9A 4DR5B 3AL2A 3HKCA 2ANCA 2OQVA 4DCVA 3K31A 2X3FA 1TU0A 1RZVA 4IDOA 4POOA 3QPVA 2W2KA 4FBMA 3L7JA 1KJ9A 3NGMA 3J81k 4MQFB 3I64A 2NTEA 3EQZA 1JHUA 3A1SA 1Z47A 3L1UA 4GWGA 3CIOA 1G4HA 2TECE 3LKDA 1E6KA 4PSUA 4KPEC 1YE3A 3DBVO 4PG6A 2B8WA 3CA8A 3IQGX 2NP7A 5MF6A 1J0DA 1I4WA 4JH0A 3QU2A 1G5QA 4RX1A 3OIDA 1BXZA 1H8ED 2EF0A 1PNOA 2CF5A 3EMDA 3FCUB 4Y6QA 3ICPA 2DGDA 3G6WA 2JCSA 3FCXA 3OOHA 1D8AA 2QI9F 3T7CA 3ZHZA 1TZ2A 1MRZA 3PITA 2Q4TA 4K6GA 2CLDX 2EG9A 4RXUA 4Q4DA 1B41A 1RI1A 1YR1A 1NM5C 3KAPA 4QXAA 3CLRD 3Q40A 3R7NA 5HUJA 3B52X 3RG8A 1P2DA 1TUBA 1SUPA 1NN0A 2WAXA 3KVYA 1Q0QA 5IUKC 2ONCA 3IP7A 4HADA 2QZ9A 1TF2A 2XB9A 5CT6A 3HCWA 4Y2RA 4L3OA 4NU5A 2XF8A 1J0BA 4D98A 2DBVO 1K4KA 4MIOA 3WGVA 3K5PA 4YN3A 5C8ZA 4ZEWA 5ERGB 3LGSA 4BJ1A 4K28A 2CVFA 2OORA 3QIVA 1RM4A 1MN6A 2J3QA 2JHCA 2JZCA 1RLUA 2X5JO 2QUBA 5EYPB 3BWYA 3W0LB 2O8CA 4IWNA 4WXMA 3WGMA 4L3WA 3JW8A 1NIJA 3JR7A 4U7TB 2OFFA 1NBHA 2VBCA 5F1OA 5IVDA 4QC2A 4BQEA 4YH1A 4ZI2A 4PZEA 1X74A 3N2KB 1GNTA 1J09A 1H6BA 1RMYA 1YDGA 2CBGA 2OP0A 4IJUA 3O8OA 3AO0B 3WJ2A 4A8JB 3LLSA 1W2HA 2O9JA 5DX1A 3PD7A 4LPKA 5BN3A 5JSFA 2C7VA 2FR0A 2CK3D 3JD1A 1PSZA 3UC5A 2XQJA 3C6KA 3DL7A 3KSMA 2V6BA 4DMFA 4WZBB 4GYJA 1L4BA 5JSYA 3CM0A 3F6PA 4H1HA 5MDHA 3L82B 1T8SA 4I3FA 5GJWC 2EV9A 3V48A 3QM1A 1SCIA 2JEYA 2X0RA 1YBFA 3WLPA 2VHUA 1ZCJA 1OFUA 3NGLA 2Q1XA 4N6NA 1GARA 1VPEA 5FEUA 3EGVA 3DOOA 2WOOA 1CC1S 4JLPA 3LWNA 4JEMA 2P2SA 4RTOA 2UUCB 1G7CA 2DWCA 4MUMA 5G3ZA 1XA3A 1H4TA 1MIOA 2A92A 2GBGA 2ZSHA 2V0GA 1B8OA 1DCMA 3JQDA 1XNJA 4YAJA 2QTWB 4HDQB 4ONEA 3T0FA 1NOJA 1RPTA 4WJLA 1HMYA 4H0CA 1XCLA 3R0QA 1W9MA 2G17A 3MOGA 5HSGA 5C31A 2WFZA 2PGAA 1U0JA 4RVFA 1TJ5A 2D5IA 3B3QA 3ASVA 2ZJ1A 1AV6A 1Q17A 3TQIA 3S2YA 1D6MA 4PLTA 5EE0A 3HDTA 4PZDA 5FWXA 3SNHA 4C1BA 3VBEA 4KB5A 3RSZA 2V0CA 3FPAA 1NW3A 1G6HA 3DT9A 2CCKA 1I4OA 5DWVA 3TPFA 5KTOA 1G3QA 3DW3X 3ZXUB 5LDGA 1L1EA 1TM4E 4GP9A 4YRTA 3F67A 5D1HA 3K6JA 4FOLA 2CDNA 4G07A 4JFRA 4PHHA 2NT4A 2RHOA 1Y5IA 3GG2A 3GRYA 1T0IA 3AY0A 1ENZA 1XEWY 3CVWA 1QF6A 1DEXA 5ALRA 3B89A 2DFLA 1QC5B 5B55A 3IEMA 1WU8A 1GZ7A 2EBHX 2HMYB 3PPIA 1VJDA 5M3BA 3D3KA 3EGDA 4Q9JA 1RLJA 3LBNA 2ZRAA 2PLAA 2ZE8A 3HYLA 3D6HA 3P2IA 3Q5DA 4YASA 1HORA 1W44A 1P2UA 2LCQA 4HGOA 2QD2A 3WAJA 3H2IA 4RGYA 2FA9A 1IJBA 5CP8A 2WU1A 1O0CA 4QTXA 3C8HA 4TV9B 4R71A 2WWTA 2O1XA 3TO5A 1R0WA 3MLAA 3AOEC 1F0NA 3I2FA 3MLEA 1S2OA 2JD0A 2O8BB 4MS4B 4Z7OB 3V9AA 3IDAA 4YRGA 5AJVB 4CKCA 2DERA 2QN1A 2H52A 2UXBB 3V46A 3FYUB 4YAGA 1MFZA 5EJ8A 1VPLA 2ZYGA 3K8QA 2HK8A 4K8RB 4MVJM 1OI4A 4B5LA 4G0VA 3AHIA 3N9IA 3EA4A 5SY9A 3QE3A 2VDQB 1QFZA 3A37A 2OPBA 2XZLA 4UMEA 1DMSA 4LDJA 2XVXA 1C0LA 1V6SA 4RM2A 4KUEA 2QVYX 3K94A 5DCYA 4PZLA 4DRXA 4AX4A 2Q3BA 1G21B 2AN1A 5J4KA 3GL9A 1PT6A 3GLFE 1PJZA 1EQ2A 1ULSA 3NHAA 4ES6A 4LBVA 4Y9DA 1H1DA 3FG9A 4CL8A 3DZIA 5AHWA 5CR9A 1E2DA 3ZCVA 1X15A 5C3UA 2CV1A 1XNHA 2RIPA 2I7CA 4R31A 5G4LA 4DUZB 3PFCA 3W8FA 1U2TA 4MV3A 5F2EA 2FPXA 3D0KA 4E2FA 3KYDA 1SHLA 2J4FA 3EDOA 3L77A 2PZEA 5K0FA 3F5QA 4NZ9A 2FEMA 2Z2KA 3B6JA 4MCHA 2VP3A 1JEJA 2OD9A 2QGZA 4C14A 3PDHA 3K0AB 1S8FA 1E6UA 1HKUA 3NDPA 4LGCA 4Q9DA 3T7JA 2Q0HA 2Q4EA 3FJOA 4N7JA 5CFRA 2SBTA 1SXHA 2BAGA 2NU8A 2CKMA 3MGKA 4EG3A 1LWNA 2GKSA 3PSAA 1FX0A 4AKTA 3S2ZA 2OKGA 3G8DA 5F2NA 5JTTA 3ZU6A 3MUOA 4RLQA 5LZ5A 4G41A 5EXDA 5HS4A 5ENDA 3DR5A 3I4CA 4KX3A 2B9EA 2POCA 2WU4A 2N47A 3RC7A 2YWHA 4FLFA 4D9KA 3UMBA 5C1OA 3IS3A 5I5EA 3DDUA 4EB6A 1RWVA 2RC5A 3D7NA 4KBYA 1KFCB 4CI9A 1YF3A 1MB9A 4LDRA 4RETA 3O4IA 4YP7A 1IY2A 4Y2UA 5JECA 4F9FA 1DARA 2SKCA 2ECFA 4HK4A 1WMSA 1W88B 2QMQA 4U7JA 1RPJA 2HSWA 4BTVA 1HI9A 3IAM6 2I65A 3RIEA 5LA6F 2PGNA 4CXMA 2DXIA 2JGDB 4S0ZA 2GUWA 4E94A 4Z0HO 1KETA 3G2IA 2QN8A 3KQHA 3Q8MA 1NY5A 3GRKA 4XUDA 2VUUA 3R3ZA 1LNQA 1VHTA 4PYQA 5AXDA 4PXYA 4OUKX 5FBQB 3O2NA 1E4VA 1RBMA 1TW2A 5K6RA 5C53B 3V2GA 4MR7B 4KYTA 4OSOA 1FQJA 5CVTA 1VBKA 4IYJA 1VXOA 1OW3B 2Z83A 4HGQA 3FZQA 3MSXA 2Q2WA 3GLRA 1SHJA 1C5KA 3KJGA 2IWRA 