2FCBA

Human fc gamma receptor iib ectodomain (cd32)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
173
structure length
173
Chain Sequence
b'APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FC GAMMA RIIB)
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of the soluble form of the human fcgamma-receptor IIb: a new member of the immunoglobulin superfamily at 1.7 A resolution.
pubmed doi rcsb
total genus 37
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 1999-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fcbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fcbA02
3UO1L 1WWAX 1JZ2A 3G08A 1C5BL 3CX5K 4O2CB 4I18B 5CBEA 4LBEB 4L9DA 2A1WL 1RK0A 5HGDB 1MNUH 3M17A 5EG6C 2AABH 2DD8L 5JMOC 2KKQA 1HHJA 4N8VA 4K9EH 2A73A 2AJYL 4GS7C 3IT8D 2OJZL 3FRPA 1J8HB 3FO0H 5IW6A 3B6SA 3LMJH 4PRDA 1B4JH 1U8QB 1JZ5A 3RNQA 1NBVL 2VABA 4HBCL 3QDJD 1QSEB 1HXMB 1CXKA 2VITB 1DLHA 2W9EH 4P5TC 4MCZB 1D9KD 4XT1C 2ADJA 2VDRH 2GSIA 1IJ9A 3C8KB 3H3PL 1XGPA 1T83C 2AV7B 1REIA 3MLVH 3BT2H 2AP2A 1B4JL 2PF6A 4ODWA 2VDKL 1VADA 4LP4A 1AI1L 2SEBB 1S3KH 4KTDL 3F7QA 4RFEB 1X4ZA 5DD3H 2QTEA 2JJWA 2VDRL 1NCBL 1VGEH 1ZVSB 4XCFL 4HJJH 2F8VA 4CN6A 2ESVB 3NTCL 4MDIB 2D7QA 2EC9T 4XCEB 2DQGL 2XYCA 3AC0A 4LSRH 4XC1H 4KHTH 2OJEA 1KTRL 4Z18A 4EJ1C 2C3HA 1T0MA 4AIOA 5HBBA 4P9HH 3KJ6L 4NGHL 5FF6B 4Z7NE 1PYWB 4J1UA 2ZNXA 2HRLA 4OZFA 4X98B 1S9WB 1ZA6B 4K3DH 4HKBB 2VXUH 2N7AA 1MCEA 3PHSA 3U0PA 1MCNA 3OB0K 3D69B 3DBXA 4YIQA 1JIBA 3F5WB 3HS0A 4URTB 1CFNA 1INDH 3HE6D 3FT3B 3GMOA 3ISWA 2H26A 3I3DA 3L3OA 2DQDL 1AIFB 1I1FA 2DRUA 4D94A 3EOBA 1MHHA 1IGML 1J8HA 5ADPH 3GSQB 1NBYA 2DTML 2YUVA 4CU8A 4LAQH 4ONFH 1XCTA 1LEIB 4HXBL 4PUBH 2OSLA 4U31A 4G42B 3TA3D 1WBXB 1KLGB 3O6FC 3VFTA 1PKQA 1S9YB 3RTQC 4X6CF 4OV5B 2DKSA 5J0BA 4P23A 3QXUA 4JO4H 2F53D 1WIUA 2OYPA 1BBDL 4DN4H 5JPNB 4XPTH 4MNQB 5E0QA 4H26B 1CIUA 4JFHD 1B0WA 3LAFA 2Q86A 3VRIB 4WFHE 4FZEH 4Y4KD 1P53A 5E1AB 5DMJB 3PNWA 3ALWA 5DO2C 3D39A 4F57H 2YS4A 3T1FB 3WS3A 1BBDH 2NY0C 4DN4L 5EU6B 1E4XH 1FLTX 1N2RB 5E00B 1HDMB 4G8EA 5HJ3B 4M7JH 5E8OA 2AEQH 2O5ZH 5J6HA 1BVZA 2AW2A 4MWFA 5CJBA 5ICYB 3DROA 5IGXL 5LGKA 1Q9LA 2WQ8A 1EFXB 4I2XA 1VEOA 4ZAKD 1ULVA 3R06B 4J2XA 3LKNA 2FDBP 3TGXA 4Z5RB 4QTIH 1IRAY 1P5UA 2WP3O 4PY7A 2UUDH 3SJVA 3NFSL 3C9NB 5LBSL 3GSVA 1UCBH 3CXDH 1A8JH 3GMRA 5AAMA 4FNLL 2P8LA 5GZOC 4YPGA 1NC4D 1C5DB 4F7TB 5HYQA 5KZCD 4M3KB 3O2VL 3GMQB 2VSDA 3KYOB 3V4PH 4UTBH 4BYHA 3NFSH 1MRDL 1DQMH 5IQ9B 1QSED 5HGHA 1YC7A 1GC1C 1QRNA 3QUYA 3GK8L 1EPFA 4HGMA 3CIQA 1BJ8A 3RVTD 3SDXE 4P3DA 2VR9A 2ZUTA 3DNKA 3CFKA 4KUZH 1YMHA 4LIQE 2YMXH 1QFWM 3DX7A 4GG8B 4JFEE 1CGUA 5DQ9A 1QR4A 4LSPH 4LSVH 3O2DL 3D9AH 3TNMA 3F12A 4JPWH 3CK0H 5E8DL 4MD0B 2NNAA 5FYLE 3WSQL 5C70A 3UJIH 3PWUA 4KKLC 5LWYL 4NNXA 4TULL 3LHPL 3O4OB 3EOAB 4MAYC 1A1MB 1DSFL 3HI5H 5GHWL 1R5WB 3SOBL 4AZ8A 5KSAD 3VXSA 2GKIA 2GAZA 2CO7B 2YEZA 4LDLB 1U41A 1R3JB 2AK4A 4IM8A 3EYQC 1U8HB 1JHLH 4NO2B 3FOMA 4XNYH 3RZWA 5ICYA 1TETH 5LWYH 3QIUD 2YHGA 1UXSB 3PGFL 3LKNB 1RZKL 2FX7L 3RA7L 4P9HC 1I8MB 4YHYB 5IESL 5C9JA 1ETZA 4L3EA 3RKDD 1E4XI 1X6NA 5ICXA 1YDPA 1A3RL 5EORL 5HD8D 5DZLA 3RL1B 3L3KA 3WHE1 1QR1B 3F7RA 3QJFA 3BQUA 5LQBL 4KRNA 4QF1B 1F42A 2APFA 1JNHB 3BI9X 2GK0B 5D1QD 5CEYA 4KRPD 4Y5YB 1K5NB 4ZUTA 4XNMB 4YE4H 4I2XE 2VWEC 1JHKH 4A6YL 3MV11 4K3HA 1MRFH 1JPGB 2QEJA 2VNCA 1WT5A 1HKFA 5BOPA 4GW4B 1MEXL 4R8WH 1HWHB 5AZEL 2VABB 5A2LH 4X6DF 3D39E 1L9NA 2AXFB 5DD0H 3UYRH 2ICWA 4LDEB 2WINB 4IRZL 3PWUB 5D7LD 1SM3H 5FKAB 4LFHG 1PEZA 5JQ6H 2ERJC 4ODSL 5AWNH 3FQWA 3MYJA 2CLZB 1SJEB 5K59E 4R4FL 4OD3L 2XKNA 3AU1A 1AE6L 3MZTA 1TZGH 3RKPA 4PV8A 3ZKXB 5JQ6L 5F70A 3SKJL 4GW5B 5CIPB 1GOHA 1UZ8A 4R2GD 1OCWL 1ZGLP 3ARDA 3RVVC 4RGNC 1UB5A 2BVQA 1I85A 2C1PB 3JWOC 3KR3L 1PJ9A 4ODTH 5DD1H 3D5OF 1NDMA 5ICZB 4OZFB 1KPUB 3I6GA 1DQDL 1RUQL 4YHML 5DGQA 4XVSL 5HHNA 4ZYKA 1JNHA 4YXLH 4PLJD 1CGYA 5CEZE 1XF5A 3QEUB 4X7DC 1OQXA 2YWYA 1FE8H 1CFNB 1ROWA 2H45A 1YJDL 3RAJH 1QPXA 3MXVL 1N64L 1NFIA 1OB1A 1BOGB 2E8ZA 4AT6A 3SCMD 2YD9A 1B4RA 2Q3AA 1A6TB 3EGSB 2ERJB 4NN7C 4JGUA 5JW4R 2VE6B 4NFCA 1CGSL 1CGTA 4OI8A 4Y4FD 3QCUH 1MCSA 4OZ4A 3OJDA 3L95B 1MCPL 1NGQH 1AGEA 4G42A 5T1LD 4M61B 5D1QB 3X3FH 1FVCA 1QUNA 3FTGA 3VFMB 2BNRA 5CSBA 2Y1VA 1OSPL 4WDIA 1NLBH 1OAQL 3T2NL 1A3LL 4U33A 5F1SA 4YHLL 4LHUD 3EJZC 4CMHB 4TNVK 3C2SA 3S88H 1BFSA 5AZ2H 3VI3F 4Y5VA 4AIZB 3OAZH 3VD7A 2FJHA 5DEFB 2GIYA 4GBXA 3SDAA 4B5EA 3MGTB 1CLZH 1X5FA 3EFDL 4L8DA 1OAUL 1KEGL 3P4NA 5SWSE 3U6RA 1FSKC 1XF4A 2HP4A 35C8H 3AB0B 1FRGH 5MEPA 2ATPA 2XRAL 3VWKA 4RBPH 2DM2A 4X5LA 3X13B 3P4LA 1WZLA 4ZS6C 1ZLSH 5HYSB 5IR1A 5E6ZA 4X4MA 3S5LB 1TVBB 3S9DB 1MY5A 4UNVA 5CZVH 4AK1A 1X5HA 3FT4A 3HG1D 4GMTL 4NQDB 4LLQB 5J12C 2EYSB 2Z92B 3KPQA 3Q5YA 1C5BH 1J8HE 1NLDH 3G6DL 3GMNB 4F7PB 5IMMA 4QHMA 5IMMB 7CGTA 1IC7H 1MRCL 3C09B 3UTSE 1WBZB 3KNBB 3EIFA 2BJMH 3BZ4B 3O3BB 3DROB 1KT2A 5DLML 5GGTH 4Y4KC 3A6CL 4JG1H 1FO0H 3EO1B 4NQXB 4FFYL 4RMTA 4M61A 1EEZA 5T1DL 4FOMA 3SCMA 4XWGL 1QFWH 3FO2B 5CP7B 4BELD 4RFEA 2CLVA 4GG8A 3G9AB 5TE7L 1BD2B 3B9KC 5CEXA 3ET9F 3BW9A 3V52L 3ELAT 4R4BA 