2FCKA

Structure of a putative ribosomal-protein-serine acetyltransferase from vibrio cholerae.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
178
structure length
174
Chain Sequence
MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal-protein-serine acetyltransferase, putative
publication title Crystal structure of an acetyltransferase protein from Vibrio cholerae strain N16961.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Structural genomics, unknown function
total genus 52
structure length 174
sequence length 178
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fckA00
4L89A 1M44A 1I1DA 3BJ8A 2HV2A 3S6KA 4CRZB 2QIRA 4M85A 3R9FA 3T90A 3NE7A 4KZTA 4KORA 1IICA 2BUEA 2G3AA 2K5TA 2PRBA 1VKCA 1B87A 4U9YA 2GANA 5EC4A 4R3KA 1Q2YA 1S7NA 1TIQA 3UY5A 4MJ8A 2Q4VA 1RXTA 1YLEA 4KOYA 4RI1A 1GHEA 3EC4A 3GKRA 1YVOA 2D4OA 2BSWA 2Q0YA 1YVKA 2A4NA 4CAXA 1PU9A 1LRZA 2B5GA 4LUAA 2OZHA 2Z11A 3QB8A 5H86A 2PR8A 1J4JA 4NXYA 1CM0A 5J8CA 2VI7A 2KCWA 4QVTA 4HKFA 4KOVA 5JQ4A 2H5MA 5FVJA 1XE4A 5J8FA 5H84A 2B4DA 3OWCA 4FD4A 4UA3A 3EFAA 2ARHA 1Z4RA 1S7KA 2JDCA 1S3ZA 4OLLA 1S7FA 3EO4A 4F0YA 3MGDA 4AG9A 3FIXA 4KLVA 4QUSA 2CNSA 4E2AA 1IIDA 2ZW6A 3LD2A 2Q44A 4F6AA 2VXKA 1NE9A 1L0CA 2OU2A 4R57A 4DNCA 4IF5A 2CY2A 3G8WA 2AE6A 4KVME 4XNHC 2PR1A 4ZBGA 2B3VA 2R98A 4AVCA 3W6XA 3FXTA 2QECA 2F5IA 1M4DA 3DDDA 1YREA 3PZJA 4YFJA 3PGPA 2OZUA 3D3SA 1NSLA 3P2FA 4KOSA 3ZJ0A 1IB1E 3GYAA 1M4IA 4LX9A 5DWNA 2P6FA 2PQ8A 2FXFA 2OH1A 2FE7A 5KTCA 2ATRA 5KTAA 3KKWA 4KOTA 2PDOA 4JWPA 2AJ6A 2Z10A 4FD5A 4JJXA 4UWIA 3IWGA 3WR7A 4H89A 4CRYB 2ZXVA 1QSNA 4EVYA 4JD6A 3DR6A 1S5KA 4PK3A 3W91A 4E8OA 5CNPA 2RC4A 2JDDA 3IGRA 2REFA 3C26A 2O28A 4XNHB 2VBQA 4NF1A 2EUIA 1YR0A 2Y0MA 4JXQA 4U9ZA 4FD7A 2PC1A 1MJAA 4B5OA 3D2PA 1IYKA 4HNXB 4IUSA 2QMLA 3B8GA 2P6GA 3VWEA 3FYNA 4HNWB 2IL4A 1R57A 4XPKA 3SXNA 2P0WA 2R1IA 4PSXA 4QBJA 2J8MA 4II9A 1M4GA 1N71A 4NCZA 2C27A 2FL4A 5DWMA 3DSBA 1S60A 4CAVA 5C88A 1Y9WA 1Y9KA 3F0AA 3S6GA 3D8PA 1QSTA 4UWJA 1Y7RA 2G0BA 4MHDA 4R3LA 2VZZA 4PSWA 5F47A 2I79A 3V8IA 2JLMA 4Y49C 4ORFA 3EXNA 4KOUA 2OZGA 1P0HA 1MK4A 3FRMA 4KOWA 5IX3A 4AVBA 3BJ7A 1B6BA 4PV6A 3SXOA 1OZPA 2DXQA 2BEIA 1XF8A 4B5PB 2ZW5A 4UBRA 4AG7A 3F8KA 4FD6A 4KUBA 4L8AA 2X7BA 1Q2CA 4RS2A 2P6EA 2R8VA 4KUAA 3R96A 5KTDA 3FBUA 4OADA 4AB7A 3TOAA 1M1DA 2FSRA 3TO7A 3CXPA 3VWDA 4QB9A 2J8RA 4MI4A 3FNCA 3D2MA 2GIVA 4XPDC 5F49A 3T9YA 5F46A 2B4BA 4Y49B 4MY3A 4R87A 3JVNA 3LODA 1XEBA 1YK3A 1WWZA 3TE4A 4KVXA 1KUYA 1PUAA 2GE3A 1S7LA 5C82A 3W6SA 3FB3A 2PSWA 4KOXA 4X5KA 2HQYA 3R9EA 4B5PA 4U5YA 1YGHA 4H6ZA 2Q4YA 1Z9UA 3H4QA 4JXRA 2D4PA 3BLNA 5ISVA 4J3GA 3EY5A 2B4DB 2HUZA 4ONUA 4BMHA 4OAEA 4JLYA 3RYOA 3JUWA 4GS4A 2EVNA 4XPLA 2B3UA 5E96A 4XPDB 1YX0A 1Q2DA 1SQHA 2BL1A 3S6HA 2JEVA 3N7ZA 1ON0A 5I0CA 3R95A 1BO4A 3TFYA 1FY7A 3SHPA 3TCVA 1K4JA 2VZYA 3TOBA 5IB0A 2FIWA 3K9UA 1RO5A 2ZW4A 1IYLA 1WK4A 1XIXA 4NEXA 2B58A 4CS0B 4MBUA 3I9SA 4AVAA 5F48A 1MJ9A 2VEZA 2VQYA 1MJBA 4R9MA 1UFHA 1NMTA 4YGOA 3DNSA 2ZW7A 1U6MA 2I00A 2WPWA 3CXSA 4CAWA 1V0CA 1QSRA 2Q04A 3DR8A 1Z4EA 2J8NA 3ZZIA 2Z0ZA 2G3TA 1P4NA 4M3SA 3TO6A 1I12A 2Q7BA 4NSQA 1CJWA 1QSOA 2FCKA 2FIAA 3G3SA 5GCNA 1XMTA 4YRHA 5HMNA 4K30A 3R9GA 1I21A 3QAHA 3S6FA 2CNMA 1KUXA 2OB0A 5HH1A 5EBVA 1BOBA 3PP9A 2REEA 3GY9A 1KZFA 4H6UA 2R7HA 3P2HA 2NMTA 4QC6A 3TO9A 4MY0A 3E0KA 5IV0A 1VHSA 5JPHA 1KUVA 2FS5A 4E0AA 3R1KA 4KVOE 3F5BA 2CNTA 3TT2A 3I3GA 4KLWA 2WPXA 2FT0A 2B5GB 4PK2A 2ZPAA 4I49A 3TTHA 4HNYB 3CXQA 1QSMA
chains in the Genus database with same CATH superfamily
