2FCKA

Structure of a putative ribosomal-protein-serine acetyltransferase from vibrio cholerae.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
178
structure length
174
Chain Sequence
b'MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal-protein-serine acetyltransferase, putative
molecule tags Structural genomics, unknown function
source organism Vibrio cholerae o1 biovar eltor
publication title Crystal structure of an acetyltransferase protein from Vibrio cholerae strain N16961.
pubmed doi rcsb
total genus 52
structure length 174
sequence length 178
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fckA00
1K4JA 2G3AA 4KOWA 4R9MA 5F46A 5FVJA 4Y49C 2NMTA 2VXKA 1KUXA 1YR0A 4KUAA 1FY7A 4B5PA 2VZYA 2ATRA 5EBVA 2GIVA 3D2PA 4X5KA 1M4IA 4L8AA 1XE4A 2J8MA 3GYAA 1Q2DA 3V8IA 2QECA 4U9YA 2FIAA 5J8FA 1VKCA 3SXNA 4I49A 2Y0MA 3BJ8A 4CAVA 3CXPA 3UY5A 1SQHA 1M4DA 4UA3A 4KUBA 2FT0A 4KZTA 4XPKA 4FD5A 4FD4A 3DR8A 5KTCA 2GANA 4QC6A 4QBJA 1S7FA 4FD6A 4J3GA 3T90A 1S7NA 2FL4A 5CNPA 5F49A 4B5PB 3IGRA 3ZZIA 4OLLA 2PDOA 1I1DA 2JDCA 4UWIA 2EVNA 3VWEA 1VHSA 4QB9A 4BMHA 2WPXA 1Z4EA 3K9UA 1M1DA 2B4BA 4KOXA 1Q2YA 3W6SA 1OZPA 2R1IA 3KKWA 4PSXA 1S3ZA 2FS5A 5DWMA 3G8WA 1R57A 2X7BA 2ARHA 2GE3A 3TOAA 3F0AA 2BUEA 4AG7A 4HNXB 3D2MA 2AJ6A 4F0YA 4JXRA 1S5KA 3D3SA 4NXYA 1B87A 1U6MA 3TT2A 1I12A 4ORFA 3W6XA 1GHEA 2JDDA 4NCZA 2JLMA 4XPDC 3TE4A 4XPDB 1YLEA 3GY9A 4R3KA 2ZPAA 1MK4A 4NEXA 2FSRA 5C88A 1QSTA 1QSRA 2J8NA 4CRZB 1I21A 5C82A 4R57A 1XEBA 3QAHA 4K30A 4KORA 2VI7A 2OH1A 5IV0A 2B3UA 2VZZA 3ZJ0A 4AVAA 5HMNA 2OZUA 3FB3A 4QUSA 1KUYA 4MY3A 4E0AA 3EC4A 4KOUA 1S7KA 1N71A 5HH1A 4B5OA 2PC1A 2ZXVA 5KTDA 2BEIA 2OZHA 2H5MA 3GKRA 2PQ8A 2D4PA 3P2FA 2P6FA 4GS4A 2B58A 2R98A 2B4DB 2G3TA 3CXQA 4OAEA 4UWJA 1YGHA 4XNHB 4PSWA 2OB0A 3DSBA 4HNYB 4H6UA 1BOBA 3R1KA 3G3SA 4JD6A 1BO4A 2Q7BA 5KTAA 3WR7A 2CNMA 3DDDA 2Q04A 4M85A 1PUAA 1MJBA 1Z4RA 1QSOA 4KOSA 2Q4VA 3VWDA 4NSQA 4RI1A 3DNSA 4H89A 4JJXA 4U5YA 3BJ7A 4M3SA 2A4NA 5IX3A 3N7ZA 1IYLA 1NE9A 4R3LA 3FXTA 4XPLA 2P6GA 3R95A 3I9SA 2EUIA 2B5GA 3FNCA 3JUWA 2FIWA 2PR1A 4KVME 3EO4A 1Y7RA 4KOVA 5J8CA 4YRHA 1J4JA 3F5BA 1P4NA 4KVXA 2DXQA 2BL1A 3TCVA 4FD7A 4E8OA 4ONUA 2Z10A 3IWGA 2OU2A 3MGDA 1V0CA 4JLYA 2KCWA 2P0WA 1S7LA 2VQYA 3SHPA 4IUSA 4EVYA 4KOTA 2OZGA 2R8VA 2FXFA 1L0CA 2CY2A 3FIXA 1YREA 5F48A 4DNCA 1MJ9A 4UBRA 1TIQA 4PV6A 5E96A 2F5IA 2IL4A 3NE7A 2VEZA 3EY5A 1YVKA 2K5TA 2C27A 2CNTA 4CS0B 2ZW5A 1M4GA 3R9GA 1XIXA 1NSLA 2I79A 4Y49B 3P2HA 4F6AA 3TO6A 5EC4A 1KZFA 3RYOA 1XMTA 4KVOE 1KUVA 3EFAA 2HUZA 4AG9A 1RO5A 1RXTA 2I00A 5F47A 3TTHA 4HNWB 3TO7A 3F8KA 1M44A 2J8RA 2QMLA 1QSNA 4CRYB 2AE6A 4KOYA 5ISVA 4XNHC 1Z9UA 2R7HA 5DWNA 3S6KA 2Q4YA 3PP9A 1CM0A 1IICA 4II9A 4MJ8A 5GCNA 2REEA 1YX0A 3R9FA 4QVTA 3FBUA 4PK2A 2O28A 5JQ4A 1P0HA 4KLVA 3TFYA 1B6BA 4JWPA 2FE7A 3TO9A 4MBUA 2Z11A 2HV2A 4E2AA 5H84A 4AB7A 1MJAA 3FRMA 3E0KA 2B4DA 3B8GA 1CJWA 4R87A 2B3VA 4MHDA 1Y9KA 5H86A 4MI4A 1Y9WA 2ZW4A 3EXNA 1Q2CA 3T9YA 3R96A 3JVNA 3LD2A 3FYNA 4YGOA 3DR6A 5I0CA 4PK3A 1XF8A 2Q44A 1S60A 3SXOA 2PSWA 3H4QA 4NF1A 3S6GA 4RS2A 4JXQA 1YVOA 1LRZA 2PR8A 5IB0A 2B5GB 4U9ZA 1NMTA 2QIRA 2G0BA 2HQYA 2VBQA 4AVCA 3TOBA 4L89A 2P6EA 4HKFA 4KLWA 3W91A 4YFJA 2JEVA 2Q0YA 3BLNA 3CXSA 1PU9A 4CAWA 5JPHA 4AVBA 2CNSA 4MY0A 1IYKA 2PRBA 3OWCA 1IIDA 3D8PA 3S6FA 2D4OA 2REFA 4CAXA 1WWZA 1IB1E 2BSWA 2Z0ZA 3R9EA 4ZBGA 1WK4A 2RC4A 3PGPA 2WPWA 3I3GA 3C26A 4OADA 1YK3A 1ON0A 1QSMA 4H6ZA 3LODA 3QB8A 2ZW7A 3PZJA 4LUAA 3S6HA 1UFHA 4IF5A 4LX9A 2ZW6A 2FCKA
chains in the Genus database with same CATH superfamily