5A5GA 1TCCA 3RBZA 3WGQA 3IPXA 4QUGA 3DEZA 3GRVA 3R5KA 3TIIA 4D5EA 221PA 3G2HA 3HKDB 3N75A 4MUGA 1H8HA 4JMPA 2FUG1 3C1OA 1EFHA 5F77A 5LQMA 3NBQA 3GA0A 4PCLA 1XJQA 2VZ8A 3GLIA 1EWQA 4RZHA 3BPSA 4CQMA 3NVKI 2ZREA 2R96A 3RAPR 3CG0A 1N5LA 2XA9A 4PQYA 5IVIA 4WBNA 2ZBGA 4ND2A 1DQPA 4XR4A 4HX2A 3PT5A 3FWZA 1LZLA 3A6JA 4IXTA 3B1XA 2ZYWX 1T8PA 3JQ9C 2F8MA 4KACA 2QE6A 4U1RA 1G59A 1M33A 1GM5A 1RMQA 5CD9A 4U3JB 3QU4A 5D00A 1HRKA 1YKFA 2H2AA 3GMDA 3HLTA 1RKXA 5CYOA 5H59A 5CA0F 5K03A 4YDSA 3NHPA 2V0NA 2IHJA 5DNWA 5CA1B 2CL6X 2HCRA 3GI1A 4FFBB 3PJRA 1UF9A 2ZI7A 2R8PA 4KLAA 4ND6A 4RDHA 4B6GA 1ZWLA 1KJQA 4TT3A 1TZJA 2OVBA 2VF2A 1KSGA 2PO7A 1OWPA 3E82A 3KYCB 2CB0A 4AJIA 4NPAA 1I6MA 4N5MA 3WHLA 1ZPDA 2F1OA 5J2TB 2KB0A 3CX6A 4JBGA 3U4CA 3WGKA 1QVZA 4GLFA 4A73A 4ZAVA 3H7AA 4BNDA 2HB6A 4WSOA 3R8FA 3GCWA 3HJNA 4N3GA 1J6UA 2V54A 1GFWA 4OAQA 1PV1A 4ZQFA 5ADWA 4DCOA 3N74A 1R0RE 3RW9A 5IM5A 1TNDA 4AO7A 2WZCA 1TT5B 1K68A 1V8PA 2XDYA 2QJFA 1T5IA 1IJEA 1DQZA 3DBIA 3N8IA 1XHLA 4FZ3A 4HJXA 4IR7A 4TV8A 2L19A 4FILA 1NDQA 1DZIA 3I12A 2PUHA 1OX4A 2ONZA 5JYBA 1FYDA 1K4YA 2Z9DA 3I73A 4FCTA 4IDFA 3F90A 5CDFE 4N5IX 2F8LA 1OGJA 2WJZB 4Y9TA 1Z7GA 1KOGA 4QJIA 2B4KA 2ZJ8A 3AB7A 2R44A 5U4QA 2CVOA 2Y4OA 3P0HA 1UBSB 4Q3EA 2O8NA 1A5ZA 1OMOA 4XX0A 5E9QA 3HO8A 3OWHA 5SY4A 3GFVA 2WJ3A 2QUKA 2W93A 2QMHA 2QQFA 4N3AA 1JRLA 2HHJA 3G8YA 3RU7A 5KYXB 4JYZA 3FNHA 2BR3A 3TVTA 3G79A 4JU8A 5KX5A 1NFRA 4IUDS 4N1AA 1AQNA 4JR1A 1V3VA 2XNDA 1MO2A 4A1OA 5IDQA 3AQIA 2IS6A 3GJ6A 4Y1EA 3UVEA 2C8VA 5C1PA 4H0FA 1JU3A 2E48A 5AKGA 2XYVA 2W00A 4DY6A 5JZOA 4P84A 2PPVA 1BW9A 2F43B 2QA5A 3PXGA 4ZQHA 3QF7A 1MG0A 2IU4A 1TB4A 4E22A 1QAMA 3L8FA 5HGJA 1W30A 5I47A 5JRJA 1HDEA 1BWQA 3IMCA 3JQ8A 4ALIA 4P92A 4L6CA 4YP6A 2QLNA 4QBTA 3VHXA 1LI4A 2DH5A 2FHPA 1R10A 3JS5A 2CBZA 4G97A 1U7ZA 2W2OA 2GETA 1UDRA 4N3NA 4O29A 4XYGA 5IM4A 4QFMA 5EZYB 2NPFA 2GN0A 3H5TA 4KO2S 5LU8A 4YX9A 3C70A 3R75A 4AWXA 3QLVA 4JNCA 4IJKA 4TYMA 4UEQA 1X80B 1EXWA 2A84A 3QSYA 3C4QA 3OZSA 3R6GA 1M1YA 5IAGA 4HNSA 1HF3A 3IP8A 4XFJA 4P1ZA 2BEKA 3CW2A 1WCIA 3EIFA 2XYQA 3RQSA 3VR5D 2C82A 1R6XA 4Q15A 3OLXA 1UWLA 4RK1A 2HK7A 3D4NA 3KR9A 5EHGA 1KMNA 3SLKA 1CIVA 3SBXA 1Z5GA 3DKIA 3GGPA 3WSTA 421PA 1X1CA 1Y5LA 4KWIA 4CCAA 2G25A 2GWHA 4LGVA 4ALKA 4MP3A 2GILA 1U90A 1V9CA 2B99A 1K6MA 2BHNA 1P1HA 2DWPA 2ORWA 1BVUA 2OCPA 5ERXA 2BR5A 4JUFA 2YNMC 2HCFA 2XITA 4GOJA 3E0XA 3B53X 3BMOB 3EIOA 4NONA 4GZMA 2W6NA 3O8QA 2QNIA 4L72A 4CODB 1NZDA 4B3TB 4P7GA 3KKLA 1J7JA 3KFLA 4DMKA 2P79A 1XKLA 4JVOA 2IW1A 1V5EA 4W9NA 3MFYA 4GXQA 4TUYA 4S1WA 4S3MA 3BF7A 2PMDA 1OZHA 1FPMA 1QG4A 3ISJA 5CB4A 2YHSA 4R8SA 5A7GA 4LVUA 1LDYA 4AKIA 2V7GA 1G6OA 3BRWA 4H4EA 6YASA 1Q74A 3LD9A 1DTWB 2R4UA 2VSXA 1XG5A 2WZDA 3NTOA 3R3XA 1DC4A 1FFHA 4IRMA 2YFQA 3DZDA 4MARA 3FGNA 1Z5VA 4HBZA 1KFJB 2OV4A 5TRTA 7ADHA 3P2KA 5K05A 5KMGB 4M1MA 1RQ2A 3JWGA 5TXGA 1UAAA 3LXUX 4K1LA 3VDMA 2P2DA 4UEOA 1GV1A 2PX0A 1VIDA 2W6ZA 4OQZA 2EAUA 2AR7A 5FBLB 5K8IA 1CLEA 4XGNA 3UMFA 1BXRA 2JH3A 3EFOB 3ADKA 1I33A 3K9LA 5AUQA 5DGDA 4D42A 1RQ7A 5DYGA 3ZXIA 3TAUA 2O7RA 1UBTS 4X94A 4OSEA 5B36A 5ITWA 4ZVPA 5B3AA 1K0FA 2ZP1A 1CUFA 3F9IA 5IMBA 5JAIA 4KFRA 3ZZ1A 1OROA 2F64A 3D3WB 3ZE0B 5BW6B 1G21E 1O77A 4RJKA 3MPUA 3UJDA 4D79A 1I7QB 2QI9C 4N40A 4KLRA 1YZQA 1YXMA 1LI7A 3TK1A 3W3AH 4RGBA 3WADA 5AKXA 3CSSA 3SF8B 4GKJB 5KSZA 2XBUA 2BYTA 1Y82A 3VR5A 1V1MA 1G8SA 5K7SA 4EPYA 1J8DA 2P4SA 2QJTA 3DZ8A 3KV3O 1V6CA 3PP8A 3JARA 2JAUA 2XTNA 2DB3A 3AV3A 4HSGA 1ZICA 4BLOA 2K7FA 1E1KA 4XB6B 3LXXA 4N39A 5HF9A 1GGKA 1U9CA 1G41A 3HJRA 3SD7A 3BMNB 1G8FA 4XQ9A 3S2SA 4IDEA 2GI4A 4PCUA 3G2JA 1BD4A 1YQ9A 3CO5A 4JP5A 4XSVA 2O0KA 3RBAA 1CR1A 2Y1FA 4CDNA 1FRZA 1XP5A 3C5EA 1P17A 1L5YA 3H1BA 3GGSA 3KVOA 4JDPA 3BXEA 1NI5A 4IIGA 3PUJA 1KEUA 2AOUA 2VH5R 3BIOA 1RR6A 1XQYA 4P3YA 3M6AA 4N82A 1G55A 1TZBA 1C8VB 2WF6A 4XYBA 4LF8B 1T5DX 5EC8A 2HRDA 3CZ4A 1YIOA 1WUHS 2AFIE 7REQA 5LYJB 2EZ9A 4E88A 3ECCA 3NQ41 4AF8A 2R1VA 5F9MA 4D41A 