1YQEA 4L89A 3FX6A 3CPAA 2PJ8A 1RTQA 1M44A 1I1DA 3BJ8A 2HV2A 3D7HA 3S6KA 4CRZB 1BPMA 1YW4A 1QMUA 4Z65A 2QIRA 1F2OA 4M85A 3R9FA 3T90A 3NFZA 3NE7A 4FUUA 4KZTA 1VGYA 4KORA 1IICA 2BUEA 2O4HA 2G3AA 2K5TA 1TKFA 2PRBA 3PFEA 1VKCA 1B87A 4U9YA 1ZO0A 5THWA 3IIBA 4CGPA 4R6TA 2GANA 4TNUA 4R3KA 2IJZA 1Q2YA 5EC4A 1S7NA 1TIQA 4YU9A 3I1UA 3UY5A 4MJ8A 2Q4VA 3BI1A 3KQZA 3H8EA 1RXTA 2YNCC 5G22A 2XEJA 4MCRA 1YLEA 2IMOA 3PB8X 5G1ZA 3D67A 4KOYA 4RI1A 1ZLIA 1YW6A 4JYWA 1XOVA 4F9UA 4B14A 1GHEA 3EC4A 3GKRA 4RN7A 1LOKA 1YVOA 2D4OA 2BSWA 3RAMA 4FWUA 2Q0YA 1YVKA 2A4NA 5J1QA 4CAXA 3FMCA 1PU9A 1LRZA 1Z2LA 4IAVA 4MHYA 2B5GA 4LUAA 4NGTA 2OZHA 2Z11A 3KR4A 3QB8A 2GLJA 5H86A 2AFSA 2PR8A 3BI0A 1J4JA 4NXYA 3NE8A 1CM0A 5J8CA 4C7IA 5BWAB 3TC8A 2VI7A 4BBHA 1Z8TA 2KCWA 3B35A 4HKFA 4QVTA 1ZG9A 4OP4A 1LAMA 4KOVA 4M6IA 3S9LA 3FVLA 3SJXA 2H5MA 4C2XA 5JQ4A 2XEFA 4P4EA 5FVJA 1XE4A 5J8FA 5H84A 2B4DA 3L2NA 3OWCA 3PBBA 3IU2A 7CPAA 5LRKA 4FD4A 5JGFA 2XEGA 1F57A 4OC3A 2Z3OA 4UA3A 2QYVA 3EFAA 3IU1A 4NGRA 1FNOA 1Z4RA 1ZG7A 2ARHA 1S7KA 2JDCA 1S3ZA 2DF5A 4OLLA 2WSAA 1S7FA 3EO4A 2ZOGA 2EO8A 4F0YA 3MGDA 5JH9A 4DUKA 4AG9A 4ZYQA 3FIXA 4KLVA 2PVWA 2CNSA 4QUSA 2EK9A 4UCMA 4E2AA 2YNDA 1IIDA 1JWQA 1Z8LA 2ZW6A 3KZWA 1LFWA 4PXCA 1XBUA 2PIZA 4UIBA 2EBJA 3IFEA 3LD2A 2AFWA 2Q44A 3RBUA 5K8PA 4RUHA 4F6AA 2VXKA 1NE9A 1L0CA 2OU2A 1XRYA 4GM5A 4JZ0A 4MFKA 4P4IA 3MRUA 4R57A 4DNCA 4IF5A 4FAIA 4LQ6A 2CY2A 2C6PA 2HC9A 3G8WA 3K9TA 2IQ6A 2AE6A 3D68A 2QJ8A 1A2ZA 2PR1A 4KVME 4XNHC 2ZEDA 2V8GA 2AFMA 4KSFA 5LRGA 4ZBGA 2B3VA 1TXRA 2GLFA 2R98A 1CBXA 4AVCA 3W6XA 1R43A 3RNZA 2PJ6A 3FXTA 2AFOA 2QECA 2F5IA 3NH5A 4B12A 4A38A 5K8NA 1VIXA 1M4DA 3DDDA 4ZX8A 1YREA 3IWWA 3PZJA 4NGMA 3PGPA 2C6GA 2JEWA 2OZUA 3D3SA 1NSLA 5CPAA 3P2FA 4KOSA 3ZJ0A 3S9NA 1IB1E 3GYAA 3QNVA 4A39A 1M4IA 4LX9A 5DWNA 2P6FA 2PQ8A 3JRUA 2V8HA 2FXFA 3HLPA 4MCQA 2OH1A 5A28A 5HVGA 2FE7A 4UEZA 5KTCA 1PCAA 2PCUA 2ATRA 2YNEA 4HPSA 2RB7A 4MRIA 3FH4A 5KTAA 3KKWA 2AFZA 3B3WA 3TX8A 5CBMA 4PXDA 1AUGA 1IOFA 4KOTA 4B6ZA 2ZELA 2PDOA 4JWPA 2AJ6A 2Z10A 1XFOA 4FD5A 4JJXA 4UWIA 1TKJA 2YNCA 3IWGA 4R76A 3WR7A 4H89A 1Z5RA 4GXHA 4CRYB 2ZXVA 4MFZA 3H8GA 1QSNA 4EVYA 4JD6A 3DR6A 1S5KA 4IHMA 1CPSA 4PK3A 4EMEA 2ZEFA 4MHNA 4F8ZA 1IGBA 1Y0RA 5IB0A 1TF8A 3W91A 4E8OA 5CNPA 4CPAA 1CG2A 4MXUA 2RC4A 2JDDA 4A94A 4A33A 4X8IA 3IGRA 2REFA 3C26A 2Z3MA 2RFHA 2O28A 1X10A 1TKHA 1CP7A 2VBQA 3FEEA 4MCPA 4XNHB 3B2YA 3IJ3A 5LYIA 4NF1A 3IC1A 3CT9A 2EUIA 4LQGA 1YR0A 4P6YA 4OIDA 2PJ9A 2Y0MA 5A27A 4M6GA 4JXQA 4TWEA 2ZOFA 4CAFA 1GYTA 2CTBA 4PXEA 4U9ZA 4FD7A 1QQ9A 2PC1A 5D8NA 1MJAA 4B5OA 2NYQA 3D2PA 1IYKA 4F9VA 4HNXB 4IUSA 2PIYA 1DE4C 2QMLA 4Q36A 3B8GA 1ZLHA 2WYRA 1H8LA 2P6GA 3GB0A 3VWEA 2J9AA 2GFQA 3FYNA 4HNWB 2IL4A 1R57A 4XPKA 3SXNA 2Z3NA 1BPNA 5LRJA 1VHEA 2P0WA 2R1IA 4NJQA 3VH9A 4A37A 4PSXA 4QBJA 5LYDA 2J8MA 2ZEOA 4II9A 1M4GA 4KSAA 2Q4ZA 1N71A 4NCZA 2I3CA 2C27A 2FL4A 5DWMA 3DSBA 4ZY2A 4OKOA 1S60A 4CAVA 1XMBA 3PFOA 5C88A 4ZX9A 4DYOA 1Y9WA 5AG5A 4UCNA 4OC1A 3BHXA 2PJ2A 1Y9KA 3F0AA 4MHZA 4ZI6A 1F2PA 3S6GA 3SJFA 3SI0A 3D8PA 4M6HA 4C7HA 1QSTA 1Y0YA 4P45A 4UWJA 4ZY1A 1Y7RA 2G0BA 4MHDA 4R3LA 5GCNA 5HXDA 2VZZA 4PSWA 5F47A 2BO9A 3V38A 2I79A 4UEEA 4CGLA 3V8IA 2JLMA 4Y49C 1FT7A 4ORFA 1ARLA 1VHOA 3EXNA 2PJ5A 2OR4A 4KOUA 3NH4A 4ONWA 5LYFA 2OZGA 3IWEA 1NSAA 2ZEPA 6CPAA 1IOIA 1OBRA 3WC5A 2Z3LA 1UWYA 1ELMP 3S9MA 2JBJA 1P0HA 1MK4A 3FRMA 4KOWA 4UFVA 5IX3A 2OOTA 2EK8A 4AVBA 1LCPA 1ARMA 5K8MA 2CTCA 3BJ7A 4C68A 1B6BA 4PV6A 3SXOA 2DEAA 4ZY0A 1OZPA 2DXQA 3T8WA 2BEIA 1XF8A 2F7VA 4KSIA 4A32A 3B3VA 3GUXA 4B5PB 2ZW5A 3GLJA 4UBRA 4AG7A 3PB7X 3D4UA 3F8KA 4FD6A 4KUBA 2GREA 4L8AA 2X7BA 4B13A 4Q38A 1Q2CA 4RS2A 2BOAA 2P6EA 3B3TA 3ISZA 4OIWA 2R8VA 4DJLA 4OC5A 3B3CA 4MFJA 4KUAA 3SI2A 4YFJA 4NGNA 3R96A 5KTDA 1R3NA 3FBUA 3K2KA 1KWMA 3QAYA 4OADA 4AB7A 2PJ4A 3TOAA 1M1DA 2FSRA 2WZNA 4B11A 3TO7A 3CXPA 4Q7AA 3VWDA 8CPAA 4QB9A 4CGNA 2J8RA 1HDQA 4MI4A 3FNCA 4P4DA 2Q7SA 3VARA 5AG4A 3D2MA 1Q7LA 2GIVA 4UF4A 4XPDC 5F49A 1LANA 3FF3A 3SJEA 2PRQA 3T9YA 2ZEMA 4R8FA 5F46A 2B4BA 5AG6A 3DGVA 3D7DA 4Y49B 3FECA 4W9YA 2POKA 3D7GA 4MY3A 4R87A 3KR5A 3JVNA 3LODA 4KS9A 1XEBA 4NGQA 4YWYA 1YK3A 1WWZA 2F8HA 3A9LA 3D7FA 3PEIA 4KVXA 1KUYA 3TE4A 5I4MA 3WABA 1PUAA 2C6CA 1M4LA 2GE3A 1S7LA 5C82A 3W6SA 4NGSA 5D29A 3FB3A 2PSWA 4KOXA 2O53A 4MHPA 1YLOA 2CF4A 4BD9A 4OC4A 4R7MA 4X5KA 1IY7A 2HQYA 3R9EA 5G21A 4B10A 1CX8A 2VL1A 3IEHA 4CYQA 4B5PA 2PJ1A 4G1PA 4U5YA 3N5FA 1YGHA 4H6ZA 2Q4YA 4CGMA 3LMSA 4UCPA 1Z9UA 4PPZA 4C2ZA 4OC0A 3H4QA 1AMPA 4JXRA 4NJRA 2D4PA 5G20A 3BLNA 3VATA 5ISVA 4J3GA 4O23A 3EY5A 3V7ZA 2B4DB 3WC7A 2HUZA 4ONUA 4BMHA 