3B7IA 1K4JA 2G3AA 2PVWA 4G1PA 4KOWA 4DUKA 4R9MA 5F46A 2DF5A 5FVJA 2PJ8A 3PB8X 4BBHA 4TWEA 3IWWA 2NMTA 4Y49C 2VXKA 4LQGA 4R7MA 1KUXA 1YR0A 1CBXA 4KUAA 1FY7A 3NH4A 4B5PA 3HUVA 1TXRA 4CAFA 2GLFA 2F8HA 4P4IA 2VZYA 2WYRA 2ZEPA 3GUXA 4Q36A 3FVLA 4RN7A 4H2KA 2ATRA 3PBBA 5A27A 3KL9A 1R43A 1Y7EA 3LWUA 5EBVA 1XJOA 3WT4A 2GIVA 1FNOA 3D2PA 1M4IA 4X5KA 4L8AA 4C2YA 1XE4A 2J8MA 3FEEA 1Q2DA 3GYAA 2Q4ZA 3V8IA 2QECA 3NH5A 4U9YA 2FIAA 5J8FA 4ZY2A 1VKCA 3SXNA 2QJ8A 4FWUA 4I49A 2Y0MA 3BJ8A 4DYOA 2ZEOA 2JBJA 4CAVA 3CXPA 3UY5A 4O23A 1TF9A 4IK2A 1SQHA 4IHMA 1M4DA 2C1CA 4UA3A 4MCPA 4FBEA 4KUBA 2FT0A 4KZTA 4A31A 4XPKA 4FD5A 4FD4A 3JTKA 5EMIA 4C2ZA 3DR8A 5KTCA 3KR4A 1HEEA 2GANA 1VIXA 5K8NA 1CPSA 4A38A 3I1UA 2YNEA 4QC6A 4A39A 2PJ0A 2PIZA 1TKFA 2V8VA 4GM5A 3VATA 4QBJA 1S7FA 3H8EA 4FD6A 2O53A 2QVPA 4J3GA 1YSJA 3T90A 1Z5RA 1S7NA 2FL4A 4CGNA 5CNPA 5F49A 4B5PB 4FUUA 1CPXA 1Y0RA 1ARMA 3D66A 3IGRA 3ZZIA 1VHOA 3IFEA 4OLLA 5LRJA 2PDOA 3SJGA 1BAVA 1I1DA 4UFXA 2JDCA 4UWIA 5AGEA 2Q51A 2EVNA 4PXCA 5CPAA 3VWEA 4ZI6A 1VHSA 5J1QA 4QB9A 4EWTA 3WABA 2PJCA 4BMHA 2WPXA 3TX8A 1Z4EA 3QAYA 4P44A 1LOKA 1M1DA 3K9UA 2B4BA 4KOXA 4JZ0A 2YGWA 4ZGYB 1Q2YA 2PCUA 1Y0YA 2AFOA 4MHYA 3IO1A 3W6SA 4GXHA 2QYVA 1OZPA 2R1IA 3KKWA 3FJUA 4PSXA 4C2XA 1S3ZA 2FS5A 5G21A 5DWMA 5K8PA 3G8WA 1R57A 2X7BA 2ARHA 4CYPA 2GE3A 3FMCA 3KASA 3TOAA 4A94A 3F0AA 2BUEA 4AG7A 3BI0A 4HNXB 3D2MA 3ISXA 5LRKA 4UIAA 2AJ6A 4FAIA 5A28A 4PXDA 4BD9A 4F0YA 3B3VA 3NFZA 4JXRA 1ZG8A 1S5KA 3D3SA 4NXYA 4MFZA 1B87A 1QQ9A 1XRYA 2CTCA 2PJ4A 1U6MA 3TT2A 1I12A 4P4EA 1IOIA 1ZLHA 4F0XA 4K3NA 4ORFA 3W6XA 3D67A 4C7IA 1GHEA 2JDDA 4NCZA 2JLMA 4XPDC 3TE4A 4XPDB 5I4MA 1YLEA 3GY9A 1IU8A 4P4JA 4R3KA 2ZEMA 2ZPAA 1MK4A 3PB4X 3FECA 2FSRA 4NEXA 4AXVA 5C88A 1QSTA 5K8MA 1YLOA 1ZG9A 5AG7A 4MMOA 2Z3PA 1QSRA 2J8NA 4CRZB 3IIBA 3NA6A 2FVGA 1I21A 5C82A 4R57A 1XEBA 3QAHA 4OMEA 4K30A 4KORA 2VI7A 2OH1A 4Q38A 2B3UA 2VZZA 3PB7X 5IV0A 3ZJ0A 4ZX8A 4AVAA 5HMNA 2ZENA 2OZUA 3FB3A 4QUSA 4CPAA 1TKHA 1KUYA 3RBUA 4MY3A 2PJ7A 3TC8A 4E0AA 4NGPA 3VH9A 3JRUA 1RTQA 1A2ZA 3EC4A 4NJRA 4C68A 1S7KA 4KOUA 1N71A 5HH1A 4B5OA 2PC1A 3FEDA 2ZXVA 3CZXA 4OC5A 5KTDA 3BXMA 2BEIA 2OZHA 2H5MA 3GKRA 1JQGA 1YW6A 5LYDA 2PQ8A 4R76A 2D4PA 3D7DA 3P2FA 4Z65A 4C7HA 2P6FA 4GS4A 2DEAA 3MN8A 2B58A 3KGQA 3MRUA 2R98A 1HDQA 2PJ6A 2B4DB 5HVFA 1Z8WA 5CBMA 2G3TA 3CXQA 4OAEA 2AFSA 4UWJA 1YGHA 2Z3MA 4XNHB 4PSWA 2OB0A 3DSBA 2HC9A 4HNYB 5AG6A 3KR5A 4JYWA 1CG2A 2EBJA 3PB6X 2ZEHA 4H6UA 1BOBA 3R1KA 2PJ1A 3S9NA 2EWBA 2ZOGA 1Z8XA 3B3TA 3G3SA 5D8NA 4JD6A 1BO4A 4MFPA 1M4LA 2Q7BA 5KTAA 3WR7A 2CNMA 1Z8LA 3DDDA 3RZAA 2Q04A 3B35A 3H8GA 2BOAA 4OC3A 4KSFA 4M85A 1PUAA 1EE3P 1MJBA 3IEHA 1BPNA 1YQEA 3KZWA 1Z4RA 4NGSA 1F57A 1QSOA 1Z2LA 1X10A 3PBEA 4KOSA 5LYFA 2Q4VA 4M6IA 1GYTA 3VWDA 4NSQA 4RI1A 3DNSA 3PEIA 4H89A 2Q7SA 3K9TA 3KQXA 4JJXA 4A33A 4U5YA 2ZEFA 4MFKA 3BJ7A 1Q7LA 1YW4A 3RO0A 2F7VA 2GFQA 4M3SA 2CXAA 2A4NA 4P4FA 1HDUA 1XBUA 4YWYA 5IX3A 2PJAA 3N7ZA 4F9VA 1YMEA 2AFXA 2CIJA 1IYLA 2I3CA 1NE9A 1CP7A 4R3LA 3L2NA 4B14A 4MHZA 2C6CA 3FXTA 4XPLA 3FF3A 2P6GA 1X12A 4UCMA 3R95A 3D7HA 3I9SA 2OOTA 2EUIA 2ABZA 2B5GA 3FNCA 7CPAA 4UFWA 1JWQA 3JUWA 4CGOA 3LMSA 2FIWA 2PR1A 4KVME 3EO4A 4IAVA 1DTDA 1Y7RA 4B12A 4KOVA 5J8CA 2BCOA 2NYQA 4YRHA 5LYIA 5LYLA 1J4JA 2XEFA 3F5BA 4OIWA 1P4NA 3SJEA 4F8ZA 3RNZA 4KVXA 2DXQA 5HXDA 2BL1A 1IOFA 1LAMA 3TCVA 4FD7A 4E8OA 4ONUA 4OP4A 3ISZA 4P4DA 4P10A 2Z10A 3CDXA 1AMPA 1XMBA 2DPSA 3IWGA 2OU2A 3MGDA 1H8LA 1V0CA 4JLYA 2KCWA 2P0WA 3GIUA 1S7LA 1LAPA 2OR4A 2VQYA 1IGBA 3PB9X 3SHPA 4F9UA 2AFUA 4IUSA 3KI9A 4CGLA 2NSMA 4KOTA 2OZGA 4EVYA 1ELMP 2R8VA 2G9DA 3IC1A 2FXFA 4UFVA 3K2KA 1F2PA 1L0CA 2CY2A 4NGQA 4A30A 3FIXA 2ANPA 3B3CA 4ZY1A 1YREA 5F48A 4DNCA 1MJ9A 2EK8A 2GREA 3PFOA 4R6TA 2DPTA 4UBRA 5HVGA 4ZY0A 4MFLA 1TIQA 4PV6A 5E96A 2F5IA 2IL4A 2IJZA 3SI0A 3NE7A 2VEZA 5G22A 3EY5A 1Z8TA 2ODFA 1YVKA 2K5TA 3SJXA 2C27A 2CNTA 3KHXA 4KSAA 2ZW5A 3SJFA 4CS0B 4CYNA 1M4GA 4ZYQA 1PYTB 3R9GA 1XIXA 2XEIA 3V38A 4B10A 4B6ZA 1NSLA 2I79A 4Y49B 3B2YA 4A2ZA 3P2HA 1ZO0A 1OBRA 1ZLIA 4F6AA 4W9YA 3NE8A 3TO6A 3DLJA 3V7ZA 4ONWA 4M6GA 5EC4A 3IU1A 4OIDA 4PXBA 4BINA 1KZFA 3RYOA 2RFHA 1XMTA 2WZNA 1KUVA 4KVOE 3EFAA 2HUZA 4AG9A 2JBKA 2ZELA 2C6PA 1RO5A 1RXTA 3CT9A 2PE3A 3IWEA 2I00A 4MCSA 5F47A 3TTHA 4HNWB 3TO7A 3F8KA 1M44A 1LCPA 3S9LA 4CGMA 1LANA 4X3RA 2J8RA 2V8GA 2WUUA 4WJBA 2GLJA 2QMLA 4P45A 4MCQA 1QSNA 4UCNA 4CRYB 2AE6A 5BWAB 2Z3LA 4KOYA 4MFJA 5ISVA 3FX6A 4OC2A 4OC1A 5THWA 2PJ9A 1VGYA 3H8FA 4UEEA 2ZEGA 4XNHC 5HVHA 4UIBA 4R8FA 3D7GA 4M6HA 1Z9UA 2AFWA 2R7HA 4UEFA 5DWNA 3S6KA 2AFZA 3S9MA 2Z3KA 