4MLIA 4Z77A 3BPOC 4XWGH 1VDGA 2CKNA 3L7FA 1F4WH 1YYLL 4JG0L 2PXYC 2GTZB 4G5ZH 2GCYB 1DP0A 1LO2L 1KB5A 2NX5E 3DMMA 5M94B 4ZS7L 5DMIL 4DKEH 1I9IL 3BP4B 3CU7A 3RWFA 4FZ8H 3QDMB 4ZOBA 4LPUA 3QUZD 1OW0A 2NXZD 5C0DA 1F4WL 3C08L 3WDIA 1KYOK 1H8SA 4LSTH 5DWUL 3DX6B 2ARWA 4ZUVA 1WFNA 4NQEE 5D93C 4ZPVB 4YQXH 2HRPH 1ZLWH 3H9HA 2R56H 5DC0A 5CBAA 4ODXA 5I1IL 5JMRA 3ESUF 1O7SA 4YUEH 2Y06L 2V7NA 1BFOA 3LQAL 2BVOA 3BE1H 3IDUA 4Y1AE 2EO9A 2R29L 3O6MH 3ZYZA 3ZKQD 3QAZC 4AY0A 4U1IB 5HDQL 1TZIB 4L8BA 1H15B 4OZFG 2PW2B 2B1AL 3LQAH 2BDNL 4PJ8D 4QHNA 3T04D 1RULL 1NFKA 2ZSWA 2OZ4H 1N5AB 3R0MA 1IGCH 2LU7A 2AJYH 5IBLD 3V6FB 4P0DA 3Q1SH 3V5KB 1AGDB 3FOLA 5EBWA 1S78D 5DK2B 4D0BA 3PABA 4OKDA 1T2QL 1Z5LB 5C08B 2X89D 2A6KA 1NCWL 1GPOL 3IJSB 5GRWA 3VJ6A 1LDSA 1OHQA 3T1FA 3WS3B 2W0PA 3F58H 2HJFA 4HCRH 5SWSD 3OBAA 2MNUA 4OQTL 2ZKHH 4JR9L 4WHYH 1AR2A 3X3GL 2H3NB 2H9GA 3UTPE 1ND0A 4XP6H 2DI8A 4XP9L 2BNQA 1EEYA 1DANU 2Z31A 4WY7H 5JOFB 4PTTA 2VITA 1QSEA 4MD4B 1JGDB 3DXAE 4MD0A 3UTSA 4HMEA 5F7FA 1O0VA 5MEQA 4X7SL 3G04A 4HPYH 4MA1B 5DRZA 1I7RB 5EDXA 4YHZL 5KW9L 3IFOA 5ETUB 4RGOL 5FUZH 2AGJL 2D4DA 3MOAL 1WBYB 4I77L 5IFAH 2EDBA 1A9BA 1MCRA 1ZSDB 1V7NL 4HWEH 4H0GA 4YK4C 1G7HB 4OSUL 1QFUL 4WJ5B 3CMOH 3GIVA 5DDHA 4NN7B 1QLRB 4U6VL 4EUPH 1LDPH 2EIDA 2VXVH 2YPLA 4IHOA 3UP1A 4OT1H 5K9KA 1WF5A 4OFYD 2X5PA 1MCBA 5B38G 4WW1A 1OTSD 3MRDB 2ZZUT 4F2MA 5F96L 1A2YA 4RMUA 2CKBB 1PG7X 4L29B 2BC4A 3DUUA 1E6JL 1W8NA 3QULA 3D85A 5ABDE 1M71A 3VGDA 4WU5A 4W4NA 4XNMA 4TVPE 3WV0A 5TQ2L 4WO4D 4U3XA 4C58B 2EC8A 1OB1B 3NIFE 5ALCL 4LSPL 2R1WB 2JJUA 2VN4A 4R0LB 3HA0A 1OARH 1HI6A 3G5XB 2WUCH 2VISB 1HIMH 3NCYS 4FQCH 3SE9L 1DTUA 3IAGC 4JFFE 5TGBA 1SHMA 3MRLA 3LS5H 2ZCHL 3BWUC 4TSCH 4HJ0D 4PJXE 3H0TB 3ZTJH 3BGAA 3CGTA 4UAOB 3E6HB 3UTZB 5DS8A 5EUOB 2QADD 1CD8A 5C09D 4UT7H 5FYLD 4XPGH 5H94A 1MWAB 2HT3D 3PNWB 3QT2A 4ELMF 4U6YB 5C0AB 1LP9B 2P47B 3OPZH 2NXYB 5MP6H 1CDCA 1KJ3H 1SMOA 1IMHC 1F58L 3VA2C 4HQQH 4NC0B 5GSRB 4ZUWA 4JFQA 1CR9H 1T22B 2IGFH 1ZWIA 1YA5A 3QHTC 6FABL 3BN9D 1YNLL 5J7CC 2ILLA 3OTTA 2GHWB 3D85B 4UT6H 4YLQT 4RBPK 1E4KC 3S8WA 4PJBB 3S4SG 2APXA 1PLGH 4PJHA 4MX7A 5GS0D 3SKMB 2BX5A 5I1LA 4RA0C 2EDNA 5AZEH 4N0UE 3UTTB 5C07B 4UT6L 4YX2L 3G6AB 1ACZA 3C5ZA 2RQ8A 3NFNA 5GZNC 1P2CB 1E28B 3WXWL 2P5EA 2VLME 3AREA 5GGUB 1EHLH 1JK8B 1HEZB 4ZTOH 1Z9OA 4LEXL 2R2EA 4FFWC 1G6RB 1OD9A 5E8PA 2Y72A 1AGCA 1FORH 5IW1A 3RDTA 5L8KB 4NKDA 5HYJE 1W0VA 5J57B 4TULH 2XZQH 4GG6A 5HDBF 2V5SA 2ZCLH 3IETA 5IROC 4LGRB 1FAIH 1A4KB 2A6IA 3KPMA 1JWMA 3W81A 3QBTB 3IDGB 1FORL 3NGBC 1IKFL 3RNKA 3C5JB 5JIHA 1CLYL 3MFFA 1MUJA 5CP3H 5IEKA 3QUMH 3PHQA 4WUUB 1NAMH 2FX7H 2VWEE 3QZWG 1HNGA 1S7UB 4LEOB 3LEYL 5FCSH 3RWJB 1T1YB 2NQCA 5I30L 4XCFH 5C07E 4I5BB 3AS2A 5DFWH 5TPWH 3ARBD 4G8FA 5IMOB 3NFPA 3BMVA 3H7BB 3QUML 4LCYB 3TN0A 5DRXB 2DS4A 3BGFB 4G6MH 4YIQB 5FM5M 2DIBA 4LVEA 5FGBC 3WFDH 3ARBB 3T0WA 2WWKO 5CLTA 5T1MA 3PP3H 3H9HB 3VDBA 1VENA 3DV6B 5FYJD 3HNVH 1KENH 2IADB 5I18L 4LHQB 3RWEA 4G6ML 2MFNA 1KB9J 4JM2C 2JF1A 1C5DA 1FN4A 4LFHD 4F7TA 2ZG3A 1VGKB 1JZ7A 1MEXH 2EKSA 1T89C 4NQCD 3TPKA 2CD0A 2G60H 5B8CA 2GJ6D 4K7PY 4ETYA 1Y18B 4MLSA 3H9SD 2WV3A 5F9OH 4I0PA 2VAJA 3W9DB 4X8JA 5DJXB 3RWHB 1TITA 4PUBL 3HUJB 1YN7A 3L5WB 2M26A 4K8RH 1Y6MR 3V6FA 2CGRL 1DJSA 1QP1A 4FP8L 4JJ5A 4UDUB 5FYKL 3WBDA 1ZHKB 1FBIH 2ZUSA 4NQTA 1N2RA 5E00A 5D71L 1RZGA 2V7HB 5DVKA 3UZVB 5I9QB 2PN5A 4PTUB 4WV1A 2RB8A 1O5DT 2PYFB 1ZS8B 2DICA 3VFVA 1B3JA 2J12B 2XTJD 4WHTA 1ZK9A 3QDAA 5HHOE 4M1GH 4XPAH 1Q9LB 3C2AH 1X4YA 1F4XL 1CICB 3QQ3B 1KIRA 4JFDB 4CADA 5I1CH 4M7JL 2BMKB 2AEQL 5FYJH 3QEGL 5IK3B 3FO2A 1CCZA 1DBJH 1CG9A 5GGSA 4NN6C 3TBWB 4F15B 5HGAA 4CUCA 1KPUA 2XPGA 3A6CH 5KVFL 2BCKB 3S4SB 5DT1H 4MQ7A 4PJ5E 5BV7C 1YEHL 3L3IA 4NP4L 4X4XA 4MJ6A 4RAUB 1IAOB 2Y36H 1T83A 2VDNH 3T0VA 4TUJA 3N0PB 1XGUB 3D2UB 4FQIH 4LVOB 1OSZA 4LNRB 5D1ZB 3FAXA 1WZMA 2AXGB 2DYPB 1XT5A 1KPRA 1D5IH 4ZOEA 4CN1A 4ELME 4Z78A 4I3SH 2W9DH 2GY7B 2JCCE 3V79C 4BFIB 1BQLL 1CD1A 1FH5H 4G3YL 4S1DC 1C1EH 4NKOB 1MRDH 4I18A 3GO1H 4NFDA 4HK3N 1OWWA 1C5CH 5KSBE 4HT1L 5IT2H 1LEKA 2R69H 3KYNA 4K8RC 5DMIH 1I9IH 3HRPA 4GLRH 2BVUA 2JB6B 3FZUC 4O4YH 1PFCA 4WU7A 2D7TL 1EZVY 5A40E 4QRSA 3VG9C 4HT1H 3QG7H 4GKSA 4K3EH 2VKWA 2DQCH 1XF3A 2R0ZH 1OLZA 4QRRD 5DEFA 5C8JA 1RHHA 3HC3H 2UZIH 1JGVH 2FR4B 5CZXC 3O4LE 5TGBB 3MRFB 4JRYD 3MRFA 4LVHC 5EBGA 4Y2DC 3ULUL 3HPLB 3BE1L 4LSUH 5E03A 3RTQB 2YA0A 1DBKL 2APWA 1MI5B 3C6SB 2H2SC 3GHEH 5I6XB 4KK9C 1JNLL 1JGLL 1T5WA 5KSUB 1RZJC 4XHQA 3NPSC 3HR5B 2QKIA 5HDQH 4UUJA 5J6GA 1C16B 3SO3C 1B2WH 4U6HB 3BUYA 2B1AH 2QQLL 2VLJE 4LSUL 1IGTA 1NC4B 2R2BB 3VMNA 1FJ1B 3IVKA 5GRYA 3LB6C 3LKPB 1MAMH 1VEMA 3FB5A 3VE0A 1G7JA 4L9LA 1MHCA 3ILPB 2QQLH 3SDXF 4ZPTA 5JZ7C 4P48A 1IAMA 2X4SA 2CIKA 1ZT4A 4MA8H 2VC2L 4JO1L 3AREB 5CJXC 5GGUA 5L2JB 5DD3L 5I1JL 4JPIB 2BERA 5JUEH 4LIQH 1NCBH 4APQA 4DUWA 4PLJC 5E08L 3V5DB 1V7ML 5IB4B 1BQHB 2E7CA 1XIWD 5TQ0H 4DK3A 4DQOH 2NZ9D 4X4YA 1OT2A 2VC2H 1HQRA 2A73B 4F7CB 1HQRB 2NY4C 4XBPA 4XRCA 3SGJA 4OF6A 5L2KB 4CBPA 5IVNA 1WQVT 3PL6D 4U1MB 4FZ8L 2FGWH 3MRRB 4FXLA 1HXYA 5SX4I 4GQPH 5F89B 