2FCBA

Human fc gamma receptor iib ectodomain (cd32)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
173
structure length
173
Chain Sequence
APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FC GAMMA RIIB)
publication title Crystal structure of the soluble form of the human fcgamma-receptor IIb: a new member of the immunoglobulin superfamily at 1.7 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 1999-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fcbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fcbA02
1CFVL 1OM3L 2XKNA 1NCWL 4FQ2H 3Q6FA 4XP6H 1OTTD 3CH1A 3WXVL 1T1ZA 4JHAL 2IPTH 3NH7L 5B38A 4X6CF 2P1YA 1LVEA 3HAEA 5JOEA 3ZHLA 2IAMD 3L6FA 5JA9A 3QUMH 2X4RA 5HHMD 3B9KC 4KQ4H 4PGDB 5L6YL 1A3QA 4FQQA 3EOTL 1QLRA 3LIZL 4EDXB 5FK9A 4M62H 3HG1E 3W0WB 4XHJC 3BP7B 1YJDH 1G9NH 5CINH 5AZ2L 4YAQA 1QR1A 1RK1A 5D4QA 1A6ZA 1N7ML 3SKJH 1I9RH 2DMBA 3BN9C 4QHNA 2DBJA 5KSBE 1NFKA 4FQCH 2QSVA 4G9DA 1VA9A 1DUYA 2XRAH 4L29B 3V0AC 1IKFL 2ORBL 4JG0L 3MLWL 4YZFE 2YS4A 1Z6JT 3RBSA 2P5WD 4HK0B 1T04B 4FQHB 1IFHL 5FUOH 3HNSH 4ZFFA 1U3ZA 1KIRA 3WHE1 4FABH 3G5XA 3BP6B 1N4XH 4YFLF 5FB8A 4IRSC 1AGDA 2HKHL 4NOBA 3MA9H 2AV7A 1FN4A 4M48H 2CUMA 1EFXB 4JM2A 5L7XL 3RWGA 3TA3C 4JFDE 1A6AA 4F7CB 1EHLL 2H2PC 1RZJL 4M6MH 5GRYA 5HVWA 3D2UA 3CU7A 4JVWA 5HJ3B 3WIFA 1D5MB 4OI7A 5HVHC 4FS0A 5D7IF 4H26A 2YN3A 4M7JL 2BSSA 4RX4A 3KDMB 1JRHH 4ZODA 1OY3B 3SJVB 2P7TB 3ES6A 4J3TA 4ZO7A 5I2IA 3EFDH 4ELKB 4JRXA 3L3HA 4WFHE 4GLRH 2HWZH 4KHXL 3SGJA 5FKPB 3T0AA 1DQTA 4WFEE 4NN7B 2HN7A 1QVOA 3RIFK 5JNYA 5HHQA 1P4LB 3AMKA 2G75A 2EH8H 1RI8A 2E9BA 2MQ3A 3TVMC 4I18C 4X98A 5E8OA 3OAYK 1UXSB 3BW9B 4MNGB 2JB6A 3JUYA 4X4MA 4HIHA 1UYWH 1XH3B 4HGWB 1A3LL 3BIKB 3H7BA 5I0ZA 3ZZ1A 5D9SB 1L4IA 3MV9E 5DJZA 4QRUB 4GKNB 2DJUA 3L1OH 1CGYA 1N6QL 3UC0L 3HZMB 2CLVA 2Z91B 4F3FB 3QXTA 5EIIA 1Q1JL 3OG6B 3WJJA 4P3CH 4TNWK 2AJSH 4HK3J 4Y19D 4G8IB 4XX1G 2H2SC 3BRFA 1JGVH 1IM9A 3GK8H 1BGXL 5IEHB 2DD8L 3JV6B 3P4OA 4CUCA 1HXMA 4D0BB 5T3ZL 3C6SB 4Q6YA 3NCYP 3IDYB 3ARGD 3MLYL 2BVPB 1FZMB 2X4PB 5DEFA 4GBXB 1A1OA 1RVFH 4MVBD 5FHBH 2VXUH 3RL2B 4LSRH 3GMRB 5HPMA 1P2CB 1NAKH 2R8SL 1U93B 1LEKB 4JFPA 3TNNB 4I0CC 2ZUXA 3O8XB 2KDGA 5GRUL 1DLHA 4P5TC 43C9A 4LLDA 3VGFA 1J5OH 3VXQA 5LQBL 4ODUA 1FO0H 1KLFA 4DK6A 5MP6L 2GSIA 3FQNB 3X3FH 3I3DA 1PYWA 4PJ7F 5D7JD 1A6VL 5GS3A 3WNMA 3LKSB 3GI8H 2IANE 4QXGL 2BRQA 2H3NA 4MA3A 3FONB 3BUTA 1HKLH 1AGBB 1V5JA 4FQXD 5F7UA 4JY6B 1DLFH 3BI9X 3WLWC 1O0VA 3GMQA 4OIIL 1X4XA 1AHWA 5BQ7A 2DS4A 5H2BA 1ZSDA 3SDXB 3ZT6A 1KIPB 1WTLA 4S1QL 2G5BA 2VXVH 5JHDA 2VRAA 5IVXF 5AD0A 2H9GA 2J8UE 3AUVA 1TJGH 1ZKAA 5DSCA 1BOYA 4G8GE 1QTYT 4UDTB 4U33A 1MCOL 5F88B 2O5XH 1I9JL 3ESVF 4JDZA 2OR8A 4JPIB 3QUKA 4GW1B 4FNLH 3BHBA 1QEWA 3LEVL 4M7KL 3RJQB 1RD6A 1U95A 4NZJA 2VDQL 1F4YH 4NQSB 4P2OC 1KUMA 1GC1L 5C0FA 3K81A 5B4MD 3RVWD 1S5IL 4XBPB 3FCTB 3GRWA 1C5BL 4LU5L 4M43L 3VXTB 1MJUH 3IYLW 1OAZL 1RQ5A 5IQ9A 2ATPA 2UZXB 1CICC 2VZTA 3VXSB 1GRWA 1CFNB 5D6DA 5J12C 1TPXB 3RTQD 5L2KD 3BFOA 4WUUB 3MRPA 3P9LB 1HQ4B 2IQAA 3GJEB 3RVTC 1CIDA 2MKWA 3T0BA 3T0DA 5AAWA 5AZEL 1LE5B 5IB3B 3ULVL 2EXWC 3MACH 3STLA 4RRPG 5DD5L 2DQUH 3ILQD 1CBVL 5D7SH 4JFEB 4QHUB 5BZWA 4PJBB 1VPOL 5D2LB 2VDKL 4AH2B 2CXKA 4OZ4A 2GTZA 4NC1C 2E8YA 3MXVL 4Y16B 4U1JA 3HNTH 4OM0H 2FIKA 3D85B 4PJIB 2UY7A 4E9LA 1UT9A 3IF1A 2R2BB 3V0WL 1MCPH 4ONGL 1F3JB 3PABB 3FFCD 2IMNA 1AQDB 4P49A 5JIPA 3UPRA 1T5XA 5DS8A 4O4YH 2GJ6B 3SGKC 2QTEA 1U3HC 3RAJL 1MREH 4WO4A 4WNQB 1QFUL 3BJLA 2IQ9L 2R2HA 1AR1D 3AS3A 3H9SA 1H8NA 2RHEA 4JZNA 5T3XD 3DARA 4XB7A 1TZIB 3D39D 4KKAD 1NANH 1XGQA 4N0FB 4MLSA 5I1GH 15C8L 2SEBB 5E2JA 1DL7L 5KANG 2QQKL 4KZDL 3HE6B 3C5ZB 1T0NB 1H9VA 1HHKB 1LO2L 4BM7A 2VYRE 3R0MA 5IMMB 4JO3H 5DHVA 5ILTL 2QL1A 5KTEL 3KPPB 3KYKH 1ZWIA 4LSPL 4BSWB 1I1AC 3MRBA 2V6HA 3U30C 1F6FB 2AJXL 2APWA 4U1HB 4Y5VB 1MUJB 2VZOA 3L3JB 5T3XH 4P2QA 1S9YB 2MFNA 3QHZL 3FO0H 5KN5B 3EYSL 1UQSB 2J88L 5E03A 3JBG7 1LO0H 2FD6H 4PRIA 3QXAB 1M4KA 5D7LE 2PTTA 3OPZH 3QIWC 1NC4B 1WVZA 2EZ0C 4OTXL 1UB6B 1NAMA 3OKNB 2OR9L 3QFDA 4XX1E 4UB0L 4O2FB 5ENWA 4K3JL 2FLBT 3BWAA 5FUZH 3LAFA 4QXUL 4WEBH 3TBWA 1N0LA 3QR2A 3VMNA 1CDGA 4S10A 3U6RA 4LF3B 4NT6A 1J87A 4P3WA 1FNHA 3PDOB 4GAYA 4JM4L 1OAUH 4AM0B 1T4KA 1QBLH 2DKMA 5JUEL 1G9MH 2CDEB 4LHUA 2ADGB 1KNOB 2FH8A 2EE9A 3I02A 5FA4A 3BZEA 4M5ZL 1XF5B 2XT1B 3WNLA 5GSVB 1K8IB 4XP9H 6FABH 4Q0XH 4XPGL 1EFQA 2VDNL 1UB5A 4L4JA 2A6JA 4R7DA 2VO5A 2NQCA 3MJ8B 4JM2F 1IGFH 2ARWA 4IRZH 4M1CD 1CTNA 1BZQK 4XBEL 3LZFH 3MRMA 1B0WA 4WFFE 5C07B 1OSPL 5BRZB 3ARDC 2V5SA 3FFDB 3V4VL 3BPNB 3CCHA 3F5WB 4XVUC 5HGDA 1NBZA 1MEXH 3VGHA 1U91B 3VRIA 5DMKA 2OM5A 2WP3T 1QACA 4G42A 4MHHG 4U6VH 1P9MA 1YN7A 4Y4KD 1FP5A 4JQVA 1NGWA 4MZ2A 4PJFA 1HHJB 1U58B 4PGZA 5T1DL 5CS7A 3O9WB 1U3JA 1DEEB 4HS6A 4HUWB 1YA5A 5JHLH 3MV8E 4O02H 4K3DL 2J1KA 2HRLA 4PGBB 5DRWB 1OPGL 3S6CA 1YNLH 5FKAB 4AK1A 3QJFB 3QI9A 4M4RA 2ARJB 4GRWB 5K93A 3WS3A 3LKRA 3CDFA 1KC5H 3B5GA 3QISA 1UVQB 3U7YH 4HCRA 5IM7A 4Y4FB 1MCFA 4XGZB 5JZ7D 2L7UA 4K7PY 4WU5B 4E41A 2MTPA 2VDOH 2JTDA 5BMFL 4RAVB 1RZIA 4Q2ZB 4UBDD 