5G20A 2PRQA 2Z3NA 2PJ5A 2Q4YA 3PP9A 5JH9A 3D68A 1CM0A 2RB7A 1IICA 4CYQA 4II9A 4MJ8A 5GCNA 4P4BA 1XFOA 1YX0A 2AFMA 2REEA 4QVTA 3R9FA 3N5FA 3B3WA 1R3NA 4OC0A 6CPAA 1TF8A 3FBUA 3IJ3A 4NGTA 4PK2A 2O28A 5IB9A 5D29A 2YNDA 4X2TA 2IMOA 4OC4A 4A37A 5JQ4A 2C6GA 1P0HA 4KLVA 1NSAA 3TFYA 1B6BA 4JWPA 4ZX9A 2FE7A 4YU9A 3TO9A 4MBUA 2Z11A 5G1ZA 2HV2A 5LRGA 4A95A 4E2AA 3A9LA 3GLJA 5H84A 4AB7A 1MJAA 3D4UA 3SI2A 2Q43A 2PJ2A 3FRMA 4MFQA 2PJ3A 5AG4A 1DE4C 3E0KA 2B4DA 2V77A 3B8GA 1CJWA 2WSAA 5JM6A 1TKJA 2J9AA 4R87A 4HPSA 2VL1A 2B3VA 3KHZA 4MHDA 1AUGA 1Y9KA 5H86A 1ZG7A 2EK9A 4MI4A 1Y9WA 2ZW4A 3EXNA 1Q2CA 3T9YA 3HLPA 3QNVA 4PQAA 3R96A 3JVNA 3LD2A 4DJLA 3FYNA 3KQZA 1VHEA 1PCAA 8CPAA 3LACA 4WWVA 3H5ZA 3PFEA 3DR6A 4YGOA 4A32A 4CGPA 5I0CA 4NJQA 4PK3A 1KWMA 1XF8A 4CAEA 2Q44A 1S60A 4NFRA 1AYEA 4P6YA 2BO9A 3SXOA 2PSWA 3H4QA 4MHPA 4NF1A 3WC5A 3WC7A 3S6GA 3CPXA 4RS2A 2YNCA 2ZEDA 4JXQA 1YVOA 2XEJA 3D7FA 4KSIA 4NGRA 4UEZA 4B11A 1LRZA 5DS0A 4EFDA 2PR8A 3DGVA 5IB0A 4NGMA 1CP6A 4B13A 2B5GB 4NGNA 1NMTA 4U9ZA 2QIRA 4X8IA 2G0BA 2HQYA 2VBQA 4AVCA 3TOBA 4EMEA 4L89A 2P6EA 4HKFA 4KLWA 3W91A 4YFJA 1QMUA 2ZEEA 2POKA 3WC6A 2CTBA 2JEVA 1IY7A 2Q0YA 3BLNA 3CXSA 5K8OA 1PU9A 4RUHA 5F09A 2JEWA 4CAWA 2EO8A 2Z3OA 2PIYA 5ELYA 2PJBA 5JPHA 4CYOA 2V8DA 2CNSA 1F2OA 4MY0A 2CF4A 4AVBA 1CX8A 1IYKA 2PRBA 3CPAA 3VARA 3OWCA 1IIDA 4MHNA 4UCPA 3D8PA 3S6FA 3FH4A 3PRTA 4OKOA 4PPZA 2D4OA 2REFA 3SI1A 1FT7A 3RAMA 4CAXA 1WWZA 1IB1E 1XOVA 3BI1A 3IU2A 3BHXA 4MCRA 4MRIA 2BSWA 2Z0ZA 3R9EA 4ZBGA 1WK4A 2GU2A 2XEGA 2RC4A 3PGPA 1ARLA 2WPWA 2ZOFA 3I3GA 4TNUA 4UF4A 1ELLP 5AG5A 2PVVA 3C26A 1YK3A 4OADA 1LFWA 3GB0A 4LQ6A 1UWYA 2YNCC 5JGFA 1BLLE 1BPMA 1ON0A 1QSMA 4KS9A 4H6ZA 4Q7AA 3LODA 2HB6A 3QB8A 2ZW7A 2O4HA 2V8HA 3PZJA 4LUAA 3T8WA 3B3SA 3NH8A 4MXUA 3S6HA 1UFHA 4IF5A 4LX9A 2ZW6A 4PXEA 2FCKA 2IQ6A
chains in the Genus database with same CATH topology
1K4JA 2G3AA 4KOWA 4R9MA 5F46A 5FVJA 4BBHA 4Y49C 2NMTA 2VXKA 1KUXA 1YR0A 4KUAA 1FY7A 4B5PA 4CAFA 2VZYA 4Q36A 2ATRA 5A27A 5EBVA 4C2YA 2GIVA 3D2PA 4X5KA 1M4IA 4L8AA 1XE4A 2J8MA 3GYAA 1Q2DA 3V8IA 2QECA 4U9YA 2FIAA 5J8FA 1VKCA 3SXNA 4I49A 2Y0MA 3BJ8A 4CAVA 3CXPA 3UY5A 1SQHA 1M4DA 4UA3A 4KUBA 2FT0A 4KZTA 4A31A 4XPKA 4FD5A 4FD4A 3JTKA 4C2ZA 3DR8A 5KTCA 2GANA 2YNEA 4QC6A 4QBJA 1S7FA 4FD6A 4J3GA 3T90A 1S7NA 2FL4A 4CGNA 5CNPA 5F49A 4B5PB 3IGRA 3ZZIA 4OLLA 2PDOA 1I1DA 4UFXA 2JDCA 4UWIA 5AGEA 2EVNA 3VWEA 1VHSA 4QB9A 4BMHA 2WPXA 1Z4EA 3K9UA 1M1DA 2B4BA 4KOXA 2YGWA 4ZGYB 1Q2YA 3W6SA 1OZPA 2R1IA 3KKWA 4PSXA 4C2XA 1S3ZA 2FS5A 5G21A 5DWMA 3G8WA 1R57A 2X7BA 2ARHA 4CYPA 2GE3A 3TOAA 3F0AA 2BUEA 4AG7A 4HNXB 3D2MA 2AJ6A 5A28A 4F0YA 4JXRA 1S5KA 3D3SA 4NXYA 4MFZA 1B87A 1U6MA 3TT2A 1I12A 4F0XA 4ORFA 3W6XA 4C7IA 1GHEA 2JDDA 4NCZA 2JLMA 4XPDC 3TE4A 4XPDB 1YLEA 3GY9A 4R3KA 2ZPAA 1MK4A 4NEXA 2FSRA 5C88A 1QSTA 5AG7A 2Z3PA 1QSRA 2J8NA 4CRZB 1I21A 5C82A 4R57A 1XEBA 3QAHA 4K30A 4KORA 2VI7A 2OH1A 4Q38A 2B3UA 2VZZA 5IV0A 3ZJ0A 4AVAA 5HMNA 2OZUA 3FB3A 4QUSA 1KUYA 4MY3A 4E0AA 3EC4A 4C68A 4KOUA 1S7KA 1N71A 5HH1A 4B5OA 2PC1A 2ZXVA 5KTDA 2BEIA 2OZHA 2H5MA 3GKRA 2PQ8A 2D4PA 3P2FA 4C7HA 2P6FA 4GS4A 2B58A 2R98A 2B4DB 2G3TA 3CXQA 4OAEA 4UWJA 1YGHA 2Z3MA 4XNHB 4PSWA 2OB0A 3DSBA 4HNYB 5AG6A 4H6UA 1BOBA 3R1KA 3G3SA 4JD6A 1BO4A 4MFPA 2Q7BA 5KTAA 3WR7A 2CNMA 3DDDA 2Q04A 4KSFA 4M85A 1PUAA 1MJBA 1Z4RA 1QSOA 4KOSA 2Q4VA 3VWDA 4NSQA 4RI1A 3DNSA 4H89A 4JJXA 4A33A 4U5YA 4MFKA 3BJ7A 4M3SA 2CXAA 2A4NA 5IX3A 3N7ZA 1IYLA 1NE9A 4R3LA 4B14A 3FXTA 4XPLA 2P6GA 4UCMA 3R95A 3I9SA 2EUIA 2B5GA 3FNCA 4UFWA 3JUWA 4CGOA 2FIWA 2PR1A 4KVME 3EO4A 1Y7RA 4B12A 4KOVA 5J8CA 4YRHA 1J4JA 3F5BA 1P4NA 4KVXA 2DXQA 2BL1A 3TCVA 4FD7A 4E8OA 4ONUA 2Z10A 2DPSA 3IWGA 2OU2A 3MGDA 1V0CA 4JLYA 2KCWA 2P0WA 1S7LA 2VQYA 3SHPA 4IUSA 4CGLA 4EVYA 4KOTA 2OZGA 2R8VA 2FXFA 4UFVA 4A30A 1L0CA 2CY2A 3FIXA 1YREA 5F48A 4DNCA 1MJ9A 4UBRA 2DPTA 4MFLA 1TIQA 4PV6A 5E96A 2F5IA 2IL4A 3NE7A 2VEZA 5G22A 3EY5A 1YVKA 2K5TA 2C27A 2CNTA 4KSAA 4CS0B 2ZW5A 4CYNA 1M4GA 3R9GA 1XIXA 4B10A 1NSLA 2I79A 4Y49B 4A2ZA 3P2HA 1ZO0A 4F6AA 3TO6A 5EC4A 3IU1A 1KZFA 