4CGOA 2V8DA 4K3NA 4C2YA 4OAEA 2PJ7A 3KL9A 4JLYA 3HUVA 3RYOA 3JUWA 3KGQA 4GS4A 4OMEA 4EWTA 4CYPA 2PJBA 2PJCA 4CYNA 2EVNA 4P4BA 4XPLA 2B3UA 5E96A 3PRTA 4MCSA 4XPDB 1YX0A 3IO1A 1Q2DA 1SQHA 4BINA 2BL1A 4NGPA 3S6HA 2JEVA 3LWUA 3PB6X 3N7ZA 1ON0A 5AGEA 1EE3P 5I0CA 2DPSA 3R95A 2AFUA 4UIAA 1BO4A 4MFQA 1PYTB 3SI1A 3DLJA 3TFYA 4WWVA 1FY7A 4X2TA 1YSJA 3SHPA 3TCVA 5ELYA 2NSMA 1K4JA 2PVVA 1BLLE 2VZYA 2AFXA 4IK2A 4OC2A 3TOBA 3WC6A 2FIWA 3K9UA 3NA6A 1RO5A 2ZW4A 5HVFA 1IU8A 1IYLA 1HEEA 4A2ZA 4A95A 4CAEA 5IB9A 2HB6A 3PB4X 1WK4A 1XIXA 1DTDA 4UEFA 3B7IA 4NEXA 2G9DA 2B58A 2PJ0A 4PQAA 2WUUA 2Z3PA 4CS0B 4MBUA 3I9SA 4AVAA 5F48A 1CPXA 4PXBA 4F0XA 5LYLA 1MJ9A 2Q43A 1YMEA 2Q51A 1MJBA 2VEZA 2VQYA 2ZEHA 4R9MA 4UFWA 1TF9A 1UFHA 2C1CA 2QVPA 1NMTA 4YGOA 2ZENA 3DNSA 2PJAA 3MN8A 3PB9X 2ZW7A 1U6MA 3NH8A 1CP6A 2I00A 2YGWA 2WPWA 3CXSA 4CAWA 3FEDA 1V0CA 1QSRA 1ELLP 2Q04A 3DR8A 1X12A 1Z4EA 2J8NA 3ZZIA 2FVGA 2ANPA 4A30A 2EWBA 2PE3A 1XJOA 2G3TA 1P4NA 2Z0ZA 3CDXA 4M3SA 3TO6A 2V8VA 1I12A 2ODFA 2Q7BA 3KI9A 5AG7A 4NSQA 1CJWA 1QSOA 2FCKA 2FIAA 2V77A 3G3SA 4NFRA 3LACA 1XMTA 3KASA 3PBEA 4YRHA 3RO0A 5HMNA 4K30A 3R9GA 1I21A 2ZEGA 3QAHA 3H5ZA 3S6FA 3B3SA 4MMOA 5K8OA 2CNMA 1KUXA 4H2KA 2OB0A 2ABZA 5HH1A 4EFDA 4P4JA 5F09A 2Z3KA 5EBVA 5EMIA 4P10A 1BOBA 2GU2A 3PP9A 2REEA 3H8FA 4UFXA 1HDUA 3GY9A 1LAPA 2JBKA 1KZFA 1Y7EA 4H6UA 2DPTA 4P44A 2R7HA 2CXAA 3FJUA 3P2HA 2XEIA 5DS0A 2NMTA 1JQGA 1Z8XA 3ISXA 2PJ3A 1AYEA 4QC6A 2BCOA 2ZEEA 3TO9A 5HVHA 4MY0A 4P4FA 3D66A 3E0KA 5IV0A 1VHSA 4MFLA 5JPHA 1KUVA 4FBEA 2FS5A 4E0AA 3R1KA 3KHXA 4KVOE 3RZAA 4ZGYB 3KQXA 3F5BA 4CYOA 2CNTA 3TT2A 4X3RA 4MFPA 3CPXA 3BXMA 3I3GA 3KHZA 4KLWA 2WPXA 3GIUA 2FT0A 2B5GB 4PK2A 3SJGA 4A31A 2ZPAA 1ZG8A 4I49A 3CZXA 4AXVA 5JM6A 3WT4A 3TTHA 1Z8WA 2CIJA 4HNYB 3CXQA 1QSMA 4WJBA 1BAVA 3JTKA
chains in the Genus database with same CATH topology
4L89A 1M44A 1I1DA 3BJ8A 2HV2A 3S6KA 4CRZB 2QIRA 4M85A 3R9FA 3T90A 3NE7A 4KZTA 4KORA 1IICA 2BUEA 2G3AA 2K5TA 2PRBA 1VKCA 1B87A 4U9YA 1ZO0A 4CGPA 2GANA 5EC4A 4R3KA 1Q2YA 1S7NA 1TIQA 3UY5A 4MJ8A 2Q4VA 1RXTA 2YNCC 5G22A 1YLEA 5G1ZA 4KOYA 4RI1A 4B14A 1GHEA 3EC4A 3GKRA 1YVOA 2D4OA 2BSWA 2Q0YA 1YVKA 2A4NA 4CAXA 1PU9A 1LRZA 2B5GA 4LUAA 2OZHA 2Z11A 3QB8A 5H86A 2PR8A 1J4JA 4NXYA 1CM0A 5J8CA 4C7IA 5BWAB 2VI7A 4BBHA 2KCWA 4QVTA 4HKFA 4KOVA 5JQ4A 2H5MA 4C2XA 5FVJA 1XE4A 5J8FA 5H84A 2B4DA 3OWCA 3IU2A 4FD4A 2Z3OA 4UA3A 3EFAA 3IU1A 2ARHA 1Z4RA 1S7KA 2JDCA 1S3ZA 4OLLA 2WSAA 1S7FA 3EO4A 4F0YA 3MGDA 4AG9A 3FIXA 4KLVA 4QUSA 2CNSA 4UCMA 4E2AA 2YNDA 1IIDA 2ZW6A 3LD2A 2Q44A 4F6AA 2VXKA 1NE9A 1L0CA 2OU2A 4MFKA 4R57A 4DNCA 4IF5A 2CY2A 3G8WA 2AE6A 4KVME 4XNHC 2PR1A 4KSFA 4ZBGA 2B3VA 2R98A 4AVCA 3W6XA 3FXTA 2QECA 2F5IA 4B12A 1M4DA 3DDDA 1YREA 3PZJA 4CYQA 4YFJA 3PGPA 2OZUA 3D3SA 1NSLA 3P2FA 4KOSA 3ZJ0A 1IB1E 3GYAA 1M4IA 4LX9A 5DWNA 2P6FA 2PQ8A 2FXFA 2OH1A 5A28A 2FE7A 5KTCA 2ATRA 2YNEA 5KTAA 3KKWA 4KOTA 2PDOA 4JWPA 2AJ6A 2Z10A 4FD5A 4JJXA 4UWIA 2YNCA 3IWGA 3WR7A 4H89A 4CRYB 2ZXVA 4MFZA 1QSNA 4EVYA 4JD6A 3DR6A 1S5KA 4PK3A 3W91A 4E8OA 5CNPA 2RC4A 2JDDA 4A33A 3IGRA 2REFA 3C26A 2Z3MA 2O28A 4XNHB 2VBQA 4NF1A 2EUIA 1YR0A 2Y0MA 5A27A 4JXQA 4CAFA 4U9ZA 4FD7A 2PC1A 1MJAA 4B5OA 3D2PA 1IYKA 4HNXB 4IUSA 2QMLA 4Q36A 3B8GA 2P6GA 3VWEA 3FYNA 4HNWB 2IL4A 1R57A 4XPKA 3SXNA 2Z3NA 2P0WA 2R1IA 4PSXA 4QBJA 2J8MA 4II9A 1M4GA 4KSAA 1N71A 4NCZA 2C27A 2FL4A 5DWMA 3DSBA 1S60A 4CAVA 5C88A 1Y9WA 5AG5A 4UCNA 1Y9KA 3F0AA 3S6GA 3D8PA 4C7HA 1QSTA 4UWJA 1Y7RA 2G0BA 4MHDA 4R3LA 2VZZA 4PSWA 5F47A 2I79A 4CGLA 3V8IA 2JLMA 4Y49C 4ORFA 3EXNA 4KOUA 2OZGA 3IWEA 2Z3LA 1P0HA 1MK4A 3FRMA 4KOWA 4UFVA 5IX3A 4AVBA 3BJ7A 4C68A 1B6BA 4PV6A 3SXOA 1OZPA 2DXQA 2BEIA 1XF8A 4A32A 4B5PB 2ZW5A 4UBRA 4AG7A 3F8KA 4FD6A 4KUBA 4L8AA 2X7BA 4B13A 4Q38A 1Q2CA 4RS2A 2P6EA 2R8VA 4MFJA 4KUAA 3R96A 5KTDA 3FBUA 4OADA 4AB7A 3TOAA 1M1DA 2FSRA 4B11A 3TO7A 3CXPA 3VWDA 4QB9A 4CGNA 2J8RA 4MI4A 3FNCA 5AG4A 3D2MA 2GIVA 4XPDC 5F49A 3T9YA 5F46A 2B4BA 5AG6A 4Y49B 4MY3A 4R87A 3JVNA 3LODA 4KS9A 1XEBA 1YK3A 1WWZA 3A9LA 3TE4A 4KVXA 1KUYA 1PUAA 2GE3A 1S7LA 5C82A 