5ABPA 5D3MB 4JP2A 1H4VB 2YRFA 4TV9A 1AQJA 3HJAA 1SBTA 4C4YA 4F46A 3VR2A 2WPDD 4J6FA 1CX9B 1FCJA 4GSLA 5FTMA 1DXQA 2E4WA 3MBOA 3KSAC 2UYQA 1NVVR 1WD5A 2XUJA 1UUFA 4XIIA 3A1FA 3CUVA 3TLZA 2F3QA 1QB8A 2HEGA 3UT5B 4DT1A 4S05A 4GEKA 1W7AA 4RADA 1ESEA 2YZ2A 3PHHA 4NE9A 1QK3A 1GY8A 1Z0AA 2AZTA 2P9JA 2VJOA 1RE0A 2Y2UA 3ETNA 3PVZA 4Z6KA 1FJ2A 4Q7EA 3IMKA 2GDJA 1FDRA 3IVMA 1MT0A 5I9MA 3IQFA 2VH1A 2PMFA 3ZHTA 4BIMA 5K3DA 4EHKA 1BFUA 2YUTA 4HEJA 1BHQ1 2B3TA 3AI3A 4IGEA 3TW8A 3LG2A 5BMVB 3PQ3A 2ZITA 1PWHA 3WKBA 2XUZA 1G1AA 3G89A 2GF0A 3L4SO 2B5WA 2G67A 4HAZA 2QORA 2NO9A 4OI1A 5DB4A 3GEBA 2H65A 1XF1A 1U4NA 2G82A 3EZ7A 1Q3TA 3QX9A 4RVGA 5KYGA 3PDIB 4M1WA 3QVJA 2Q1WA 3A6ZA 3MJHA 1YVDA 4RL4A 4EMSA 2PAAA 1R4ZA 1YZGA 3DBLB 5CT4A 4FYWA 3VSBA 5BNZA 5DW3A 3AHDA 2WE7A 4XVQA 2QYTA 1QS0A 3CPHA 1XPRA 3TG2A 1WZUA 2X1LA 1UAYA 1FX0B 4IH9A 2BKLA 3CX8A 4H3HB 4QNNA 1I4DD 2GD6A 3OPXA 4PLWA 4W5WA 2PUGA 3LW7A 2JAWA 1JHZA 2NN3C 4LRUA 3CH5A 3L0DA 1GZUA 4N8SA 5FAXA 4DLZA 3ZHYA 2WD7A 4B74A 1C1XB 2FRDC 4G1FA 4KIJA 3UWOA 4ITUA 4L8VA 4RWZA 1J33A 4LC9A 4GT1A 4TTSA 2Y67A 5INTA 2CXSA 4IUBS 4CL2A 1GTL1 1W19A 2Q5OA 2PM8A 5ARBA 2CMGA 4E2ZA 2OGTA 1L0BA 3QJGA 2B69A 1EE9A 2PSFA 4NJOA 4HXFB 4MUJA 4MW6A 5HE9A 3W4JA 4B0OA 1N25A 1T9GS 3MTIA 4X9XA 1C3JA 5H70A 4B33A 4U6NA 5K0GA 1C0KA 1ONNA 1TZMA 1XKXA 2DKNA 2ZR9A 4PRKA 4F93B 3P9YA 2EBWA 3SDBA 3OMLA 4Y2VA 3L4JA 4L22A 1XELA 3AKEA 1N92A 1KYQA 3G9UA 1EVJA 5DTEA 3A06A 3K72B 4J1NA 5BV2P 3S7ZA 1Z4JA 1WMBA 1JFRA 4B8ZA 4GZ3A 4O33A 2ZIXB 5AI6A 2C2BA 5G1PA 3CW9A 6REQB 2IBTA 1EG2A 3V1TC 4LRYA 1NSYA 2G08A 2HA5A 1WDMA 2VSFA 3ZDRA 2XBMA 3OOWA 1XZEA 3VTZA 4JJEA 4MKFA 1LDEA 2ZSAA 2YXLA 4BECA 1WUKS 2PZAA 3OOSA 3OQIB 3HGTA 3MBKA 5ILGA 3GUCA 5D85A 2QTNA 3R09A 1XFDA 4CQJA 4F4DA 3CG4A 3OUZA 3I45A 3BH7A 3PNVA 1XQ6A 1E1LA 2P62A 2ZAMA 2H00A 3RSLA 2NIPA 4Z86A 2GO7A 4EHAA 4A23A 1KAGA 2VNAA 3UJ7A 3AEUB 1EJ0A 1JEQB 2C8LA 4J29A 2XRYA 2Z04A 4PC3A 5KYWB 2O5EA 1F60A 4TKVB 2YIJA 2QRVB 3ZK7A 8GPBA 5ELXA 1NNI1 1SXPA 2YQZA 4G1CA 1ADYA 4H7FA 2DPXA 2WB4A 2BKUA 1NJGA 4BMNA 2HV8A 3ZIUA 2BFMA 5B57C 5A5FA 1F48A 4LJ7A 2CJXA 3GZJA 2MSWA 2DKFA 3NJRA 3P5SA 4KXLA 2OHVA 1EJ6A 5AFSA 1W36B 1TQHA 5AP9A 4B2YA 2WHYA 1PDOA 1HYHA 2BKAA 3MMSA 3ICEA 2BFEA 1PL0A 3PPYA 4O2AB 5HFJA 4EI7A 2ZPAA 1ECPA 5E8JA 4Q9NA 4TX1A 2H7CA 5K0ZA 3F47A 3PXBA 5EZ5A 4DV4B 3GEPA 1JBQA 4B3GA 1YZVA 4FGLA 3WZLA 1CEXA 1H1TA 4LXIA 3UXMA 3WMRA 5KNBH 4HKTA 1QONA 4G2TA 4N9WA 4PQEA 5BN4B 3ZDAA 2VP2A 5DK4A 1AK9A 1CS4C 1HFJA 5IZCC 3ETLA 3D4PA 1P1RA 4H4DA 1ZAKA 2OFXA 3RADC 4G56A 3HWWA 3KQOA 3KRTA 2H59A 2BJHA 3LFHA 2WNIA 4RQTA 2NUPB 3QYAA 3V4FA 3QY0A 4IJ6A 4F4JA 1VKNA 2YJZA 4TV8B 4MV8A 3JQGB 4OX9B 3TQOA 4LXTA 2WUWE 5K3AA 3DEIA 5DIZA 2AMVA 2B8NA 4TLAA 2WWHA 4O02B 1T9GR 2I0FA 5K51A 3T7KA 4NFLA 4H18A 2ATIA 1QHSA 1T0HB 1WUJS 2V97A 2O23A 3CEHA 3IB3A 3W34A 4G4SO 3AEKA 1GSAA 3NHSA 1ODJA 5JWOA 1E2FA 3C7KA 1A3CA 2EQAA 1BOFA 1ZKMA 3OOJA 2XMDA 2ZM5A 4CCYB 1TK2A 3K8YA 2XUDA 1QZ3A 4Q34A 4OM7A 1WB6A 1X0VA 4KNYA 3SMQA 1IHYA 1IU9A 4II7A 4JI6B 4DJJA 5CNKA 1F3LA 3CLRC 1B73A 1T1SA 5CGQB 5F5NA 4CPDA 1CB7A 3KWJA 1FLDA 4CT4B 1GFIA 4EA7A 1MKYA 4FNGA 1KO7A 2OV8A 3W2GA 1N6LA 1II9A 2IYUA 2YIVX 4O4IB 5EIBD 3QG1A 3F8SA 3NWJA 1RZ3A 3PR1A 4NLLA 5JPCA 1Q83A 4MW1A 2EL9A 5DW0A 1PNRA 2Y76A 2VVTA 5LSAA 1PVVA 2DETA 3E48A 1JV2B 1D2EA 3CZ5A 4YXWA 4DLNA 4ZIRB 4RTKA 2MMGA 4MZXA 5I45A 1T3HA 1TA0A 2X6TA 3UFXA 2EHJA 3E7PA 2D5BA 3I52A 3SC2A 4BB0A 4CM8B 4KR3A 2JLVA 3KJXA 3GFSA 2DR3A 2VJPA 3EE6A 2EGGA 3KLPX 3NKLA 3O38A 4Q12A 5HFAA 4KR2A 1AN9A 4LZPA 5C46F 4I9HA 5KKNB 3PFWO 4ZVNA 5AQ1A 4TV8F 3II6X 4HXYA 4X1IA 5EJ9A 3GFOA 4EJ6A 3EOBI 3GEGA 1U2RA 3TEJA 5HZKA 5K3FB 4BVFA 1VIAA 2HBRA 3VKUA 1E6LA 3OSZA 2SCUB 2J3MA 2D3WA 5D5QA 1QH1A 3B1VA 3CTMA 4YECA 1C9DB 4CKWB 4E13A 1KAEA 1WCIB 3D6MA 1V3UA 3C7AA 2QNRA 4TWIA 3Q2KA 4D44A 4RGVA 2X0DA 3KB1A 1TD9A 1E4OA 4G0QA 2ZRFA 3BRSA 3D1VA 3IIMA 3TGWA 3EZ6A 4JLDA 2XVYA 1BGWA 2RK6A 4XSHA 1KKMA 2FFBA 