5E8PA 4M6OH 4P5MB 2FJFA 4YNYB 1KN2L 2AJ3B 4PREB 4LCIH 2NY4B 3ZL4H 3NFNB 3QO1A 1DCLA 1F4HA 3EJYD 3VD9A 3IDNB 4OD1L 5TGBB 5IBLD 5GGRB 4CADB 4L3EB 1TVHB 1KGCD 4WTZA 2BNRB 4EUPH 3BKJL 1Q0XH 4X80H 1CGUA 1O7VA 4OGAC 3QEQD 4HPYH 1MF2H 3H42L 1E6OL 3CUPB 3DVFA 1FV1A 5TPWH 4U05A 4NQEE 5HSFA 1H8SA 4JCMA 4ODSH 1FLTX 3C9NA 3QG7L 1ETZB 5FM4A 4YXHH 2QQLH 4G7YL 5HBBA 1FC2D 3ORJA 4M8QA 3IJHA 4RFNC 1SM3L 3CFEA 3VGGA 1LMKA 3VXRA 2HT4C 2VXSH 1SMAA 3AS2A 4FOMA 2XA8H 4LASL 3VE0A 3I6LE 3VWKA 3TV3H 2AK4A 2VE6A 1ZHLA 5CFHA 4JGMA 5J13B 4DGYH 5K59E 1JFQH 3QJHB 2BOCB 4G6AC 4OGYH 1R3IH 3EYQC 4CN4A 4BZ2L 2NXYC 3HI5L 4K55A 3MRGB 3PL6D 5LCVL 5EUKB 1NUFA 4U3HA 4I48B 3ARFC 1JPFB 3EYUH 3KLSA 2Z8SA 4HFUL 4HDIA 2BERA 4ZQKA 3ZKSD 2OL3H 1Z9LA 5E5UB 3AVEA 2AI0H 2APXA 1DVFC 3PDDA 1WT5C 2BY0A 3NIDF 3MUZ1 1T5WB 3U2SA 1ZLVK 4P2YA 3VG9B 2Q3AA 1YPZA 4XP6L 5I8KH 1ZXQA 3DYMA 4EDWH 4DEPC 2X4NB 1I4FA 2UZYB 2IPTL 3QH3A 4UUJA 4X6BA 3GIVA 2LE9A 3FRUB 4ORGA 4BH7A 1B2WH 4NQDB 4ODXB 5CMAB 1MCRA 3N85L 2EDLA 1BWMA 4LOUC 3V5HA 4QRPE 3MV01 2PR4L 5LGJA 1A7RH 3B83A 5EO1B 4PP2B 4CNIB 3SKJL 5HYSG 4HG4K 1UWGH 2F9BT 4POZC 2H26B 2DQDH 3ARED 4FQCL 1S7UB 3I6KB 1MJ8H 4F80A 1A7QH 3U83A 2A6KA 3KPQA 1ES0B 3VRJB 1P69B 1BQLL 4LVHC 2RJMA 2VLKE 3TIDA 5I73C 3ZT7A 2MPAH 4WJ5A 5FUOL 3HNSL 2X4OA 1R3JA 1EEQA 3H6JA 2Z31B 1LK2B 3MMEA 3B8SA 5CJXA 5DR5L 2FDBP 2MKLC 3PP3K 4NZTH 4NNXB 1NFDE 1LK3H 5A2IH 4RBPH 5ID1A 4GJTB 3P9MB 5HDOA 1G6RB 3T77B 3BZDA 2P5EA 4M48L 5JMOC 1JRHI 4QRQB 1KTLA 4J12A 4OF7A 5CSGA 5C0JA 3MBEA 4NKOA 1ERNA 1CDYA 4QOKA 5C0AD 3FT4B 3LS5H 1EUUA 4NP4L 3ZMRA 4GLRI 4M6ML 5ICXB 5DD1H 1G7HA 3UTSA 5CGYC 1L9NA 1K4CA 3S4SB 2J5LB 5ESAB 3TBTA 5JR1H 4WHTB 2HTKC 4OZGB 1AI1L 4HIIB 4R9HA 4UINH 3T4YB 5EU6A 3VXUB 1LEGB 4K8RD 5K9OA 1SEQH 2X4SB 1S7TA 3SEPA 4RGND 4UDUA 2Q6WA 3WS6C 2F54B 1GGCH 4IIQB 5LG1A 3MOQA 3I75A 2HWZL 2YEZB 1D5ZB 3CAFA 3SCMA 1HXYA 1F90L 4OQ1A 3MNWB 3KXFE 4XNMB 5JO5A 4R96B 4L4TE 3KPRB 3WUWG 5L0QC 3K8KA 4U1LA 4K8RH 4LHQB 5ITFA 4I2XB 1IC5L 3C8DA 2EEBA 4MMZC 3C08L 4JRYB 1UYWL 2GY5A 4NRYB 4PLKD 5E8EA 5DUML 1I8IB 32C2A 3SDAD 3QNXB 3TBVB 3U7AA 5C0BE 3L7FA 2Y6SD 1F2QA 5KSVB 2O61B 2NXZC 4JN2B 4L4VD 2Q7YA 3L1OL 1SYVB 2YBRA 3PWJB 4KKNA 5I1EL 2H1PL 2R0WH 1K85A 1B4RA 3WNNA 5FYLH 1N5YH 3MO1B 4WUKL 5H8DA 1BQHB 2VLRB 5HGAA 1MAKA 1HEZB 4IBLT 4HWUA 4P4KB 1ZLWH 2AJSL 2DWEB 1J1OH 2F53E 1IEAB 2YXMA 3GMOA 3INUL 2NW2A 1GOHA 3QIBC 3H2WA 4OSUH 2R1YA 1MHHB 5DJ6B 4NM8L 1JGVL 3ZDYF 3DPBA 2QJDA 5EFIB 3ZE0F 3DX6A 2XZZA 3ZE2F 1BLNB 4C58B 5SWQB 4PJ5A 3BP4A 5D1XC 4ZTPH 3K8MA 5E1HB 3LV3B 4PJEA 5MENB 5FGRA 3VGAC 4FXLA 1RVFL 3ECBB 3DXAE 1BF2A 4QKXB 4Y8DC 3RX7A 3T3MF 1NAKL 1AXTL 3MLXL 3SGEH 3VH8G 4OZHB 3CFBA 3QFJE 5IK3A 2RAMA 5SWSE 1LQSR 2I26N 3IS1X 1RHFA 3SKNB 4D0CB 1UJ3B 4MJID 2DOCA 3CLFL 1W0VA 4U1GB 1J5OL 4BFIA 5DJ2B 1FO0L 1G7QA 4LMQI 5C0CE 1HCVA 4KRPD 5M94B 3C2SA 2DAVA 1YC8A 3Q1SL 3X3FL 5IVNA 4ZAKC 3DBXA 2VLJE 5IF0A 4RMRA 5IVZA 1HKLL 3QUZD 4FP8H 1SYSB 1KPVB 4KK6C 1RZ7H 1FIGH 5IJKA 3OKOB 1FVEB 2YWZA 4JFQA 3GDBA 1U8NB 2R0LL 5DTFA 5FDWA 1PEWA 2BOBB 1FFPB 4X6CE 4QTHA 1JYWA 3ME0A 2FNBA 4OD2A 3KNBA 5TDPA 2Q1EA 5FGBC 2XWJB 3PP4H 4BELD 4FFVD 4BZ1L 5C9JA 3BQUA 5IKCA 1B90A 1TJGL 3WSQH 4PJFF 4ZXBD 3LKPA 2NX5A 3WNOA 5HHOB 4JREB 5ISZD 3PWVB 2MCPL 4FNLL 4PRBA 1ZLSL 5FYJD 5AG9A 1EO8H 1N6VA 4P9HC 2ERJC 4YHOH 1Q8MA 1F4YL 1KN4H 1WCBB 3FQXA 5EZOH 4MSWB 4MMXC 1MFAH 3B4NA 4D9QD 1PX4A 4LQFH 5DD6B 4DGIH 1VACA 4OFDA 4FQLH 5JPMA 3QDMD 1WZLA 2D03H 4QRRA 4ZS7H 2DMCA 5DT1H 1AD9B 2D0FA 1X5XA 4XBGA 1MJUL 2XZAH 2D7TH 4CAGA 1YEEH 3MLRH 3WHXA 3P30H 1U8LA 2H32A 1MCKA 3MV7D 5TDOA 4Y4HD 1PLGH 4RFOL 1U8PA 2HFGL 5AYUH 1F5WA 1F02I 1KB5A 4XPAH 4KMTH 1I7RB 4IHOB 2DQUL 1JPTH 5L88H 1LE9A 1D9KC 4NCDA 4ZOBA 5C3LD 3HNTL 1NANI 3AY4A 2QKIA 5C6TL 4EN3B 2HAZA 2FSEA 5IHLB 9CGTA 5JOFB 4F8TA 4NJ9H 1MCPL 3HUJA 1GH7A 1VGKA 1S9VB 4N68A 3BJ91 4IRJB 2YOCA 1WIOA 5E6IA 1QSFE 1UJTA 3GMNA 2DQIH 2W0PA 1CK0H 4JE4B 3BZ4A 3MLTB 1XF1A 1MREL 5CP3H 3V5DA 4KROC 5ANMA 1E28A 4JFFA 4LPVA 1KLGA 25C8L 1M05B 5ERWA 4QTIH 1MCNA 3LKQA 1HKFA 2CXGA 1OP3K 4GS7C 4Z7NF 1NBVH 2JCCE 2PF6A 2V5MA 3RGVA 4Q9QH 1JWMA 2YUXA 5E00A 5EPMB 4RNRB 2CKBH 2FX7H 3LDBB 4TUOA 4E5XB 4HJ0C 5C0EB 1DN0B 1IAMA 3RWHB 2WLZA 4Q58C 3FOLA 1NEZB 3W0WD 5CD5C 5IW6A 5T1KB 1YPZF 3P77A 4C56A 5T3XL 3R0NA 3WFEH 3T2PA 3FZUC 1UM5H 2BVQB 3AS1A 4Y1AD 2FJGB 5DYOA 3DMMB 1JNHB 2PYEB 1H3TA 1HI6B 1LO0L 1UC6A 2FD6L 5D72H 3KJ4B 5HDQL 2RFXB 4A6YH 3AB0B 5D7IB 1BPVA 4FA8A 3ULUF 4XP4H 3OPZL 1XZ0A 1IM3A 1VEPA 2IH3B 3C5SB 4X4YA 4NCC1 1J8HD 4PJAA 1XF4B 1D6EA 2DTMH 2VOTA 4W4OA 5DJCA 1UZ6F 4TNVF 3EDFA 3MFGB 3FQTB 3E1F1 1MRCH 2DWDB 2E5EA 5E1AA 2JE8A 4JB9H 5D7KE 1EFXD 2Y5EA 3IXTB 2OXGA 3CC5B 3BD3A 4XCEB 2MJWA 4Z76B 3OXSB 1OAUL 1ZA6A 1QBLL 2HJKA 3PGDA 1G9ML 1YUHA 2X4UA 4PJDA 1OP9A 4MNQA 4WW2C 2HLAA 5C0GB 3HG1D 1MHPL 2FGZA 6FABL 1G0DA 3SHSA 1ADQA 3JTSB 1MHCA 4FFYL 4GKOA 4QXTA 7FABH 3ETBF 2I07A 4S11A 5DI8B 1U6AH 3O3BB 3SJVD 4ZNCD 1IGFL 4RA0C 4IRZL 1HDMA 3HMXH 5CLWA 3O6FC 3LZFL 2G2RA 4PJ7E 2V2TB 1CIUA 3LQAC 1NCTA 5TE6H 5F7EL 2E7LC 1CD9B 12E8H 1A2YB 3B2VH 4U6VL 3CFKB 