3W6SA 3FB3A 2PSWA 4KOXA 4X5KA 2HQYA 3R9EA 5G21A 4B10A 4B5PA 4U5YA 1YGHA 4H6ZA 2Q4YA 4CGMA 4UCPA 1Z9UA 4C2ZA 3H4QA 4JXRA 5G20A 2D4PA 3BLNA 5ISVA 4J3GA 3EY5A 2B4DB 2HUZA 4ONUA 4BMHA 4CGOA 4C2YA 4OAEA 4JLYA 3RYOA 3JUWA 4GS4A 4CYPA 4CYNA 2EVNA 4XPLA 2B3UA 5E96A 4XPDB 1YX0A 1Q2DA 1SQHA 2BL1A 3S6HA 2JEVA 3N7ZA 1ON0A 5AGEA 5I0CA 2DPSA 3R95A 1BO4A 4MFQA 3TFYA 1FY7A 3SHPA 3TCVA 1K4JA 2VZYA 3TOBA 5IB0A 2FIWA 3K9UA 1RO5A 2ZW4A 1IYLA 4A2ZA 4A95A 4CAEA 1WK4A 1XIXA 4NEXA 2B58A 2WUUA 2Z3PA 4CS0B 4MBUA 3I9SA 4AVAA 5F48A 4F0XA 1MJ9A 2VEZA 2VQYA 1MJBA 4UFWA 4R9MA 1UFHA 1NMTA 4YGOA 3DNSA 2ZW7A 1U6MA 2I00A 2YGWA 2WPWA 3CXSA 4CAWA 1V0CA 1QSRA 2Q04A 3DR8A 1Z4EA 2J8NA 3ZZIA 4A30A 2Z0ZA 2G3TA 1P4NA 4M3SA 3TO6A 1I12A 2Q7BA 5AG7A 4NSQA 1CJWA 1QSOA 2FCKA 2FIAA 3G3SA 5GCNA 1XMTA 4YRHA 5HMNA 4K30A 3R9GA 1I21A 3QAHA 3H5ZA 3S6FA 2CNMA 1KUXA 2OB0A 5HH1A 2Z3KA 5EBVA 1BOBA 3PP9A 2REEA 4UFXA 3GY9A 1KZFA 4H6UA 2DPTA 2R7HA 2CXAA 3P2HA 2NMTA 4QC6A 3TO9A 4MY0A 3E0KA 5IV0A 1VHSA 4MFLA 5JPHA 1KUVA 2FS5A 4E0AA 3R1KA 4KVOE 4ZGYB 3F5BA 4CYOA 2CNTA 3TT2A 4MFPA 3I3GA 4KLWA 2WPXA 2FT0A 2B5GB 4PK2A 4A31A 2ZPAA 4I49A 3TTHA 4HNYB 3CXQA 1QSMA 3JTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L89 A;  1M44 A;  1I1D A;  3BJ8 A;  2HV2 A;  3S6K A;  4CRZ B;  2QIR A;  4M85 A;  3R9F A;  3T90 A;  3NE7 A;  4KZT A;  4KOR A;  1IIC A;  2BUE A;  2G3A A;  2K5T A;  2PRB A;  1VKC A;  1B87 A;  4U9Y A;  2GAN A;  5EC4 A;  4R3K A;  1Q2Y A;  1S7N A;  1TIQ A;  3UY5 A;  4MJ8 A;  2Q4V A;  1RXT A;  1YLE A;  4KOY A;  4RI1 A;  1GHE A;  3EC4 A;  3GKR A;  1YVO A;  2D4O A;  2BSW A;  2Q0Y A;  1YVK A;  2A4N A;  4CAX A;  1PU9 A;  1LRZ A;  2B5G A;  4LUA A;  2OZH A;  2Z11 A;  3QB8 A;  5H86 A;  2PR8 A;  1J4J A;  4NXY A;  1CM0 A;  5J8C A;  2VI7 A;  2KCW A;  4QVT A;  4HKF A;  4KOV A;  5JQ4 A;  2H5M A;  5FVJ A;  1XE4 A;  5J8F A;  5H84 A;  2B4D A;  3OWC A;  4FD4 A;  4UA3 A;  3EFA A;  2ARH A;  1Z4R A;  1S7K A;  2JDC A;  1S3Z A;  4OLL A;  1S7F A;  3EO4 A;  4F0Y A;  3MGD A;  4AG9 A;  3FIX A;  4KLV A;  4QUS A;  2CNS A;  4E2A A;  1IID A;  2ZW6 A;  3LD2 A;  2Q44 A;  4F6A A;  2VXK A;  1NE9 A;  1L0C A;  2OU2 A;  4R57 A;  4DNC A;  4IF5 A;  2CY2 A;  3G8W A;  2AE6 A;  4KVM E;  4XNH C;  2PR1 A;  4ZBG A;  2B3V A;  2R98 A;  4AVC A;  3W6X A;  3FXT A;  2QEC A;  2F5I A;  1M4D A;  3DDD A;  1YRE A;  3PZJ A;  4YFJ A;  3PGP A;  2OZU A;  3D3S A;  1NSL A;  3P2F A;  4KOS A;  3ZJ0 A;  1IB1 E;  3GYA A;  1M4I A;  4LX9 A;  5DWN A;  2P6F A;  2PQ8 A;  2FXF A;  2OH1 A;  2FE7 A;  5KTC A;  2ATR A;  5KTA A;  3KKW A;  4KOT A;  2PDO A;  4JWP A;  2AJ6 A;  2Z10 A;  4FD5 A;  4JJX A;  4UWI A;  3IWG A;  3WR7 A;  4H89 A;  4CRY B;  2ZXV A;  1QSN A;  4EVY A;  4JD6 A;  3DR6 A;  1S5K A;  4PK3 A;  3W91 A;  4E8O A;  5CNP A;  2RC4 A;  2JDD A;  3IGR A;  2REF A;  3C26 A;  2O28 A;  4XNH B;  2VBQ A;  4NF1 A;  2EUI A;  1YR0 A;  2Y0M A;  4JXQ A;  4U9Z A;  4FD7 A;  2PC1 A;  1MJA A;  4B5O A;  3D2P A;  1IYK A;  4HNX B;  4IUS A;  2QML A;  3B8G A;  2P6G A;  3VWE A;  3FYN A;  4HNW B;  2IL4 A;  1R57 A;  4XPK A;  3SXN A;  2P0W A;  2R1I A;  4PSX A;  4QBJ A;  2J8M A;  4II9 A;  1M4G A;  1N71 A;  4NCZ A;  2C27 A;  2FL4 A;  5DWM A;  3DSB A;  1S60 A;  4CAV A;  5C88 A;  1Y9W A;  1Y9K A;  3F0A A;  3S6G A;  3D8P A;  1QST A;  4UWJ A;  1Y7R A;  2G0B A;  4MHD A;  4R3L A;  2VZZ A;  4PSW A;  5F47 A;  2I79 A;  3V8I A;  2JLM A;  4Y49 C;  4ORF A;  3EXN A;  4KOU A;  2OZG A;  1P0H A;  1MK4 A;  3FRM A;  4KOW A;  5IX3 A;  4AVB A;  3BJ7 A;  1B6B A;  4PV6 A;  3SXO A;  1OZP A;  2DXQ A;  2BEI A;  1XF8 A;  4B5P B;  2ZW5 A;  4UBR A;  4AG7 A;  3F8K A;  4FD6 A;  4KUB A;  4L8A A;  2X7B A;  1Q2C A;  4RS2 A;  2P6E A;  2R8V A;  4KUA A;  3R96 A;  5KTD A;  3FBU A;  4OAD A;  4AB7 A;  3TOA A;  1M1D A;  2FSR A;  3TO7 A;  3CXP A;  3VWD A;  4QB9 A;  2J8R A;  4MI4 A;  3FNC A;  3D2M A;  2GIV A;  4XPD C;  5F49 A;  3T9Y A;  5F46 A;  2B4B A;  4Y49 B;  4MY3 A;  4R87 A;  3JVN A;  3LOD A;  1XEB A;  1YK3 A;  1WWZ A;  3TE4 A;  4KVX A;  1KUY A;  1PUA A;  2GE3 A;  1S7L A;  5C82 A;  3W6S A;  