5TPWB 3ZGXA 3TS1A 3OE7A 7MDHA 1FMCA 2AE2A 1IG0A 2Y1DA 5E7MA 4BNZA 3OURA 2R65A 3D6AA 2AQIA 4TS4A 1GKYA 3I0MA 2F00A 3PLRA 3NT5A 4MAAA 3AZOA 1AT1A 3QPCA 3UMSA 1QBKC 4MQEB 1QU2A 1Y6GA 2E6KA 1Q7EA 5B1IA 2IYZA 1M76A 1BHO1 4M9CA 1CZKA 5AK0A 2OO3A 3N8GA 4MR9A 1HT2E 1XK7A 4CL0A 3PGLA 4G5FA 3BSSA 3DGEC 1MUUA 4Y6OA 3LI2A 1II8A 2X7HA 3NHUA 1DIOB 3P26A 3HPRA 5IM4F 1EGAA 3PD0A 3RLIA 5JEEA 4J9VA 2B30A 3A6HA 3U13A 2JI9A 1W5TA 3VR4D 1FFEA 2ZRIA 3EN0A 1SVOA 4IEIA 3RHSA 3W5BA 2AMLA 1SXJE 5J9FA 2ZI5A 5C52B 1UBNA 2E4UA 3DWGA 2MINB 3LSTA 3ET5A 3EH1A 1W581 2X76A 1QJCA 3B51X 1X38A 1ZGJA 1AOXA 2BMWA 3IOCA 4ZVTA 1L7AA 4UHHA 1N5KA 3OM9A 4LZWA 4V0OA 4YC7A 3EMVA 1YWGO 4QBFA 5EHZA 1Q11A 1A1SA 4YJ3F 2NSJA 1JNYA 2YW9A 1MGPA 4UHFA 4PNHA 1CXZA 5HF8A 1EFLA 4ABTA 1JWLA 2ZBFA 4BPRA 1UPXA 4CDGA 2Z57A 3QXCA 2AJDA 1LRJA 1E4EB 1KYZA 1B93A 2Q3LA 1OA1A 2C2OA 5U1PA 1ZGHA 2I6TA 5KS2A 1X7ZA 3L8GA 1FSGA 2CHQA 3P0JA 1AUQA 1E79A 3AWIA 3P2JA 1JALA 2V6FA 3K3PA 2VHWA 4L5AA 2HFJA 4G84A 3S1SA 2PH3A 4DZTA 2JFNA 2Z6AA 5D87A 5J4LA 3KUCA 4LF6B 3QNMA 3BFVA 5EUMA 3ABOB 4ZZ0A 5KU7A 3Q6NA 2GAFA 1OBCA 1Z33A 2LKDA 3STWA 5JCXA 1JHVA 4B3SB 4IHJF 4KIGA 4CWAA 4G5QA 5FQNA 4X60A 1EB9A 4AF7A 5FR1A 5FHRA 1PBNA 4E1VA 3IOMA 4X7RA 2PT5A 3DHEA 4C4XA 1OY1A 2HQBA 3LLCA 4BO9A 1XMVA 4M88A 4N0DA 4XGRA 2QYHA 2BGNA 1M6HA 3CNNA 1JSRA 5SZKB 1XD8A 2C84A 1A9XB 3FDXA 1L5KA 4RHEA 2NZUG 4CMEC 4PZAA 1O9GA 1U0SY 2VKQA 4HRYA 5FULA 5K5EA 1FE8A 1VP9A 5JBNA 1QGYA 3COSA 4J8PA 2MSDB 5H9VA 1GN9A 4ON9A 4BRUA 4IVNA 1EK1A 2R1VB 3WKDA 4RTMA 1Y4ZA 3GGCA 3DEYX 3AHEA 4IMIB 4MVJE 4KR7A 2FHSA 5H82A 1HT3A 1XZKA 5DCWA 3ZWBA 1E3EA 1JQ5A 2CEAA 2X9LA 3B1WA 3L06A 4ZAWA 1KIMA 2CFCA 3OPQA 4RJJA 4TZ0A 4NK5A 3N8HA 4C06A 4F7DA 2CHUA 4BNUA 5FX2A 3BHNA 4BCDA 1JS1X 4URVR 2FWIA 1JEOA 2G1UA 1GTJ1 2NNWB 3FAZA 4JQCA 5ALFA 5FOTA 4RJ2A 4MHTA 2RGCA 2A0YA 1E2EA 2YDXA 3HABA 3WISA 1JE1A 1SKBA 3TIFA 5BWNA 1MJFA 1Y37A 2LZ0A 2HZ7A 1V8FA 1AB5A 4GPZA 5HWSA 1X94A 3FUTA 1SXGA 2PZBA 3DL0A 3HN7A 3H65A 5B12A 2LP4Y 4UZFA 1JAHA 1U31A 5AW5A 2VUTA 1TC1A 3TTVA 4GQIA 1QFXA 1YQXA 2Q1SA 3UN1A 3QELB 4EJSB 4EFLA 2VCYA 3PL1A 2ZT8A 3S28A 4XW2A 1C8LA 2VDMB 3LZCA 1SZCA 4LOLA 4Q4JB 1NVFA 3QXJA 1O03A 3I2IA 1AA6A 3LVBA 1I01A 1U0TA 2GHRA 2WG0A 5LYJF 3T7TA 4C4ZA 1BDIA 2YWFA 3CWCA 4KXUA 4XQCA 3RFVA 2BCGY 2IPNA 2FQXA 1R27A 4CIVA 1LFAA 4GX0A 1RRVA 1XU7A 4X1OA 4OK3A 2HHCA 3W6PA 1T8UA 2P41A 3HKBB 4JVMA 4ZV7A 1BDMA 1NYLA 2YMPA 1RLMA 5ALEA 5ICMA 4EVRA 1C0EA 1FUKA 2HN9A 1Q92A 3ED1A 5G0WA 4KOEC 1G5PA 2W2TA 3JWPA 2W6MA 1V35A 3GDWA 2C3OA 1IEVA 4R1SA 1A82A 4R9VA 4PC7A 1IN7A 2R8EA 4JS0A 1U1GA 4LVCA 4R2LA 4UBMA 5DHSA 5BSHA 2ERCA 4Q9AA 5FL7A 4RF4A 4II3A 4L78A 2BFWA 2OXFA 3ZJYA 2OCDA 5CURA 2CLLB 4C04A 5LR6A 1WOYA 4HCJA 1G18A 2OGSA 2QQEA 4MV0A 4R2JA 3EDRA 3UJ6A 1VE3A 5D3ZA 3VPDA 3T12A 2CNLA 3ZKWA 4C5BA 3HLYA 2BDEA 2EHDA 4NDZA 1EDZA 3UKJA 2B0JA 3F8WA 1N5IA 3FMGA 3MF4A 3SZLA 2ID4A 3WB0A 3EPPA 1DKPA 4N03A 1E3MA 2RHWA 3K5HA 4DRYA 2VWGA 1I1NA 1SBHA 4MRSA 4MV6A 5ESWA 1SOUA 2FEPA 2H3HA 1Z7YA 1T36A 2CXPA 4BEWA 3M6VA 3DUWA 3DR3A 3U16A 1PZHA 2CT8A 2ZTVA 2COKA 5BPHA 1TIKA 2RIRA 2AOWA 3EA0A 4A8TA 6REQA 4PHGA 3NIGB 2FRDA 1MG5A 2VRBA 1C4WA 3OSUA 3MCAA 1PJ3A 1EFCA 4Y9UA 4ECEA 1IHDA 1K63A 3CIFA 1K89A 1CS0B 4IWXA 5T5QA 4YI3A 4OXXA 2ZLBA 3L9WA 4HR7A 1J25A 1IDN1 2MYPA 1SU8A 1DXYA 5C0OE 3WMFA 4OA8A 2EF1A 2H1HA 4CLRA 3RIMA 2HQRA 3DOFA 1FUIA 3TOVA 5EVJA 1EX6A 2ORIA 3ADOA 3DTNA 4DHEA 1PE0A 2IYRA 4S1VA 5JISA 3ZVKA 3ZDCA 4EY7A 3AVPA 3U3RA 3ZYZA 3OWXA 4Y67A 3D0OA 2XMQA 3ZNPA 1I94B 4D9CA 1NVTA 5E3IA 1Y4SA 1MX1A 1DJOA 1NKTA 2J07A 3JALB 2V6GA 4EF5A 3AM1A 4TQUS 1DKOA 5TQ0A 2G04A 2HX1A 3S1AB 5GAJA 2XTJA 2VRCD 4M2LA 5DXFA 8LDHA 3KJHA 5DM2A 5ER6A 3RIYA 4JXXA 5DN9A 4U7PB 3ETEA 1UFOA 4YHHB 2R8YA 1Z38A 4QKQA 1LJ8A 1V26A 4DQXA 2ZYUX 3GVCA 1PWYE 4BZZA 1WUIS 4FXPA 1YI0A 2WVHA 4MQ6A 4BYMA 3GU3A 2HSEA 3SP1A 2IHVA 2IIBA 2RK4A 3VKVA 2GEFA 3UY4A 5KTNA 3AVVA 4IW3B 1YQUA 1S7CA 4KUGA 1UBFA 3MSCA 4LTNA 