3RYOA 1XMTA 4KVOE 1KUVA 3EFAA 2HUZA 4AG9A 1RO5A 1RXTA 3IWEA 2I00A 5F47A 3TTHA 4HNWB 3TO7A 3F8KA 1M44A 4CGMA 2J8RA 2WUUA 2QMLA 1QSNA 4UCNA 4CRYB 2AE6A 5BWAB 2Z3LA 4KOYA 4MFJA 5ISVA 4XNHC 1Z9UA 2R7HA 5DWNA 3S6KA 2Z3KA 5G20A 2Z3NA 2Q4YA 3PP9A 1CM0A 1IICA 4CYQA 4II9A 4MJ8A 5GCNA 2REEA 1YX0A 3R9FA 4QVTA 3FBUA 4PK2A 2O28A 2YNDA 5JQ4A 1P0HA 4KLVA 3TFYA 1B6BA 4JWPA 2FE7A 3TO9A 4MBUA 2Z11A 5G1ZA 2HV2A 4A95A 4E2AA 3A9LA 5H84A 4AB7A 1MJAA 3FRMA 4MFQA 5AG4A 3E0KA 2B4DA 3B8GA 1CJWA 2WSAA 4R87A 2B3VA 4MHDA 1Y9KA 5H86A 4MI4A 1Y9WA 2ZW4A 3EXNA 1Q2CA 3T9YA 3R96A 3JVNA 3LD2A 3FYNA 3H5ZA 4YGOA 3DR6A 4A32A 4CGPA 5I0CA 4PK3A 1XF8A 4CAEA 2Q44A 1S60A 3SXOA 2PSWA 3H4QA 4NF1A 3S6GA 4RS2A 2YNCA 4JXQA 1YVOA 4B11A 1LRZA 2PR8A 5IB0A 4B13A 2B5GB 4U9ZA 1NMTA 2QIRA 2G0BA 2HQYA 2VBQA 4AVCA 3TOBA 4L89A 2P6EA 4HKFA 4KLWA 3W91A 4YFJA 2JEVA 2Q0YA 3BLNA 3CXSA 1PU9A 4CAWA 2Z3OA 5JPHA 4CYOA 4AVBA 2CNSA 4MY0A 1IYKA 2PRBA 3OWCA 1IIDA 4UCPA 3D8PA 3S6FA 2D4OA 2REFA 4CAXA 1WWZA 1IB1E 3IU2A 2BSWA 2Z0ZA 3R9EA 4ZBGA 1WK4A 2RC4A 3PGPA 2WPWA 3I3GA 5AG5A 3C26A 4OADA 1YK3A 2YNCC 4KS9A 1ON0A 1QSMA 4H6ZA 3LODA 3QB8A 2ZW7A 3PZJA 4LUAA 3S6HA 1UFHA 4IF5A 4LX9A 2ZW6A 2FCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4J A;  2G3A A;  4KOW A;  4R9M A;  5F46 A;  5FVJ A;  4Y49 C;  2NMT A;  2VXK A;  1KUX A;  1YR0 A;  4KUA A;  1FY7 A;  4B5P A;  2VZY A;  2ATR A;  5EBV A;  2GIV A;  3D2P A;  4X5K A;  1M4I A;  4L8A A;  1XE4 A;  2J8M A;  3GYA A;  1Q2D A;  3V8I A;  2QEC A;  4U9Y A;  2FIA A;  5J8F A;  1VKC A;  3SXN A;  4I49 A;  2Y0M A;  3BJ8 A;  4CAV A;  3CXP A;  3UY5 A;  1SQH A;  1M4D A;  4UA3 A;  4KUB A;  2FT0 A;  4KZT A;  4XPK A;  4FD5 A;  4FD4 A;  3DR8 A;  5KTC A;  2GAN A;  4QC6 A;  4QBJ A;  1S7F A;  4FD6 A;  4J3G A;  3T90 A;  1S7N A;  2FL4 A;  5CNP A;  5F49 A;  4B5P B;  3IGR A;  3ZZI A;  4OLL A;  2PDO A;  1I1D A;  2JDC A;  4UWI A;  2EVN A;  3VWE A;  1VHS A;  4QB9 A;  4BMH A;  2WPX A;  1Z4E A;  3K9U A;  1M1D A;  2B4B A;  4KOX A;  1Q2Y A;  3W6S A;  1OZP A;  2R1I A;  3KKW A;  4PSX A;  1S3Z A;  2FS5 A;  5DWM A;  3G8W A;  1R57 A;  2X7B A;  2ARH A;  2GE3 A;  3TOA A;  3F0A A;  2BUE A;  4AG7 A;  4HNX B;  3D2M A;  2AJ6 A;  4F0Y A;  4JXR A;  1S5K A;  3D3S A;  4NXY A;  1B87 A;  1U6M A;  3TT2 A;  1I12 A;  4ORF A;  3W6X A;  1GHE A;  2JDD A;  4NCZ A;  2JLM A;  4XPD C;  3TE4 A;  4XPD B;  1YLE A;  3GY9 A;  4R3K A;  2ZPA A;  1MK4 A;  4NEX A;  2FSR A;  5C88 A;  1QST A;  1QSR A;  2J8N A;  4CRZ B;  1I21 A;  5C82 A;  4R57 A;  1XEB A;  3QAH A;  4K30 A;  4KOR A;  2VI7 A;  2OH1 A;  5IV0 A;  2B3U A;  2VZZ A;  3ZJ0 A;  4AVA A;  5HMN A;  2OZU A;  3FB3 A;  4QUS A;  1KUY A;  4MY3 A;  4E0A A;  3EC4 A;  4KOU A;  1S7K A;  1N71 A;  5HH1 A;  4B5O A;  2PC1 A;  2ZXV A;  5KTD A;  2BEI A;  2OZH A;  2H5M A;  3GKR A;  2PQ8 A;  2D4P A;  3P2F A;  2P6F A;  4GS4 A;  2B58 A;  2R98 A;  2B4D B;  2G3T A;  3CXQ A;  4OAE A;  4UWJ A;  1YGH A;  4XNH B;  4PSW A;  2OB0 A;  3DSB A;  4HNY B;  4H6U A;  1BOB A;  3R1K A;  3G3S A;  4JD6 A;  1BO4 A;  2Q7B A;  5KTA A;  3WR7 A;  2CNM A;  3DDD A;  2Q04 A;  4M85 A;  1PUA A;  1MJB A;  1Z4R A;  1QSO A;  4KOS A;  2Q4V A;  3VWD A;  4NSQ A;  4RI1 A;  3DNS A;  4H89 A;  4JJX A;  4U5Y A;  3BJ7 A;  4M3S A;  2A4N A;  5IX3 A;  3N7Z A;  1IYL A;  1NE9 A;  4R3L A;  3FXT A;  4XPL A;  2P6G A;  3R95 A;  3I9S A;  2EUI A;  2B5G A;  3FNC A;  3JUW A;  2FIW A;  2PR1 A;  4KVM E;  3EO4 A;  1Y7R A;  4KOV A;  5J8C A;  4YRH A;  1J4J A;  3F5B A;  1P4N A;  4KVX A;  2DXQ A;  2BL1 A;  3TCV A;  4FD7 A;  4E8O A;  4ONU A;  2Z10 A;  3IWG A;  2OU2 A;  3MGD A;  1V0C A;  4JLY A;  2KCW A;  2P0W A;  1S7L A;  2VQY A;  3SHP A;  4IUS A;  4EVY A;  4KOT A;  2OZG A;  2R8V A;  2FXF A;  1L0C A;  2CY2 A;  3FIX A;  1YRE A;  5F48 A;  4DNC A;  1MJ9 A;  4UBR A;  1TIQ A;  4PV6 A;  5E96 A;  2F5I A;  2IL4 A;  3NE7 A;  2VEZ A;  3EY5 A;  1YVK A;  2K5T A;  2C27 A;  2CNT A;  4CS0 B;  2ZW5 A;  1M4G A;  3R9G A;  1XIX A;  1NSL A;  2I79 A;  4Y49 B;  3P2H A;  4F6A A;  3TO6 A;  5EC4 A;  1KZF A;  3RYO A;  1XMT A;  4KVO E;  1KUV A;  3EFA