4K3DL 5JLZA 5MEOA 3DXAA 3F65A 4JN2B 5I73B 3L9RA 4O00A 3ZKND 3TP4A 1P7QB 4K3GA 1ZTXH 1KUMA 1BD2E 5B39A 4MJ4A 5IVXA 4U7KA 4UT9H 3U0TB 2FH6A 2LTQC 2C26A 5B3JE 2ICEA 3CDGB 3DVFA 3OQ3B 5F97E 2BRRH 2G5BA 3MRHA 1J1XH 4XNUL 4NWTH 3DYPA 1LO3L 3H3BC 3BP5A 2B1HL 2EDQA 3MJ8A 2VLKE 1BBJA 1FFOA 2EEAA 4G8GB 5DD1L 4TVPL 2EXYC 2HTLC 3FFCB 1OP9A 3WIHL 4PRNA 2BVEA 3DYOA 5SX5K 3UJJH 1G7PA 2D4FA 3TJHD 5JA8B 4OF3A 5JXEA 2CSPA 4J3XA 3GBLA 2E3VA 4HUKB 1M05B 5ANMB 3E1F1 1KLUB 5B38A 3BDBA 3B2VH 3QUZA 2DBLL 2DQUH 5D1QC 1J0HA 3ZL4H 3HI1A 5IQ7L 1RJCA 1FZMB 3N1QC 3IKCA 4F33B 3VD9A 3WFBH 3ZE1E 4YAQA 12E8L 1J7VR 1Z6JT 1UEYA 2VIRA 4G9FA 1JYXA 1R5IB 4KMTL 1T04A 3OG4B 5IHLB 4QWWD 1MVUA 4HS8H 3M07A 4PY8J 4WY7L 1RSFA 3NCYP 4KK6D 3LKRA 4E9LA 1NBQA 3C5ZD 4P46C 4LSSH 4KMTH 1IQWL 3BP4A 5HYJA 3S3JA 2Z93B 1U8NA 3X13A 3WLWC 1RZFH 5JHLL 5DK0A 5JOFA 5IMKA 4X6BB 3MGOA 4D0DB 3S98A 4FQXA 5KS9F 1F58H 3LEVH 3FB7A 4JHAH 3MXWH 5I1LB 5JOPE 3IFOB 1PY4A 4U6XA 2KUTA 1DLFH 3WEXB 3CLEL 1MLCA 5C0CE 3V6ZA 2FRGP 3LV3B 1X3DA 1SY6A 5IVXF 3DX9A 1VEPA 1ED3B 4EBQH 2OK0H 4RWHA 4OGZA 2J8HA 2WUBL 3TZVA 3N9GL 4JPWL 3PDGA 4CMHC 1OOAA 3VU2A 4FQQA 4GXUM 5F3BA 3LMJL 5HDOA 3SJVB 4PIRF 1QVOB 1L6ZA 1JWUA 5F88B 3EO9H 2ENSA 3U2SB 3KPPA 4MSWA 4Y8DC 5DUML 1FGNH 3WUZA 4GW1B 4M43L 4WEBL 1KFAL 5EBWB 1MY7A 2P5EE 4XNYL 3MJ7B 3DYMA 1T0PB 4R7DA 4X7EC 1YEGL 5FHBL 3EFFB 2AXGA 1SVZA 3QDGE 3RA7H 2YEZB 2OMNA 2ZCHH 2WW8A 1NFDF 4KV5E 4M8QA 4NDMA 1AD0A 2Z93A 1TDQA 4G9DB 4MQTB 2FZ3B 1KXQE 4G6JL 2YUZA 1OAKH 3CDCA 4WFED 2H2SD 1MIML 2MOVA 3QO0B 2IEPA 2D2OA 3MV9E 3WIIL 4QTHA 3UTQA 3S37L 4WW2C 4HC1L 3PHOB 1GHFH 3BSZL 1XR8A 4K8RD 4PJGF 4I0CC 1HHKB 1J1PH 2ZOLA 5F7DA 4XZUB 1I1YB 2HAZA 2L0DA 4A6YH 3I2CL 5E4EB 1I3RB 3MNVA 4OFYA 2CMRH 3E3QE 1ES0B 3BZFB 5BMFL 7FABH 5CJQH 4NZJA 4GAFB 4OD1H 3LY6A 3MSPA 3KPRB 4PRPE 3OZ9L 4BSJA 4DGYH 2AERT 4U1HA 3UYRL 2WIIA 3VMPA 5K59F 1UJ3A 1CXIA 4P49A 1N5YH 1NC2A 1YEJL 1WEJH 4Z7QF 3DUSB 4M7ZB 5E9DD 5KAQG 3GMPA 5IB5B 3V5KA 4QHUB 5EUOF 2QSVA 1N6VA 2BOCB 2NYYC 4UILL 3MJ7A 4YR6B 3SY0B 2R2HB 5E2VH 3WNLA 4K9EC 2NY5L 3IJSA 5EOQL 3FQUA 1AE6H 1QFOA 5FO9A 1N5YL 4NCDA 4ETQA 4XBGA 5E94A 5EC2B 5IVOA 1KN2L 3ULSB 2Y7QB 1BAFH 2HJKB 2CK2A 4OBSA 3FOMB 5IG7A 1HI6B 3G5XA 1HXMA 3DTXB 5D1ZC 3DMMC 1A4JB 3V5HB 1G0XA 1HEZA 1N0LA 2J8UE 4KRMB 2Y25A 5F44A 5IBTH 4X5WB 4KQ3H 3UEZA 4OQTH 1ETZB 3X11A 5JOPD 4BH8B 1TLKA 3SQOL 3CD4A 5ISZE 3WIFB 1NGYA 1VADB 1JZ8A 3RFZC 4ODWB 1IM3A 5FA4B 2BY2A 1MJ8H 1WV7T 5FA4A 4PJ8A 3HAEB 2GSGB 4R9HA 4PRHB 5I30H 1JGEA 4BSVB 4OM0H 1N6UA 5F3HB 3BJ91 4EN3A 4Z7UE 3VI4E 1CFSA 4WWKB 1GL4B 4RGOH 5FUZL 3PHQB 4WUUA 3O8XD 3UAJD 3TVMD 2G9HA 3HNTH 4JZJC 1H5BA 2IG2L 2M8XA 3B2UD 4MVBD 3WDJA 4OFKA 4NO0B 2YKLL 3Q6FA 2UUDK 1UM6H 4LSDA 4U0QB 5I18H 1T21A 4LQ1A 4WENB 3L5IA 1P4BH 3BN3B 2VXVL 4XPBH 3U7WL 3D18A 2EDOA 1ZVYA 3M1BA 4X5XB 3V8CA 2XKSA 3S35H 1NFIB 3SCMB 3BDXA 4R26H 4PRNB 1F11A 1FFNA 3OF6A 3DMMD 5EULV 4YPGB 3I6LD 5C92A 4NQEA 3GIZH 3LHPH 3QSKB 3GMMA 1FFPA 4P2QA 1Y0LA 4Q6IC 3GSWB 4M02A 4H0HB 5EFIB 3W9EA 4JQIH 4Z7WF 3EYVB 32C2B 1T4KA 5IR1B 3IDNB 3CMGA 5IESH 3NAAH 1P7KA 4KVCL 2NNAB 4UMGA 3O6LH 3QUXD 2XZAL 2DM4A 2IAMD 3QIBC 4M8VA 3QWRD 1LP9A 1UH2A 3VFSA 4FQ1H 4DZBA 1UJTA 3P4NB 3MO1A 4Z8FH 3TT3L 3WNNA 4RZCB 3T2OA 1XCQA 4H1LG 3VXTA 3LIZL 2EDEA 3C87A 4G6FB 5E9DE 1KULA 5E2UH 3PGCB 3U46B 1U92B 4F7MB 1AO7D 1I7UB 3LKOB 1FZJA 4PJBE 1V3LA 1DBAH 1DEDA 1JUFB 4U0RC 2E6PA 2FO4A 4LLQA 5GS0C 1JHTA 3KPNA 1X5XA 3ULVC 2X4PB 1X5ZA 1MCOH 3EAKA 5D7IB 4FG6C 1UB6B 4YC2B 3JUZA 5JO5A 3OX8A 1HILB 5C0AD 5I1EL 5E5MB 4QRTA 3O3UN 1K8DA 3EYSH 5DQDH 1UQSA 2DDQH 5E08H 4YFLF 4KJYA 3O2WH 2Z35A 5TQ0L 1VKXB 3G6JF 2DL2A 4EI5A 3ES6B 2C3VB 5J9PA 4UV7L 3EYSL 1NANI 1A6VH 3W39A 3WUWA 3O0RH 4HWBH 2CKBL 3BQUC 4OD2B 1WZ1L 4PV9B 5L0QB 4WGWB 3AM8A 1I8KB 4U1SA 3HZYA 2Y06H 4LLDA 2I9TB 3QPXH 1KNOA 3OWEA 5LGHL 3MBEC 2GUOA 1DDHB 4JJ5B 4ZFOL 4O2FA 1QEWA 4WI7A 5IKCB 4MYWB 1J10A 4H20L 5DI8A 4WI4A 4OJFL 1NCAL 3UC0L 1IAIL 3NIGF 2JLLA 5BZDA 5IB3B 5L6YL 4GAJL 2OX5A 4RISL 4J8RA 2W60B 1W0WB 1JPTL 2K1MA 1JGLH 2X1PA 4AIXA 4AEIH 3BOVA 3HI6H 1BWWA 5EN2A 4GOSA 1JNJA 2RFXA 1P4IL 3FN0H 3OMZA 5B4MC 4KK5D 1RV6X 1JUFA 2W0FB 4M7ZC 4RISH 3RPKA 5D7JC 2B2XH 4ZD3L 4JM4L 4EI5C 2UYLB 4YDLC 4MHHG 1X6LA 3BPLB 1MI5E 4F33A 4ZFGH 1DQQB 3QCUL 2P42B 1XGRB 1CDUA 4MJ6B 2XT1B 1D3CA 2PCPB 4DKFL 4OFPA 4QCIB 4RMSA 2FCBA 5H35B 4NNPH 5HTSA 1XGYL 4XH2B 3BIAX 3JV0A 5DD0L 2IALA 3FCTB 4QYOA 5I8CA 4RDQG 2A83B 3N1FC 4Z78B 1MJJA 2Q8AH 4HPYL 4Z7VE 4AENB 4DKFH 4L4TD 4RGNB 4KUCF 1U42A 3EYFB 4O5LL 4I77H 3ZKMC 4NPYA 4PTTB 3DPBA 2ATKA 4WO4B 3IDYB 5IB5A 1LNUA 4D9LH 1SYVB 3I02A 1CDJA 1UM4H 1YY9C 2HLAA 5FYJU 4HLZH 1TPXC 1FIGL 3U4EA 1FL3B 2VAAA 2XNAA 3P40A 3QQ4B 4TPRL 3VXSB 4OSUH 3MCKA 5EUKB 1S7VA 4RFOH 4PTUA 1ZT1B 3THML 3QIBA 4R0LA 3VGGA 5BOZG 2MKWA 4O58L 2G2RB 4PJDA 4ZFOB 5ILTH 5KSVB 1KCKA 1A7QL 2FL5B 4JN2A 4QXGL 5CIPA 1DN0A 3HC4L 1I8MA 4PJ5B 2EZ0C 5FYKD 5C2BH 4J12A 4FABL 3WHXB 3RU8L 3KLHD 3OHXB 1F13A 5ILTL 3GEWB 4GKNA 3MPCA 4YWGL 3C5SB 3QUKB 3VW3H 2NW3B 5DLMH 5GGTL 5IBLC 4IOFC 4FFYH 4Z7UF 3VI4F 4FHBD 3IFPB 4EDXA 1XGRA 3GJFH 4QRUA 