1JMZA 2BNUA 3K2MC 3MUY1 2X4QB 4HUUA 4NQCB 3M17A 5A2KH 5JDJA 4MJ6B 4MDJB 1JZ3A 4MCZB 2VZVA 4YHZH 3VFNA 5DK2A 2ENSA 4IOIA 5CILL 3B9KA 1I9EA 3FO2A 5BVPH 4PGCA 4PLNC 4IJ3C 4LSSL 5E7BA 1HSBA 4OM1L 5IVXE 4O5LL 2ZOLA 1U8QB 1D5IH 1TQCB 3V7MA 4AYFA 5I1DB 1KTDA 1CGSH 1JE6A 1KC5L 2NY6C 5H94B 3TPUA 3U7YL 5L2JB 3NCMA 3IETB 3PQYA 1FZOB 3GGWB 2VDOL 3PWPA 4S1SL 3KPMB 2CRYA 3JTTB 4M6OL 1AC6A 3U46A 1NBQA 1VFOA 5E56A 2A0LC 2Z8WC 3VXME 2C26A 3ZL4L 3WIHL 4WEMB 4L9LB 1AO7B 4FQXC 3EOYG 4GQ9H 1EBAA 1HWGB 4IRSA 1DDHB 2WIMA 4NRZB 4NHCL 1R3LB 1Q0XL 4X80L 4HPYL 4HJGA 3OR6B 2WBKA 3TA3A 3MJ9L 4Z7WB 3BUYA 4HHAB 5DA4A 5JIKA 5IMLB 3BYYA 4JANA 4ODSL 3ALPA 1I1FA 5BVJA 3KLAA 3RWJB 3Q5YA 4P46B 3U4EB 3DHMA 3T0EE 5CEXA 2XA8L 4U6YA 3TV3L 3O8XD 1I1CA 1CFQB 4OGZA 3UYRL 4J8RB 3JWOC 4PJ9C 4DGYL 2XPGA 2EECA 2PYFA 4OGYL 3TP4A 4G80B 3UCRA 1VFBB 3LN9A 3CFJB 3S35H 3TH4T 3G5VB 3MV11 5AUMA 1BHGA 1QRKA 1I8MB 3SDDD 4PJEF 3W9EA 3EYUL 3CNKA 4UQ2B 4DKEH 1EDQA 3CFIC 3F58H 5C2BH 4XWOC 1XGPB 4Y7MA 5GS0H 2XN9A 4WCYL 5FM8A 4QYOA 4XPHH 4KJQC 3QEUA 4U1MA 4O58H 3TVMA 2AI0L 3VDBA 4I18A 2ADJA 3FKUS 1A14H 4QT5B 3S5LA 3FB8A 1T7ZA 5I8KL 3V79C 1PQZA 1UZ8A 4EDWL 3GBMH 5J06A 3C09B 4F2MA 3ILQC 4DVRH 3WIIH 2FBJH 4CMMB 3VD5A 5I71C 2HP4A 1JN6B 3EZJB 1RPQA 4RAUB 5KZCB 2OTWB 1TZGL 1EGJH 1RZKH 5GGTA 2NW3A 1PVHA 4UU9A 4PR5B 5IMOB 2R4RH 3WO4B 5MHSE 3PGFH 1F8TL 2DQDL 4PRPB 3DUSB 1H15B 1CFSB 3B9EA 3OZ9H 2IAND 2R0ZL 2Y7QB 5F70A 1T7YA 3GIZH 5K9QG 1CR9H 4HFWB 1UGNA 3VXSD 1WLHA 3KAAA 5KJRH 4PJHA 3P0YL 4WUUD 1H0DA 3QDGB 5D2NC 1QQDB 5HYQA 4NZTL 4QCIB 4FMFA 2QADC 4MS8D 1LK3L 5F71A 4KQ3H 4EUPA 4HAFA 4V1DE 5DMGC 4JFED 4OCYL 1MHEB 2Q86B 3ARBC 1MH5B 4P5TA 2RGSA 4F7MA 3D85D 4GKSB 4HIEA 1I75A 1KB9K 3CSGA 3DIFB 4LCYA 1E27A 2XKNB 5DD1L 5C9KA 4FQ1H 4OFYA 3ZYJA 3TFKD 3CH1B 3FAWA 4LRIC 5I16B 2B4CH 1T1ZB 2VABB 1KPUA 2GQHA 1UCBH 3NVQA 2HYMA 5B38B 4I0PB 4PLOB 1FCCA 4FRWA 3HAEB 1KIQB 1GVIA 4UINL 3L6FB 1OB1A 4J3WA 5H37H 2CDFB 4OBSA 3UTTA 1GJIA 4NWTL 4BFBD 4LGPB 1XEDA 1I8KA 5C8JA 1FJ1A 1QLRB 5FUCE 3HUJF 5FK9B 3HE6D 4MAYD 3C5ZD 3JSSA 4KHTL 3LPGA 4YAQB 5EU7C 3VJ6A 3VG0H 1QR1B 3T4AA 3LRHA 2D31B 5DJAB 4OLUL 2FR4A 1ZHNA 1R5WA 4G9DB 1U42A 5FIEA 1CVSC 3B5HA 1DUYB 2NZ9C 4K8RL 2X1XR 2IEPA 4P2OA 5HD8D 4X6EB 2NY0B 4BZYA 4ZFFB 1EEUA 3RY4A 3DV6A 5F89A 3BEWB 3PWLA 4GXVH 4UIKH 3K4ZA 3OB0H 4ZFZA 1T21A 5FB8B 1AGDB 1JV5B 4X4ME 2AV7B 4NZUH 1FN4B 2R0WL 4CVZA 1NC4D 4HX1A 4JM2B 1CICA 4BA8A 3RWGB 3NAAH 1FNAA 3GSOA 3BYTA 2WWKT 1CD1A 2WUCH 1MCQA 1UKQA 2BVYA 2EO9A 4UZGA 1J1OL 1MLBB 2PCPA 2HT2C 3SGEI 2VN7A 4XCYA 3AFLA 3D2UB 1AE6H 4OSUL 5I8EB 1FG9C 4U3CA 4HEPG 1G0XA 2IPKA 4H26B 1DJSA 4APQC 4MB3A 1WBZB 3MREA 4ZTPL 4PP1D 4PJAF 1C5DA 3IT8D 3KHOA 1J0IA 3ES6B 3VXNA 4JRXB 2XWTA 3L3HB 4CN1A 3Q2CA 3SGKA 3MLZH 4LVEA 1U3HA 4QY8B 3OL2A 3WLBA 4CRPA 2HN7B 1QVOB 1FDLH 5JNYB 5C07D 1J1XH 1NFIA 2Z4QA 2DQFA 5AAMA 2C3GA 2EYSB 2E7BA 2NNAA 4L3CA 1OW0C 3GM0A 1ZOXA 4UNUA 4JG1L 4PJDF 2JB6B 2C1PA 3VWJC 3DX8A 4HIHB 5ACLA 1T7XA 4KZEL 1S78D 4RQQA 3H7BB 3L3DB 2P42B 3NIDE 2F5BH 4M7ZC 3ALXA 4YE4H 4ZUUB 3O9WD 1RZ7L 3KPSA 1I1AA 1FIGL 5DJZB 3GBLA 1FG2A 1DE4A 1BWWA 2DB8A 3RZCB 5HGHB 4DVBA 2CLVB 5FHAL 3VFVA 2DJSA 2W1NA 4OLWL 5EIIB 3UJTH 2C7UA 4Y4FD 3PP4L 4PTUB 3IVKB 4M93B 5T5FH 1IBGL 3SBWC 2VQTA 4YXKH 1MCHA 1KCLA 1T1WA 2BY2A 1WAAA 5E7FA 1IM9B 3QIWA 1QSEA 3P4OB 5JHDE 2NY4D 4NQXA 1HXMB 1EO8L 1W72H 4YDKH 4YHOL 1EX0A 5EZOL 4KPHH 4MCYA 4P23C 1MFAL 4O51A 3F6IA 4GRWH 1IQWH 2EXYC 1YEHH 1RSFA 4WFFD 5CBEA 3RZWA 5J11C 2BNRD 4FQLL 1A1OB 2D03L 4ZS7L 1J18A 3FRPA 4NN5B 5CEZD 1HZHL 3R8QA 5D1ZC 3O0RH 5GISL 2LTQB 1OSZA 4JVPA 4PTTA 2XKUA 4Y0GA 4MWFA 6CGTA 4PY8J 2FIRT 2XZAL 4GMTH 2D7TL 1YEEL 4N5UA 3FHQA 3DVGA 5FYJL 3BT2L 4P2RA 43C9B 4LLDB 4OCRH 1FZJA 4JY5H 1PLGL 1WCQA 4L8BA 1RMFH 4XPAL 2ZUQC 4MAUH 4ZPTB 4KMTL 1RIUH 3HHRB 2H3NB 4I3GA 4MA3B 2ENYA 2AABL 4KUCD 5CEZH 3WO3B 2F19H 3ARDA 5L88L 1PD6A 2HVJB 3UBXI 1QKZL 3GMQB 4WHYG 3S34L 5BQ7B 3PIQB 5H2BB 1ZSDB 1INDH 1IEBA 4JRWA 3F62A 2G5BB 2DQIL 5AD0B 1WZ1H 2H9GB 4YXLH 2CIKA 3HE7D 2BZDA 2FB4H 3WKMH 1WWAX 1BBDH 1BD2B 5DSCB 4LDOB 1G7JA 4OZFG 1KCSH 1MAML 4JDZB 1JCKA 3D69A 4WI3A 1TITA 3QUKB 3NPSB 3BHBB 1QEWB 3MRRA 3OJDA 3N1FC 4QTIL 5BS0E 1C1EL 4L8SB 1U95B 4Z7UA 3HR6A 4NQED 4MB4A 4I77H 1NC2A 1VFUA 4XMPH 4Q9QL 2YKLL 3O2VH 3L3OA 5I17B 3MGTA 4PG9A 4XWGH 4PPTA 2CKBL 3S4SG 1WFOA 3HRPA 3D3VA 4ZO8A 3RVXD 2DL2A 5BRZE 4HKZA 3QB7C 5JOPE 3RDTC 1NMAH 2HLFD 1LDPL 3VI4F 3VFUB 1MCWM 4HH9A 1UM5L 4YO0A 1WIUA 4JGUA 1X5HA 4DGVH 1OF2B 1KJ3H 2X89D 3HB3D 3TJEH 4XZUB 3REWA 4JR9H 4GG6E 2FGWL 5IR1A 3F7PC 2JB5H 3S97C 4ZUTB 3STLB 1KEGH 4P2QE 3QCVH 3IFOA 1A7OH 3GMMA 4XAKD 4XP4L 5BZWB 5D1QB 5I19H 2Z31D 4DN3H 4OZ4B 2GTZB 1L9MA 3VXPA 5JLZA 3O6ML 4XNUH 2VMFA 3GNMH 2WM0A 4U1JB 5C6PB 2EDFA 2EC8A 1ZHBA 2FIKB 1XMWA 5IOPA 3VFTA 4PRIE 1MRCL 2VAAA 4HJJH 4JB9L 1TXKA 4OI9A 4OF5A 2DQCH 3ZE0E 1RHHA 3ZE2E 3UPRB 5DK3A 1QFPA 1FVCA 5DS8B 1YNTA 1X9QA 1JMXA 4C83A 1L7TL 1Y18A 1E0OB 2ITCA 4HLJA 2A6IB 4WO4B 5ABDE 1QRNA 2R2HB 2XZQH 4PJHF 2BNQA 3H9SB 3ARFA 3QQ9D 3EDJA 4LCUB 2HG5A 4NN6B 2R4SL 4OCSH 4QRTA 3QSKB 3W5NA 4OBRA 4Z95H 