A;  2HUZ A;  4AG9 A;  1RO5 A;  1RXT A;  2I00 A;  5F47 A;  3TTH A;  4HNW B;  3TO7 A;  3F8K A;  1M44 A;  2J8R A;  2QML A;  1QSN A;  4CRY B;  2AE6 A;  4KOY A;  5ISV A;  4XNH C;  1Z9U A;  2R7H A;  5DWN A;  3S6K A;  2Q4Y A;  3PP9 A;  1CM0 A;  1IIC A;  4II9 A;  4MJ8 A;  5GCN A;  2REE A;  1YX0 A;  3R9F A;  4QVT A;  3FBU A;  4PK2 A;  2O28 A;  5JQ4 A;  1P0H A;  4KLV A;  3TFY A;  1B6B A;  4JWP A;  2FE7 A;  3TO9 A;  4MBU A;  2Z11 A;  2HV2 A;  4E2A A;  5H84 A;  4AB7 A;  1MJA A;  3FRM A;  3E0K A;  2B4D A;  3B8G A;  1CJW A;  4R87 A;  2B3V A;  4MHD A;  1Y9K A;  5H86 A;  4MI4 A;  1Y9W A;  2ZW4 A;  3EXN A;  1Q2C A;  3T9Y A;  3R96 A;  3JVN A;  3LD2 A;  3FYN A;  4YGO A;  3DR6 A;  5I0C A;  4PK3 A;  1XF8 A;  2Q44 A;  1S60 A;  3SXO A;  2PSW A;  3H4Q A;  4NF1 A;  3S6G A;  4RS2 A;  4JXQ A;  1YVO A;  1LRZ A;  2PR8 A;  5IB0 A;  2B5G B;  4U9Z A;  1NMT A;  2QIR A;  2G0B A;  2HQY A;  2VBQ A;  4AVC A;  3TOB A;  4L89 A;  2P6E A;  4HKF A;  4KLW A;  3W91 A;  4YFJ A;  2JEV A;  2Q0Y A;  3BLN A;  3CXS A;  1PU9 A;  4CAW A;  5JPH A;  4AVB A;  2CNS A;  4MY0 A;  1IYK A;  2PRB A;  3OWC A;  1IID A;  3D8P A;  3S6F A;  2D4O A;  2REF A;  4CAX A;  1WWZ A;  1IB1 E;  2BSW A;  2Z0Z A;  3R9E A;  4ZBG A;  1WK4 A;  2RC4 A;  3PGP A;  2WPW A;  3I3G A;  3C26 A;  4OAD A;  1YK3 A;  1ON0 A;  1QSM A;  4H6Z A;  3LOD A;  3QB8 A;  2ZW7 A;  3PZJ A;  4LUA A;  3S6H A;  1UFH A;  4IF5 A;  4LX9 A;  2ZW6 A;  2FCK A; 
#chains in the Genus database with same CATH topology
 3B7I A;  1K4J A;  2G3A A;  2PVW A;  4G1P A;  4KOW A;  4DUK A;  4R9M A;  5F46 A;  2DF5 A;  5FVJ A;  2PJ8 A;  3PB8 X;  4BBH A;  4TWE A;  3IWW A;  2NMT A;  4Y49 C;  2VXK A;  4LQG A;  4R7M A;  1KUX A;  1YR0 A;  1CBX A;  4KUA A;  1FY7 A;  3NH4 A;  4B5P A;  3HUV A;  1TXR A;  4CAF A;  2GLF A;  2F8H A;  4P4I A;  2VZY A;  2WYR A;  2ZEP A;  3GUX A;  4Q36 A;  3FVL A;  4RN7 A;  4H2K A;  2ATR A;  3PBB A;  5A27 A;  3KL9 A;  1R43 A;  1Y7E A;  3LWU A;  5EBV A;  1XJO A;  3WT4 A;  2GIV A;  1FNO A;  3D2P A;  1M4I A;  4X5K A;  4L8A A;  4C2Y A;  1XE4 A;  2J8M A;  3FEE A;  1Q2D A;  3GYA A;  2Q4Z A;  3V8I A;  2QEC A;  3NH5 A;  4U9Y A;  2FIA A;  5J8F A;  4ZY2 A;  1VKC A;  3SXN A;  2QJ8 A;  4FWU A;  4I49 A;  2Y0M A;  3BJ8 A;  4DYO A;  2ZEO A;  2JBJ A;  4CAV A;  3CXP A;  3UY5 A;  4O23 A;  1TF9 A;  4IK2 A;  1SQH A;  4IHM A;  1M4D A;  2C1C A;  4UA3 A;  4MCP A;  4FBE A;  4KUB A;  2FT0 A;  4KZT A;  4A31 A;  4XPK A;  4FD5 A;  4FD4 A;  3JTK A;  5EMI A;  4C2Z A;  3DR8 A;  5KTC A;  3KR4 A;  1HEE A;  2GAN A;  1VIX A;  5K8N A;  1CPS A;  4A38 A;  3I1U A;  2YNE A;  4QC6 A;  4A39 A;  2PJ0 A;  2PIZ A;  1TKF A;  2V8V A;  4GM5 A;  3VAT A;  4QBJ A;  1S7F A;  3H8E A;  4FD6 A;  2O53 A;  2QVP A;  4J3G A;  1YSJ A;  3T90 A;  1Z5R A;  1S7N A;  2FL4 A;  4CGN A;  5CNP A;  5F49 A;  4B5P B;  4FUU A;  1CPX A;  1Y0R A;  1ARM A;  3D66 A;  3IGR A;  3ZZI A;  1VHO A;  3IFE A;  4OLL A;  5LRJ A;  2PDO A;  3SJG A;  1BAV A;  1I1D A;  4UFX A;  2JDC A;  4UWI A;  5AGE A;  2Q51 A;  2EVN A;  4PXC A;  5CPA A;  3VWE A;  4ZI6 A;  1VHS A;  5J1Q A;  4QB9 A;  4EWT A;  3WAB A;  2PJC A;  4BMH A;  2WPX A;  3TX8 A;  1Z4E A;  3QAY A;  4P44 A;  1LOK A;  1M1D A;  3K9U A;  2B4B A;  4KOX A;  4JZ0 A;  2YGW A;  4ZGY B;  1Q2Y A;  2PCU A;  1Y0Y A;  2AFO A;  4MHY A;  3IO1 A;  3W6S A;  4GXH A;  2QYV A;  1OZP A;  2R1I A;  3KKW A;  3FJU A;  4PSX A;  4C2X A;  1S3Z A;  2FS5 A;  5G21 A;  5DWM A;  5K8P A;  3G8W A;  1R57 A;  2X7B A;  2ARH A;  4CYP A;  2GE3 A;  3FMC A;  3KAS A;  3TOA A;  4A94 A;  3F0A A;  2BUE A;  4AG7 A;  3BI0 A;  4HNX B;  3D2M A;  3ISX A;  5LRK A;  4UIA A;  2AJ6 A;  4FAI A;  5A28 A;  4PXD A;  4BD9 A;  4F0Y A;  3B3V A;  3NFZ A;  4JXR A;  1ZG8 A;  1S5K A;  3D3S A;  4NXY A;  4MFZ A;  1B87 A;  1QQ9 A;  1XRY A;  2CTC A;  2PJ4 A;  1U6M A;  3TT2 A;  1I12 A;  4P4E A;  1IOI A;  1ZLH A;  4F0X A;  4K3N A;  4ORF A;  3W6X A;  3D67 A;  4C7I A;  1GHE A;  2JDD A;  4NCZ A;  2JLM A;  4XPD C;  3TE4 A;  4XPD B;  5I4M A;  1YLE A;  3GY9 A;  1IU8 A;  4P4J A;  4R3K A;  2ZEM A;  2ZPA A;  1MK4 