4PR5A 4GRWH 4JGMA 3PIQB 5DVMA 4YHOL 2CRIA 4PJHB 5IHUL 2OR9L 2DM7A 4IRSB 4IRSC 1NGQL 2HKHH 3V7AG 3JTSB 3UTTA 2PYEA 1I3GH 2CLRA 1JWSA 1KIPB 1HCFX 1YEHH 1AKJB 3H42L 3JV5A 2G5RA 2VZSA 2P8MB 2EXWC 3IJHB 2V2XB 3WL9B 2VDNL 4U1LA 2NR6C 5CKAA 4KK8D 3LVEA 1DVFC 4WI2A 2P48B 5JORB 4ENEC 1VESA 3AM8C 1JRHL 2QQKL 1I3GL 4KI5E 3NVQA 1VHPA 5D6DA 1XH3B 1QSFE 1U8OB 1U8OA 4W6WB 1Q9KA 2XN9D 5I9QC 2IH1A 5F7HA 4HC1A 5ADOH 4EXKA 1NGZA 4ELKB 4CJ0A 4G7YH 2AK4E 1CLZL 2DYPD 3RY6C 4WUUD 2DWDA 3BEWA 5D1XB 5J1AB 5DJAB 2FX9H 2DQIH 3RNKB 1GJIA 3OGCB 5KSVA 4PJEB 3HZVB 1A9EB 1MVFA 3EUUA 3OB8A 4EUPG 2FR4A 5EU5B 5IFJB 3MRLB 3HNSL 5BRZE 3VFOA 3F62A 3S96B 4Z0XA 1HDMA 4G8EB 2IBZY 5I17B 1MFCL 2P44B 5A16A 4IRJD 3WJLC 1YN6B 2Y9RT 3EHBD 4ONHB 3IXTB 4P2CG 5IHBA 4JPKH 1G1CA 2Q76A 4NNYB 3CFEA 2WBWB 1AQKH 5KVEH 2X1QA 4Y16C 1NMAH 2ORBH 1XF5B 3QEUA 4HS3B 4ACPA 3SPVB 2NY5C 4ZUUB 1KOAA 3TN0D 1NGWB 3FRUB 4JKPL 4LU5L 4LLUA 1HHJB 1TQCB 4Y2DD 3VFWB 1NKRA 4JG1L 4HIJA 1RJYA 3RVWC 1MLCB 4POUB 1S8DB 3QIWD 4PBXA 1MOEA 1QACA 3QWRA 3U30C 5I74C 4CVZB 4DVRH 1HHIB 4TSAH 4IIQC 1P7QD 1TJGL 1P84J 1DLHB 4LU5H 3QRGH 5L7XL 1CE6B 4Y4KA 5IQ9A 3MOQA 3KPSA 5KS9A 4G80B 1WBXA 2C3WA 1WIOA 3WFCH 2DM3A 1JJUA 3QZWB 4LLVA 2V6HA 2BNRB 2CDFA 1EJ6A 5CILL 1OQOA 1NFDE 2A74A 1TZHB 3PQYB 1GGBH 4E42B 1LE5A 15C8H 4PJXA 3REVA 4WEUD 3GJEB 5IMLA 3B9KA 5E8NA 3EYOA 2XZCH 2X4TA 3MV7A 1GAFH 2YC1B 2DQEH 5MEOB 1X5AA 4YEEA 1HYRC 4JFFA 3ARED 3EBAA 5SX5H 2XXCB 1TPXB 4IBLT 3QO1B 1MHEA 5J06A 3O41A 3ARWA 4OUUA 5DK3A 2F5BL 1J8HD 2J4WL 1QHOA 1G1YA 1I8IA 3OXRB 4FFVC 1ZA6A 5GQBA 4NUJA 3VFNA 1ND0B 3DETC 3HMWH 1OAXH 3QFJB 4UB0L 3JV4B 3CMOL 4HS6A 1S9VB 4HIIB 2DIAA 2P43B 2R9HD 3WXVL 2CMRL 1G7LA 3SPVA 1A1NB 3JWOH 3OJVC 4E41A 3AXLA 3EO0A 1B6UA 3GUTA 3DIFB 3WNMA 4MA7L 4K94C 4UB0H 5J13B 1CFVL 2PTTB 5J89A 1SY6L 5MERB 4OQTA 4RAVB 1HHIA 2LU3A 5I66B 1FDLL 2EXWD 3T65A 4WW2A 2WP3T 1MAKA 4QWWC 3BO8A 3W2DH 1AXSB 2YUWA 2DQDH 1XZ0A 5DSCB 1KLGA 4CDGC 2AJVH 4E0RB 1TZIA 1FDLH 4MJIE 2E9JA 4LASL 4PRIB 5IBUG 3RI5K 2FIKB 2IADA 1N3NB 3LD8B 1OP5K 5A43C 5A2IH 1FNAA 1G7MB 2O5ZL 3QHFL 5T1LB 2X70A 3JV6A 5FHAH 2ADIA 1TNMA 5E95B 5J11C 1LD9A 5L9DL 4V2CB 4PREA 5M7QA 3RI5F 1YY8A 2YBRA 4WI8A 3UTOA 3H9SE 4RZCA 2X10A 2FATH 3GSNA 4HHAA 2FYYA 3QEGH 4QHKJ 4HDIB 3SQOH 4TYUA 5EO9A 3RUGB 4FZEL 4NYLB 4X0KA 1W0WA 4HS8L 3B6SB 3CLFH 4FQXD 4PGBA 1NUDA 2IBGA 3MMEA 4EKXA 4OZGE 1UKTA 1U91A 5HHME 2IMMA 2QHLA 2A9NH 5ESVB 3VFPB 4JHWL 2X4PA 4WCYL 4JFEA 4RWYH 4D9QE 2VYRE 1YNLH 5TJWK 5BRZA 3KLHC 2WANA 4OB5L 1LO4L 2IAMB 4LPTA 3NCMA 3GNML 5IOPB 3CVHH 4Z7VF 4PGDB 4JHWH 2EH7H 1XF3B 5HI4C 5TF0A 2Y5EA 3BD4A 4G9FD 1H9VA 5LBSH 1E6JH 1DEEA 3WN5B 1EVUA 5FUCE 4I18C 5J9PB 1ZT7A 4H1LA 4LVNC 3WKML 4H1LB 4HK0B 1BHGA 1RIHL 3DJ9A 3I75A 3GNMH 3FQRB 2GT9B 3K0WA 1DL7L 1MI5A 3C6SA 3HB3D 3TBWA 5C07D 4PJIF 3BAEL 2NY3B 3T0EC 4JKWA 5ALCH 4LEXH 1YEEH 4QO1A 3C8DA 4OCWL 3SY0A 5HVHB 2BOCA 2CKBH 3U4EB 1MJUH 3E8UH 4M6NL 1K9TA 1BX2B 1H5BC 1OP3K 2Z31D 3R0NA 4JQVA 3QXVA 4NZUL 4HFWB 1CT8A 2BVTA 4ELKA 5DUMH 5JQHC 4HJGB 4MDJA 2NY1C 2YK1L 2I5YL 3NH7H 1Q9OA 1QD0A 3CK0L 3ILQC 2VOTA 3LB6D 4PRDB 3TVMA 3C6LC 4LCCC 3KJ4C 3IF1B 4P5MA 5E8EB 3HI5L 1J11A 5ACMA 5D8JL 4N8CH 2LVCA 4OJFH 4JY6B 2GITB 4A2LA 2X9YA 5DMKA 1IC4H 1CG9B 3LEXA 1EGJA 2D7PA 3O9WC 4L3EE 4JFZL 4UNUA 5GRJH 3OPZL 3MBXH 3G5VB 1E0OB 2LU4A 3SKOB 2E6QA 2FJHB 4U05A 3RVTC 1GHFL 3BSZH 3K74B 5GGVH 4XMKL 3DGCR 3W11C 1FC1A 3MBXL 5TF1L 1PYWA 1XGTB 3JBG7 2BNRD 5GGTA 1CDBA 2CUHA 5BMFH 4PJ7E 1YEKH 3HR5A 1MJ7H 5CKGA 1NDGA 3QDJE 4G8GD 5FAAA 3U1SL 1HKLL 4JFOA 2B4CC 4WIQA 1YMMA 1YC8A 3OKOB 1T66D 4YDLB 4WU5B 2IPKA 3RWCB 4KROC 2VZTA 4P46A 4LLUB 1BLNA 1ZT1A 4AEHL 4QGTA 2FHCA 1L7TH 3GKWL 4UQ2B 1A6VL 3T4AA 5GZOD 4KV5F 5I8KL 5IV2A 4UILH 2UZYB 3BKMH 3DGGB 4N8VG 1S7SB 2DI7A 2YPLD 4NZDA 5HHPA 1JK8A 1G9NC 4FG6D 1WAAA 25C8H 5KS9B 1MHEB 1CLOL 1HHGB 4Z0XB 3FONB 5DD5L 3RTQA 4HIHB 1L4IA 4U1JB 3UPCA 3MRJB 2W07A 3O9WD 4C4KT 4NO3B 2HFEB 1N64H 3CFKB 3CFDB 4OLXH 3GI9L 1CLOH 2QHRH 3D0VB 3QUYC 1K4DB 3JWDH 1OAYH 5T3XE 2PW1A 1EUUA 2G9HB 1DQDH 4X6FB 3WJJC 1S7XA 2K7QA 2Z91B 3OKKA 1CGXA 1N7ML 3BP7A 4NRYB 3U0PB 4EIGB 2ZPKH 3ULVH 2BSRB 4JZOA 1X7QB 3H9ZA 3OXSA 2WIMA 5LKNA 3RIFK 1N7MH 5GGQH 3SGKA 3MRPA 2UVFA 2OCFD 2FO1A 4FS0A 3MLTB 3LPGA 2P8LB 4UIKL 1GZPB 1UWXH 4HX1A 1U8QA 5DJYB 5F9OL 1VACB 2HT2C 5DRWA 1U3HC 2XRAH 4Y5YA 1KLUA 43CAA 4NBZB 1EEQA 4LOUC 2NY7L 1WTGT 5ISZD 5IVXB 1QQDA 4NKMA 3OXRA 3BZEB 4H25B 1YMHB 5C0BA 2DQCL 2R0ZL 2R8SL 2DMKA 4DGIL 2UZIL 3VD5A 3RWHA 2DQJH 3S6CA 1XEDA 1K8IB 4QGYA 3MGOB 4D0DA 2R23B 3A67H 3P0YH 5TE6H 1ZHLB 4PJEF 3LQMA 3PHOA 4BQ8A 1UWEL 3VXQA 3WYRA 1F4HA 1YUHB 4ODBD 2XN9E 1H3GA 4XCYA 2NX5D 3B2UC 2GFBB 3LSOA 2LQRA 3HE6A 5FA3A 5DD6A 3GMRB 2JIXA 4BK4A 5TE6L 1NCCL 4KVCH 4YXKL 4OZHE 4PGBB 5ID1A 2IPUG 1I7UA 4R7NA 1YQVH 4PV8B 1X7QA 5T1MB 1U3HA 1CZ8L 4L3CB 4Y5YC 4P5TD 2N56A 1JV5B 2Y36L 4ERSH 2BJML 3LKQA 3LIZH 5T1KB 3ORJA 3KPRD 5EOCL 4OCSH 1YPZF 3VFGH 1RMFL 3ZDYF 1F00I 4JREC 2MKLC 1NBYB 4P5TB 2J8UA 4FFWD 4ZXBD 3IXAA 4U6HA 2GK0A 3H9YA 4M4RA 4KPHH 43CAB 1KV3A 4R3SA 1NAKL 3PIQA 4WWID 1INQA 4DQOL 1C1EL 5FKPB 4BKLB 