4UU7A 2VPPA 3ESYA 4X5OA 5H4HA 4A2WA 4E31A 1P62B 3OI7A 2GPYA 3A2KA 4OOEA 3DKPA 4EX7A 1JLKA 2Q2QA 4L8GA 4M9UA 4L0MA 2FEOA 3G0GA 1NI3A 1WXFA 4MRNA 2W9XA 3ZBUA 4G0UA 1FZTA 1U63A 1J4AA 1TVMA 2PG3A 3BXXA 4UD6A 4I4NA 4UC0A 4H16A 2JIOA 4LOIA 1GU0A 2WVJA 1H85A 1G8HA 2NWQA 4OP1A 2QTTA 4YJKA 2I8LA 1E2HA 1NMYA 2PMEA 5FLXA 1XEFA 4IJMA 3U4DA 4F21A 5DHFA 4CU2A 3N0RA 4LDNA 1M6NA 4W1QA 3WGNA 5KQLA 2EP8A 3L92A 3P9RA 3OLWA 3K4PA 4FWTA 1P2VA 2KYRA 1JTVA 1D2RA 2GFIA 2R8ZA 3QWHA 4LMAA 3SKXA 2I8CA 4FYJA 2QN7A 4TXNA 3VJLA 4YT5A 3AFMA 2CE2X 2AG8A 3CLUC 3IDZA 4RA6B 3SSAA 2IE8A 4WLNA 3VNAA 5A5VA 1AGXA 3H2ZA 5IUJC 5CITA 2I22A 3D7LA 1R0ZA 1GD1O 5EIXA 3EGXB 4FVTA 3GDHA 3VR2D 1JG4A 4I55F 4RZIA 5JZBA 4P81A 4U02A 3FVWA 2A2ZA 1P60A 3KUKA 4DC0A 1EZZA 1YOVA 3FPHA 1HT1E 3SHFA 1QDEA 1HM5A 4XDGA 4XJTA 1UCFA 1C14A 1T3GA 2VRCA 3ELDA 4I5FA 3KQSA 4D8UA 3O8CA 3K8OE 3OEED 1CQPA 1PR2A 2OQRA 3CSUA 4OPMA 5P21A 3RUEA 3RASA 4KXVA 3H5AA 4BFCA 4CM8A 1SOWA 3ISTA 5JYEA 1GCOA 2Q1UA 4DMGA 1JR3D 2BDUA 4AJKA 2A9KA 3FPEA 1KMHB 2XXJA 3V34A 3C7TA 4I1PA 4UREA 5IBQA 1U2EA 1FLVA 1UP7A 2J30A 3FBTA 3K35A 1WMDA 1QVWA 2CFOA 1MENA 3OETA 3ENWA 4HNHA 3WA7A 2JRCA 4DEXA 2O05A 2PL5A 1O89A 1RXSA 4M54A 2A59A 2F48A 2Q5QA 3HFGA 4PPFA 4RD3A 5HK8A 3A1VA 4TMXA 2AMFA 3C6MA 3GPLA 4MI6A 3ZLJA 2VYVA 3I83A 3PFGA 1OSNA 1U4SA 3E9MA 3FRHA 4J4TA 4K6MA 3K32A 2EGHA 5TB5A 4B79A 2RSLA 1DT3A 5KTKA 2I91A 3PG5A 4ZU1X 4M0CA 3WL3A 4GYYA 1J2TA 1PFUA 4XH9B 3B5JA 4HSEA 1TA4A 1RMTA 2EJUA 2Z2ZA 2LW7A 3UAOA 4RKRA 4YUZA 3DLPX 3A05A 1OJ7A 1QIEA 1X7YB 3FNGA 1UWVA 1Y6FA 5DNEA 1R4NA 4DNQA 5EPEA 1XZNA 2UZ3A 3WNCA 4DXDA 2YC2C 2IYWA 1I30A 1VKZA 1IPEA 1FYEA 1P0QA 4ZVKA 4TWZA 3PE3A 2C4UA 3E18A 4Q48A 4Z4EA 2OBXA 3R74A 5K0SA 3E4CA 5LPNA 1YL6A 3TZ6A 1C9EA 2Y2VA 3BWCA 3O4JA 3STVA 4EI8A 3S5UA 3ER6A 1JSZA 1NVWQ 2YQ5A 3KT6A 5KYYB 3HCAA 3B70A 3PEEA 2NU9A 3X3HA 1X1AA 2WILA 1DAOA 4X6YA 3RSOA 3ZWOA 3LECA 1A9TA 1XD2B 3GH1A 4OQ4A 1HE2A 4UUMA 1GQYA 2F3RA 5KWJA 1OC4A 4ZOLA 2WHXA 1C7FA 4YYZA 4WW0A 4Y2XA 4DUYB 5MFPA 3AYZB 1T8WA 4N0EA 1DRVA 3DDSA 5ERYA 2M6SA 2WMDA 4K3UA 1K08A 3HCOA 3MILA 1KIFA 1U1IA 2EFCB 3NHYA 1QUFA 4WDQA 3RHFA 4BNXA 5KC9A 3KV1A 1LA2A 2R6ZA 1SUEA 4L8FA 5BQXA 3KU4A 3ITNA 2XCIA 1R6AA 1Y7PA 2PGJA 4NU8X 3J80A 4YEDA 2J45A 2VF4X 1M5TA 3NETA 3QVGB 4LV8B 3KQTA 4G8CA 2WWWA 2IK8A 3HFSA 5ER9A 3UAVA 3W2HA 2C9DA 5JCJA 1JA9A 2PKCA 3ZJ5A 5EFOA 2I9KA 2B4AA 4UUNA 1QGOA 1YQQA 2HA0A 3H19A 4EHDA 1L5RA 4HB3A 4JKOA 1RXEA 4R84A 4AXXA 2OESA 1ICIA 3EMKA 1QDLB 4WV3A 3GLIB 1Z45A 1EJBA 1SM4A 4D9BA 4CM9A 1RAAA 3DDHA 3VR4H 5KAMA 4K0RA 1EBFA 1IN5A 1I10A 5I7UA 1ULZA 2IA5A 4RSHA 4CLOB 3UAXA 4OP3A 3T7IA 1DO0A 1C8KA 1NUQA 4JB2A 4KODA 5JG7A 1NQTA 5G2OA 3ZU2A 5BOVA 2HLDA 2H1VA 2R8XA 1SUDA 1UWCA 3BRWD 1RHRA 4NWIA 3NP7A 1QQ6A 4WZ6A 3IVAA 2REBA 4AJJA 3MERA 4EG1A 5B6JA 1SVIA 3SKYA 1CR6A 2VHXA 4KE9A 1XI2A 3SM9A 5JT1A 2J9ZB 2Z4SA 4TTVA 3UK1A 1LV8A 2AI1A 5HIKA 1A9XA 3EY4A 2HNKA 1T8TA 4WY8A 1FY2A 2ATXA 2VN8A 1AUPA 1IXKA 1FYXA 4A3SA 1VPVA 4BMDA 1USWA 4XWOA 4E09A 2UZ4A 1PZEA 2AI3A 5KPJA 4TLBA 1RRCA 1QV7A 3INRA 3G0OA 4AJLA 2RBGA 4DUGA 1W1WA 1LVUA 1S96A 1Z17A 2HU2A 4GMXA 2QKYA 3PYXA 1PFQA 3OF5A 4FIDA 4IGIA 1VMEA 4PR0A 5E7IA 1HE5A 3CC8A 3BXZA 1XTSA 1OYYA 3G1TA 2HCTA 4H17A 4LYAA 3ZU5A 1O5IA 4BX8A 1DRWA 1KJIA 4ZHSA 4WZZA 3EJWA 2PGXA 3OIGA 3P4YA 1LDNA 2GZSA 3JZAA 3M1IA 1WZIA 4U6QA 1Y1SA 3AR7A 3SOZA 5HKOA 3GLGA 3PIIA 1JHOA 3G3EA 2JJYA 4C3UA 3AG6A 2H4FA 3QBDA 1DOZA 1JG3A 1KQOA 1RYNA 2DY1A 4NYMR 1Y6QA 2QTAA 2Q2NA 1E8DA 1J1IA 5CB0A 5ITSA 4ZVRA 1DGQA 1N6KA 3VDNB 2XUPA 1FFDA 5DJ5A 1M8GA 1XVAA 2CZGA 3P0RA 4Q19A 4X6LA 5TLSA 2XXBA 4RZ3A 1C7IA 3K96A 1UOEA 5FUWA 3BC1A 3MN1A 4MJXA 3JQEA 2Q9CA 4OCZA 5IARA 2EC5A 4Y2PA 4XX0B 3ZE1B 2GK7A 3OPVA 2AJBA 3DD1A 4NV1A 3Q1KA 5CG1A 3ZWMA 2WB2A 2R6FA 1XZPA 2BFBA 2Q6LA 4RIEA 4EKYA 1NF9A 2AOXA 1JIKA 3EY9A 4EYOA 1NVDA 2X7XA 4ASUD 5KQGA 1VFNA 1K5PA 3LYHA 1ZO8A 1YE8A 2H57A 2XOKA 3K0HA 1BKSB 3DQZA 4KQMA 1T8YA 6CHYA 1HE3A 1Y3IA 