A;  3PB4 X;  3FEC A;  2FSR A;  4NEX A;  4AXV A;  5C88 A;  1QST A;  5K8M A;  1YLO A;  1ZG9 A;  5AG7 A;  4MMO A;  2Z3P A;  1QSR A;  2J8N A;  4CRZ B;  3IIB A;  3NA6 A;  2FVG A;  1I21 A;  5C82 A;  4R57 A;  1XEB A;  3QAH A;  4OME A;  4K30 A;  4KOR A;  2VI7 A;  2OH1 A;  4Q38 A;  2B3U A;  2VZZ A;  3PB7 X;  5IV0 A;  3ZJ0 A;  4ZX8 A;  4AVA A;  5HMN A;  2ZEN A;  2OZU A;  3FB3 A;  4QUS A;  4CPA A;  1TKH A;  1KUY A;  3RBU A;  4MY3 A;  2PJ7 A;  3TC8 A;  4E0A A;  4NGP A;  3VH9 A;  3JRU A;  1RTQ A;  1A2Z A;  3EC4 A;  4NJR A;  4C68 A;  1S7K A;  4KOU A;  1N71 A;  5HH1 A;  4B5O A;  2PC1 A;  3FED A;  2ZXV A;  3CZX A;  4OC5 A;  5KTD A;  3BXM A;  2BEI A;  2OZH A;  2H5M A;  3GKR A;  1JQG A;  1YW6 A;  5LYD A;  2PQ8 A;  4R76 A;  2D4P A;  3D7D A;  3P2F A;  4Z65 A;  4C7H A;  2P6F A;  4GS4 A;  2DEA A;  3MN8 A;  2B58 A;  3KGQ A;  3MRU A;  2R98 A;  1HDQ A;  2PJ6 A;  2B4D B;  5HVF A;  1Z8W A;  5CBM A;  2G3T A;  3CXQ A;  4OAE A;  2AFS A;  4UWJ A;  1YGH A;  2Z3M A;  4XNH B;  4PSW A;  2OB0 A;  3DSB A;  2HC9 A;  4HNY B;  5AG6 A;  3KR5 A;  4JYW A;  1CG2 A;  2EBJ A;  3PB6 X;  2ZEH A;  4H6U A;  1BOB A;  3R1K A;  2PJ1 A;  3S9N A;  2EWB A;  2ZOG A;  1Z8X A;  3B3T A;  3G3S A;  5D8N A;  4JD6 A;  1BO4 A;  4MFP A;  1M4L A;  2Q7B A;  5KTA A;  3WR7 A;  2CNM A;  1Z8L A;  3DDD A;  3RZA A;  2Q04 A;  3B35 A;  3H8G A;  2BOA A;  4OC3 A;  4KSF A;  4M85 A;  1PUA A;  1EE3 P;  1MJB A;  3IEH A;  1BPN A;  1YQE A;  3KZW A;  1Z4R A;  4NGS A;  1F57 A;  1QSO A;  1Z2L A;  1X10 A;  3PBE A;  4KOS A;  5LYF A;  2Q4V A;  4M6I A;  1GYT A;  3VWD A;  4NSQ A;  4RI1 A;  3DNS A;  3PEI A;  4H89 A;  2Q7S A;  3K9T A;  3KQX A;  4JJX A;  4A33 A;  4U5Y A;  2ZEF A;  4MFK A;  3BJ7 A;  1Q7L A;  1YW4 A;  3RO0 A;  2F7V A;  2GFQ A;  4M3S A;  2CXA A;  2A4N A;  4P4F A;  1HDU A;  1XBU A;  4YWY A;  5IX3 A;  2PJA A;  3N7Z A;  4F9V A;  1YME A;  2AFX A;  2CIJ A;  1IYL A;  2I3C A;  1NE9 A;  1CP7 A;  4R3L A;  3L2N A;  4B14 A;  4MHZ A;  2C6C A;  3FXT A;  4XPL A;  3FF3 A;  2P6G A;  1X12 A;  4UCM A;  3R95 A;  3D7H A;  3I9S A;  2OOT A;  2EUI A;  2ABZ A;  2B5G A;  3FNC A;  7CPA A;  4UFW A;  1JWQ A;  3JUW A;  4CGO A;  3LMS A;  2FIW A;  2PR1 A;  4KVM E;  3EO4 A;  4IAV A;  1DTD A;  1Y7R A;  4B12 A;  4KOV A;  5J8C A;  2BCO A;  2NYQ A;  4YRH A;  5LYI A;  5LYL A;  1J4J A;  2XEF A;  3F5B A;  4OIW A;  1P4N A;  3SJE A;  4F8Z A;  3RNZ A;  4KVX A;  2DXQ A;  5HXD A;  2BL1 A;  1IOF A;  1LAM A;  3TCV A;  4FD7 A;  4E8O A;  4ONU A;  4OP4 A;  3ISZ A;  4P4D A;  4P10 A;  2Z10 A;  3CDX A;  1AMP A;  1XMB A;  2DPS A;  3IWG A;  2OU2 A;  3MGD A;  1H8L A;  1V0C A;  4JLY A;  2KCW A;  2P0W A;  3GIU A;  1S7L A;  1LAP A;  2OR4 A;  2VQY A;  1IGB A;  3PB9 X;  3SHP A;  4F9U A;  2AFU A;  4IUS A;  3KI9 A;  4CGL A;  2NSM A;  4KOT A;  2OZG A;  4EVY A;  1ELM P;  2R8V A;  2G9D A;  3IC1 A;  2FXF A;  4UFV A;  3K2K A;  1F2P A;  1L0C A;  2CY2 A;  4NGQ A;  4A30 A;  3FIX A;  2ANP A;  3B3C A;  4ZY1 A;  1YRE A;  5F48 A;  4DNC A;  1MJ9 A;  2EK8 A;  2GRE A;  3PFO A;  4R6T A;  2DPT A;  4UBR A;  5HVG A;  4ZY0 A;  4MFL A;  1TIQ A;  4PV6 A;  5E96 A;  2F5I A;  2IL4 A;  2IJZ A;  3SI0 A;  3NE7 A;  2VEZ A;  5G22 A;  3EY5 A;  1Z8T A;  2ODF A;  1YVK A;  2K5T A;  3SJX A;  2C27 A;  2CNT A;  3KHX A;  4KSA A;  2ZW5 A;  3SJF A;  4CS0 B;  4CYN A;  1M4G A;  4ZYQ A;  1PYT B;  3R9G A;  1XIX A;  2XEI A;  3V38 A;  4B10 A;  4B6Z A;  1NSL A;  2I79 A;  4Y49 B;  3B2Y A;  4A2Z A;  3P2H A;  1ZO0 A;  1OBR A;  1ZLI A;  4F6A A;  4W9Y A;  3NE8 A;  3TO6 A;  3DLJ A;  3V7Z A;  4ONW A;  4M6G A;  5EC4 A;  3IU1 A;  4OID A;  4PXB A;  4BIN A;  1KZF A;  3RYO A;  2RFH A;  1XMT A;  2WZN A;  1KUV A;  4KVO E;  3EFA A;  2HUZ A;  4AG9 A;  2JBK A;  2ZEL A;  2C6P A;  1RO5 A;  1RXT A;  3CT9 A;  2PE3 A;  3IWE A;  2I00 A;  4MCS A;  5F47 A;  3TTH A;  4HNW B;  3TO7 A;  3F8K A;  1M44 A;  1LCP A;  3S9L A;  4CGM A;  1LAN A;  4X3R A;  2J8R A;  2V8G A;  2WUU A;  4WJB A;  2GLJ A;  2QML A;  4P45 A;  4MCQ A;  1QSN A;  4UCN A;  4CRY B;  2AE6 A;  5BWA B;  2Z3L A;  4KOY A;  4MFJ A;  5ISV A;  3FX6 A;  