5FOJA 4YHIB 2O61A 3TO2B 5C0FA 3MLUH 1HH9B 1YEDB 5AUMB 5F8QC 1EUTA 5DJ6B 2VDLL 1QRNE 2DKMA 3HPJA 1HSAB 3QWOA 4H25A 5C0BB 4MHHI 4FRWA 1AKJA 5J1TC 3HZYB 1UVQB 2X6MA 2XWBA 1ZHNA 3WMSA 5D7LA 4LVOC 5BCAA 5BV7L 3ARUA 1ACYH 5JW3H 4Y4HB 2YZ1A 1QKZH 2XKUA 4OLYH 3TFKD 5DI8B 1A3QA 4X6DB 1UM5L 4HZLB 3VWKD 2JB6A 4HZLA 4L4VB 3RL1A 1Z9LA 2ZOKB 5DC4B 1MCWM 3ARTA 4NYLA 4D2NA 3GZKA 5EZIL 1DBKH 1AH1A 2X4OA 1EA9C 5E6ID 3H7LA 1HINH 2NY0B 2MPAH 4MA7H 2XWTB 2JJVA 4HMCA 1A7OL 2FBJH 3U7YH 1DN0B 2IBZX 2RAMA 2FECL 4Q2ZB 3TC9A 4L3CA 2NY5H 1A1OB 1H5BB 4WRLA 2ZSWB 4ODVH 5F7DB 1U8MB 3QCVH 4LHUA 3W2DL 4P5KA 4LRNL 3MRIB 5GPRA 2AJVL 1YNKL 4JVWA 3P0VH 4OZGB 1WITA 2EE9A 5E5RB 4APQD 1YMME 4X80H 4GXVH 1ZLVK 1P4LB 2BVPB 3STLA 1Q0YH 5IBTL 1U3JA 1TCRA 4GLRI 1AIFA 2ZUQB 4L9LB 5C3TA 3W0WA 4M8QB 4NDMB 4GO6B 2YPKB 4P3DB 1XIWB 5DJ0A 1W8OA 3MREA 3QWQB 4XMLL 2OTPA 4S2SA 5I8EA 4OM1L 3K8LA 3D2UD 2VQ1A 5ESQA 4KVNL 4PG9A 1BQUA 2ADJB 4TVPD 4Y16D 4KI5C 3FTGB 2ADFH 2HVJA 1PW3A 5D2LA 2O5YL 3CLFL 2DLFL 1A14H 4PRAA 3NIGE 2I9LB 2VTFA 4QHLA 3U9UB 2NY1D 4MAYB 5DFTA 4MB5A 5F9AC 3QUMA 5HHOD 1ITCA 2F54E 4Q0XL 3LQZB 1IAII 4MDIA 2YN5A 2EEBA 5F96H 1J18A 2HTKD 5L8JB 1A14L 1UCBL 3CXDL 2GSIB 2J5LC 1P7QA 1K4CB 4KJQC 5D7JB 2F53B 1Y0LB 1LK2A 5JDSA 4G6KL 3V4PL 3PJSA 1C7TA 3TA3B 4BH7B 1DQML 1EBPA 3MRHB 4QXGH 5J6GB 5T5NF 4GRMB 3ALXA 3C5ZC 4M3JA 1FGVH 2MWCA 3I50L 4YGVA 1JCKA 4KI1A 1R0AL 4ONFL 1FYHB 3MRBB 1MWAL 1JHTB 4R2GC 3MCG1 5D5MF 1QLEL 1PX3A 2R4RH 4PPTA 1S9XA 5E5MA 3LS5L 4QHMB 3MREB 1S9XB 2YPKA 1FZOA 1A7NH 4JFYA 2P8PB 1KTDA 2P7TB 4YHOH 2H2PC 4MCYB 1Z3GH 3KYKH 3TJHC 1MH5A 3V4VH 1DN2A 1DQLL 4JY6A 4JRXA 3IDIB 3VGEA 4LNVA 4GAYB 4UT7L 1RIUL 4JAMB 3OKEB 2WUCL 3OKEA 4K2UL 4MJ2A 3T2QA 1NSNH 4RDQF 1RY7B 2D31B 3GM8A 1E4XL 3MA9H 1K8DB 1KJ3L 1Z9SA 1T4KB 3EYVA 5ANME 1NCDL 4JPVH 5C9KA 2HFTA 1MFEH 3HC0B 3V0WH 5I1KL 1JL8A 4GBXB 1P7KB 3B9EA 3P11L 4K2UH 3OSKA 3L3DA 3VXPB 1BWMA 1ZVHA 2ZCKH 3MA9L 1R24A 1I85C 3GSNH 3BPNC 5F7KC 4FQJL 5CJOL 4ZFZB 1S7WB 4KRPC 1R3IH 3MRCA 3VG0L 3NIDF 5D96B 1SEBB 5C6TH 4WHTB 1RUAL 1P84K 3ZDZE 5T3ZL 2VDOL 2Z31B 3D3VD 5MP6L 4GRMA 1G7LB 3C5JA 5E99L 4FQXC 4QHKI 5DUBA 1IGFL 3TWCH 1DDHA 3ZKNC 4O2EB 1DCLA 1JFQH 1QO3B 4XP1H 4HUWA 1F4AA 2AJSL 3S5LG 2R4SH 3GMNA 4F7PA 1HILA 3TH3T 1Q1JL 2H2PD 2PXYD 4RAVA 5EIIB 5KBNC 2A1WH 4N68A 2XY2A 1DUYB 2P7TA 5E24E 5IFHL 2AJXH 4MQXC 4N0CD 1VGKA 3QI9A 1OVZA 2NZ9C 4R7NB 1FZJB 1PBYA 3F6LA 4LSVL 3BXNB 5EZLB 1ADQA 1R3KA 3GSOB 1KJVB 2A0LD 1AY1H 2JK5A 2FSEB 3ARFD 2IBBA 2OJZH 4BFEA 2R0KH 4ESKA 4LRIA 5FECB 1TJGH 3CPLB 1M7IB 4GUPB 4QRTB 4GUPA 1PD6A 2W9EL 4LCWA 3HUJA 1IGYA 1DUZB 2F54D 3MLRL 2CK0H 3AAZB 1OD7A 4BZ2L 5BW7A 4LPCA 2VDKH 5HGHB 3FQUB 4KJQD 5JTWA 3GBML 4XTRD 4L4VD 1S3KL 5K9OA 2V2WB 3T0EA 4NSKB 4XMPH 4XCNA 2RHEA 4KDVA 5INDB 3S35X 4ZD3H 2O5XH 4P9MH 3ULUD 5MI0C 4JRXD 4PFEA 2RJMA 1UACL 1F8TH 2FZ3A 1RHFA 5J11B 1J1PL 5A1AA 5JPMB 2YUXA 3QCTH 4Y4FB 1J9CT 2WLYA 3NIDE 5EIVA 3KYMB 2DWEA 1PZ5A 2GW5A 4GS7B 3UMTA 4O9HH 3BKYL 3L1OL 1F3JB 3G5ZA 2VXUL 2W59A 4N90E 1P9MC 3HLAA 4JM2B 3HLAB 1IBGH 4ISVB 4P59H 5AYUH 1AFVH 3AREC 3RDTD 3IYLW 4N0YH 3CC5A 5K9JH 1U8KB 2W0LA 4DKAA 4WW2B 4PB9H 3RWIB 4RQQB 2F8OA 1RIVH 3V8OA 1IM9A 1K5NA 3BISA 4ZUTB 5GGQL 2BK8A 5E6IC 5LXGH 5ERWB 4ONGL 3U4BH 3T0BA 5C0GA 5CCKL 3EYUH 1FIGH 4NRXB 2GT9A 2FLBT 4LAQL 3WHE0 5D70H 5FV1L 2EDJA 3L5WA 3S36X 3KLAB 2BXZA 3GKWH 3IRZA 5ESQB 5B3JF 3SDAC 2NY7H 1AO7E 3BKML 1WVZA 3DHMA 3KYNB 4NC2B 4RNRA 1U3ZA 1FRGL 4Q7DA 1N4XL 3M8OH 3RBGA 3K80A 1YY8B 3O6FD 4DZ8B 3HRZA 4H8WL 2IFGA 4XPTL 5KVDL 3HR6A 3MNWB 1NEZG 3FQWB 3ZSSA 4KJPC 4B0MM 4PLKD 2AJ3B 1K3ZA 4ZO6A 3VI3E 4OFDA 2FBOJ 2XTJC 4Y5VB 4ORZC 3QXAA 1XF2B 1MREH 3BRFA 1QA9A 1RFDL 4AMKL 5DJZA 3UJTH 5CD5C 3IU4H 5L2JA 3MCLH 4Z7WA 5J12B 5C0JB 3RQ3A 5KVMC 2VDQL 2YD3A 5D7LE 2AV1B 1MRCH 1C12A 5I1AA 4NN6B 4P2OA 1ERNA 3L3JA 4DN3L 5LJYH 1TTFA 1NCCH 5T1KA 5D2NC 3B9VA 3H0TA 5DZOA 5TE4L 1I3RA 3MNVB 1YQVL 1IQDB 1WICA 3DRTB 4G8IA 4NQSA 3G6JE 3MLYL 1U8KA 4GBXD 1OPGL 3CC5B 2DAVA 4IOIB 5T1DH 1JE6A 1A7RL 2VLLB 1FH5L 1AO7B 3TH2T 5DHVA 1P4BL 4XPBL 3VFGL 4YBLC 2KQNA 3JVGA 3Q3GA 2E27H 3K4ZA 3VCLB 3Q3GB 2AXJA 5H8DA 4NP4H 4PP1C 3T77B 3C5SA 1CDYA 3X14A 4O4YL 1M7XA 3GJFB 4ZTPL 5KSBA 2W91A 3SN6N 4XWOC 4NQDD 5GRVK 3IKKA 1MIEH 2NCMA 3M17B 4O02L 1XGPB 3SKMA 5DTFB 2Q87A 1UH3A 4MNGB 5C7XL 3SDCA 3SBWC 2VZ1A 1YEEL 2ZWLT 3BEWB 3OR7B 5ACLA 3QIBB 1DBBL 5KSAB 5I1HH 4LSTL 1U8PA 3R8BB 5IT2L 4JQXA 4NM8L 5C0IA 3QYCA 5D2NA 4X9BA 2L7UA 3WJLA 2X4TB 3MV7B 5DHXB 3QH3B 5IHZB 1XCTB 1LEIA 1VACA 5DRWB 1A21A 1CD0A 4S1QL 1UM5H 1Z2KA 4OLVH 2VZOA 3ECBA 1BQHA 5JDJA 3QG7L 5D7IE 1JHLL 2CDFB 3DMMB 4NKQB 4FTVB 3HZKB 1BZ7B 5GS2D 4R2GB 3Q6GL 4P5KB 1ZMYA 5D2LE 1UXWA 4YDVB 5D8JH 4YDVA 3V6BR 2VIRB 4G9FB 5AYQA 4DFIA 3LCYA 1HSBB 1XGQA 4HH9B 3VGHA 1GGUA 4HBCH 2VXSL 4LMQE 1M7DA 5ELIA 1GOFA 3FQXA 1S7TB 1J5OL 3LSOB 2Y07H 2MTPA 3QDMD 1CI5A 5FF6A 5HJ3A 1T1XA 4FQHA 5E2TL 1OM3H 5JDSB 3T77A 4S11A 2ZG1A 1D5BA 2GYSA 1FCGA 2BXYA 1MCOL 4KFZC 2B0SH 1A5FL 2XTLA 1KJ2L 4S10A 1BJ1H 4X5XA 1OF2A 2VH5L 5KTEL 2KZ1B 1GC1L 4ZO9A 4P23B 5MEND 4HUWB 3G9VA 4HIJB 1YYLH 1HHHB 4Q9CA 4LKXB 2HLFC 