2WWFA 5EY5B 5IKEA 1DKLA 2XWQA 1KGSA 4F4IA 2GDZA 3LK7A 1DDGA 3W6ZA 3N70A 3EIQA 4OG2A 3TRJA 3D4BA 1C3XA 3V4OA 3RVKA 1M2GA 4W7SA 1J21A 5TS2A 2HDWA 1K8RA 1N2CA 4YRKA 1QANA 2OSBA 5IN4A 1XYYA 3HUEA 2XNKA 1KDRA 4RHUA 4D5GA 2CLEB 4Z3KA 4BQRA 5CK5A 4CKEA 5K99A 5D6NA 3JQFC 1Y63A 3PR2B 2VYNA 2O14A 2R5NA 2ZRBA 3FNFA 3QNUA 4Y1GA 4NE7A 5I7HA 3W1EA 1OILA 1L4KA 1X14A 5DLYA 4ZMBA 1QO9A 4BATA 1WKCA 2R87A 3PCXA 2WHRA 5THKA 4AUEA 3BQ9A 5CDGA 4JJ7A 3OCWA 4BUJA 4FM9A 1X80A 3M5DA 3ZWQA 5I4KA 1PJTA 1XQ1A 4I55A 2VAXA 5DM0A 4LX8A 5CVEA 1DWOA 1E3JA 4E6EA 4YRBA 4Z4GA 1FNCA 5EMLA 1HETA 4KWEA 1D9ZA 4KPUA 3IVGA 1J56A 4TOIA 3AILA 3EG5A 3JSAA 4LHYA 3GVXA 3GUYA 3O9MA 3DZFA 1R8XA 2Q1TA 1XHEA 2AW5A 2F3UA 1VMKA 1K75A 3HG7A 3HYNA 2JHPA 1JWBB 3LQ2A 5JZMA 2B61A 4D99A 3BWMA 2WIJA 3LUGA 1UKBA 2AB0A 1R74A 1RS0A 3FCSB 4JQYA 1NF8A 5CRIA 1ML3A 3RS2A 2H3EA 4P58A 4C5AA 5HW0A 3CF0A 3UJHA 5BRJA 3IQZA 3PXXA 5IS2A 1EZ1A 3ITKA 3HJUA 3O8QB 1YV9A 4IIXA 4Y7DA 5IK2D 2UUAB 4UVDA 4BGVA 1HNWB 5ESXA 1E96A 5CIWA 2ZXFA 1NATA 1KZHA 5ICSA 3K0BA 2BFDB 1UBUS 2E4XA 1R66A 4NS1A 4PWYA 3SU8A 3VOTA 4QZVA 2WF7A 1GPUA 1H0RA 3KTAA 4J6EA 5DK6A 5BSWA 2QR2A 1Q0ZA 1NUHA 1WPQA 5ESDA 1F7VA 4MEAA 1FTSA 4GPAA 3S29A 4JL5A 4TL6A 1NKVA 5JLAA 4IHKA 1XZHA 5GM1A 4CLRB 2HJGA 3KO8A 3Q98A 1HURA 5DU2A 4GYWA 2YJNA 4A6DA 4MB0A 3UAGA 1GXSB 2ZR0A 4GVXA 1IJFA 4CQLA 2YTZA 3RLFA 1Q19A 4WX2B 4BLPA 3R24A 1BXRB 1ID1A 1ZOSA 4DV5B 3ITDA 2P2GA 2ZKIA 3PBKA 5TQ0B 3NZEA 4HWRA 2C77A 3IQIX 4BP3A 2HPHA 5K2MA 1H2WA 2VQDA 2AHRA 2AKAB 2H9AA 5KTSA 4EZEA 3GRFA 3WLEA 4Y98A 1RZRD 2WW8A 3N2GA 1Z16A 3Q7RA 3WLSA 1K5DA 3G5TA 3JY6A 2PX3A 2HU5A 2OM2A 3GZ4A 1K3FA 1U0RA 4DGQA 2CMFA 3PQDA 1OZGA 2BFNA 5LBIA 1O8BA 4DDMA 5HOEA 2FPMA 3IKTA 1OLSA 4K6FA 1G8AA 1KPIA 1TA9A 3NIBA 2I7XA 4LY0A 4UE2A 4F2PA 4E33A 5J23A 3THYA 1C50A 1RBQA 2O6HA 4P08A 4OKIA 3PXCX 4GPEA 1T1JA 1CY0A 1XTBA 4XARA 3STTA 2R6GA 4B3RB 5I8ZA 1KS2A 3HCRA 3NYRA 3O95A 3ORRA 2O2XA 2R2AA 3T0GA 5BVHB 2CL0X 1P72A 3BB1A 3UJ3X 3DOJA 1YACA 3F96A 2J08A 3DAFA 3IKJA 3K9CA 4PN3A 5JCOA 2NG1A 2V7VA 3VTAA 4P4GA 3AZPA 4TKZA 1NDUA 5EIBC 4NBLA 4MRPA 2HQSA 1Z0JA 3CB2A 4G5XA 4PQGA 3UGTA 1E1CA 1T4CA 5BSRA 5IFLA 3ZI4A 3ECSA 4BKMA 1DO8A 1KK0A 2BDTA 1DMRA 3G0HA 4JXZA 2O52A 2JAXA 3HSKA 4QGBA 4RHTA 1HTTA 2XGMA 4PFQA 3JQAB 3T3DA 3ZU3A 2A30A 5TJ9A 3H42B 1TD1A 4BFVA 3OTWA 2Q2VA 4CM9D 5BXYA 4MB2A 1RXIA 3OZGA 2IU0A 4CV0A 4FDVA 1AKEA 3CEJA 5ALYA 3SSNA 7REQB 1WW3A 1SQ0A 4IQFA 1VJ5A 4LWOA 4KQHA 5CYPA 4B6RA 1A8PA 4DLLA 3H9EO 3RDPA 2IZ1A 3O1IC 4E14A 1WLYA 3E8XA 1XT6A 2Y1WA 4JU9A 2R84A 4ZCSA 2ZJAA 1UH5A 2UUOA 1R6DA 1GGEA 2GF9A 4BBZA 3H04A 4CCWA 4EITA 3CH6A 4RF2A 4D9GA 4NDNE 4E21A 1EXVA 1P9WA 1I2CA 1NBMD 4O4LF 4P4UA 2XZOA 4ARAA 4MZDA 4F97A 1PV2A 1FIUA 2QR3A 1UJMA 2HSZA 2FY8A 4DABA 2ZJ4A 2P6NA 1Z5UA 1D2MA 3KPJA 1JYFA 1OR8A 3QTLA 4NJMA 4NZMA 2VF7A 2DUJA 1Z8NA 3WRVA 1TUGA 2Y1XA 4OQDA 5C4GB 2W7TA 4YI5A 1RADA 4YVFA 1ORWA 1FP1D 2Z8XA 4MITA 2OHHA 4GI3A 2LIVA 4KDCA 3T7SA 3WYFA 5KTPA 3EDMA 2ZQZA 4P2GA 3ZCUA 2VQ3A 2FG6C 5L3ZA 2CLSA 1GG8A 5IAKA 4R1MA 5BN5A 4DCSA 4M60A 3EBOA 3LF1A 1RPNA 2WFMA 4J1TA 4LGYA 4EJMA 4TS3A 2GZAA 2WIAA 3WL7A 4BOYA 5IVPA 3TBHA 3IEXA 3SZOA 4WK0B 4M0MA 4ZQIA 1HO3A 3MUEA 4PLZA 1PL6A 4BLQA 1MB3A 2ZETA 4YK7A 2F62A 3ZEAA 3PDIA 2P1RA 2QEQA 1T6YA 3EODA 3KU1A 4U63A 4FYXA 4C9BA 4Z2YA 1HDRA 3UWPA 5IASA 3PRJA 3QXHA 3KXIA 1QS0B 2I03A 3ZQUA 1LD3A 1AS3A 1PLJA 1TL7C 2RARA 4FPXA 3ZNOA 3SI7A 2NU6B 4HH3C 5GIOE 3C8ZA 3NT4A 4W5HA 3DZBA 2V7TA 2ZZKA 1D2AA 3QLUA 1U94A 2A14A 4CMEA 3K0CC 3Q10A 4RMIA 1GKIA 3PIDA 5BV7A 1SK9A 1Z15A 2X40A 1ZJZA 2XDQB 1KOFA 2LGJA 2QM8A 2PU5A 1U8XX 2BTQA 2D1FA 2FPRA 2NT3A 1N5JA 4JJ6A 5CVUA 5A04A 3AVYA 1O87A 2ZQ5A 3EXHA 1JB9A 4F85A 4AY4A 3M4YA 3UJAA 4PYJA 4MDEA 1SPBS 3TCNA 4DBLE 3VX4A 1EAMA 1X9HA 2NO6A 4IHQA 3LLVA 3K1JA 2WQ7A 1T1RA 1DXOA 13PKA 1GDHA 4KQXA 3KQYA 4HL6A 4FCVA 4G26A 3WXBA 5I7AA 3AHGA 2PBRA 4L4RA 4LNUA 1R6VA 4O4JB 3VKWA 1T4GA 1THZA 1XDDA 1BNCA 1SA0A 3OBIA 4E1AA 