3RIAF 2W65A 2H8PA 2QSCL 1ZANH 4H5SA 4HWEH 3ZKNC 1IGIH 1G6RH 3SGDH 1DVFA 1PGRB 3WD5L 3W9DA 1WT5A 2HFEB 3VXUD 5DC0A 1ZA3B 4PJCE 5DHVB 3MR9A 3HMXL 3ARVA 1ZWIB 2F54D 3MRBB 3E8UH 5TE6L 1OP5K 12E8L 4FQJH 5IJVB 1HE7A 5IT2H 1T3FA 4GOSA 2ZPKH 4DUWA 2F5AL 4YDVB 4Z5RB 1TTGA 3RWCA 1JGLH 1WV7T 3KPRD 5HYJA 1ZEAH 3PWUB 3VMPA 3DYOA 5DD0H 5BVPL 4JRYD 4M6AA 2F8OA 2PTTB 5ITBH 1NLDH 1VKXB 4PJFE 3VDCA 3V6FA 3QFDB 5ENWB 3BWAB 1J0YA 3HZVA 4PRNA 2ATKA 1WC7B 3TBWB 3D5OF 3LKNA 1YMMA 2D4FA 4U1KB 2R1WA 5I1HL 1KEML 4LIQH 5SX5H 3QBTB 2EDHA 1WWBX 3OB8A 3EUUA 2VLRD 5I8OH 5DRNA 4AT6B 1MOEA 4P4KD 5LAXA 1TMCB 1WBXA 2WBJC 4ODVH 5EZLA 1CXLA 3CH8A 5D71H 3QUZC 4E41E 3BE1L 2BHYA 4LLVB 5AG8A 1CG9A 4GQ9L 5FA4B 1X44A 4H1LA 2BCKA 1QPPA 4NQDE 3SO3B 3LS4H 5SWZE 1KV3A 4R7DB 2A6JB 2Y5TA 5CZVH 5EU4A 1AR2A 4R3SB 4OF8A 4FFVC 3MRMB 5DMIL 5MEND 1AJ7H 1NCBL 4UOJA 2Q8AL 1MNUH 4ZXBC 5I74B 5HGDB 3STBA 1NBZB 1FAKT 4RBPK 4HZLA 5E4EC 5DMKB 4PV9B 2ZKHH 1II4E 1EZVY 1YN7B 4I9WE 4WGVB 4F57H 3IRZA 5ALCH 3DGGA 1A7PH 5HHVL 2BDNL 2H6PA 3RNKA 1NGWB 4TYUA 3GHEH 3WS6A 1WQVT 2DLHA 4HS6B 3VXRE 1IAKB 2GJJA 3LH2H 1ZT4B 2F8VA 4JDVA 2XACC 4DKEL 4FTVA 1QLEH 3F58L 4UILH 4EQ2A 5CGTA 5C2BL 3QI9B 5F3HA 3WS3B 1CDBA 5TQ2H 4XPHL 5E8NA 5IM7B 3DOSA 5HHXH 1QFOA 4UIMA 4AENA 2QV2A 1A14L 2P49B 3IDGB 2X40A 4Y4HC 1QFWM 4X5LA 1RZIB 4IMLA 5E8PB 2XG4A 4OCMC 4Z7NE 3FT2A 2FJFB 5A3IC 4R4BB 3GBML 5D6CA 3UZVB 3MJ7A 1UM6H 3WIIL 2IWGA 2FBJL 4MA7H 4JZJC 1L6XA 5C09E 3NZHL 1U8MA 2F74B 5HHOD 1YPZE 5H35B 4XXDA 1RZKL 1TZHB 5KSBA 2CPCA 5JQHC 1ZVSA 3QFJD 3G08A 1MFCH 4UQ3A 2IFFH 1REIA 4MD4A 2OP4H 2R4RL 3CVHA 3GJFA 1SBBA 3PGFL 4U2ZA 3QIBA 3BKCH 3IJHB 3CFEB 3ULUE 2OJZH 4X7EC 3CX2A 1RUQL 2CGRH 5IROC 4FZEH 3OZ9L 1WBYA 1C08B 2AXFB 3K1DA 1WAAF 1CE1H 2IADB 3NABL 2AK4B 2P4AB 2VE6B 1ZHLB 3FB5A 5D1XA 2V7HA 1S3KH 4J7RA 5KJRL 4WI8A 5GS1B 4YC2B 5C92A 5GRJL 4BSJA 5DZNA 1J7VR 1X5LA 4HDIB 5E4IA 1KSRA 3GO1L 1A1MA 1FNLA 3OAZH 2M1KA 4XC3L 1RURH 3TEUA 1ZHKB 4EN3D 3MROB 2KH2B 3T0EC 3A67H 4N8VG 4MQXD 4HH8A 1F11A 4ZAKA 4ACPA 3MFFA 4LVNC 4IRJD 1BFSA 4FQ1L 1CGTA 2B4CL 1I4FB 2BP3A 4UUJB 3IAGC 4X7TB 4NQTA 3TC9A 1R24B 3GIVB 4M9OA 2E7MA 5IW3A 4ORGB 3FN0L 4FXGB 2R0KH 4X9GA 3UTSE 5LXGH 2X41A 5TF1L 2PW1A 1HILA 3FQWA 3V5HB 3L3IA 4I4WA 4KVCL 2ESVE 3BZFA 3QPQC 5LGJB 1U8KB 4QHKJ 5FGBA 4PRDA 5CIPH 1FBIH 1CD0A 1PY4A 3VGEA 4LP5A 3KPQB 1XGTA 3EJJX 4R4FL 5T1KD 2J4WH 2YHGA 3MV9A 4JKMA 2GAZA 4GUPA 3TIDB 4Z7UF 3DMMD 2HTLD 1GZPA 4HGKC 5F9JA 1RFDH 3EYFA 3MMEB 3O41A 1M6OA 4GXVL 3SN6N 2ZUVA 4JCLA 2B5IB 2HJFB 3EJZC 4X9IA 1G7MB 4WV1B 4YHKH 1ZGLM 1S9WA 5MEOB 2P5EB 2BVOA 1KTLB 5C0JB 4NN7C 3MBEB 4NKOB 4QOKB 2BVTA 2GKIA 1CQYA 2WUCL 5F97E 4ZFGH 1G7HB 3BH9B 3RBGA 2V2XB 1FAIH 4U1SA 3IAPA 1I3UA 3TBTB 2ZOKA 1D9KA 4HF5L 2C1OB 5JORA 3MRIA 1J12A 2DQEH 3V0VA 2CDGB 5EU6B 4P3DA 4XMKL 1S7TB 1BEYH 5ACMA 4UDUB 2AVGA 2Q6WB 3OR7A 1LO3H 1I1YA 3BGMA 4LCWE 3DSFH 3TWCL 4ZUVB 4RMWA 5EO9A 4NZRH 1DSFH 3MRNB 1GGBH 4U6HB 4IDLA 1J1XL 3SO5A 1E4JA 1RZ8A 4XMLL 5JO5B 3UTPD 3WFDH 4RA3A 3U36B 4MNHB 3HNVH 4NNYA 2R56H 4U1LB 4BUGA 2ZCHL 5CBAA 5ITFB 4G5ZH 4WENB 3K2UL 4YBQD 1ZT7A 5DEGA 2VISA 1RIHH 3C5JA 1S9XA 5E8EB 3DVNA 3MQIA 2F5BL 3WBDA 32C2B 1OGTA 5IHUH 5I1CH 3L7FB 5EBLB 3K3QA 4GBXC 2J8UA 3AM8C 1NCDL 2GT9A 3QUMB 2Q7YB 2YBRB 2YMXH 4XRCA 4CDHA 3X17A 5DXWA 4G8GA 1FL6A 4R2GC 3HC0A 5JW5A 3P73A 4GT7A 3MRFB 1Z2KA 4MDIA 1T7VA 5LGHH 3CPLA 1IC1A 1KJVA 1K8DA 5E8DH 5HGAB 4YIQA 1I3GH 1A6WL 5T5FL 3BESR 4YXKL 2NY5H 2OSLA 3GMOB 3TJHD 3TIEA 4N0YL 4M00A 3PF2A 3F12A 5E2VH 3WDIA 4IDJH 3V6ZA 1LD9A 5EZJB 3T3PE 1ND0B 4YDKL 4PJ5B 4KPHL 1IQWL 1YEHL 1PBYA 5F96H 1A0QL 4OD3L 4IOFD 4PJEB 4QO1A 1A3RH 1D5BA 4D3CL 3B5TA 1EEZA 3QAZC 3O0RL 4LKCB 1RJCA 3P0VL 5F9WC 3CFBB 4HQQH 5IBTL 1AY1H 3TZVD 3VFGH 4HKBB 1AFVH 1RUPH 2NY7H 4WW2A 1OAYH 1AQKL 1KOAA 5JXED 4OCRL 1W0VB 4P46D 4BFIB 2YPLE 1SHMA 3A6OA 5DUPL 1G7QB 4XH2A 1MFBL 1SJEA 5ELIA 2OYPA 2VIRA 2ITDA 2PYEE 2FHBA 1RMFL 2FJHA 3DBXB 3IJYB 4MAUL 4M3KB 3NCEB 4JPWL 3DGCR 5IVZB 3OF6A 4NPYB 3O6FA 5CEZL 3FQUA 2CMRH 2F19L 3MA7A 2E7LA 3T09A 4P4RA 1OAKH 3EGSA 1I3RB 3ARSA 2BXZA 3FB7B 5D5MB 5ID0B 2Z35B 3MYZA 4OD2B 3KNBB 4QLRA 5BV7C 4GMSH 1WZ1L 5DRXA 4YXLL 1L7IL 5C9JB 5IKCB 3K80A 1MCWW 2FB4L 3E3QE 1WZKA 1BBDL 2BSTA 2DBLH 4KGJA 1MI5B 1KCSL 1M1SA 2IMMA 1VADA 2NX5B 2UV3A 5DC9B 1P84J 1A5FH 2LV4A 3CSYA 1DBBH 3U9UA 2BRRH 3NGBC 3G6AA 1H5BC 4BJLA 3LN4A 5KG9B 3G6JE 4Y16C 2AJUH 2LFGA 5KZCD 4NCC2 4JFFE 1T0PB 1A6TA 3MX0A 1MSPA 2Z9TA 4LGSB 4QRRB 4PJ8B 4G7VL 4TOYH 4R6UA 2VH5L 1QA9A 2EIZA 1TIUA 3GKWH 4XBGB 4JQXC 2K1MA 1W8OA 4DZ8B 2RQ8A 4FQXA 3WHXB 5D7LA 4DCQA 1U8LB 2H32B 3S3JA 4DGVL 3G9VA 1IGYB 2LU3A 3BDYH 5GRVK 1U8PB 1CLZH 3TJEL 4Q6IC 4JR9L 5TE7H 1KB5B 3ZHKA 1QBMH 2JB5L 3WE6A 1RJYB 3GSQA 3QCVL 5KSBF 3BPLC 1CI5A 3HE6C 3HC4H 1M7DA 4DN3L 1FGNH 1LE9B 3ZKMD 3QDGD 4XNUL 5IGXH 3GNML 1HHHA 2QKIB 2AGJL 3IFNH 4JZOB 2FSEB 4YR6A 3QUXC 4Y5YB 5CUSH 3HUJB 3SGDI 1V7NL 3X12B 5E6IB 2CO7B 2DQCL 2HFTA 3GMNB 4N8CH 4PJ9A 4J2XA 4EIGB 3KPTA 4Y19B 2GK0A 3MNVA 4P2CG 1KFAH 3BZ4B 3LCYA 3ARZA 4ZYKA 3KPLA 1FVDA 2XZQL 1FSKB 4RSVA 5ANMB 1E28B 4AIZA 4KJPD 1FL5A 4OCSL 