3LD8C 4JY5H 1H0DB 4OBRA 1RZJL 1DANT 3IGAB 1C08A 5EBMA 2IFFH 5IF0B 4BQCA 5DJDB 3C08H 1E27B 1H8OA 3VFUB 4AEHH 5CIPH 4Y19B 5LGHH 4JY5L 4N0UB 1FNHA 3JWOL 4JJHA 4UBDD 1CFQB 3O2DA 4R4FH 1OTTC 4LCIL 1DE4A 4U4BA 3IETB 4WHDA 5INCB 5B4MD 5AD0A 1SY6H 3HG1B 1ZANL 2KQMA 1D6VH 4UV4H 1JF1A 1KN4H 5IROA 5DMGD 1QO3A 1ADQL 3PXJA 3N85L 3RPIA 4Y2OA 4XVSH 2DTSA 5C0AE 4M9OA 3R1GL 1IEHA 3GHBH 1NFDB 2FYYB 2ADGA 4KZEL 3CCHA 3I50H 4JCLA 3MV9A 3W11D 2YRLA 3NCEB 4P2QD 4WFFD 1MH5B 3QNYB 1BZ9B 4APQC 1AXSA 1WK0A 2BVYA 5T3XH 3D69A 3DBXB 5F6HJ 3TT1H 4TQEH 5ERWA 2Q7YA 3PWNA 4NQED 5MHSD 5BV7B 1A7NL 5D1XD 4KROD 5F1NA 5CP7A 4DVBB 2GTWB 1H3WM 5CMAB 4UIMA 4PBWD 3IFNL 3BEVA 4YAQB 5C0CD 2V5YA 3ARGD 1A02N 4KRLB 2YPLE 4CGTA 3IFPA 4EDXB 5GGSY 4POZC 4PJ9B 1NUFA 1ZE3C 4HFUL 2NW2B 1ZHKA 3KPRA 5F6HI 1KYOJ 4MJID 5K93A 1MQKL 3PWVA 1MQ8A 3TBYA 4EXPX 5E5UB 4WFGE 5I1KH 3MFGB 4GMSL 1S5IL 1CD1B 4X8JB 2E9WA 1A6WH 3ZYJA 4Z76A 3P4MA 4XVTL 1FZKA 2F54B 2B7DT 4L9LC 4MXVE 4PJ7A 3AAZA 4MMXC 3UPAA 5T3XD 4N5ED 2OK0L 1TQBB 1QFUH 5EU6D 5GGRB 4QY8A 3EDDA 4P46D 1MAJA 4QRSB 5H37G 1NMAL 4KJWC 2B5IC 4PD4J 1NFDA 5E99H 3ARFB 1G7IB 5KG9B 3PGDB 4JHAL 3QA3B 3B5HA 2E7HA 3IF1A 3ILQD 5JR1L 2HVKB 3VDAA 5FGBA 4WJ5A 3FO9A 3HE6C 4I3GA 3BXNA 3QQ3A 4JFDA 2F53A 3NPZB 4Q2ZA 3WSQH 1CTOA 2YD5A 1PEWA 1MWAH 1CGVA 5IHUH 1GIGH 1EHLL 4HKJB 1WBYA 3CVHB 1V8HA 1JF5A 1R3HB 1I8LA 1I4FB 3QG6B 2WUBH 5SWQA 2BCKA 3S4SA 2I5YH 4XP5H 2AXFA 8FABA 3L5HA 3SEPA 4TUJB 4G9FE 2X4UB 1MLBA 2EDRA 15C8L 4OCSL 5A2KH 1MCQA 1CXEA 5E2WH 2HJKA 4M43H 4S1SH 5FK9A 1KFAH 2H3NA 1OW0C 3TPUB 2D0GA 5IV2B 1GGCL 4BFIA 5HVFB 3W9DA 1KTDB 1OGAE 5KANG 3MA7A 4H5SA 4XXDA 2V5RA 2NXZB 2QQNL 4KHXL 5T5FL 4YR6A 3MRGB 3N1MC 1J05A 1V5JA 4S1SL 1Q9WB 2J4WH 2AV7A 3NZ8B 3UDWA 3ZDZF 4JFEB 1N0XL 4KAQL 4NN5B 2OM5A 2CJUL 4OCRH 3RY6A 3OAYK 5DFVC 4F8QA 1MCFA 2I9LA 3MLXL 1BQSA 1MCIA 3U79A 2HT2D 3QFDA 1QFHA 2X09A 5F3HA 6FABH 3ARGA 3UO1H 4Y1AA 1E4WH 4I13B 1M7DB 4HD9A 3SBWA 4PJ9C 2ORBL 1UZ8B 1QFPA 4L4VE 3Q48A 2ICES 3CXHK 4Z7VB 4P2OB 1PLGL 1JPST 1AHWC 1T2JA 4W4OA 1NEZB 1YQ2A 3S97C 1NC2B 4NZRL 2QJDA 3CDYA 3VGFA 5GS2H 4RGMC 4XI5C 1D9KA 5EIQA 4YX2H 2YRZA 3BH8A 3D25A 5FYKU 4DVRL 3E0GA 4PR5B 1IAOA 3LDBC 2LABA 4WTZA 1BGXH 3MRBA 1UFUA 3M45A 1XR9B 3FQXB 2IPUK 4U6YA 4YHKH 3RVUD 4K7PX 4KJPD 1A6UL 5D70L 4ZTOL 2VLRB 3VFSB 4DZBB 3H3PH 3BJLA 3B3IA 3SJVE 1Z0NA 2P8PA 3ARQA 3HCVB 6CGTA 3D3VB 2MQCA 4X5WA 5F7EH 5L8LB 3KAAA 1IKFH 2ZKHL 4JR9H 4DTGL 3OV6A 5C0ND 1TZHA 2R0WL 1U2HA 5JA9A 1KB5H 2V9RA 1NGPH 4HAGA 4X99B 3MCLL 3RWEB 3MZGB 3NFNB 1U8PB 3DETD 3KPMB 2VDQH 2UWEE 4QRRE 4Y5XB 4R90H 3HKFA 3CDFA 3HZVA 5DHVB 1WAAF 2CDEA 4LRIC 2PTUA 4PJAE 3ROLA 2CDEB 3L9RB 3CFCH 5IW1B 5I17A 2XTJB 4Y5VC 5HY9A 5HYJD 3DSFL 2VRAA 4DW2L 3L5XH 1YYML 4ZFZA 5E8OB 1P6FA 3INUH 4DK6A 3I6KA 5DJ2B 4W6XB 2VXQH 3VXMA 1D5BB 3X14B 3QDGA 5B39G 5EOTA 1T21B 2MSPA 4HIIA 1KG0A 5GS0H 5ADPL 3BPCA 3DSFH 4QXUH 4DW2H 1TVBA 4PD4K 2IQAA 4Z95L 3ULUC 4CMMB 2OL3H 2ENYA 4J7RA 3TIEB 4BJLA 4ONGH 4FFZL 3U36B 3U4BL 3G6AA 4M1DL 1QLFB 3O45B 3V6ZB 1I1YA 3WN5C 3LKSB 2X4SB 2J88H 1DUYA 3LRGA 1I9EA 3KYOA 3S34L 4G7VL 4QCIA 5FYLH 3SKUD 5GISL 2WBJB 1P9MA 3FHQA 4NZTL 4OZHB 4ZXBA 1G6RH 5I1HL 4HIHA 1EK3A 2DMBA 2K9UA 5CZVL 4C55A 3WIHA 4H8WC 1CDGA 2YD1A 5C0CA 5D9SA 3VDCA 1QVOA 3C9NA 4D8PA 5DJCB 3S36H 1CXFA 3QIWA 2BNRE 5DJCA 2W38A 2ICWI 1G7QA 4OGAC 3S3SA 1K8IA 2ESVA 1TIUA 4GT7A 2VLKB 4PJCB 3EOYG 5EBMB 1CFTB 3ZT7A 1IC4L 4KK8C 3PWJA 4XTRC 2UZXB 1QSEE 4KK6C 3IU4L 5DURD 1LD9B 3IFLL 2NLJA 4JB9H 4YO0A 4FQPA 3FFDA 4ETQB 4EVNB 1XAUA 3UBXG 4MZ2A 4J1UB 4JHBA 4X9GA 1B2WL 4QTIL 4QRPD 4MA3A 3LN4B 3QWOB 1QFWL 1R3LB 1JTPA 2A6DB 1E4KA 1EEYB 4K71C 5DFVD 5F7YC 3VXUD 1RAMA 3C09C 3SE8H 5TE7H 4FQXB 4HK3J 5D93B 4G6FD 3KYMA 4M00A 5E2TH 2PW2A 4YHNA 1A7RH 1X5YA 4K3JL 2Q8BH 1ITBB 3VG0H 5D5ME 3ARPA 1RZGB 2V7HA 3OHXA 3STZA 4LKXA 5DUPH 5BRZB 4F7EB 4N8PA 3E3QC 3MLTA 1G7PB 1F2QA 3DRTA 4OCLC 5CJXA 4PJ9D 1K2DA 3SE4A 1HK6A 5KJRH 4I48B 2DKUA 1FG2B 2HG5A 1ED3A 2VL5B 2VLLA 3QQ9C 3ZYIA 4RX4A 5I1EH 2OMBA 2R4SL 4YHIA 4J3OC 4ZDHA 1VFOA 4J3TA 3MROA 5K9KB 1ZHBA 5FIEA 1Q72L 4GG6E 1K6QL 5FO8B 3QIWB 1KPVA 2FEDD 2E9BA 4D8PB 1JYWA 3QI9C 2I25N 3VXRB 3CPLA 3NCJL 4B7LA 4Z7UB 4UV7H 4E41E 2ATKB 1RK0B 3PL6A 4QXTB 3DX8A 2F5AL 4PJ7B 1ZHLA 3VJ6B 4U2YA 2A6KB 3VGAB 3HC3L 4CVUA 2YSSA 3KXFE 2DYPA 2IF7A 3OKNB 2P49B 4D9QD 1I8LC 2IALB 3MNWA 1I9JH 1T3FB 2MQ0A 5HYEA 5IM7A 3GI9H 4B7IA 3TBYB 4FTVE 1G7IA 4L4TE 3PXHA 5TDPB 3F8UB 4C83B 4DKDC 4PJDB 5C0DB 1FE8L 1N26A 2NY6C 2JKXA 3RAJL 3MXVH 2V17L 4PLNC 2YR3A 2OI9C 1P5VA 4NQCE 4QRRA 1I3UA 2WINA 4PRPD 2UV3A 4GAJH 4GG6F 1JZ6A 5EOCJ 2F8XC 1JPTH 2UYLA 4OCMC 5EB9A 4I4WB 2C4FT 4XX1G 1H3TA 3O8XB 4U2ZA 1IFHH 1A9BB 2ZSVA 1AP2A 3LZFH 1QFWI 3UBXI 4PGDA 4I48A 3DX9B 3KPSE 1SQ2N 1I9RH 2D03H 3GSRB 5JLZB 1T6VN 1J0JA 2XI9A 3FHAA 1MJ7L 5EU5A 4AQOA 4Y4HC 4KKLD 5FYKE 1EJOL 3VH8B 2BSSA 3I9GL 3IJYB 5DVLA 3AROA 3STLB 1UM4L 2HTKC 4Y0GA 4P4KC 4FQQB 4RMQA 5D7KD 4OUOA 5IBUB 3ARGC 3ZT5A 2Q76B 3PDOA 1OL0A 1U58A 1BIHA 4WFFE 3I9GH 3K2UH 4OGXL 1KCSL 4LBEA 1MQKH 2FHBA 1WZKA 1MFDL 5A3IC 5C08A 1KELH 2YD8A 4N1CA 5EC1A 2NZIA 5TH2A 2Z9TA 