2FCJA

Structure of small toprim domain protein from bacillus stearothermophilus.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
114
structure length
114
Chain Sequence
MRRVEKVIIVEGRSDKQKVAAVLNEPVVIVCTNGTISDARLEELADELEGYDVYLLADADEAGEKLRRQFRRMFPEAEHLYIDRAYREVAAAPIWHLAQVLLRARFDVRIESLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small TOPRIM domain protein
publication title Crystal structure and putative function of small Toprim domain-containing protein from Bacillus stearothermophilus.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 38
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1360.20 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Toprim domain 2fcjA00
2FCJA 2I5RA
chains in the Genus database with same CATH superfamily
1T6T1 3VE5A 1EQNA 2AU3A 1D3YA 2ZBKA 4EDRA 4EE1A 4EDVA 4E2KA 4EDTA 1DD9A 4EDKA 3VDUA 4EDGA 2V1CA 1DDEA 2I5RA 3VDPA 1VDDA 2Q2EA 2FCJA 3B39A 4O6OA 5GUJA 4O6PB 4JCVA
chains in the Genus database with same CATH topology
2FCJA 2I5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCJ A;  2I5R A; 
#chains in the Genus database with same CATH topology
 1T6T 1;  3VE5 A;  1EQN A;  2AU3 A;  1D3Y A;  2ZBK A;  4EDR A;  4EE1 A;  4EDV A;  4E2K A;  4EDT A;  1DD9 A;  4EDK A;  3VDU A;  4EDG A;  2V1C A;  1DDE A;  2I5R A;  3VDP A;  1VDD A;  2Q2E A;  2FCJ A;  3B39 A;  4O6O A;  5GUJ A;  4O6P B;  4JCV A; 
#chains in the Genus database with same CATH homology
 2FCJ A;  2I5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...