2FCKA

Structure of a putative ribosomal-protein-serine acetyltransferase from vibrio cholerae.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
178
structure length
174
Chain Sequence
MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal-protein-serine acetyltransferase, putative
publication title Crystal structure of an acetyltransferase protein from Vibrio cholerae strain N16961.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Structural genomics, unknown function
total genus 52
structure length 174
sequence length 178
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fckA00
2HUZA 4B5PB 2GIVA 3FRMA 2R98A 2D4OA 3V8IA 4R87A 4R57A 3DR6A 3CXQA 5IX3A 1NMTA 3R1KA 2GANA 1KUXA 1Q2CA 5C82A 1KUYA 4CRYB 4QUSA 4K30A 3WR7A 4XPLA 2B4BA 1BO4A 4R9MA 1Y9KA 4OLLA 2VZYA 3R95A 4QC6A 3PGPA 5JQ4A 4F0YA 5I0CA 4M85A 1XF8A 1WK4A 1P0HA 2B4DA 3RYOA 3S6GA 1J4JA 3ZJ0A 1M4GA 1OZPA 2BUEA 2J8NA 2KCWA 2FL4A 4I49A 2REEA 1XMTA 1XIXA 2FT0A 2B3UA 3DNSA 1UFHA 3TE4A 4QVTA 5IV0A 3E0KA 3S6HA 5J8CA 2OB0A 4L8AA 4EVYA 3P2FA 5KTDA 5DWMA 1TIQA 3R9EA 4AVCA 2Q0YA 3LD2A 2F5IA 3PP9A 3TOBA 2PSWA 1S7FA 4QBJA 4NSQA 4FD4A 2G0BA 2P6EA 4II9A 2R8VA 4YFJA 1XEBA 2VBQA 1QSNA 1QSMA 2FSRA 2VXKA 5CNPA 5F48A 2CNMA 2K5TA 1YVOA 4XNHB 2PR8A 2Z0ZA 2Q4YA 4E8OA 1M1DA 4PSWA 3T90A 4RI1A 4XPDB 2BSWA 3N7ZA 1B6BA 3JUWA 3MGDA 3FBUA 2JEVA 5FVJA 2QIRA 4MY0A 3K9UA 3TCVA 4ZBGA 3SXNA 1I12A 4MBUA 1U6MA 4KOYA 3D8PA 1QSOA 4FD6A 4AG7A 4UWJA 1M4IA 4R3LA 4HNWB 1S7LA 1BOBA 4XPDC 5E96A 2J8RA 2BL1A 3FB3A 2P0WA 4RS2A 3GYAA 3QB8A 5F49A 3TOAA 5F46A 2PR1A 3IGRA 1VHSA 2QMLA 4JD6A 3TTHA 4UBRA 2ZW6A 4CRZB 1QSTA 4H6ZA 4HNXB 5HMNA 1N71A 2Y0MA 3SHPA 2ZXVA 2R7HA 4QB9A 1PUAA 4KVOE 4E2AA 2HV2A 2OZHA 4KUBA 4MJ8A 1K4JA 4NF1A 4NXYA 4AVBA 5KTCA 3F0AA 4Y49B 2JDCA 4U5YA 2ATRA 5JPHA 2P6GA 2WPWA 4F6AA 2IL4A 2H5MA 2A4NA 3D2PA 3TT2A 4KZTA 4JLYA 1S3ZA 3F5BA 4MI4A 2B58A 4AVAA 3EC4A 3JVNA 2FS5A 4Y49C 1LRZA 4MY3A 2GE3A 1CJWA 4OAEA 2O28A 1SQHA 4KOSA 3D3SA 4HNYB 1L0CA 1YR0A 4DNCA 3R9GA 2PQ8A 1FY7A 3FNCA 2Q44A 1I21A 5HH1A 1Z4EA 2B3VA 4KOTA 3OWCA 1S60A 2VQYA 3EFAA 3EY5A 1B87A 4MHDA 1S7KA 