4U1IB 3B3IA 1OAQH 2WIIA 5ERWB 4HAGA 2Q7NA 4O9HL 4I0PD 1NBYA 1IGIL 1G6RL 4XPFL 3RGVB 4NYLB 1JWMB 5E00B 4TUOB 1B0RB 4Z8FH 3RI5F 3O2DL 4R26H 3FOLB 4LLWA 3IDJA 4UOW1 3DURA 1GL4B 4FQJL 4LLMA 3P77B 4C56B 3NA9H 2A38A 2AEPL 5IT2L 2IG2H 1SJHA 3RL1A 2HT3C 3MUHL 5D7JB 1Q9WA 2AXHA 3SPVA 4ZMAT 3D18A 2EE3A 4JFYA 4XB8A 3HAEH 4NO2A 1FFRA 1ZEAL 3HI1A 4H25A 1KYOK 1J05A 1JI1A 2NY0D 1M7XA 1IM3B 1XZ0B 1NLDL 3P4MA 5ITBL 1MCDA 2KPNA 1CN4A 5AYQA 1F6LL 4PJAB 1D6EB 4HPOL 2VTFA 3GSRA 3KYNB 5C7XH 2CD0A 2XTJB 3BPNC 2FEDD 1I85C 2Z92B 4LIQL 3GHBH 3U79A 4JM2D 1MELA 1S7RA 4PY8I 2AXGA 2FL5A 1GXEA 3GSUA 5I8OL 4HKXB 1CFTA 4MD0B 1T20B 1ZA6B 4RGMC 5D2NA 2HJKB 4ODVL 4D9LL 5BOZG 5D71L 5JQ6H 1YUHB 2X4UB 3D2UD 1KG0B 4MHHI 4PJDB 1ZS8A 4MNQB 4E0RA 43CAA 1VGEH 3MLPA 5A16B 1IAIL 2HLAB 3RX8A 3PJSA 3ARBA 1LO5A 3O6KH 4QXTB 4RRPA 3H7LA 2I07B 2HKFL 4JQIH 5CZVL 2VLME 5GGSY 4MJ5A 3I6GA 4CGTA 4Y4FC 3MOBH 1AJ7L 2G2RB 4JRXD 1MWAA 5DO2D 4B5EA 1MNUL 4LRIA 4N0CD 1H3PH 3QYCA 4HEME 3S37X 2BNUB 4HUUB 3RTQB 2A1WL 3M17B 2NY4C 4EIZC 1A7PL 4ISVA 3BGAA 5DK2B 4IOIB 4KI5E 3TYGH 1NCUA 3B9KB 1XF3A 4JHWH 4BKLA 2ZSVA 3FO2B 4PGCB 3UTZB 2BJML 1HSBB 3LH2L 4ZG1A 5J3HD 4M1GH 5DLMH 5MEPA 4UILL 5EG6C 4TULH 1KTDB 3D1MC 2J2ZA 1WSST 3TPUB 5TQ2L 4X5XA 2W9DH 3FFCB 1HYRC 3BD4A 5HHXL 3EZ8A 4Z77A 3PQYB 1N59A 1VFAA 5FDYA 5GHWL 3PWPB 4N5ED 5DFVD 5I0DA 2BHZA 2OBGA 2D7PA 5AEAA 2FATH 2D9QB 5J13C 3V95A 3EO0A 3MGOA 5IP4A 4Y5XB 4X7FC 3CSPA 4QRPA 1FNEB 1YN6A 4IRSB 1MY5A 1IM9D 4UT6H 2CK0H 1B6UA 2J8UF 1Y6MR 4W70A 2W60A 4TTDC 3IGAB 4R4ND 4S1RL 3JWDH 3BUYB 4BH8A 1MFCL 1S7WA 2IFFL 2OP4L 4JANB 4NC2B 1JPGB 4CVUA 5FM5O 4ZPVA 1HSAA 1I1FB 1KPRA 2ICCA 5BVJB 4OKVA 1OQOA 3BKCL 2VLKA 4NUJB 1SVZA 5DRZA 2CLRA 3WIHA 5E99H 5HI5D 2OJZL 3VG9C 5CEXB 5HVHB 4OFVA 2UY6A 2QR0B 3LD8C 4APQA 5E2TH 3KG5A 2XPGB 1S3KL 2PYFB 2R23A 4RIRA 1PZUB 2NPLX 2BVUA 3V2AR 5IB2B 1C12A 3MJ9A 1YEFL 3QEHB 3GUTB 4Z7VE 1K6QL 2X4TA 3W9EB 3RVXC 3WFHB 2EH7H 3U1SH 1MIMH 3TLRA 5KAQF 2XN9B 5DQJA 4QYOB 3KPOB 3QEUB 4U1MB 5DWUL 4XAWH 1OW0A 4R97B 1JF6A 1T0MA 3ULSA 4JAMB 3VFMB 3VWJA 3LHPL 5DJ0B 1UZ8B 3HR5A 1WFTA 2OLDA 4F2MB 4RCAA 2VWEC 1ORSB 3DETC 1I7UA 8FABA 2G9HB 1OGAE 3DJ9A 5DURB 3PXJA 1X5GA 3GSXA 1RULH 5ACZA 1KCVL 2NW3B 5HHPB 5HPOA 1SY6H 3I3EA 1FBIL 1ZLVH 3SBWA 4PV8A 4YFLI 5CCKH 3UTTE 2DM3A 4NBYB 4ELMF 1F2XK 4X5WA 1N2RB 4X6DA 2A9NH 1ORQB 2AV1A 4NKQB 3C8HA 3EYVA 2J4WL 1V7MH 1ZTXL 5C0BA 4P23A 3FT3B 4S1DC 1BREA 4PJHB 2DLGA 3NMEA 4QGYA 1H0DB 1OWRM 1ZAGA 5BXFA 5D1ZA 2CLZA 5HYQB 4JFZL 1G7PA 3G5YA 5LWYH 5DJ8A 3ZYOA 4YHKL 4EUPB 3F7YA 3HZYA 3GRWH 2F53A 4DKAA 4WY7H 2PW2A 2YD1A 2ILLA 5LJYH 2NY1C 4F7MB 3UZEA 3B9DA 3QRFM 1CLCA 4O00A 1DBMH 1E27B 2OJEA 5DK0A 3NCJL 2R2CA 2E6JA 2OZ4L 4ZFGL 4NO5A 3MCKA 2GY7B 1KPUB 2XTLA 2D7MA 3T04D 1Q72H 1C7SA 3PP3H 3Q6GH 2C3VB 3N1MC 4WO4D 2YUZA 4LRNH 4X0KB 2DQEL 3H9SD 3DXAA 5HI3C 3QEQB 1OB1B 3E6FB 1U8IA 1BEYL 1I8KB 2YUWA 1OTUD 5SWSA 1LO3L 4Z7QE 5C8JB 1FJ1B 3GSVA 3DSFL 4N1HB 4BQ8A 1JGEA 3VJ6B 4ZUWA 5C0CA 1DSFL 1FYTE 3PHSA 5EULV 1GGBL 4KTDH 5FV2A 2OL3B 2I9TA 2FR4B 1OOAA 1ZHNB 1R5WB 1UH4A 2VLJA 3ILPA 3WFDL 3OJMB 3HNVL 1NEUA 4P2QD 1BECA 2BSED 4PB9H 1RIHL 3FO1B 3OX8B 4RMUA 3DV6B 3ZKQD 2I9LA 4X6CA 2XZCL 5I1CL 5IHUL 5DHVH 4ZFZB 3RDTA 1T21B 1TVBB 3F8UB 2YMXL 4YHIA 4CVZB 2I5YH 3BSZL 4TUJA 4EKXA 3B9VA 3GSOB 4UT9L 5DZLA 5LGHL 2QHRL 4YHLL 5E8DL 3DLQR 1I3GL 5I30L 5HYSA 2P8MA 2PCPB 3PNWA 3CMGA 4LKXB 4XCYB 1WEJH 5B21A 3L7EA 3H3KA 3CLEL 5E2VL 4TQEH 4ZD3H 1TJIL 2IPKB 4IDJL 2C5DC 4AL8H 4J23A 3VGDA 4H8WH 5J1SC 1GZQA 4EVNB 4LHUD 4EI6B 2ZUYA 3MREB 2N7BA 5TE4L 1C5DB 4UV7H 1NAMH 5FA3A 3VXNB 1WAAE 3O3DA 3OV6A 1A3RL 1QSEE 3AU1B 2FEEI 2AJYH 1U3HB 5IHZB 1NLBL 4HQQL 1EMTL 1AY1L 1IAIM 2I27N 1K2DA 3SQBA 3IXAA 4HMDA 2Z4QB 1AFVL 1RUPL 2NY7L 4KK9D 1OAYL 3IKKA 2NNAB 2QBWA 4L4VA 3LMJH 5A43C 2ZG3A 4CBPA 4I5BA 2Q8BH 2J6EA 4K2UL 4MQSB 3TN0C 1A47A 3DUUB 4G6ML 4H20H 3SQOH 4PGJA 1OHQA 2VDLH 4RQQB 2XKSA 4DWHA 4RWYH 3D9AH 1KJ2A 2CMRL 2CO6B 4N90E 4P2RE 3NPZB 3KPSB 5E94B 5T3ZE 3U30B 1Y0LA 3BXNA 1GOGA 4NWUH 1FG2B 1DE4B 4XCNA 4DVBB 3QXUA 5C0AB 3QI9D 4QHKI 3VFVB 5E2WH 1HOCA 2VL5A 1UM4H 4NRXA 2ZUTA 1UG9A 3CFDA 1IMHC 2GUOB 5I1LA 2YZ8A 1G0YR 1ZVHA 2DBLL 4M5YH 2ZCLL 3WMSA 4MLIA 1JL8A 1H8OA 2JCCA 2J7LA 3L5HA 3QIWB 3WUWA 2HFFA 1CXHA 1DBBL 2BRRL 3OKKB 2FZ3B 4MCYB 1IGML 2AK1L 4MJIA 5CBEB 2AJUL 4X4XA 4B0MM 4HCRH 1FLRH 4QNPF 1FFNA 1C7TA 1OSZB 4PTTB 4MWFB 2A9ML 2WBJA 3QCTH 1V3MA 3QUZA 5ICZA 3PG2A 5DJXA 4GW5A 4U6XA 4KY1H 1FZJB 4TSBH 3BDYL 3K7UA 1CLZL 2X42A 3TO2B 3SDYH 3TYFA 4PGEB 4ETYA 1YY9C 3RKDD 2AK4D 3LB6C 3RWEA 4LBEA 1BJ1J 1JF1A 1LILA 5IFHL 1NL0L 1P5VA 1T6VN 4LFHG 2VZSA 4ZXBA 5IGXL 3QDAA 1JZ5A 3DX7B 4GSDH 1Y6NR 3H0TA 1IEBB 5DHYA 1Z0MA 4LEXH 5HI4D 3UO1H 1UWEL 1V8HA 3O3EA 3VH8A 1G7LA 4Q74A 3BD5A 2CRZA 4RFEA 1JGUH 1TFHA 3NCBB 4HWBA 1C5CL 3QDMA 1LNUA 4JHZA 2B39A 3U7WL 1CT8A 3S96B 2I24N 3D69B 1NGYA 1OAQL 1LP9E 3MRRB 3ROOA 3ROLB 3QRGL 4Z7UB 1Q0YL 2LAGB 2WNGA 1YQ2A 4UT7H 1NC2B 3IU3A 1BIIB 4YWGH 3ULVE 2DIBA 4OCXH 3O6LH 1IGTA 2BNQE 4Y4HA 3UYPA 5B3JF 1YECH 3D3VB 4Z8FL 3ULUD 5IMKA 1A9BA 1TCRA 1T7WA 2V17H 4KKLC 4PRHA 5J8OA 