3FB3 A;  2PSW A;  4KOX A;  4X5K A;  2HQY A;  3R9E A;  4B5P A;  4U5Y A;  1YGH A;  4H6Z A;  2Q4Y A;  1Z9U A;  3H4Q A;  4JXR A;  2D4P A;  3BLN A;  5ISV A;  4J3G A;  3EY5 A;  2B4D B;  2HUZ A;  4ONU A;  4BMH A;  4OAE A;  4JLY A;  3RYO A;  3JUW A;  4GS4 A;  2EVN A;  4XPL A;  2B3U A;  5E96 A;  4XPD B;  1YX0 A;  1Q2D A;  1SQH A;  2BL1 A;  3S6H A;  2JEV A;  3N7Z A;  1ON0 A;  5I0C A;  3R95 A;  1BO4 A;  3TFY A;  1FY7 A;  3SHP A;  3TCV A;  1K4J A;  2VZY A;  3TOB A;  5IB0 A;  2FIW A;  3K9U A;  1RO5 A;  2ZW4 A;  1IYL A;  1WK4 A;  1XIX A;  4NEX A;  2B58 A;  4CS0 B;  4MBU A;  3I9S A;  4AVA A;  5F48 A;  1MJ9 A;  2VEZ A;  2VQY A;  1MJB A;  4R9M A;  1UFH A;  1NMT A;  4YGO A;  3DNS A;  2ZW7 A;  1U6M A;  2I00 A;  2WPW A;  3CXS A;  4CAW A;  1V0C A;  1QSR A;  2Q04 A;  3DR8 A;  1Z4E A;  2J8N A;  3ZZI A;  2Z0Z A;  2G3T A;  1P4N A;  4M3S A;  3TO6 A;  1I12 A;  2Q7B A;  4NSQ A;  1CJW A;  1QSO A;  2FCK A;  2FIA A;  3G3S A;  5GCN A;  1XMT A;  4YRH A;  5HMN A;  4K30 A;  3R9G A;  1I21 A;  3QAH A;  3S6F A;  2CNM A;  1KUX A;  2OB0 A;  5HH1 A;  5EBV A;  1BOB A;  3PP9 A;  2REE A;  3GY9 A;  1KZF A;  4H6U A;  2R7H A;  3P2H A;  2NMT A;  4QC6 A;  3TO9 A;  4MY0 A;  3E0K A;  5IV0 A;  1VHS A;  5JPH A;  1KUV A;  2FS5 A;  4E0A A;  3R1K A;  4KVO E;  3F5B A;  2CNT A;  3TT2 A;  3I3G A;  4KLW A;  2WPX A;  2FT0 A;  2B5G B;  4PK2 A;  2ZPA A;  4I49 A;  3TTH A;  4HNY B;  3CXQ A;  1QSM A; 
#chains in the Genus database with same CATH topology
 1YQE A;  4L89 A;  3FX6 A;  3CPA A;  2PJ8 A;  1RTQ A;  1M44 A;  1I1D A;  3BJ8 A;  2HV2 A;  3D7H A;  3S6K A;  4CRZ B;  1BPM A;  1YW4 A;  1QMU A;  4Z65 A;  2QIR A;  1F2O A;  4M85 A;  3R9F A;  3T90 A;  3NFZ A;  3NE7 A;  4FUU A;  4KZT A;  1VGY A;  4KOR A;  1IIC A;  2BUE A;  2O4H A;  2G3A A;  2K5T A;  1TKF A;  2PRB A;  3PFE A;  1VKC A;  1B87 A;  4U9Y A;  1ZO0 A;  5THW A;  3IIB A;  4CGP A;  4R6T A;  2GAN A;  4TNU A;  4R3K A;  2IJZ A;  1Q2Y A;  5EC4 A;  1S7N A;  1TIQ A;  4YU9 A;  3I1U A;  3UY5 A;  4MJ8 A;  2Q4V A;  3BI1 A;  3KQZ A;  3H8E A;  1RXT A;  2YNC C;  5G22 A;  2XEJ A;  4MCR A;  1YLE A;  2IMO A;  3PB8 X;  5G1Z A;  3D67 A;  4KOY A;  4RI1 A;  1ZLI A;  1YW6 A;  4JYW A;  1XOV A;  4F9U A;  4B14 A;  1GHE A;  3EC4 A;  3GKR A;  4RN7 A;  1LOK A;  1YVO A;  2D4O A;  2BSW A;  3RAM A;  4FWU A;  2Q0Y A;  1YVK A;  2A4N A;  5J1Q A;  4CAX A;  3FMC A;  1PU9 A;  1LRZ A;  1Z2L A;  4IAV A;  4MHY A;  2B5G A;  4LUA A;  4NGT A;  2OZH A;  2Z11 A;  3KR4 A;  3QB8 A;  2GLJ A;  5H86 A;  2AFS A;  2PR8 A;  3BI0 A;  1J4J A;  4NXY A;  3NE8 A;  1CM0 A;  5J8C A;  4C7I A;  5BWA B;  3TC8 A;  2VI7 A;  4BBH A;  1Z8T A;  2KCW A;  3B35 A;  4HKF A;  4QVT A;  1ZG9 A;  4OP4 A;  1LAM A;  4KOV A;  4M6I A;  3S9L A;  3FVL A;  3SJX A;  2H5M A;  4C2X A;  5JQ4 A;  2XEF A;  4P4E A;  5FVJ A;  1XE4 A;  5J8F A;  5H84 A;  2B4D A;  3L2N A;  3OWC A;  3PBB A;  3IU2 A;  7CPA A;  5LRK A;  4FD4 A;  5JGF A;  2XEG A;  1F57 A;  4OC3 A;  2Z3O A;  4UA3 A;  2QYV A;  3EFA A;  3IU1 A;  4NGR A;  1FNO A;  1Z4R A;  1ZG7 A;  2ARH A;  1S7K A;  2JDC A;  1S3Z A;  2DF5 A;  4OLL A;  2WSA A;  1S7F A;  3EO4 A;  2ZOG A;  2EO8 A;  4F0Y A;  3MGD A;  5JH9 A;  4DUK A;  4AG9 A;  4ZYQ A;  3FIX A;  4KLV A;  2PVW A;  2CNS A;  4QUS A;  2EK9 A;  4UCM A;  4E2A A;  2YND A;  1IID A;  1JWQ A;  1Z8L A;  2ZW6 A;  3KZW A;  1LFW A;  4PXC A;  1XBU A;  2PIZ A;  4UIB A;  2EBJ A;  3IFE A;  3LD2 A;  2AFW A;  2Q44 A;  3RBU A;  5K8P A;  4RUH A;  4F6A A;  2VXK A;  1NE9 A;  1L0C A;  2OU2 A;  1XRY A;  4GM5 A;  4JZ0 A;  4MFK A;  4P4I A;  3MRU A;  4R57 A;  4DNC A;  4IF5 A;  4FAI A;  4LQ6 A;  2CY2 A;  2C6P A;  2HC9 A;  3G8W A;  3K9T A;  2IQ6 A;  2AE6 A;  3D68 A;  2QJ8 A;  1A2Z A;  2PR1 A;  4KVM E;  4XNH C;  2ZED A;  2V8G A;  2AFM A;  4KSF A;  5LRG A;  4ZBG A;  2B3V A;  1TXR A;  2GLF A;  2R98 A;  1CBX A;  4AVC A;  3W6X A;  1R43 A;  3RNZ A;  2PJ6 A;  3FXT A;  2AFO A;  2QEC A;  2F5I A;  3NH5 A;  4B12 A;  4A38 A;  5K8N A;  1VIX A;  1M4D A;  3DDD A;  4ZX8 A;  1YRE A;  3IWW A;  3PZJ A;  4NGM A;  3PGP A;  2C6G A;  2JEW