4OC2 A;  4OC1 A;  5THW A;  2PJ9 A;  1VGY A;  3H8F A;  4UEE A;  2ZEG A;  4XNH C;  5HVH A;  4UIB A;  4R8F A;  3D7G A;  4M6H A;  1Z9U A;  2AFW A;  2R7H A;  4UEF A;  5DWN A;  3S6K A;  2AFZ A;  3S9M A;  2Z3K A;  5G20 A;  2PRQ A;  2Z3N A;  2PJ5 A;  2Q4Y A;  3PP9 A;  5JH9 A;  3D68 A;  1CM0 A;  2RB7 A;  1IIC A;  4CYQ A;  4II9 A;  4MJ8 A;  5GCN A;  4P4B A;  1XFO A;  1YX0 A;  2AFM A;  2REE A;  4QVT A;  3R9F A;  3N5F A;  3B3W A;  1R3N A;  4OC0 A;  6CPA A;  1TF8 A;  3FBU A;  3IJ3 A;  4NGT A;  4PK2 A;  2O28 A;  5IB9 A;  5D29 A;  2YND A;  4X2T A;  2IMO A;  4OC4 A;  4A37 A;  5JQ4 A;  2C6G A;  1P0H A;  4KLV A;  1NSA A;  3TFY A;  1B6B A;  4JWP A;  4ZX9 A;  2FE7 A;  4YU9 A;  3TO9 A;  4MBU A;  2Z11 A;  5G1Z A;  2HV2 A;  5LRG A;  4A95 A;  4E2A A;  3A9L A;  3GLJ A;  5H84 A;  4AB7 A;  1MJA A;  3D4U A;  3SI2 A;  2Q43 A;  2PJ2 A;  3FRM A;  4MFQ A;  2PJ3 A;  5AG4 A;  1DE4 C;  3E0K A;  2B4D A;  2V77 A;  3B8G A;  1CJW A;  2WSA A;  5JM6 A;  1TKJ A;  2J9A A;  4R87 A;  4HPS A;  2VL1 A;  2B3V A;  3KHZ A;  4MHD A;  1AUG A;  1Y9K A;  5H86 A;  1ZG7 A;  2EK9 A;  4MI4 A;  1Y9W A;  2ZW4 A;  3EXN A;  1Q2C A;  3T9Y A;  3HLP A;  3QNV A;  4PQA A;  3R96 A;  3JVN A;  3LD2 A;  4DJL A;  3FYN A;  3KQZ A;  1VHE A;  1PCA A;  8CPA A;  3LAC A;  4WWV A;  3H5Z A;  3PFE A;  3DR6 A;  4YGO A;  4A32 A;  4CGP A;  5I0C A;  4NJQ A;  4PK3 A;  1KWM A;  1XF8 A;  4CAE A;  2Q44 A;  1S60 A;  4NFR A;  1AYE A;  4P6Y A;  2BO9 A;  3SXO A;  2PSW A;  3H4Q A;  4MHP A;  4NF1 A;  3WC5 A;  3WC7 A;  3S6G A;  3CPX A;  4RS2 A;  2YNC A;  2ZED A;  4JXQ A;  1YVO A;  2XEJ A;  3D7F A;  4KSI A;  4NGR A;  4UEZ A;  4B11 A;  1LRZ A;  5DS0 A;  4EFD A;  2PR8 A;  3DGV A;  5IB0 A;  4NGM A;  1CP6 A;  4B13 A;  2B5G B;  4NGN A;  1NMT A;  4U9Z A;  2QIR A;  4X8I A;  2G0B A;  2HQY A;  2VBQ A;  4AVC A;  3TOB A;  4EME A;  4L89 A;  2P6E A;  4HKF A;  4KLW A;  3W91 A;  4YFJ A;  1QMU A;  2ZEE A;  2POK A;  3WC6 A;  2CTB A;  2JEV A;  1IY7 A;  2Q0Y A;  3BLN A;  3CXS A;  5K8O A;  1PU9 A;  4RUH A;  5F09 A;  2JEW A;  4CAW A;  2EO8 A;  2Z3O A;  2PIY A;  5ELY A;  2PJB A;  5JPH A;  4CYO A;  2V8D A;  2CNS A;  1F2O A;  4MY0 A;  2CF4 A;  4AVB A;  1CX8 A;  1IYK A;  2PRB A;  3CPA A;  3VAR A;  3OWC A;  1IID A;  4MHN A;  4UCP A;  3D8P A;  3S6F A;  3FH4 A;  3PRT A;  4OKO A;  4PPZ A;  2D4O A;  2REF A;  3SI1 A;  1FT7 A;  3RAM A;  4CAX A;  1WWZ A;  1IB1 E;  1XOV A;  3BI1 A;  3IU2 A;  3BHX A;  4MCR A;  4MRI A;  2BSW A;  2Z0Z A;  3R9E A;  4ZBG A;  1WK4 A;  2GU2 A;  2XEG A;  2RC4 A;  3PGP A;  1ARL A;  2WPW A;  2ZOF A;  3I3G A;  4TNU A;  4UF4 A;  1ELL P;  5AG5 A;  2PVV A;  3C26 A;  1YK3 A;  4OAD A;  1LFW A;  3GB0 A;  4LQ6 A;  1UWY A;  2YNC C;  5JGF A;  1BLL E;  1BPM A;  1ON0 A;  1QSM A;  4KS9 A;  4H6Z A;  4Q7A A;  3LOD A;  2HB6 A;  3QB8 A;  2ZW7 A;  2O4H A;  2V8H A;  3PZJ A;  4LUA A;  3T8W A;  3B3S A;  3NH8 A;  4MXU A;  3S6H A;  1UFH A;  4IF5 A;  4LX9 A;  2ZW6 A;  4PXE A;  2FCK A;  2IQ6 A; 
#chains in the Genus database with same CATH homology
 1K4J A;  2G3A A;  4KOW A;  4R9M A;  5F46 A;  5FVJ A;  4BBH A;  4Y49 C;  2NMT A;  2VXK A;  1KUX A;  1YR0 A;  4KUA A;  1FY7 A;  4B5P A;  4CAF A;  2VZY A;  4Q36 A;  2ATR A;  5A27 A;  5EBV A;  4C2Y A;  2GIV A;  3D2P A;  4X5K A;  1M4I A;  4L8A A;  1XE4 A;  2J8M A;  3GYA A;  1Q2D A;  3V8I A;  2QEC A;  4U9Y A;  2FIA A;  5J8F A;  1VKC A;  3SXN A;  4I49 A;  2Y0M A;  3BJ8 A;  4CAV A;  3CXP A;  3UY5 A;  1SQH A;  1M4D A;  4UA3 A;  4KUB A;  2FT0 A;  4KZT A;  4A31 A;  4XPK A;  4FD5 A;  4FD4 A;  3JTK A;  4C2Z A;  3DR8 A;  5KTC A;  2GAN A;  2YNE A;  4QC6 A;  4QBJ A;  1S7F A;  4FD6 A;  4J3G A;  3T90 A;  1S7N A;  2FL4 A;  4CGN A;  5CNP A;  5F49 A;  4B5P B;  3IGR A;  3ZZI A;  4OLL A;  2PDO A;  1I1D A;  4UFX A;  2JDC A;  4UWI A;  5AGE A;  2EVN A;  3VWE A;  1VHS A;  4QB9 A;  4BMH A;  2WPX A;  1Z4E A;  3K9U A;  1M1D A;  2B4B A;  4KOX A;  2YGW A;  4ZGY B;  1Q2Y A;  3W6S A;  1OZP A;  2R1I A;  3KKW A;  4PSX A;  4C2X A;  1S3Z A;  2FS5 A;  5G21 A;  5DWM A;  3G8W A;  1R57 A;  2X7B A;  2ARH A;  4CYP A;  