1CS6A 4HKZB 4R26L 4MB5A 3E6HA 4HIXL 1Q9LA 4F9PC 2DYPA 3E3QC 3QIUC 1KBGH 3FQRB 3NA9L 3GB7B 2EKSA 4JZJA 4HH9B 2IG2L 1YDPA 4JKPL 4YO0B 2K9UA 4XNXH 4LNVA 4JO1H 1B4JH 4AIXA 4LFHD 5KS9B 5DVLA 3REWB 4Y8AA 5FECA 4JY4A 1OP3H 1NGZA 1WISA 5IV2A 4NGHL 4KJYB 3IFOB 3ULUH 3ARYA 1PG7L 3GMMB 2VDMH 1MY7A 4CDGC 3QNZA 3O4LE 1CZ8H 5E9DB 5JLZB 4QGTA 5HYIA 5HYJE 1ZHBB 5IOPB 3VFTB 1IE5A 5IROA 4NKIH 1N6UA 3L9RA 2P43B 1ZGLA 5DHXB 2P5ED 5FYKD 3CFCH 1RHHB 3MBED 4X6DF 1P4BH 4QOKD 1YNTB 5DVMA 5GRXG 1FNSL 1DQML 1QP1A 3MLVL 4YBQC 4C83B 4LAJH 3MLUL 2NXYB 3O2WH 2LU4A 4DOHB 1QRNB 3QCUH 3VCLA 3ARFB 2VC2L 1SVCP 4QRTB 3W0WA 1HQRA 2APFA 3I85A 3BP7A 3RY5A 1DP0A 2W65B 3QDJB 3E2HC 2E7CA 1TQCC 4ZTOH 3GEWB 1DVFB 3W9DB 3U0WH 4JQIL 5EU6D 5FYKH 1EVUA 3T0EA 3MOAH 2O5YH 3MR9B 4LP4A 3O4OC 4L29A 5L8JB 5DUBB 1Q9KA 3WXWH 3KR3H 4G9FB 3CDCA 4GAGH 1OAXH 3FOMA 3SCMD 4NKMB 1T3FB 5GIRB 1DBAH 3OHXA 4L9LC 3BP6A 3RWCB 3TYGL 4NNPL 2AP2A 1MFDH 2EEAA 4IOFC 1MCEA 4U0QB 3PUCA 4M1GL 5DLML 3T0WA 3U82B 1QG3A 5EA0H 1E4XL 2P44B 3LY6A 3IJSA 2DQTH 3HZVB 4PRNB 2ATKB 3F7VB 2V7NB 4KDTC 1YMMB 2YD8A 2CKBB 4P46C 1QYGH 4NC0B 4LVHB 5C08B 2X1QA 5I73B 1YNKH 2H41A 3KDMA 4LK4A 1DBJH 2DN7A 1U3YA 2FATL 5LAXB 1XGRB 4IM8A 3X14B 1WBXB 3GSNA 3QO0B 4ELKA 5T33H 1KTRL 1CG9B 2FECI 3CXDH 2VDRL 2BCKB 2CK0L 4U31A 5FKPA 3L3KB 3DRTA 1CL7H 4A6YB 1NMBH 1CYGA 3OJ2C 2YK1L 4PJ5D 1QSZA 1P4LA 3N1QC 4YBLB 5EU4B 4XCFH 4BQ6A 4MA8H 4TSCH 1UXSA 3A6CL 4LNRA 1LHZA 1NCCH 4HGMA 3IAQA 4ZO9A 3PHQB 5E99L 1N64H 1X5ZA 1XH3A 4Y1AB 3BH8B 4JPVH 3C09C 5DVNA 3W11D 3DGGB 2EEDA 5D9SA 3U48A 4P0DA 2H6PB 3RNKB 4V1DA 1IZJA 3FTGB 4GKNA 2W0FB 4TVPD 3HZMA 4F3FA 4I8DA 2PXYB 1J8HB 4JDVB 2UWEB 4FTVB 4LSTH 2EH7L 4JJ5A 3U1SL 4CW1A 2NR6C 3W82A 3HPLA 5F3HB 2B2XH 4HLZH 5KAQG 3WO4C 1EXUA 1YYLH 4UIMB 2YXFA 4AENB 3LQZA 2ZG2A 4QF1B 4WTWA 4TVPH 3FT2B 4FZ8H 1P7QB 5C0DA 5D6CB 3BQUD 4X8XA 4YHML 4KI5C 1A4KB 4J4PC 5KSAC 3UJJH 1PKQE 2BVPA 4EBQL 2C3HA 2EDOA 1EZVX 4GBXA 4HWZB 2UZIL 3AM8A 2NXZB 3HG1B 1MI5D 2DLIA 2NX5D 3GMRA 1U8MB 1MCBA 5D8JH 5EBMA 1IZKA 1U93A 5KSBB 1UH2A 3HLAB 1RULL 1BX2A 1ZVSB 2YC1A 3G08B 4RWHA 2Y72A 4UQ3B 2KBGA 4MD4B 2R39A 4RZCA 4XI5C 3CVHB 4DFIA 3QIBB 5CCKL 4QRRD 4PJ8D 3OMZA 3CK0H 4LSQH 3LKSA 4I13B 2WWMC 3RWFA 1T2JA 1T89C 4AMKH 4TUKL 3EOBA 2JCCF 4X7CC 3GI9H 1V7ML 5D1XB 4I0PC 2V7HB 4JY6A 2YUVA 1K4DB 3N06B 2C4XA 4JKWA 1JUFB 2XIDA 2W07A 4WU7B 5J6HB 3QXVA 3J8F7 1KIPA 2WUBL 2XWBA 3SE8H 5LWYL 3VFOA 4JFDB 5IFAH 4LDEB 3GRWL 1A1MB 2LABA 4WY7L 5DC4B 5IESL 3BKYL 5F88A 2AEQH 5A2JH 1FH5L 3OGOE 1DBML 4GW1A 2H32H 5E6ID 3FMGL 4ZSOE 2DI7A 3L5JA 3QDHA 3DHJA 1KB5H 3HFML 3QNYB 4LGRB 3IDIA 1SJXA 4X8JB 3T1WA 4XBPA 1VCAA 3FCTA 4NSKA 5HHME 4XT1C 4U3XA 4ZFOB 3VXTA 3H3PH 1KTKE 4XP5H 2VZ1A 3FQWB 1P4IH 4I4WB 1CLOH 4PRDB 3RGVD 1HIMH 1S9KC 2RIKA 3OKMA 5KVDH 2A77L 1HQ4A 3GJEA 1RIVH 4ENEC 2CKNA 1JF5A 2DLTA 3BEVA 5FV1L 1D5XA 1Z3GL 4C56D 7CGTA 3N0PB 1ZV5A 1H5BA 2ERJB 2P5WE 4PJBA 4QHUA 5D2LA 1T2XA 3MV9B 2BMKB 4M1DH 2GAZB 3EHBD 3EOAA 4Y16A 3QUYB 4F9LC 1FFOB 4PB9L 3D85A 4PJIA 1RUAL 4HK3N 1TLKA 5GGSB 2CJUH 3SDDB 3EYFB 2R2BA 3O41B 1M6OB 2GFBA 1BFOA 2XXCB 3BRGC 5AWNL 1YY8B 3WJLC 2WINB 3I9GH 1AQDA 1A4JA 1JGDB 1T22A 4JQXA 3A0OA 5I15H 1AKJB 2GJ6A 1S9WB 4PB0L 1JHTA 4WNQA 2M8XA 2QQNH 4TRPH 1SY6A 4JO2H 1BAFH 3ET9F 1DANT 2XTJD 4Z7OE 1JTOA 1O5DT 1TZIA 4Q6IA 4EEEA 4CVXB 1BBJA 5KOVC 1E4WH 4KK5D 4OLVH 3ARTA 3MYJA 2FWOA 4YX2H 3BMWA 3HE6A 4U1SB 4PUBH 4AIOA 1T0NA 2L4OA 4ZD3L 4OT1L 4N9GB 1D9KB 1PFCA 5IMMA 3MRIB 4AL8L 1VFMA 2BX5A 4YH6A 3KPPA 4H8WL 3DV4A 4BSWA 3QUXA 5JW3H 4MNQD 3IU4H 4K94H 3OR7B 3PGCA 3RZCC 4X9HA 1I1YB 4N5EC 4AEIH 5KN5A 2AJYL 4J6RH 4J3XA 4KVNL 5DFVC 2V5YA 3UAJD 3TT1L 2MOVA 4F37F 5F9DC 4DTGH 2IANB 3QXAA 1DTUA 1D7FA 2YA0A 1UCTA 3C60C 3LMJL 2EDQA 4NNYB 4K23H 3CD4A 4G8FB 1NC4A 4GS7B 5GZNC 4N0UE 5J0BA 3OKNA 4R4NC 5DEGB 2VISB 3SQOL 2VDLL 1ADQH 1XIWB 2VQ1B 2JIXA 3B9KD 3D9AL 4K9EH 4LPXA 4PG2C 1OGTB 2EE6A 1F42A 4LF3A 4QRSB 4XHJD 2NY2B 2J8UB 5CWSB 5CSZA 2GT9B 1NKOA 2CUHA 1FIEA 3PDOA 3V52H 5IG7A 1Z0NA 3BN9D 3QWRD 4HBCL 1TETL 3P4NA 4G8GB 1FL6B 4XCCL 3HC0B 3P73B 1WFNA 5EORH 4MDIB 1HINH 2CDEA 2UYLA 3CPLB 4GFTB 1KJVB 1UM4L 2ADGA 3PQYD 5B8CC 1MJJB 1FZKA 3MODH 3QULB 5BS0A 1OARL 2ZJSH 3PWPD 1K8IA 5GSVA 2OSLB 4YK4C 4M5YL 2OQJB 4YEFA 2A74A 2CRMA 1RZJC 3HTLX 3F12B 3CVIH 1YQVL 4Z18A 2J12B 3SE4C 3LN5B 1INEL 3MJ8A 3V6ZB 4M02A 1LD9B 4PLJC 2HRPL 5BRZA 2L7JA 1KULA 5EZIL 4ELME 4IRSD 3F5WA 4NZDA 1I85A 1U91A 4MAYB 4HCRL 1CLYH 1DQQB 1FRGH 3TA3D 1EEZB 1DUZB 5E08H 2XQYK 5ESVA 2H2PD 4PYHA 1HHJA 3NTCH 1U58A 3QCTL 5C0IB 5MEQB 4GG6A 1DEEA 4WW2B 3QEGH 2GYSA 3IDUA 3JXAA 4KY1L 4PGBA 4TSBL 5I8CB 2NTSP 2Z8VC 2X10A 1SJEB 2DIAA 5FKAA 1NGPH 3HCVB 3QJFA 4DUXA 4Q9BA 2FO4A 2BXYA 1L6ZA 4L8SC 4KK8C 4Y4FA 1FYHB 2EKJA 3O6FB 4WU5A 3FQUB 3MA7B 4EOWL 3MZGB 3C6LC 4FFZH 1IAOA 4YGVA 3BVNB 2VZ3A 4P5MA 1UH3A 4FXKB 2WP3O 4GSDL 3VGBA 4P4RB 4YNYA 3EGSB 4PREA 5JW4M 3L95A 4ODHH 1YEGL 4UMGA 3IDNA 2XN9D 5J7CC 5GGRA 3TO4C 1U92A 1GPOL 5DRXB 4L3EA 2N56A 5E6YA 3EAKA 1CF8H 5HY9A 1JGUL 4EUPG 4IJ3B 4NO0B 4HXAH 2R29H 1MCJA 4V2BA 5I66A 3CUPA 3S98A 1VADB 4GXUN 2R9HD 