A;  2OZU A;  3D3S A;  1NSL A;  5CPA A;  3P2F A;  4KOS A;  3ZJ0 A;  3S9N A;  1IB1 E;  3GYA A;  3QNV A;  4A39 A;  1M4I A;  4LX9 A;  5DWN A;  2P6F A;  2PQ8 A;  3JRU A;  2V8H A;  2FXF A;  3HLP A;  4MCQ A;  2OH1 A;  5A28 A;  5HVG A;  2FE7 A;  4UEZ A;  5KTC A;  1PCA A;  2PCU A;  2ATR A;  2YNE A;  4HPS A;  2RB7 A;  4MRI A;  3FH4 A;  5KTA A;  3KKW A;  2AFZ A;  3B3W A;  3TX8 A;  5CBM A;  4PXD A;  1AUG A;  1IOF A;  4KOT A;  4B6Z A;  2ZEL A;  2PDO A;  4JWP A;  2AJ6 A;  2Z10 A;  1XFO A;  4FD5 A;  4JJX A;  4UWI A;  1TKJ A;  2YNC A;  3IWG A;  4R76 A;  3WR7 A;  4H89 A;  1Z5R A;  4GXH A;  4CRY B;  2ZXV A;  4MFZ A;  3H8G A;  1QSN A;  4EVY A;  4JD6 A;  3DR6 A;  1S5K A;  4IHM A;  1CPS A;  4PK3 A;  4EME A;  2ZEF A;  4MHN A;  4F8Z A;  1IGB A;  1Y0R A;  5IB0 A;  1TF8 A;  3W91 A;  4E8O A;  5CNP A;  4CPA A;  1CG2 A;  4MXU A;  2RC4 A;  2JDD A;  4A94 A;  4A33 A;  4X8I A;  3IGR A;  2REF A;  3C26 A;  2Z3M A;  2RFH A;  2O28 A;  1X10 A;  1TKH A;  1CP7 A;  2VBQ A;  3FEE A;  4MCP A;  4XNH B;  3B2Y A;  3IJ3 A;  5LYI A;  4NF1 A;  3IC1 A;  3CT9 A;  2EUI A;  4LQG A;  1YR0 A;  4P6Y A;  4OID A;  2PJ9 A;  2Y0M A;  5A27 A;  4M6G A;  4JXQ A;  4TWE A;  2ZOF A;  4CAF A;  1GYT A;  2CTB A;  4PXE A;  4U9Z A;  4FD7 A;  1QQ9 A;  2PC1 A;  5D8N A;  1MJA A;  4B5O A;  2NYQ A;  3D2P A;  1IYK A;  4F9V A;  4HNX B;  4IUS A;  2PIY A;  1DE4 C;  2QML A;  4Q36 A;  3B8G A;  1ZLH A;  2WYR A;  1H8L A;  2P6G A;  3GB0 A;  3VWE A;  2J9A A;  2GFQ A;  3FYN A;  4HNW B;  2IL4 A;  1R57 A;  4XPK A;  3SXN A;  2Z3N A;  1BPN A;  5LRJ A;  1VHE A;  2P0W A;  2R1I A;  4NJQ A;  3VH9 A;  4A37 A;  4PSX A;  4QBJ A;  5LYD A;  2J8M A;  2ZEO A;  4II9 A;  1M4G A;  4KSA A;  2Q4Z A;  1N71 A;  4NCZ A;  2I3C A;  2C27 A;  2FL4 A;  5DWM A;  3DSB A;  4ZY2 A;  4OKO A;  1S60 A;  4CAV A;  1XMB A;  3PFO A;  5C88 A;  4ZX9 A;  4DYO A;  1Y9W A;  5AG5 A;  4UCN A;  4OC1 A;  3BHX A;  2PJ2 A;  1Y9K A;  3F0A A;  4MHZ A;  4ZI6 A;  1F2P A;  3S6G A;  3SJF A;  3SI0 A;  3D8P A;  4M6H A;  4C7H A;  1QST A;  1Y0Y A;  4P45 A;  4UWJ A;  4ZY1 A;  1Y7R A;  2G0B A;  4MHD A;  4R3L A;  5GCN A;  5HXD A;  2VZZ A;  4PSW A;  5F47 A;  2BO9 A;  3V38 A;  2I79 A;  4UEE A;  4CGL A;  3V8I A;  2JLM A;  4Y49 C;  1FT7 A;  4ORF A;  1ARL A;  1VHO A;  3EXN A;  2PJ5 A;  2OR4 A;  4KOU A;  3NH4 A;  4ONW A;  5LYF A;  2OZG A;  3IWE A;  1NSA A;  2ZEP A;  6CPA A;  1IOI A;  1OBR A;  3WC5 A;  2Z3L A;  1UWY A;  1ELM P;  3S9M A;  2JBJ A;  1P0H A;  1MK4 A;  3FRM A;  4KOW A;  4UFV A;  5IX3 A;  2OOT A;  2EK8 A;  4AVB A;  1LCP A;  1ARM A;  5K8M A;  2CTC A;  3BJ7 A;  4C68 A;  1B6B A;  4PV6 A;  3SXO A;  2DEA A;  4ZY0 A;  1OZP A;  2DXQ A;  3T8W A;  2BEI A;  1XF8 A;  2F7V A;  4KSI A;  4A32 A;  3B3V A;  3GUX A;  4B5P B;  2ZW5 A;  3GLJ A;  4UBR A;  4AG7 A;  3PB7 X;  3D4U A;  3F8K A;  4FD6 A;  4KUB A;  2GRE A;  4L8A A;  2X7B A;  4B13 A;  4Q38 A;  1Q2C A;  4RS2 A;  2BOA A;  2P6E A;  3B3T A;  3ISZ A;  4OIW A;  2R8V A;  4DJL A;  4OC5 A;  3B3C A;  4MFJ A;  4KUA A;  3SI2 A;  4YFJ A;  4NGN A;  3R96 A;  5KTD A;  1R3N A;  3FBU A;  3K2K A;  1KWM A;  3QAY A;  4OAD A;  4AB7 A;  2PJ4 A;  3TOA A;  1M1D A;  2FSR A;  2WZN A;  4B11 A;  3TO7 A;  3CXP A;  4Q7A A;  3VWD A;  8CPA A;  4QB9 A;  4CGN A;  2J8R A;  1HDQ A;  4MI4 A;  3FNC A;  4P4D A;  2Q7S A;  3VAR A;  5AG4 A;  3D2M A;  1Q7L A;  2GIV A;  4UF4 A;  4XPD C;  5F49 A;  1LAN A;  3FF3 A;  3SJE A;  2PRQ A;  3T9Y A;  2ZEM A;  4R8F A;  5F46 A;  2B4B A;  5AG6 A;  3DGV A;  3D7D A;  4Y49 B;  3FEC A;  4W9Y A;  2POK A;  3D7G A;  4MY3 A;  4R87 A;  3KR5 A;  3JVN A;  3LOD A;  4KS9 A;  1XEB A;  4NGQ A;  4YWY A;  1YK3 A;  1WWZ A;  2F8H A;  3A9L A;  3D7F A;  3PEI A;  4KVX A;  1KUY A;  3TE4 A;  5I4M A;  3WAB A;  1PUA A;  2C6C A;  1M4L A;  2GE3 A;  1S7L A;  5C82 A;  3W6S A;  4NGS A;  5D29 A;  3FB3 A;  2PSW A;  4KOX A;  2O53 A;  4MHP A;  1YLO A;  2CF4 A;  4BD9 A;  4OC4 A;  4R7M A;  4X5K A;  1IY7 A;  2HQY A;  3R9E A;  5G21 A;  4B10 A;  1CX8 A;  2VL1 A;  3IEH A;  4CYQ A;  4B5P A;  2PJ1 A;  4G1P A;  4U5Y A;  3N5F A;  1YGH A;  4H6Z