2GE3 A;  3TOA A;  3F0A A;  2BUE A;  4AG7 A;  4HNX B;  3D2M A;  2AJ6 A;  5A28 A;  4F0Y A;  4JXR A;  1S5K A;  3D3S A;  4NXY A;  4MFZ A;  1B87 A;  1U6M A;  3TT2 A;  1I12 A;  4F0X A;  4ORF A;  3W6X A;  4C7I A;  1GHE A;  2JDD A;  4NCZ A;  2JLM A;  4XPD C;  3TE4 A;  4XPD B;  1YLE A;  3GY9 A;  4R3K A;  2ZPA A;  1MK4 A;  4NEX A;  2FSR A;  5C88 A;  1QST A;  5AG7 A;  2Z3P A;  1QSR A;  2J8N A;  4CRZ B;  1I21 A;  5C82 A;  4R57 A;  1XEB A;  3QAH A;  4K30 A;  4KOR A;  2VI7 A;  2OH1 A;  4Q38 A;  2B3U A;  2VZZ A;  5IV0 A;  3ZJ0 A;  4AVA A;  5HMN A;  2OZU A;  3FB3 A;  4QUS A;  1KUY A;  4MY3 A;  4E0A A;  3EC4 A;  4C68 A;  4KOU A;  1S7K A;  1N71 A;  5HH1 A;  4B5O A;  2PC1 A;  2ZXV A;  5KTD A;  2BEI A;  2OZH A;  2H5M A;  3GKR A;  2PQ8 A;  2D4P A;  3P2F A;  4C7H A;  2P6F A;  4GS4 A;  2B58 A;  2R98 A;  2B4D B;  2G3T A;  3CXQ A;  4OAE A;  4UWJ A;  1YGH A;  2Z3M A;  4XNH B;  4PSW A;  2OB0 A;  3DSB A;  4HNY B;  5AG6 A;  4H6U A;  1BOB A;  3R1K A;  3G3S A;  4JD6 A;  1BO4 A;  4MFP A;  2Q7B A;  5KTA A;  3WR7 A;  2CNM A;  3DDD A;  2Q04 A;  4KSF A;  4M85 A;  1PUA A;  1MJB A;  1Z4R A;  1QSO A;  4KOS A;  2Q4V A;  3VWD A;  4NSQ A;  4RI1 A;  3DNS A;  4H89 A;  4JJX A;  4A33 A;  4U5Y A;  4MFK A;  3BJ7 A;  4M3S A;  2CXA A;  2A4N A;  5IX3 A;  3N7Z A;  1IYL A;  1NE9 A;  4R3L A;  4B14 A;  3FXT A;  4XPL A;  2P6G A;  4UCM A;  3R95 A;  3I9S A;  2EUI A;  2B5G A;  3FNC A;  4UFW A;  3JUW A;  4CGO A;  2FIW A;  2PR1 A;  4KVM E;  3EO4 A;  1Y7R A;  4B12 A;  4KOV A;  5J8C A;  4YRH A;  1J4J A;  3F5B A;  1P4N A;  4KVX A;  2DXQ A;  2BL1 A;  3TCV A;  4FD7 A;  4E8O A;  4ONU A;  2Z10 A;  2DPS A;  3IWG A;  2OU2 A;  3MGD A;  1V0C A;  4JLY A;  2KCW A;  2P0W A;  1S7L A;  2VQY A;  3SHP A;  4IUS A;  4CGL A;  4EVY A;  4KOT A;  2OZG A;  2R8V A;  2FXF A;  4UFV A;  4A30 A;  1L0C A;  2CY2 A;  3FIX A;  1YRE A;  5F48 A;  4DNC A;  1MJ9 A;  4UBR A;  2DPT A;  4MFL A;  1TIQ A;  4PV6 A;  5E96 A;  2F5I A;  2IL4 A;  3NE7 A;  2VEZ A;  5G22 A;  3EY5 A;  1YVK A;  2K5T A;  2C27 A;  2CNT A;  4KSA A;  4CS0 B;  2ZW5 A;  4CYN A;  1M4G A;  3R9G A;  1XIX A;  4B10 A;  1NSL A;  2I79 A;  4Y49 B;  4A2Z A;  3P2H A;  1ZO0 A;  4F6A A;  3TO6 A;  5EC4 A;  3IU1 A;  1KZF A;  3RYO A;  1XMT A;  4KVO E;  1KUV A;  3EFA A;  2HUZ A;  4AG9 A;  1RO5 A;  1RXT A;  3IWE A;  2I00 A;  5F47 A;  3TTH A;  4HNW B;  3TO7 A;  3F8K A;  1M44 A;  4CGM A;  2J8R A;  2WUU A;  2QML A;  1QSN A;  4UCN A;  4CRY B;  2AE6 A;  5BWA B;  2Z3L A;  4KOY A;  4MFJ A;  5ISV A;  4XNH C;  1Z9U A;  2R7H A;  5DWN A;  3S6K A;  2Z3K A;  5G20 A;  2Z3N A;  2Q4Y A;  3PP9 A;  1CM0 A;  1IIC A;  4CYQ A;  4II9 A;  4MJ8 A;  5GCN A;  2REE A;  1YX0 A;  3R9F A;  4QVT A;  3FBU A;  4PK2 A;  2O28 A;  2YND A;  5JQ4 A;  1P0H A;  4KLV A;  3TFY A;  1B6B A;  4JWP A;  2FE7 A;  3TO9 A;  4MBU A;  2Z11 A;  5G1Z A;  2HV2 A;  4A95 A;  4E2A A;  3A9L A;  5H84 A;  4AB7 A;  1MJA A;  3FRM A;  4MFQ A;  5AG4 A;  3E0K A;  2B4D A;  3B8G A;  1CJW A;  2WSA A;  4R87 A;  2B3V A;  4MHD A;  1Y9K A;  5H86 A;  4MI4 A;  1Y9W A;  2ZW4 A;  3EXN A;  1Q2C A;  3T9Y A;  3R96 A;  3JVN A;  3LD2 A;  3FYN A;  3H5Z A;  4YGO A;  3DR6 A;  4A32 A;  4CGP A;  5I0C A;  4PK3 A;  1XF8 A;  4CAE A;  2Q44 A;  1S60 A;  3SXO A;  2PSW A;  3H4Q A;  4NF1 A;  3S6G A;  4RS2 A;  2YNC A;  4JXQ A;  1YVO A;  4B11 A;  1LRZ A;  2PR8 A;  5IB0 A;  4B13 A;  2B5G B;  4U9Z A;  1NMT A;  2QIR A;  2G0B A;  2HQY A;  2VBQ A;  4AVC A;  3TOB A;  4L89 A;  2P6E A;  4HKF A;  4KLW A;  3W91 A;  4YFJ A;  2JEV A;  2Q0Y A;  3BLN A;  3CXS A;  1PU9 A;  4CAW A;  2Z3O A;  5JPH A;  4CYO A;  4AVB A;  2CNS A;  4MY0 A;  1IYK A;  2PRB A;  3OWC A;  1IID A;  4UCP A;  3D8P A;  3S6F A;  2D4O A;  2REF A;  4CAX A;  1WWZ A;  1IB1 E;  3IU2 A;  2BSW A;  2Z0Z A;  3R9E A;  4ZBG A;  1WK4 A;  2RC4 A;  3PGP A;  2WPW A;  3I3G A;  5AG5 A;  3C26 A;  4OAD A;  1YK3 A;  2YNC C;  4KS9 A;  1ON0 A;  1QSM A;  4H6Z A;  3LOD A;  3QB8 A;  2ZW7 A;  3PZJ A;  4LUA A;  3S6H A;  1UFH A;  4IF5 A;  4LX9 A;  2ZW6 A;  2FCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...