3CSYB 4PJCA 4YHPB 4NFBA 3U9UB 3MRLA 2NY6B 4UT7L 5I1AA 1XGUB 3QQ3A 5D1QC 2P8LB 5DURD 4YWGL 4OCXL 4YPJA 2OTPA 3D0VB 1YECL 1A6TB 2DF3A 3M07A 1K3ZA 1QA9B 3KPNA 1SBSH 3RUGE 4BUHA 1KBGL 3AXLB 4KV5F 4LLUA 1OD9A 2D7QA 5D7LB 3MRGA 5L2KE 2H2SD 4DCQB 4M7LH 4JO1L 3H9YA 1BJMA 1B4JL 4I48A 1AGFB 5IB5A 2CIIB 5F7YC 2EIEA 4MJ2A 2IBZX 5B39B 3WE6B 2I60L 5M7QA 2VJXA 4YHYC 1P84K 5GGTH 1HNGA 1W72B 3KLHC 1HHHB 2JJSC 2GSGB 3MRKA 4HMCA 4YR6B 4HS8H 3RQ3A 5FO8B 4NKIL 4J3SA 5ALBL 3U4BH 5JMRA 3T08A 3CFCL 2APBA 4P5TD 3PHOB 1P4BL 2VLLA 5IW1A 3MNVB 3FRUA 1EO7A 1YEJH 3MCLH 3MRCA 4ZYKB 4P5KA 3KPLB 3O2WL 4NQDA 1FVDB 3QCUL 5T3XE 4ZDHA 5DMJB 5CMAA 3D39E 3TBSB 1GHFH 4OFYD 4WI7A 5SWZA 4AIZB 1FL5B 1VDGA 3SDXF 5EO1A 3RWDA 3TCLB 3WLWD 1NBYB 4R8WH 4ZTOL 2H26A 5D2NE 2GIYA 3U0WL 5FYKL 4HUKB 3I6KA 3T1FA 2ZWLT 2W9EL 3MOAL 1Z5LB 4YDLB 1GC1C 3UTTD 3VRJA 5T1LB 1QHPA 3OKYA 4LLWB 3IDJB 3WXWL 2EDTA 3T2OA 1QNZL 3KR3L 4OLYH 3DURB 4LLMB 5F6HJ 1S7VA 5I71B 3MV8B 1LK2A 1N0XH 1RJLA 1SJHB 1F3DJ 3RL1B 1DBAL 2IFGA 3SPVB 3D18B 4O2EB 4JFYB 1MFDL 2KKQA 1MFEL 3T77A 3KYMA 1UFUA 4OZFA 4P2OD 4H25B 1J05B 3ULVC 3FT4A 1R5IA 2XOTA 3O2DA 3RVVC 4HIJA 1CFVH 2RR3A 1OP5H 5EA0L 1RK0A 1NCWH 3GSRB 4KI1A 1TNNA 2DQTL 3M8OH 1CL7I 3S4SA 5I74C 3ZHDA 4JHAH 4F15B 2ZNXA 3HE7B 4WHTA 5EU7E 1CICD 4HC1L 2AXGB 2B8OT 2FX9H 4HIIA 1YNKL 1DQJB 3BMVA 5C09A 4PJBF 5D2LF 1CFTB 4FQ2L 1LEGA 2X4SA 3RVTD 5FEBA 3B2UC 5J6GB 4TTGA 4QNPE 4PJIF 4E0RB 3P9WB 4PY7A 3DTXB 3LIZH 4NQEB 1HYSC 3CXDL 3PJSB 5AZ2H 1NJ9B 1LO5B 1UEYA 3QUML 4WHDA 4FG6C 4KQ4L 5CHNB 4MJ5B 1R3KB 4A2MA 4M62L 5CZXD 1YJDL 1IKFH 2AQ2A 2ORBH 3MUGB 4MA8L 1G9NL 1MWAB 5CINL 3MLWH 4I2XA 4MQ7A 1I9RL 1U3HD 3K74B 4Z0XB 4WI4A 1OD7A 4NKDA 4JPVL 4DK3A 3ZTJH 1I8IA 3NCFB 2XRAL 3TBVA 1WZMA 4I1NB 2YWYA 2ZSVB 3CZJA 2LU7A 3B43A 5L7XH 4Y2DC 3ZKXB 3DROA 3MO1A 2G60H 3T65A 4RGOH 5MEPB 4KJWD 4FABL 1EHLH 1ZMYA 1N4XL 3KPSD 5F7DA 1IEAA 4X5XB 3MA9L 2ICEA 4ZS6D 1MHHA 1N59B 4M7JH 1VESA 5EFIA 4TVPL 4ALAH 5SWQA 5E5RB 4J3OC 3D87B 3EO0B 3MGOB 5B3JE 1KGCE 4LHJB 4QRPB 1D6VH 5MENA 2ESVA 5GS1C 2PN5A 1YN6B 3HA0A 3HI6H 2HVKA 3ECBA 3ARPA 3NN8A 3QIWD 5D8JL 3CDYA 2VL4A 1JRHL 1NKRA 4OZHA 2W60B 3MRHB 3EFDL 1YMHA 4BH8B 1S7WB 1N5AB 5J1AA 2NYYC 5HI4C 1KPRB 4BK5A 4OKVB 2VLKB 2QSTA 5DRZB 3CK0L 4LSQL 3WNPA 2FBOJ 1FE8H 4AMKL 4Z6AT 1A3LH 2EH8L 4APQB 1F6AB 4OV6F 3GI9L 1KPVA 1W0WA 5FYLD 5JIHA 1HCFX 1NFDB 2R23B 4P2RD 4RIRB 1MVUB 4KKBC 3SY0B 1G1CA 4LPYA 2XXMB 5T3ZD 1MAJA 4NDMB 1MQKH 1N6QH 3UC0H 4X6DE 4K71C 2ED9A 2YD6A 3SE8L 3E0GA 2D4DA 5IFAL 2XWJA 3ARDD 4XVUD 4BQCA 2APVA 3QG6A 4GG6F 2DD8H 1T0MB 3ULSB 2KQNA 3VWJB 5BJTA 3PWNB 3CZFA 5F8QC 5T3ZH 1AGCB 5CGMA 3TN0A 5L8LB 4P3CL 2ZG1A 2ZSWB 4OZIE 3REVA 4MJ4A 1WCBA 1SEBB 3BDBA 1KB5L 3UYOD 5DD6A 1U0QA 3MLYH 3GK8L 1I7UB 1BZ7B 4YPGA 4JPKH 1I7TA 4LLQA 1LO4H 4XNZC 5DJDB 4LCWA 8FABB 2JJWA 4HT1H 2DQJH 3GSXB 1F97A 4ODTH 2NY3C 2B5IC 5F7HA 2R8SH 1RUMH 3H3PL 2EDXA 4IS6A 4WV1C 4XP5L 3EFFA 1P4IL 1JWUB 1IGJA 3BN3B 4EI5B 1NC2D 3KXFB 1EAPA 1PJ9A 2W91A 4L4TB 4U7SA 5FHBL 1CFBA 2VXUL 4LSRL 4PV8B 4RMSA 4CVWA 5LQBH 3FN3A 3D3VD 1RIVL 3UJIH 5FF6B 4QXGH 4U7KA 1I7RA 2XNAA 2F8XC 3EYVB 5C0BB 4PJCF 4P23B 4M1DL 4XP1H 5FO7A 3LEXB 5J11B 4MD5A 4OIIH 3TNMA 5FO9A 3GI8L 5JOFA 4OGAD 1OTSC 1S9VA 2A6DB 5BXFB 5D1ZB 5BZDA 2CLZB 3HC3H 1Q9OA 3G5YB 5DJ8B 4KKCD 4NQVB 3DX9A 5I15L 1DLFL 3F7YB 3HZYB 4BQ9A 2F53B 5GGQH 2PW2B 5E9DD 3BPOC 3RU8H 2QQNL 1MCOH 4MXQC 4KUCF 1HHIB 4JO2L 1I9JH 2VXVL 4WWKC 3I84A 3F6LA 3UBXG 4XVTH 2OJEB 3LEVH 4M7KH 4OLVL 1GAFH 3MCKB 2ZUQB 4G6AD 4YX2L 5EUOE 2C3WA 5EO0A 3EYQD 1GC1H 2NXYD 2O5XL 3O3AB 4GRLB 1QRND 5I6XB 4E5XA 3ARFD 3DXAB 4OF0A 4URTB 5JW3L 3RWHA 3MXWH 3IU4L 1C5BH 4LU5H 4RGNE 4K7FB 2YR3A 1U8IB 3QFJB 2AXJA 2FHCA 2IJ0C 5SWSB 3QDJD 3Q48A 4ZNEE 3GSVB 4J6RL 1DVFD 2BVQA 1H3VA 1R5VA 2FJGA 3N1GC 2YPLA 1JJUA 1JNHA 2OZ4A 5C0CB 1UXWA 3IFPB 2XFXB 1A1NA 2PYEA 1DFBH 1HI6A 5JPNA 1OTTC 5AZEH 1TENA 1HK6A 4U4BA 2VLJB 5GSRA 3VDAA 3ILPB 4N8VA 4G9FD 5DD5H 5IIEB 1IL1A 3PXHA 3HRZB 1M71A 2AEIT 2VDKH 3NBNA 2IAMC 4F33B 1H3GA 5DZOA 2IC2A 3MACL 2DWDA 4X6CB 5D7SL 4L4VE 5IEKB 3RDTB 3IXTA 4CMHC 4F9PA 5EC2B 3QIUA 5GGUA 5HVFB 3V52L 4Z76A 4OM0L 4POZD 3ARRA 4TUJB 1QFUH 1FNGA 2EYRA 5EORL 1HINL 5CIPB 4G6FB 1YMMD 1ZT1A 2IALB 4B7IA 3PNWB 4O4YL 5E95B 5C08D 1TCMA 3JTSA 3L7EB 1DL7H 3G6JA 4OUUA 3RPIA 1OWWA 5DI8A 1LO2H 3O3BA 3D48R 2Y9RT 1PEZA 5ILTH 1KYOJ 1GZQB 1IARB 3QZWB 5I1GL 1UACH 2AJXH 2E9IA 4X7DC 1B6DA 3O3DB 1CLYL 4OI8A 1CD8A 2X4QA 4JO3L 4NQCA 2BY1A 3EYSH 4KU1A 3V5KA 4MJ6A 5E08L 5F93C 4N1CA 3KYKL 4M6NH 2KL6A 3OKLB 4NHUA 4B7LA 3UEZA 5CGYD 1FGVH 3IXAB 4MJIE 4K07A 4TNVK 3QEGL 3FO0L 5ICYA 4G6KH 3QPXH 4PJGE 2HTKD 1VERA 2H45A 4I5BB 3P40A 1NGPL 5FCUH 1V05A 4XNQB 3W5MA 2RBLA 3AAZB 4OTXH 5I1DA 4EZMA 4H1LH 2RB8A 1JNJA 4HMEA 5H94A 1YEIH 5L2JA 3BP5A 4K3JH 3SDCB 5MI0C 4OQTA 1QSFB 4U0RB 4NBZB 3BXNB 4FFZL 2PXYD 3JTTA 2EDWA 4PJ8C 4FTVD 4XCNB 5GS2D 5A40E 3LVEA 2O5ZH 4PJXE 4PRAB 5FUZL 1HOCB 2X44D 4ODHL 4WEBL 2VL5B 5JUEH 3S36H 5IFJB 4L9LA 1AO7A 3WN5C 4NRXB 1AC0A 3CFDB 4NRZA 1CF8L 1R3LA 4QHLA 2E7HA 4HXAL 4OV5A 2R29L 4M4PA 2A73B 4M9PA 5ISZE 2VDNH 3SKMA 2JCCB 