A;  2Q4Y A;  4CGM A;  3LMS A;  4UCP A;  1Z9U A;  4PPZ A;  4C2Z A;  4OC0 A;  3H4Q A;  1AMP A;  4JXR A;  4NJR A;  2D4P A;  5G20 A;  3BLN A;  3VAT A;  5ISV A;  4J3G A;  4O23 A;  3EY5 A;  3V7Z A;  2B4D B;  3WC7 A;  2HUZ A;  4ONU A;  4BMH A;  4CGO A;  2V8D A;  4K3N A;  4C2Y A;  4OAE A;  2PJ7 A;  3KL9 A;  4JLY A;  3HUV A;  3RYO A;  3JUW A;  3KGQ A;  4GS4 A;  4OME A;  4EWT A;  4CYP A;  2PJB A;  2PJC A;  4CYN A;  2EVN A;  4P4B A;  4XPL A;  2B3U A;  5E96 A;  3PRT A;  4MCS A;  4XPD B;  1YX0 A;  3IO1 A;  1Q2D A;  1SQH A;  4BIN A;  2BL1 A;  4NGP A;  3S6H A;  2JEV A;  3LWU A;  3PB6 X;  3N7Z A;  1ON0 A;  5AGE A;  1EE3 P;  5I0C A;  2DPS A;  3R95 A;  2AFU A;  4UIA A;  1BO4 A;  4MFQ A;  1PYT B;  3SI1 A;  3DLJ A;  3TFY A;  4WWV A;  1FY7 A;  4X2T A;  1YSJ A;  3SHP A;  3TCV A;  5ELY A;  2NSM A;  1K4J A;  2PVV A;  1BLL E;  2VZY A;  2AFX A;  4IK2 A;  4OC2 A;  3TOB A;  3WC6 A;  2FIW A;  3K9U A;  3NA6 A;  1RO5 A;  2ZW4 A;  5HVF A;  1IU8 A;  1IYL A;  1HEE A;  4A2Z A;  4A95 A;  4CAE A;  5IB9 A;  2HB6 A;  3PB4 X;  1WK4 A;  1XIX A;  1DTD A;  4UEF A;  3B7I A;  4NEX A;  2G9D A;  2B58 A;  2PJ0 A;  4PQA A;  2WUU A;  2Z3P A;  4CS0 B;  4MBU A;  3I9S A;  4AVA A;  5F48 A;  1CPX A;  4PXB A;  4F0X A;  5LYL A;  1MJ9 A;  2Q43 A;  1YME A;  2Q51 A;  1MJB A;  2VEZ A;  2VQY A;  2ZEH A;  4R9M A;  4UFW A;  1TF9 A;  1UFH A;  2C1C A;  2QVP A;  1NMT A;  4YGO A;  2ZEN A;  3DNS A;  2PJA A;  3MN8 A;  3PB9 X;  2ZW7 A;  1U6M A;  3NH8 A;  1CP6 A;  2I00 A;  2YGW A;  2WPW A;  3CXS A;  4CAW A;  3FED A;  1V0C A;  1QSR A;  1ELL P;  2Q04 A;  3DR8 A;  1X12 A;  1Z4E A;  2J8N A;  3ZZI A;  2FVG A;  2ANP A;  4A30 A;  2EWB A;  2PE3 A;  1XJO A;  2G3T A;  1P4N A;  2Z0Z A;  3CDX A;  4M3S A;  3TO6 A;  2V8V A;  1I12 A;  2ODF A;  2Q7B A;  3KI9 A;  5AG7 A;  4NSQ A;  1CJW A;  1QSO A;  2FCK A;  2FIA A;  2V77 A;  3G3S A;  4NFR A;  3LAC A;  1XMT A;  3KAS A;  3PBE A;  4YRH A;  3RO0 A;  5HMN A;  4K30 A;  3R9G A;  1I21 A;  2ZEG A;  3QAH A;  3H5Z A;  3S6F A;  3B3S A;  4MMO A;  5K8O A;  2CNM A;  1KUX A;  4H2K A;  2OB0 A;  2ABZ A;  5HH1 A;  4EFD A;  4P4J A;  5F09 A;  2Z3K A;  5EBV A;  5EMI A;  4P10 A;  1BOB A;  2GU2 A;  3PP9 A;  2REE A;  3H8F A;  4UFX A;  1HDU A;  3GY9 A;  1LAP A;  2JBK A;  1KZF A;  1Y7E A;  4H6U A;  2DPT A;  4P44 A;  2R7H A;  2CXA A;  3FJU A;  3P2H A;  2XEI A;  5DS0 A;  2NMT A;  1JQG A;  1Z8X A;  3ISX A;  2PJ3 A;  1AYE A;  4QC6 A;  2BCO A;  2ZEE A;  3TO9 A;  5HVH A;  4MY0 A;  4P4F A;  3D66 A;  3E0K A;  5IV0 A;  1VHS A;  4MFL A;  5JPH A;  1KUV A;  4FBE A;  2FS5 A;  4E0A A;  3R1K A;  3KHX A;  4KVO E;  3RZA A;  4ZGY B;  3KQX A;  3F5B A;  4CYO A;  2CNT A;  3TT2 A;  4X3R A;  4MFP A;  3CPX A;  3BXM A;  3I3G A;  3KHZ A;  4KLW A;  2WPX A;  3GIU A;  2FT0 A;  2B5G B;  4PK2 A;  3SJG A;  4A31 A;  2ZPA A;  1ZG8 A;  4I49 A;  3CZX A;  4AXV A;  5JM6 A;  3WT4 A;  3TTH A;  1Z8W A;  2CIJ A;  4HNY B;  3CXQ A;  1QSM A;  4WJB A;  1BAV A;  3JTK A; 
#chains in the Genus database with same CATH homology
 4L89 A;  1M44 A;  1I1D A;  3BJ8 A;  2HV2 A;  3S6K A;  4CRZ B;  2QIR A;  4M85 A;  3R9F A;  3T90 A;  3NE7 A;  4KZT A;  4KOR A;  1IIC A;  2BUE A;  2G3A A;  2K5T A;  2PRB A;  1VKC A;  1B87 A;  4U9Y A;  1ZO0 A;  4CGP A;  2GAN A;  5EC4 A;  4R3K A;  1Q2Y A;  1S7N A;  1TIQ A;  3UY5 A;  4MJ8 A;  2Q4V A;  1RXT A;  2YNC C;  5G22 A;  1YLE A;  5G1Z A;  4KOY A;  4RI1 A;  4B14 A;  1GHE A;  3EC4 A;  3GKR A;  1YVO A;  2D4O A;  2BSW A;  2Q0Y A;  1YVK A;  2A4N A;  4CAX A;  1PU9 A;  1LRZ A;  2B5G A;  4LUA A;  2OZH A;  2Z11 A;  3QB8 A;  5H86 A;  2PR8 A;  1J4J A;  4NXY A;  1CM0 A;  5J8C A;  4C7I A;  5BWA B;  2VI7 A;  4BBH A;  2KCW A;  4QVT A;  4HKF A;  4KOV A;  5JQ4 A;  2H5M A;  4C2X A;  5FVJ A;  1XE4 A;  5J8F A;  5H84 A;  2B4D A;  3OWC A;  3IU2 A;  4FD4 A;  2Z3O A;  4UA3 A;  3EFA A;  3IU1 A;  2ARH A;  1Z4R A;  1S7K A;  2JDC A;  1S3Z A;  4OLL A;  2WSA A;  1S7F A;  3EO4 A;  4F0Y A;  3MGD A;  4AG9 A;  3FIX A;  4KLV A;  4QUS A;  2CNS A;  4UCM A;  4E2A A;  2YND A;  1IID A;  2ZW6 A;  3LD2 A;  2Q44 A;  4F6A