4C57C 5DURB 1OAZL 1LE5B 3VWJC 5J1AA 3FB6A 1JNNL 3BMWA 1CWVA 4UZGA 1HXYB 3RNQB 2YD4A 5ID0A 2HMIC 1KTKE 3ZDXF 5DRNA 2JB5L 5I15H 5C0JA 4POZD 5DRNB 5D71H 4LLMB 4KI5D 1DQJA 4NKIL 5CHNB 3RL2A 1U9KA 1DBMH 2X4RA 1R0AH 4KK9D 1IVLA 2IWGA 3SDYL 3V6OA 1T20A 1UZ6F 4EBQL 1NUNB 2NW3A 5INCA 1A4KA 4LLAA 4BZ1H 2X42A 1AR1D 3QRFM 3IDNA 3B43A 3GHBL 2CRMA 1I1AB 1NMCB 1WCQA 3KPOA 1OTTD 4M5YL 4XNQB 2FHFA 4ZAKB 1F2XK 1CGSH 2J6EH 3V4VL 2FEEI 4GRWF 5IEKB 1OT1A 2FWOB 5EU6E 4QRQB 1I3VA 1BFVL 3MUGB 2Z8VC 2F74A 2X1OA 2DQHL 2J1KA 1L0YA 4XGZB 4XCCL 1P2CA 3HZMB 4M5YH 2NXYD 4KH2A 1WBZA 4Q58C 3P77B 1NSNL 1MHPH 3BVNA 4CJ1A 3PG2A 3FO1A 2IANA 2WAHA 3ARSA 3S88L 1IEBA 5JXAH 4LAJH 3D18B 3EO1A 4JRXB 3LS4H 4MX7B 2VLKD 1RUPH 3WFEH 3V0WL 4HG4K 3P9LB 2Z0BA 3DIFA 4KDTC 2OR8A 1QSFA 1JMXA 2E7MA 2DWDB 1PKQE 4QHLB 4FQJH 5CJOH 3ZSTA 4N9GB 4TUKL 2QQKH 4JO2H 3MRRA 3TA3C 3IU3B 5DEGA 2WM0A 2YRPA 1IM9D 4TSBL 2EKSB 2OSLB 3GB7A 4KKCD 2ED8A 1ZEAH 2FB4L 1RK1B 3RZCC 3O9WB 4KKAD 3LEVL 4RIRB 2BNUB 3B5TA 3RWFB 2AJZA 2ATPB 5GJTL 2G75A 1JPSL 1EXUA 3OJ2C 1UGNA 2JJTC 1WTLA 2R0LL 3U46A 1ZEAL 2FB4H 3D0VA 3T0DA 1EHAA 3DVIA 4Q6YA 2KPNA 1F5WA 4JY4B 1FQ9C 3FQNA 3GSXB 4NQDA 5EZJA 4O51B 5C0AA 2VLRA 1BVKA 3MRKB 1AQKL 3MYZA 1TXKA 2UVEA 5KVEL 3QP3A 3KVQA 4WV1B 1LP9E 2R0LH 4FN0A 4G6AC 4WUUE 1T1YA 4P57B 4WV1C 2VUYA 5E2VL 5IJVB 3K1KC 5DA0B 5EOQH 5HVHC 2VXSH 3CX2A 1H3XA 1J0YA 4LLYB 1RMFH 3QI9B 3ARBA 4XP5L 4L4TA 1K85A 3O3AB 1GVIA 2FIRT 3BPOB 1GAFL 4TSAL 4HUVB 5IWLA 1AGBA 5FDWB 2E7BA 1VFAA 1JWUB 5F88A 1A7BA 3F7PC 3Q2CA 4ODHH 5F1KC 2CKBA 5EU4B 2BHUA 5T1KD 5I66A 5DC9B 4L8CB 1DZBA 2CQVA 4Y1AD 1RUKL 4YDIH 4PRPA 3S3PA 1ORQB 2VLKA 1LE9A 5D7SH 5IF0A 3SGKC 5FKPA 4KKAC 1GGBL 1A1MA 3O6KH 4XAKE 5IKCA 4KKCC 1I7TB 3WIIH 4U1HB 1CQKA 1NAMB 1RUKH 3SE4C 1QKZL 1U3HD 3E6FB 2AJ3A 4I0PB 2DQEL 4NUJB 4AG4H 2ZG2A 2CJUH 4S2SB 4BK5A 4WW2F 4XC1L 2V2XA 2DQFB 3BIKB 5D6CA 4TOYL 1F4YH 3FQNB 1VA9A 2F5BH 4JY4A 1J1OH 3FT4B 1KCRL 1IT9L 3C8KA 5I1DA 2IG2H 5I19H 3VXOA 1ZV5A 3EO0B 7FABL 4PJAF 2GAZB 5FKAA 4G6KH 5JIIA 5J13C 4WU7B 4ZODA 1Q9KB 2B20A 5D5MA 1T7XA 4IJ3B 5EO1A 2FBJL 1SJEA 4NWTL 1TJIL 3CSBA 2JIXB 3BQUB 5GZND 3ULUE 3MRQA 1DFBL 4GQ9L 2B1HH 4PJCF 5JNYA 3DVNB 1QBML 2XWJB 4NQVB 3BKJL 5J4MA 5F9JB 1NMCC 4E0RA 3C60D 4OLWH 3Q5TA 4GW5A 3RX8A 3B9KD 5MEQB 4J6RL 4KKBD 2CIIB 4X6CB 3AMKA 3UBXB 5D7JD 3VWJA 2FLRT 1QZ1A 4JM2A 5L9DH 1L6XA 1U58B 5GISH 1BAFL 4GW1A 1P69B 1IAIM 3DUSA 2DBLH 4R4BB 2HWZL 3L3IB 1LE9B 3DWTA 3BH9B 1RFDH 3BGFC 4LLWA 4AMKH 2PO6D 4Q9QH 4JO4L 2P5WA 3MCKB 3IJYA 1BLNB 3WCYA 1RUMH 4PLKC 3FQRA 3VXSD 5KSAA 4A6YB 2QADC 4NHUB 4UOW0 5KS9E 3JXAA 5HYIA 4C83A 1T7WA 4YHZH 2EO1A 4HEPG 2FD6L 2P8MA 4KQ4H 4WGVB 1YN7B 3MOAH 1NDGB 4FNLH 1M71B 4K23H 5JW5B 4MAUL 3WNKA 1S9YA 4LSSL 5CZKA 3O2VH 1XR8B 3MUY1 4MNHB 4WI6A 4PRAB 3MYJB 4U6VH 2YD2A 3EDJA 4F7CA 1ONQB 3SE8L 2AK4B 3I6GB 4MJ5A 3TIDA 5BVPL 4P4KB 3OR6A 4P4KA 1D5XB 3QPQD 5KOMC 2QR0B 4P2QE 3SKOA 4PJAB 3T09A 3SQBA 4F9PC 4MS8C 4LL9A 1YNTA 3DXAB 2AJUH 1CFSB 4TRPH 4WWKA 5DUPL 1U3YA 4HUXA 4UU9B 4HUXB 4UU9A 3R8QA 2NTSP 3TYFB 1U0QA 3IDXH 1F3DH 1MHCB 3ILPA 1BZ7A 4ELMB 2VZVA 4ELMA 1T22A 1UYWH 3BZDA 2OI9B 3BFOA 2H8PA 3K46A 2OR7A 4XHJC 4D0CB 1IGTB 4RGNE 1K6QH 1JYVA 2N7BA 4X9HA 1J86A 2DOCA 2NY6B 2OTUA 2QV2A 1LWRA 1OTUD 1MFBL 3GMOB 9CGTA 1GZQA 3U48A 5DQJA 3RWDA 3MOBL 3VCLA 4JRWA 3VXMD 3SDCB 2R1WA 2NY6D 2WLZA 2R15A 2CK0L 3O11B 3V6OC 4NO5B 4Y4HD 2F15A 3JTTB 1KCVL 4H5SB 5ESAA 1OGAB 3GMMB 1OGAA 1SMAA 4JZOB 1IAIH 2YK1H 4Q97A 3LEYH 1PSKL 4RA3A 3X11B 2B4CH 1OF2B 2RCSL 1N8ZB 1PQZB 5E6YA 1BVLB 3GMLA 3O6LL 5GGVL 4NKMB 1OTSC 1ZXQA 3MNZB 1XMWA 4DEPC 1OAKL 1PY9A 3T0EE 2D31A 1FPTH 1SJVA 3TIDB 4NNYA 3MUZ1 4NCC2 1G7QB 4H26A 3QJHA 4X6DE 4HIEB 1CGWA 2P1YA 5CGYC 1D6EA 4L3AA 2D7NA 4U3CA 4Z7WE 2ZJSH 2E8YA 3HUJE 1KEML 1IFHL 5HY9B 1IBGL 4LIQL 4J4PA 3GI8L 1FNSL 3L3HB 1UWXK 1W2KT 1L7IL 1W0VB 2V2WA 3EDKA 4N0YL 1PGRB 4YZFE 4K3JH 1OY3B 4QNPF 1JFQL 4HKBA 2ZJSL 4X6BA 2IPTH 1RJZB 3D25B 3MLWL 3ZZ1A 4XP4H 2J8OA 1LILA 4NRZB 2GEEA 3ZHKA 3VRJA 5IFHH 1XR9A 1QEWB 1CXLA 5EA0L 3ARYA 3NN8A 3PQYA 2BY1A 2BOBB 2X1WL 4LK4A 3EOBB 3TVMC 1HKLH 4JFYB 3T65B 3ME0A 1HQ4A 1U95B 3HCVA 3CVIH 4OZIE 3PGCA 4AH2A 3M8OL 1FBIL 4WHYG 5CD3B 1RUQH 4YHMH 3V9FA 3OAYH 3O3AA 3O9WA 3TM6A 3EJYC 1BPVA 3QQNA 5JXED 4IRJB 4O58H 1T7ZA 1QQDB 2ZNWA 5HI5D 4H20H 3RRQA 2DLHA 3C2AL 1NBZA 3VRLF 4L4JA 5ACZB 3P2TA 2WBJC 2WMPA 4NQDE 3EZJB 1W72B 4YFDB 3L7FB 5T5NG 5EZJB 5IWLC 2ZPKL 3I3BA 4X7FC 3EYQD 3WUWB 3T3PF 1TTGA 5KVFH 2EYRA 3X3FL 4YXLL 4NJAL 5EZOL 1CICC 4M7LL 2FH8A 3QNXA 1A3LH 2YZ8A 3JWDL 4YHLH 1KENL 3HNVL 4OAWB 4UDTA 1UXSA 4FXGB 4BQ9A 3QNYA 3SDAD 2XQBH 3MUJA 5AYUL 4NIKB 4MCZA 2DL9A 4YGAB 3FB7B 2OZ4A 3HE7A 2AV1A 4O51A 3INUL 3N50A 4Y7MA 3CFBB 5GSVB 4QHNB 1MCLA 4XAWL 2R1YA 3QNZA 1BFOB 1LGVA 1IGIH 5EU4A 4L8CA 5H2BA 1FO0B 3QG6A 2VUOA 3GSUB 1OAQH 2R8SH 3I84A 3E2HC 2XWTA 2VQTA 1G9MC 2D7TH 5H35A 4XVTH 4LKCA 2MHAB 1KPRB 3AY4A 4WW1B 5FECA 3O3DB 3E6FA 4JFXA 5EU3A 2Y6SD 4HPOL 2AAVA 2DBJA 4TSBH 1MF2H 4OI9A 2EDXA 2H6PA 3P0GB 4MQ7B 4IMLA 3QDJB 1LO5B 1U8JA 2CH8A 2WQRA 5E7FA 3ZTJG 2QQQA 2R1XA 4I0KA 2EDDA 4J3UA 3DI2B 1J8KA 