2OCKA 3G82C 4C4PA 3UM9A 2FOXA 4BXOA 4G9GA 3HFRA 4PYKA 1B26A 2ZSJA 2JGAA 3DJYA 1QM5A 4BCBA 3EVBA 3RRNA 1XDBA 2ZIWB 3NUQA 4CF7A 4MMZB 4QOFA 3NKVA 4OBXA 4XCXA 2GN1A 1P44A 2V3WA 3FF4A 1W4CA 3L04A 3QVGA 4TL7A 4UPEA 2HF2A 2ZIZA 1D9XA 1VSQA 1VTKA 1N2HA 1U1EA 1KVQA 4C05A 4QTYA 5LIPA 1DDOA 2HF7A 2NSDA 1B2RA 2MSLA 4CF3A 2AZ4A 4EMUA 1JI0A 2A1IA 5IAEA 2CB9A 3EBPA 3PNQA 2FZGA 4JI7B 4YIKA 1G5HA 4BFYA 5B2FA 2X8LA 2PQ6A 5F21A 3TFWA 3GGDA 1EUCB 3PHBE 1FDTA 1IJKA 1QIHA 3LF2A 4DZZA 4TYYA 1QYXA 2B8TA 2EX0A 2NUTA 4HNUA 3LT4A 3QOWA 3Q9LA 4BQPA 1IE3A 4JROA 1ULAA 4TKVA 5E6UA 1MNQA 2WJWA 2XIQA 5FOSA 4CLOA 4FN4A 4C7XA 4WCFB 3A6LA 4Q24A 5LMNB 1T10A 5DHAA 1N4AA 3IUYA 1PNQA 2WTEA 3QVWA 5LOVF 3L1IA 3B78A 3CCBA 4I50A 2Y6UA 1Y3FE 5IEBA 1UBLS 1W85A 1NHWA 3M6XA 4WGFA 3RE1A 4JP3A 4ND5A 2XVAA 4F56A 1N7GA 4XVUA 2HL6A 1E20A 4FFOA 3P9SA 1XFAA 4M9SA 5CH5A 4DC1A 4ZMSA 5CLIA 1QE0A 3D8HA 2QYOA 3KT3A 4ZO9A 3WGHA 5IBCA 3KOYA 4G5SA 4TS9A 1GO2A 2CVQA 2D54A 3AHJA 3ESDA 2AEFA 3IXMA 3L8ZA 5AJYA 3LUPA 3B20A 1ESNA 4ZRMA 5ICGA 4X7MA 1E2KA 4JI8B 1S2LA 4OJMX 3L6OO 3QW2A 4AWBA 1ZONA 1GRVA 1JPNA 3NBKA 4RMGA 1E9BA 4OQYA 5BWBA 2J09A 4BV9A 2QVXX 1B0ZA 2GJKA 2UVQA 2WZQA 4EEKA 5AM2A 3H5OA 2PDAA 1UEXC 3HMQA 3QTBA 4ZO4A 4DR3B 2OY0A 5EKDA 4MOWA 3I34X 5FWYB 1N77A 5LQCA 1UC5B 5CXSA 3OBBA 1XKTA 2ZRJA 3PGXA 4ZYVA 2O5VA 3TRHA 5J4HA 3RSGA 2BFPA 1ZBDA 5JFTA 3FY4A 1WZNA 2B5VA 2FPIB 3LA6A 1NZFA 1YZHA 2BVNA 2C94A 3RS5A 3MC1A 3EQ9A 4NFYA 4PR3A 4Y6RA 4LCEA 2ZJYA 4AJEA 1HA3A 4P22A 5CXXA 4ZYZA 2O2IA 1XTZA 4QVIA 3HBLA 1VA5A 1PGPA 3O8OB 3VR3D 2G9ZA 2JFHA 1N75A 4O2BF 4U8HA 1DB3A 1H5QA 2R8BA 4CCYA 2NOAA 3P19A 1VKHA 3W3AA 1SZJG 5AW7A 3IV9A 3FSGD 1ACJA 2GN4A 3I30X 1CUJA 1IAQA 3D8SA 3EVZA 3MZ0A 2QHXA 4Y18A 4QT4A 5GINE 4D46A 4HNAA 3QFRA 4JUDX 2E4AA 4TWAA 3TJZA 4ETNA 4C6TA 5EGNA 5DHQA 2J59A 3GT4A 3OZUA 4B17A 3A3KA 4AYWA 3E61A 4OM8A 2BISA 3V4RA 1EK5A 4HFJA 1EP2B 3HVUA 4F3TA 5DYTA 3IFSA 4X6XA 3RCBA 1OYWA 5JD5A 1X8LA 5P8WA 4KKXB 4G8BA 1D5WA 2H9IA 1LBQA 2R68A 2EBFX 1JHXA 1KJNA 4DB2A 3L5KA 1YC5A 1Z29A 3NTRA 4PNPA 2B1RA 3WNBA 3TNFA 4JR2A 3HJCA 4PYIA 1VA4A 2QSJA 4NMMA 2EJCA 1SXIA 4W5NA 3COJA 1EBUA 4OH7A 1GP2A 1WSBA 4BMPB 4F86A 1SBIA 3EDCA 1KY3A 1JHMA 5F7ZA 3TW6A 3F74A 4JWTA 2H7VA 1ULBA 2HK9A 5DXAA 3TAHA 4JC8A 2YH2A 3PKJA 1QTRA 3ZEIA 4G09A 4XCQA 2D1TA 3G0CA 4MIYA 2A5LA 2RGDA 2JDIA 3FHOA 2JFGA 1LPSA 4EAAA 1W8IA 3K70D 2PKYX 2BRUC 3KSZO 5KNBA 4B80A 4RTSA 2A9OA 2RHGB 4NBRA 3WP0A 4W5TA 5EIWA 1ZLXA 2I87A 5B1EA 1WRBA 3U3DA 4COOA 2PNJA 4TYNA 4A0FA 3HKEB 1SUFA 3ILYA 1JKJA 1TIBA 3R6LA 3G2QA 2BMJA 4JLNA 4M8NE 5KI6A 3T1TA 1OAKA 3PB3A 3ZY2A 1CV2A 2CXOA 2OK7A 4ZDWA 2GZ2A 3Q7TA 2P30A 1E5QA 1EESA 4MQEA 1YL7A 1JIQA 4CI0B 3D59A 5K3EA 4QHYA 3DE5X 2VHYA 5HX7A 2D7DA 4FJ2A 1O0SA 4I0WB 1PJ4A 1BDHA 4HYYA 2JI4A 3A9SA 4FQ8A 4GM1A 3ZVRA 1DSSG 3TLKA 2BH2A 2OZKA 1GUBA 2ZSIA 4BVHA 1XMXA 2ZQYA 3T3HA 4YCSA 3LLMA 2O1EA 4BVGA 2L69A 3RVDA 5I7OA 3J81A 3UQYS 4QSMA 1W4BA 1ZUD1 2DCUA 1AHNA 5FI5A 1VKJA 2J0UB 3HWX1 1WIWA 1EMDA 2ZB8A 2IEBA 4PICA 4GVPA 3O4HA 4GKVA 3T06B 3CH4B 1AO0A 3FIJA 2IXTA 4MA4A 6PFKA 4GGMX 1F8YA 3KJZA 3T5GA 2OM6A 4HVAA 3PI7A 3Q8XB 1NTOA 4W99A 3TM4A 4RHFA 3MJFA 1EFPA 1JFSA 5L8VA 1G21A 1TC2A 4G0ZA 2D4HA 3JD4A 1GL6A 3K7EA 4KLZA 5EMKA 3KOUA 5J2UB 5HRUA 3FTPA 2X4IA 2XGSA 2E18A 1XVTA 1VLVA 2GB4A 1EFRD 1HLGA 2HDNB 4JIMA 5TEWA 2FK8A 2MTBA 3RJ5A 3WGUA 1G3IA 3F71A 1ZI8A 3N39C 4LHSA 4RELA 1I1HA 2E89A 2IUEA 3VPAA 3ZGZA 5JS1A 1A96A 2B3DA 3OZIA 2WHPB 3EUFA 1JKFA 5JCJD 3AF3A 3AW9A 1A69A 1JECA 3AMVA 3DE6X 1TU4A 2X5XA 3CXRA 2HSDA 3RGWS 1XU9A 5HA5A 3CVYA 1KAHA 3GLHB 2SICE 5TVKA 4HGRA 3KELA 4CTJA 2H1IA 4DOMA 2NO7A 3I1YA 3K0AA 3TPZA 1O97C 1SCJA 2FFRA 2Y6VA 1G8YA 2WSYB 4QEZA 2WUGA 1QF9A 3VUFA 2J85A 3GLUA 4QX6A 5KYVA 5I01A 2CD7A 2I6FA 1DEKA 2YHIB 4Q3AA 2KE5A 2O07A 3FPSA 4I2NA 4COKA 2VJYA 1FMTA 1ZSYA 2V7QD 5WRFA 3ZNNA 4DSAA 3PUIA 1ZD4A 5IRCD 1EDOA 3GGOA 2NM0A 1XRMA 2XAUA 3P8ZA 2VJKA 4GRDA 7YASA 2HMWA 2WIBA 1JR3A 1Z74A 