A;  2VXK A;  1NE9 A;  1L0C A;  2OU2 A;  4MFK A;  4R57 A;  4DNC A;  4IF5 A;  2CY2 A;  3G8W A;  2AE6 A;  4KVM E;  4XNH C;  2PR1 A;  4KSF A;  4ZBG A;  2B3V A;  2R98 A;  4AVC A;  3W6X A;  3FXT A;  2QEC A;  2F5I A;  4B12 A;  1M4D A;  3DDD A;  1YRE A;  3PZJ A;  4CYQ A;  4YFJ A;  3PGP A;  2OZU A;  3D3S A;  1NSL A;  3P2F A;  4KOS A;  3ZJ0 A;  1IB1 E;  3GYA A;  1M4I A;  4LX9 A;  5DWN A;  2P6F A;  2PQ8 A;  2FXF A;  2OH1 A;  5A28 A;  2FE7 A;  5KTC A;  2ATR A;  2YNE A;  5KTA A;  3KKW A;  4KOT A;  2PDO A;  4JWP A;  2AJ6 A;  2Z10 A;  4FD5 A;  4JJX A;  4UWI A;  2YNC A;  3IWG A;  3WR7 A;  4H89 A;  4CRY B;  2ZXV A;  4MFZ A;  1QSN A;  4EVY A;  4JD6 A;  3DR6 A;  1S5K A;  4PK3 A;  3W91 A;  4E8O A;  5CNP A;  2RC4 A;  2JDD A;  4A33 A;  3IGR A;  2REF A;  3C26 A;  2Z3M A;  2O28 A;  4XNH B;  2VBQ A;  4NF1 A;  2EUI A;  1YR0 A;  2Y0M A;  5A27 A;  4JXQ A;  4CAF A;  4U9Z A;  4FD7 A;  2PC1 A;  1MJA A;  4B5O A;  3D2P A;  1IYK A;  4HNX B;  4IUS A;  2QML A;  4Q36 A;  3B8G A;  2P6G A;  3VWE A;  3FYN A;  4HNW B;  2IL4 A;  1R57 A;  4XPK A;  3SXN A;  2Z3N A;  2P0W A;  2R1I A;  4PSX A;  4QBJ A;  2J8M A;  4II9 A;  1M4G A;  4KSA A;  1N71 A;  4NCZ A;  2C27 A;  2FL4 A;  5DWM A;  3DSB A;  1S60 A;  4CAV A;  5C88 A;  1Y9W A;  5AG5 A;  4UCN A;  1Y9K A;  3F0A A;  3S6G A;  3D8P A;  4C7H A;  1QST A;  4UWJ A;  1Y7R A;  2G0B A;  4MHD A;  4R3L A;  2VZZ A;  4PSW A;  5F47 A;  2I79 A;  4CGL A;  3V8I A;  2JLM A;  4Y49 C;  4ORF A;  3EXN A;  4KOU A;  2OZG A;  3IWE A;  2Z3L A;  1P0H A;  1MK4 A;  3FRM A;  4KOW A;  4UFV A;  5IX3 A;  4AVB A;  3BJ7 A;  4C68 A;  1B6B A;  4PV6 A;  3SXO A;  1OZP A;  2DXQ A;  2BEI A;  1XF8 A;  4A32 A;  4B5P B;  2ZW5 A;  4UBR A;  4AG7 A;  3F8K A;  4FD6 A;  4KUB A;  4L8A A;  2X7B A;  4B13 A;  4Q38 A;  1Q2C A;  4RS2 A;  2P6E A;  2R8V A;  4MFJ A;  4KUA A;  3R96 A;  5KTD A;  3FBU A;  4OAD A;  4AB7 A;  3TOA A;  1M1D A;  2FSR A;  4B11 A;  3TO7 A;  3CXP A;  3VWD A;  4QB9 A;  4CGN A;  2J8R A;  4MI4 A;  3FNC A;  5AG4 A;  3D2M A;  2GIV A;  4XPD C;  5F49 A;  3T9Y A;  5F46 A;  2B4B A;  5AG6 A;  4Y49 B;  4MY3 A;  4R87 A;  3JVN A;  3LOD A;  4KS9 A;  1XEB A;  1YK3 A;  1WWZ A;  3A9L A;  3TE4 A;  4KVX A;  1KUY A;  1PUA A;  2GE3 A;  1S7L A;  5C82 A;  3W6S A;  3FB3 A;  2PSW A;  4KOX A;  4X5K A;  2HQY A;  3R9E A;  5G21 A;  4B10 A;  4B5P A;  4U5Y A;  1YGH A;  4H6Z A;  2Q4Y A;  4CGM A;  4UCP A;  1Z9U A;  4C2Z A;  3H4Q A;  4JXR A;  5G20 A;  2D4P A;  3BLN A;  5ISV A;  4J3G A;  3EY5 A;  2B4D B;  2HUZ A;  4ONU A;  4BMH A;  4CGO A;  4C2Y A;  4OAE A;  4JLY A;  3RYO A;  3JUW A;  4GS4 A;  4CYP A;  4CYN A;  2EVN A;  4XPL A;  2B3U A;  5E96 A;  4XPD B;  1YX0 A;  1Q2D A;  1SQH A;  2BL1 A;  3S6H A;  2JEV A;  3N7Z A;  1ON0 A;  5AGE A;  5I0C A;  2DPS A;  3R95 A;  1BO4 A;  4MFQ A;  3TFY A;  1FY7 A;  3SHP A;  3TCV A;  1K4J A;  2VZY A;  3TOB A;  5IB0 A;  2FIW A;  3K9U A;  1RO5 A;  2ZW4 A;  1IYL A;  4A2Z A;  4A95 A;  4CAE A;  1WK4 A;  1XIX A;  4NEX A;  2B58 A;  2WUU A;  2Z3P A;  4CS0 B;  4MBU A;  3I9S A;  4AVA A;  5F48 A;  4F0X A;  1MJ9 A;  2VEZ A;  2VQY A;  1MJB A;  4UFW A;  4R9M A;  1UFH A;  1NMT A;  4YGO A;  3DNS A;  2ZW7 A;  1U6M A;  2I00 A;  2YGW A;  2WPW A;  3CXS A;  4CAW A;  1V0C A;  1QSR A;  2Q04 A;  3DR8 A;  1Z4E A;  2J8N A;  3ZZI A;  4A30 A;  2Z0Z A;  2G3T A;  1P4N A;  4M3S A;  3TO6 A;  1I12 A;  2Q7B A;  5AG7 A;  4NSQ A;  1CJW A;  1QSO A;  2FCK A;  2FIA A;  3G3S A;  5GCN A;  1XMT A;  4YRH A;  5HMN A;  4K30 A;  3R9G A;  1I21 A;  3QAH A;  3H5Z A;  3S6F A;  2CNM A;  1KUX A;  2OB0 A;  5HH1 A;  2Z3K A;  5EBV A;  1BOB A;  3PP9 A;  2REE A;  4UFX A;  3GY9 A;  1KZF A;  4H6U A;  2DPT A;  2R7H A;  2CXA A;  3P2H A;  2NMT A;  4QC6 A;  3TO9 A;  4MY0 A;  3E0K A;  5IV0 A;  1VHS A;  4MFL A;  5JPH A;  1KUV A;  2FS5 A;  4E0A A;  3R1K A;  4KVO E;  4ZGY B;  3F5B A;  4CYO A;  2CNT A;  3TT2 A;  4MFP A;  3I3G A;  4KLW A;  2WPX A;  2FT0 A;  2B5G B;  4PK2 A;  4A31 A;  2ZPA A;  4I49 A;  3TTH A;  4HNY B;  3CXQ A;  1QSM A;  3JTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...