35C8L 3HS0B 5C0NC 2PR4H 1BX2A 3NZ8A 4I9WD 4QXWA 3KDMA 4M5ZH 1UZ6E 2GCYA 4H88L 5HHVH 4YEFA 4Y2DB 3QDHA 3RHWK 4ODUA 1KTLA 1G6VK 5FYJL 2ZOKA 3TN0C 4GXUN 3QA3A 1A4JA 4WWKD 3NCFB 3LPFA 4MD4A 3TCLB 1A1NA 4FA8A 1DQJB 3RL2B 3VH8G 3TF7C 1WGOA 4L3EB 4M62H 5C9JB 5A16B 4M7KH 3K4AA 4P2OC 5CMAA 5ALBH 3CH1B 5ICZA 1JMZA 4JO1H 3PQYD 1L0QA 3VD3A 1CTNA 2V9TA 4LARL 4KU1A 4KC3B 5FUCC 4YNYA 2W9DL 4M62L 2WSKA 5C8JB 2C4FU 4ZAKA 4G6JH 5GRXG 4P99A 5FM4A 5TDOA 1Y18A 1IEAB 1ACYL 2CIIA 4EI6B 2WIIB 5JW3L 5EPMB 5F6IC 1N0XH 3FMGL 4PYGA 5EU3B 4N0FA 2JELL 3OKLB 4ENED 4IMLB 2PO6A 3QIUB 2LV4A 4JKKA 2NR6D 3IAPA 4RSVA 3AVEA 2ADIB 4X4ZA 3OKNA 3EFFA 1E4WL 1NGYB 3NOIA 1CN4A 1VSCA 1JGVL 2H26B 3GGWB 4PRBA 3SCMC 3E6HA 1LK3H 2Y23A 3HNSH 4IRSD 1FZMA 1QSFB 4PJ8B 4TOYH 4JRXE 5L2KA 3RVXD 1AHWA 4Q74A 3SGDH 3C60A 1INDL 2APVA 2K7PA 1FFPB 1ADQH 2CPCA 4LLMA 1I9JL 3TBTB 3FL7A 1AQDA 1FNLA 1KJ2B 1RZIA 3R1GH 1T0MB 5GGSB 2GJJA 5D2LB 1UADC 3LOWA 1OP5H 3UTZA 4JM2F 3IXTA 2F19L 4R4ND 5T3XL 2GSGA 1A7OH 3U7YL 3IDGA 5AD0B 5C08E 5HGGS 1ZVSA 4X9IA 4Y5XA 4MGXA 4LASH 2XQYK 4LOUD 1NGWA 4HGWA 2Z92A 1R5VA 3KPQB 4LRNH 1BOGA 2DF3A 2Z8SA 5JUEL 1JBJA 2KL6A 2EXYD 2HTLD 4NO0A 4OF5A 5EO0A 3SDXB 1NL0L 5D2LF 2O5YH 2FJFB 5IVZB 2P5EB 4KUCD 1DR9A 2VLMD 2ARJA 1AJ7H 5I2IB 3D3VA 5CWSB 4XB7A 3TCXA 4OLZH 3SKNB 2DIJA 3REWA 5F7UA 1CE1L 4PG2A 1D7FA 4NM4H 4OZHA 2EZ0D 4B53A 3K3QA 3WD5H 3OKYA 1FVEA 2PYED 4MJIB 3MJ9A 3OX8B 3LKQB 3O6KL 4K94L 1UB6A 1PDKA 2EDHA 2HFEA 1PZUB 1WCBB 1B90A 3SJVD 2DLTA 4KVNH 5TDNA 3NMEA 4NGHH 4MXQD 4HLJA 2A9NL 1R5IA 5CP3A 3I3EA 1MFDH 3WD5L 1FN4B 1ZA3B 3O4LA 1YNTB 3BWAB 5KSAC 3CAFA 5HHMB 1ZOXA 4N5EC 4RFOL 4Y19A 3KPSB 3U7WH 3UZEA 1EEUA 4JAMA 2IH3A 1D6VL 4KROB 1YEIL 1KCUH 4LPYA 4EEEA 5TQ2H 5JHDA 5CLWA 2JB5H 2OQJA 1FLRH 3HAEA 3QDGB 5I15L 3WIHH 1KC5H 4FXGA 4N9OB 1JWMB 4S0SD 4LCYA 3TN0B 2HT4D 2Q1EA 5D7LB 4OT1L 1EAPB 3BP6A 3R06A 4EN3C 1NC4A 2R2BA 1HYSC 2VDML 4FABH 2ITCA 1QPPA 3CFJA 1Z3GL 3KYKL 4BUHA 3EDFA 3EO9L 4OTXL 4PG2C 2DQUL 3HE6B 5FA3B 5EO0B 3SDXA 4M93B 5T3ZE 4WEBH 4ZFFA 5IJVA 1DVFB 2X7LA 4PRIE 2HFFA 2UY6A 2GJZB 1MFAL 5I1GH 2QSCL 5K33A 3L95A 3SOBH 1S9VA 4NUGH 2R4RL 3MOBH 4JREB 4ZDHB 3TZVB 4Z5RA 1RJLB 2WBJA 1BFVH 3RWCA 3RGVB 3KPNB 2BMKA 4IRJA 2DQHH 4PV9A 3T8XA 3T0AA 4Q9QL 5KANI 4JO3L 3BZEA 3VWJB 2PTTA 3UBXA 1MHPL 5SWZE 2X9WA 3QEQB 4JB9L 2XN9B 4H1LH 1BMGA 4M6ML 5BVJB 5F1IA 3GFUA 4MSWB 2N1KA 2B4CL 2RCSH 2YC1A 3MJ6A 4F58H 1PG7H 4X4ME 5GRUL 3D48R 1RZFL 5JHLH 4JFPB 3RJQB 3VXNB 4DAGL 4N5UA 3TJEL 4D9RE 3DECA 1IC5L 1JP5A 2GFBA 4V2BA 3VWKC 1KCLA 3P73A 4NSKA 1Q9OB 1VFMA 4NHCL 5ITBL 4HZAA 3T1WA 1ZLUK 3FFCD 5DMGC 4LQFH 3B8YA 5HHQA 4KMLB 1EXUB 3CLEH 2VLJA 3PP3K 1EAPA 2ZCKL 3VXUB 1BM3L 2P5ED 3VGBA 1EX0A 1L7IH 4ZUVB 1IL1A 4CW1A 1CQYA 1MCJA 2ESVE 3PWJB 2I60L 2AVGA 2P46B 4HWUA 2I24N 4JDTL 4ORGB 5GGRA 1IGJA 2EIZA 5DD6B 3VXRD 2IPTL 3O45A 3RX5A 4MJ5B 3GK8H 1ONQA 4I5BA 2PO6C 4JKMA 1B6DA 2GJZA 1EGJH 1MNUL 3PP4L 3VXUE 3PWPA 2XIDA 3K2MC 4NQXA 4RQQA 3TCLA 1EHXA 5E9DB 5LCVL 1U2CA 5FCUL 3ESVF 3S7GA 4PJ5A 2I07A 4OCWH 1HNFA 1A6ZA 3BGMB 3SDDB 1HZHL 1WC7A 5I8KH 2DB8A 4M6NH 4GFTB 3L3GA 1NBVH 1S9WA 5IB2B 1JN6B 4F7EA 4NQCA 1JN6A 2Q6WB 2XWBB 1IQDA 4G8IB 5FCUH 4OV6F 3FOLB 2AS5M 1FHGA 3BYYA 4EUPB 4CU6A 4LCWE 4FQLH 2BNQE 2K3TA 4HS3A 4LLWB 3BUTA 3D85D 4S1RH 1W72L 2C9AA 3QIBD 3WLBB 3MJ8B 1DEEB 3WN5A 3CH8A 3HI6L 3TO2A 3RP1A 5DQJB 1EO8L 4KHXH 5T5FH 3BDYH 1EO5A 4HCRA 4YDIL 2XQYG 3LN4A 3NTCH 2Z31C 4S1RL 5BS0D 1OAYL 4V1DD 1ZHNB 4BFBD 5GRJL 5IB1B 5ESAB 2HLAB 3I02B 3CFCL 1LNUB 5D6CB 2XOTA 3O4LD 2C1OB 5C09B 4K7FB 4CW1B 4OLEA 4BH8A 2ZUVA 2O5XL 4P9ML 5DHVH 5DRZB 3LPWA 5I1AB 4YE4L 2VXQL 1UACH 1HHKA 4Q6IB 2BY3A 3QNZB 1EH9A 4NCC1 1CXHA 1ZGLB 2VO5A 4XRCB 3PGDA 3ARFA 5KG9A 5HGBB 2Q8AL 3DVNA 1KCRH 1QSZA 5HHPB 4Y89A 3C60B 3ZE1F 1UEMA 5DZNA 4XCEA 3BKYH 3L1OH 2D3VA 2IAND 4K8RL 4R26L 3MLWH 2QLVB 1CFVH 2UWEB 3EOTH 4UIKH 1B0RA 3EJJX 1MSPA 1RIVL 4JDVA 2HH0L 4BQ6A 3CUPB 1AP2B 3DRQA 3BKJH 2Q7NA 4JZNB 3WO4C 2RR3A 5I2IA 4JFOB 1C16A 3PWPD 1KEGH 5HI3C 4TN9A 3OF6D 1E6OH 2BSSB 2OTWA 5E94B 4U0RB 2NX5A 2C3XA 1R5VB 4PP1D 4EI6A 4CAGA 1AGFA 4IDLA 1KTLB 5E7BA 1A6TA 4DTGH 4WFGD 5AAWA 1GZPA 2VLRE 4DN3H 1ZT4B 2R0WH 4NKOA 2HKFL 1UWEH 5TE4H 2XZAH 5L88L 4QEGA 2R2EB 2Z4QB 5HHOB 3MLYH 5BJTB 2APTA 2JCCA 1G9NH 5L2KD 2AQ2A 2GQHA 4NT6B 1CFBA 2B5IB 2OR9H 1NMBL 3V4UL 4FQIL 3UJTL 1T20B 4E42A 4X99A 1S7QA 2E7LA 5HGBA 1K3IA 1KF9B 5DJYA 4LCUA 1VERA 1UG9A 4ZQKB 3CZFA 3UCRA 4ZMAT 4YHYC 2C7UA 5CD5D 4LF3A 1IEAA 3U6RB 1R24B 4Z95H 1RD6A 1UC6A 4XNXL 4JFQB 2MCG1 1NLBL 1JPFB 1X5LA 3MV8A 3Q6FB 2BSTB 2FEEL 2OQJB 5JOEA 4UOW1 2PO6B 43C9B 2EECA 3DO7B 3LKOA 1IEBB 2R9HC 3NIFF 1D5IL 4K3EL 4DKEL 3F7VA 4P3CH 5C0RL 2OTWB 4OI7A 5T33H 2EE6A 3HMXA 4YBQC 5GSVA 2JELH 5BZWA 2H41A 5D4QA 3O2DH 3D9AL 2J7LA 1Q38A 3QUXA 3L7EB 4MB3A 5E8DH 5ENWA 1MJUL 3E8UL 3S36L 3GSUA 3BO8B 1DSFH 1ZLVH 1R6VA 1IM9B 3K8KA 3FB8A 5BJTA 3ROOA 2AEPL 1T66C 4NKDB 4U1JA 3QHZH 2NTFA 1RZ7L 2D0FA 5FO7A 1UH4A 4ZS6D 1KBGL 1J5OH 4ZOCA 4I3RL 1XF1A 3MLSH 4PGJA 2AEPH 2H6PB 1UWGL 2HMID 5MI0B 4CRPA 2OP4L 5IFJA 1RPQA 1FYTD 3QFJD 3B9AA 1IILE 5E1HB 2YBRB 5DVOA 1UWGH