3B12A 3E84A 3JQAD 5T57A 4S1PA 5AVUA 2GXUA 2YWXA 5AUOB 3N05A 5AVJA 4HFRA 5K8LA 5GVRA 1YR6A 3GDFA 2J0VA 1O95A 1C3LA 3OLCX 4PBSA 1KVTA 5FTWA 5JHGB 3PHLA 1D3AA 3CZAA 4L75A 5AM0A 1TCVA 5DBOA 4B4UA 3S55A 4H3VA 1E2UA 3NOOA 3WLRA 4QG3A 5TY0A 3ETCA 4AMZA 5F3WB 3UA4A 1D1QA 4NEGA 1AK2A 2EKPA 2PKWA 5IN5A 4JBNA 5E0KB 4A0RA 3NANA 5JTUA 5CVCA 3VH3A 4MRMB 1BMFA 3TZHA 3NG1A 1I3MA 1GTRA 1KAMA 1WXDA 1OXVA 1UMCB 2IEZA 3PXEA 3TZLA 1PJRA 3T3OA 3EK2A 2P2YA 1E3QA 4J94A 2WYVA 1ZRMA 4XYLA 1Q0UA 5J47A 1QH8B 1HYBA 4ZOBA 1C4KA 1WV0A 4UMFA 1BHJA 3MJSA 3UHJA 5AD1A 1XV5A 1Y3AA 3R7DA 2AE1A 4HWOA 3ZR4B 1Y4AE 1PD0A 1HSOA 3H2SA 3K15A 1ZIDA 1G6Q1 3L05A 3GEIA 3NTVA 4Q3CA 1F8UA 2VLIA 4O4IF 5HE8A 5KDDA 3OD5A 4GKAA 4EF6A 3ENQA 1N7HA 2IY9A 1IRXA 2PWPA 3BTOA 5JCPA 2C57A 1ZAYA 5A4KA 3IHLA 5CBPA 4HNQA 1C30B 3MQ4A 3R76A 3D3QA 3WLHA 2RGXA 2GYWA 2RBEA 4LHXA 2VT3A 4Z4FA 3N3AC 4WBSA 4QYXA 1AKVA 1SURA 2IWHA 4GEGA 1M2FA 1KI6A 4R05A 1ZJJA 1EZ4A 2I3GA 2VDUE 4GI1A 1LGYA 2C92A 2RHJA 2PZ8A 2QSUA 2R3SA 3PEFA 4EY3A 2ZPTX 1K7XB 3DDNA 5FV4A 2FPLA 4KRXA 3A9TA 4HN4B 1OBOA 2PT7A 4L1KA 1O0BA 3ED5A 1A97A 1WX1A 2W6ID 4WFKA 1T4BA 1ECJA 4BEJA 4RNCA 1C1YA 3GD5A 3LC2O 4XJVA 3IOBA 3Q41A 4LWZA 5GWXA 1YVRA 2BBWA 4JBYA 4DNXA 2QRHA 5HG0A 2OZLA 5KSOA 2YXNA 2C03A 3AVOA 3F49S 2B6HA 4WACA 2QJRA 2VJCA 1I24A 3HDYA 1MB4A 2GARA 2YZMA 4FX5A 3E7FA 5FBRB 4A91A 4BV2A 5JBQA 1IN1A 4K9SA 5C80A 3AUKA 3KALA 1T9BA 2EJBA 2FW6A 2X3YA 3ZZNA 5K6AA 3EGWA 2PS0A 2Q8NA 2IHUA 4OHUA 3F5FA 4PXSA 3TECE 1SBQA 1OXUA 4ZK2A 3BMQB 4C30A 1ZK0A 5CEEA 4WLVA 3WGOA 4F1JA 4D0NA 4GC5A 3FOCA 4OYYA 1PJ2A 1YZUA 2H2DA 4O5AA 5KUTA 3GRZA 1I5RA 3RKRA 1ADCA 3RRXA 5CPFA 3SR4A 3K2IA 4P4NA 5DP2A 1KZ6A 1TRHA 2OECA 2ZAGA 4NBKA 5L4SA 3K1AA 3CLKA 1IPHA 1SQ6A 3L3BA 1SA0B 3VSCA 5DT2A 4X8HA 3C5VA 1WABA 2XYGA 4ZHQB 1WZCA 4I4TB 1VFPA 1DOHA 3CO0S 5FNVF 3T3GA 4ZICA 5BSKA 2JB9A 1Q15A 2IQ5A 3CRRA 2LDBA 3SSOA 4YLYA 5AW1A 1ZQ9A 3CX4A 4HVTA 4I19A 1IFXA 3WFZA 4ZCIA 2XKKA 1SELA 5A4IS 3UMVA 2ISQA 1LF0A 1KI4A 4PWZA 3FCAA 1AZLA 2GESA 2HXSA 4GZ5A 4AD8A 3H2JA 5F1PA 4MVJF 5KDLA 1ZUNA 1A9ZA 1TW3A 2FZ5A 3OFVA 4I7EA 3LZDA 1IRIA 2XMPA 4K87A 1AA9A 5TF0A 5BO5A 4QXOA 1IOVA 4DGSA 2N3ZA 1E64A 2ZWIA 1DAKA 1FTNA 3FVTA 1K06A 4JQOA 3JQ8B 4FI3F 1Z07A 1QMPA 5LM3A 1G42A 3CZPA 4P0TA 2XUAA 3M3PA 4HI0E 3RO7A 3WDKA 4DJEC 4F8EA 4R69A 3AC0A 3FVVA 2GMWA 3V7WA 5BW8A 5BSMA 3RTGA 3QJ5A 3RJMA 1U3UA 1TADA 4AZ3B 4U7FA 1YASA 4DSZA 4II2A 2J5KA 3G8CA 4JMLA 1VC2A 4U6SA 4HX5A 1W85B 4MK4A 5DYWA 1Y0BA 2ZUFA 1XQVA 4DARA 5DMXA 2ACKA 3MA0A 3TZKA 1VI6A 2FWBA 4PRZA 1U0LA 2Z2IA 4JUCA 4W1PA 3UAZA 1CG6A 3VSAA 4PFSA 2AH5A 1EGHA 4YS6A 4AYTA 3IKLA 4LFAB 4F3NA 3GCGA 5C4MA 5KTTA 1LS1A 2IP1A 2Q6VA 4LHWA 5TMBA 2EWWA 4NXNB 2OCAA 3R7LA 3MELA 3IRUA 1ZCZA 5JNTA 4J16C 5GV8A 5M04A 3VKFA 2VJDA 3LQYA 3M4ZA 3W5CA 4UQLA 2D2IA 1PT8A 1FRFS 4P9NA 2XB6A 4UM7A 3MJDA 4XA8A 1D1TA 2XB4A 2HJHA 1FNDA 3EUWA 3FR7A 1GAJA 1ZNWA 4IIFA 4C6SA 3TZQA 1P7CA 4J49A 5FWYA 3TLAA 1Z6PA 4CTMA 2TMYA 4M1EA 5A3SA 2E55A 5DDIP 1LQTA 5YASA 4UDNA 4EY5A 4YQFA 1PS8A 4YDQA 3A31A 4MB6A 5L7TA 5DNVA 3WIVA 2ON6A 3ZWKA 4UAVA 4WNCA 1NP6A 4EG7A 3RYTC 1SIWA 3CURA 1EFVB 2Y0PA 5JSUA 1RHMA 1YE5A 1OBVA 2WWXA 1M1YE 1OX5A 2W0SA 2HRCA 3AUFA 3W79A 5G0UA 3AF6A 2VF5X 2A5DA 2IYNA 1T1GA 4K3VA 4OP2A 4LSGA 5F4BA 3IR6A 3TUZC 4CLEA 2BKXA 4J16A 3EVNA 1RABA 2J0EA 1H2FA 4AS2A 1UP6A 4Q1CA 1T2EA 1YS1X 3B38A 1JL3A 3AF2A 4TXLA 4EHBA 2Z30A 2BRUA 3EFOA 3EQ2A 3GN1A 5JAHA 2REQA 3R44A 1E0AA 4GPIB 5TQ2A 3BEDA 3LV8A 3AR8A 4KQ1A 3B8EA 2Q5FA 4Q0MA 1SC3A 2FSIA 1SUSA 3M4XA 4JQSA 3L1KA 3DCJA 4XTCS 2ETXA 3GZNA 4RKQA 5BWCA 4UNQA 1N57A 2HMUA 1A4IA 3K9FC 2KX7A 2DY0A 1F8XA 2O4UX 2E5WA 2D1SA 4B84A 4RHCA 1T5LA 3TLCA 1LQ2A 1LTKA 1OFIA 3VC2A 4URXR 4DJDC 1X1RA 3OT5A 3HCBA 4U2EA 3UMRA 1AC5A 3DKRA 4IX1A 4BQIA 5JAZA 5KYTA 2MDTA 2HI0A 3NAMA 1G2PA 1H2YA 3AM4A 3DTVA 3QE2A 3R23A 4KVFA 4L0CA 4NV0A 2NZ8A 4PIVA 4PVDA 3VZBA 5LKAA 4O63O 4DDHA 2ZM6B 3PLNA 3W04A 3K70B 3HE3A 1KPHA 2FZ4A 3EPRA