1BJ8A 4XXCC 4Z7WA 1P7QD 3FHAA 5FYJE 3WUWB 2HFFB 3KWWB 5GS2H 1OSPH 5F1IA 2EYTA 4D9QE 4BFEA 2NXZD 3V4VH 4XP9L 4KDTA 3QDME 4Q0XL 4P46A 3U4EA 4X4XB 4NOFA 5C1MB 4Y5YC 2DTSA 4X9BA 3QWOA 1FFNB 5IQ7H 4X6FA 4J8RA 2F15A 4PFEA 2WBJB 1F4WH 3S37H 1VFBA 1MEXL 3CFJA 5T1DH 5ICZB 3MV7E 4KUZH 4GW5B 3QIBD 1AD0B 4K3DH 4U6XB 3J7HA 4UQ2A 4PRHE 1B3JA 5CKGA 2ADIA 1XGPA 5D1XD 5IB4A 3ARGC 1NSNH 4OZHF 5GGTL 5JHLL 2PO6B 4O02L 1EHXA 1YNLL 3ZDXF 4MVBC 3QXDB 4L9DA 4QT5A 2NTFB 5BMFH 3CVHH 3GJFH 5E4EB 1IKNC 5K9JH 3AS0A 3MRDB 4HS8L 4JFDD 3U4BL 2E6PA 4OCWH 5DHYB 4OD1H 4CMMA 3OKEB 1S8DA 4L1HA 2CR3A 3VH8B 2KZWA 3MCLL 3UTOA 1JNLH 4RFEB 2OTWA 5D7JC 3GSWB 3MBXH 2J8OA 1LNUB 4UTBH 5KVFH 4LCIL 1GHFL 3H42H 1E6OH 1T2QH 2CR6A 3GMLB 2X7LA 3NFSH 1NGYB 3G5ZA 2O93L 1NUDA 1T83C 4KK6D 4PR5A 4PJ7B 1WIPA 3QG7H 4N0RA 4R8WL 4J3VA 2AERT 4G7YH 2D7OA 4WFHD 1MF2L 1SM3H 1IGTB 4PRPA 4WFED 3V8OA 5TPWL 1NCAH 2Y7QA 4H0IA 4LASH 2HH0H 3W0WE 5IMKB 1TCRB 4KK5C 4KDWA 3TZVB 4YXHL 3E6HB 2QQLL 1Q9LB 4J4PA 3IKCB 5CLTA 5KSAA 2VITB 2DYPB 4Y1AE 2X1PA 1XCTB 2VXSL 5GS0D 1N0XL 2EKSB 4LCCC 1YDPB 5KW9H 5IVXB 4BSVA 1G7IA 3JV4A 5F1OB 1H3UA 4HFUH 5FYKU 1JFQL 5FECB 4JY4B 3VMOA 1NGZB 1R3IL 3MV9D 2AQ1A 4W4NA 3QUYD 2M2DA 3T8XA 3RP1A 1OT2A 4GKSA 5B4MC 3RVWC 2V5TA 1M7IA 2JELH 1IILE 4JLRA 4GAJH 1T89A 4F7PB 1OQXA 3M8OL 4S2SA 3TESA 2OL3L 3L9RB 1AKJD 5I16A 3VXMB 2VABA 3HPJA 1ZGLB 2BK8A 3GMPA 2JJTC 4I0PA 5CD3A 1PY9A 2FX9L 3RTQC 4P9HH 1JI2A 1KIQA 2CDFA 5H37G 1OLLA 3VCLB 4N8PA 5IBUB 3N85H 3K4AA 2PR4H 5IWLC 5ESQA 1HQRB 1JWSA 1INQB 2IPUK 3L5WB 1D9KD 2X5PA 4ETQA 4JFXA 4FFWD 2A83A 1KJMB 4OJFH 5DDHB 1B2WL 2D31A 3SJVE 5DJAA 5F1SA 3T0EB 4AEHH 2W92A 4LVNB 5I75C 1A7RL 3O45B 5IB1A 1XT5A 1BQLH 3CX5J 4GG8B 3L3GA 3I50H 1B9ZA 4OAWA 1Q9KB 1Z9MA 3T3PF 1UWGL 3JV5A 4X6EA 3FOMB 1MJ8L 1AR1C 4KROD 1A7QL 4Z7VA 3BEWA 5DR5H 3MJ6A 3OHXB 4Y5XC 4KKAC 3UMTA 4MNGE 1BP3B 1JV5A 4WI5A 1U8HA 2MPAL 4Z9KB 5T1MA 4W6YB 2G60L 4RGOL 3WL9A 4ZUSB 1XIWD 3U9PH 4R0LB 4HJ0D 2XICA 35C8H 1PZ5B 3BRDA 4NP4H 1MLBA 3IJSB 5CD5D 5HHNA 2NY2D 2FYYB 5I8EA 5TQ0H 4PD4K 4JVUA 5IVOA 3KGRA 3FZUD 4G8GD 4F9LA 1AI1H 2OS7A 1OGAA 4ALAL 3LS5L 4BYHA 1WBZA 1Z9OA 3Q6FB 4R7NA 2HJLA 3GSNB 4EXKA 3WJLA 1RUKH 3I3BA 1UWXH 1D6VL 5JR1L 1X5AA 1FPTH 3HI6L 1G9MC 1QO3A 3LOWA 4WGWB 4QY8A 1HH9A 2PTUA 5CP7A 4KV5E 4NJAH 3DRTB 1SEQL 1X5KA 2X4RB 1CXEA 5DFWH 2WWKO 1F90H 3WDJA 4FQQB 2EYSA 2QSQA 1GGCL 5KSUA 4CN6A 4R97C 3BPCA 4LNRB 1RK1B 2WLYA 1A6ZB 1IC5H 1CWVA 1VB9A 4QHNB 3C08H 1BOGA 3WEXA 3WHE0 1FE8L 1MFNA 2ZCKH 1TVDA 3L3DA 2R9HC 3G6JF 5DUMH 4ZUUA 4GKZA 3IB4A 1IRAY 1KACB 4V1DB 3RIFF 1MQKL 3RZCA 5HGHA 5I1EH 2H1PH 1KIRB 5JW4Q 1JPST 1CU4H 5CEYA 4WUKH 2IH1A 4M1CC 3OF6D 4JJ5B 4U49A 3O6FD 3G5XB 4PTUA 4CW1B 3IVKA 1GSMA 3HPLB 3JVGC 4ONHA 2P24A 2JKXA 1EXUB 5B39G 3INUH 4L1DA 4UI2A 3SDXE 3C60A 4NM8H 1P53A 5FYLL 1N5YL 3LQZB 1RU9H 1K3IA 4Y4KC 1A6AB 5F6HI 5C0DB 1GGYA 4PG2A 4L3AA 3WIFB 1JZ8A 4NO0D 4JPKL 1LO4L 4HT1L 2DQJL 2BSSB 3LQAH 4RDQG 4TNWF 4ODTL 1AXTH 5EBMB 3MLXH 1FYTA 1CDCA 1RUML 4R2GB 4QXWA 2NY6D 1BX2B 2YC1B 5I2IB 5E6ZA 5JZ7C 4W6WB 5B8CA 5I1IH 3CLFH 4RZCB 1ACYH 4MA1C 4UBDC 3Q1SH 3UJIL 2FX8H 2A0LD 3SE4A 2DICA 3RWFB 5HHQB 3LKOA 4ZPTA 2JJVA 3EJYC 3EOBB 2G75B 1DR9A 5IBLC 1NUGA 3VXSE 4Z7WF 3GKZA 4X98B 5D7LD 2HVJA 5E8OB 2VUYA 4XP1L 4WUUE 1LDSA 1R6VA 2R0LH 2OCFD 3BAEH 3PIQA 2W59A 3QAZB 2XWBB 4FP8L 3HC3L 5F9WB 4JFEE 3VFOB 4PJBE 5D2LE 2P8PA 4BZ1H 1ITCA 5GGQL 1FCGA 1BD2A 4PJIE 3RWIA 3CMOH 3RU8L 1QOKA 4DZBA 2MCPH 2BSRA 4XVTL 1ZLSH 1GAFL 4L8SA 4PJ9D 2GJ6E 2O26U 1MCIA 5TJWK 3WSQL 4UAOC 5FFLA 5LKNA 5I17A 4OCNC 3PL6C 3IDIB 3C6LA 1EEYA 4UTAH 4NSKB 4MXWH 3MXWL 1KN4L 4XWOD 1MRDH 3VFUA 1ONQA 4KJQD 4LQFL 2GEEA 5CZKA 3TO4A 4DGIL 5BV7B 3ZYIA 3HS0A 5DEFB 3JWOH 5HPMB 1OF2A 1WWCA 4RFOH 4N1EA 3OKMB 5K9KA 2HFGH 5DT1L 2Z93A 4XZUA 5T1LD 1S7QA 1DFBL 4FQPA 5GGVH 4JFPB 1A9EA 4ZUTA 4YQXH 3MLRL 1DLHB 3BEVB 1D5XB 3NGBB 3P30L 2OK0H 1OCWH 1H5BB 5D1QA 3VXQB 3MV8D 4ODUB 2Z0BA 3EOAB 1PSKH 4FMKA 2GSIB 5AYUL 2J8HA 5C6TH 1PYWB 1FL3A 2GFBB 1BFOB 4HV8A 5C6WH 1TQBC 1JPTL 5CZXC 1A4JB 1T22B 4F7EA 3B6SA 5INCA 1JHTB 3AREC 5DGQA 1AHWB 2A6IA 4KI5F 4NJ9L 4LEOA 4LCUA 4OFKA 1GIGH 3BO8A 4Q6IB 5JHDB 1BBJB 1SQ2N 25C8H 3OTTA 1CK0L 2I25N 2OI9B 2P48B 3MYJB 3H8NA 2FWOB 3BPLB 3RX5A 5HDBF 4MGXA 4JFOA 2R2EA 2HFEA 3K1KC 3X3GH 1DN2A 1ZA3A 3C87A 4KJWC 2JJSA 3DV4B 1ED3A 2QADD 3QUXB 5L8KB 1UACL 5DMGD 1T1YA 4ZS6C 4X9FA 5IJVA 1NBVL 3ARBD 2WBWB 3PGCB 5C0FB 5TDNA 2FX7L 1V3KA 4Z5RA 4YDVA 4M6NL 2MCG1 5C07E 2C3XA 2D0GA 3I6LD 4LLYA 1KIUA 1EJ6A 1FGVL 1R3HA 3PWUA 5HDQH 5B3NA 2NZIA 5BW7C 3WFEL 5IQ9B 1ROWA 2ATPB 4G6KL 3QPXL 1PX3A 5FCUL 4XPBH 1AGEA 1E6JH 5D93B 2DDQH 1VKXA 3MRPB 4K8RC 5FOJA 5D72L 2IQAB 1YEIL 4GXUM 4RMTA 1NCNA 4RGNC 4A6YL 2JIXB 5FGCB 1WC7A 4U1KA 4YFEA 1NQBA 2GITA 5CSZB 2DTML 4GRWE 1MWAH 2DM2A 2GK2A 3QP3A 3RIAK 4AT6A 2O5ZL 5IG7B 3P4NB 3V8CA 3IF1B 3IS0X 1LEIA 3S36L 2PNDA 3B8YA 2UYLB 4LLVA 5D96C 4Z7VF 1FZKB 2GW5A 1LP9A 1T5XB 1NDMA 3RHWK 5BS0B 1NDGA 2NZ9D 1AP2A 5BO1H 5E70A 1MHPH 2A74B 4N9OB 5J56B 2N7AA 4PLKC 4FFYH 4X99A 1EERB 3ESUF 4R3SA 4JZNB 3SDAC 4M3JA 4Q97A 4L3EE 3TPKA 2Y6SC 4QRPD