5KTAA 2FCKA 4U9YA 2I00A 4PSXA 2FE7A 4H6UA 2R1IA 1KUVA 4BMHA 2AE6A 3I9SA 3VWEA 2CY2A 3W91A 1MJAA 4L89A 4CAXA 3VWDA 1IYLA 3GKRA 1I1DA 4PV6A 2OZGA 1IIDA 5J8FA 2VZZA 1Y7RA 3GY9A 4X5KA 3CXSA 2FIAA 2HQYA 1S5KA 5H84A 3T9YA 2B4DB 2EUIA 4B5OA 1MK4A 1RXTA 3W6SA 1V0CA 4NCZA 3BLNA 4U9ZA 4FD7A 5EBVA 1NSLA 3R96A 5DWNA 1YVKA 5H86A 1S7NA 3FIXA 4IUSA 1P4NA 4KOXA 2CNSA 2C27A 2BEIA 1VKCA 2OH1A 4PK2A 3EXNA 3TO6A 1YGHA 4H89A 4KVME 3D2MA 2PRBA 2Q7BA 3SXOA 4AG9A 1Q2YA 2B5GA 3F8KA 4YGOA 2JLMA 1YLEA 4CAVA 2Q04A 3P2HA 2FIWA 4GS4A 4M3SA 2ZW4A 1Z9UA 3R9FA 3S6KA 2J8MA 4LUAA 1Q2DA 5IB0A 2VEZA 4YRHA 2QECA 4CS0B 2REFA 4LX9A 1Z4RA 1RO5A 4ORFA 4NEXA 3G8WA 1YK3A 3QAHA 2RC4A 5EC4A 4HKFA 2CNTA 2DXQA 2EVNA 1KZFA 4UA3A 2D4PA 3TO9A 1IB1E 2ZPAA 2X7BA 3DSBA 5F47A 2ZW5A 3TO7A 3LODA 4KLWA 4AB7A 3ZZIA 4JJXA 3IWGA 1CM0A 3BJ7A 1ON0A 3H4QA 3B8GA 2FXFA 4B5PA 4KORA 2OU2A 4ONUA 2I79A 3PZJA 4UWIA 4FD5A 1XE4A 2OZUA 1IICA 2B5GB 2ZW7A 3DR8A 2NMTA 1Y9WA 3W6XA 4KOWA 4E0AA 5ISVA 4JXRA 3S6FA 3NE7A 2AJ6A 2JDDA 4R3KA 2PC1A 2VI7A 3C26A 3UY5A 4KVXA 2Q4VA 1MJBA 1MJ9A 3I3GA 4KOUA 5C88A 3CXPA 2PDOA 1PU9A 3FYNA 1GHEA 1YX0A 3DDDA 5GCNA 3FXTA 1NE9A 2WPXA 4JXQA 4J3GA 4CAWA 3TFYA 3EO4A 4XNHC 2Z10A 4PK3A 2P6FA 4XPKA 2ARHA 4IF5A 1YREA 1M4DA 1WWZA 2G3TA 4KLVA 1M44A 2Z11A 3BJ8A 4JWPA 3KKWA 4KUAA 1QSRA 2G3AA 1R57A 3G3SA 1IYKA 4OADA 4KOVA
chains in the Genus database with same CATH superfamily
3KGQA 2HUZA 2RFHA 3KR4A 4B5PB 4CYQA 4FBEA 2GIVA 3FRMA 2R98A 2D4OA 3V8IA 5HXDA 4MHYA 2IMOA 2CXAA 3QNVA 4MFQA 4R87A 4R57A 3DR6A 4OC0A 3CXQA 3IIBA 1R43A 3SJFA 5IX3A 3D67A 2FVGA 3ISXA 1NMTA 3R1KA 1YW4A 1KUXA 1Q2CA 2GANA 1HDUA 1KUYA 5C82A 4CRYB 4QUSA 4K30A 3D4UA 3WR7A 4XPLA 4X2TA 5JH9A 2QYVA 4P4DA 2WYRA 3FVLA 2B4BA 1BO4A 4R9MA 4R7MA 1Y9KA 5LYLA 4OLLA 4BD9A 4MHZA 2VZYA 7CPAA 3R95A 4QC6A 2AFOA 3PGPA 5JQ4A 3KQZA 3FJUA 4OC4A 4F0YA 5I0CA 4M85A 3CPXA 2ZOFA 1LANA 2YNCC 1XF8A 2PVWA 4KSIA 4YU9A 1WK4A 3RZAA 1P0HA 2B4DA 2GU2A 2PJ2A 3RYOA 3S6GA 1J4JA 2ZEMA 3ZJ0A 1M4GA 4OIWA 4A95A 5DS0A 1OZPA 2BUEA 4ZY0A 3IFEA 2J8NA 2KCWA 2FL4A 4I49A 2REEA 1XMTA 2XEFA 1XIXA 2FT0A 2VL1A 2PJ1A 2V8HA 3B2YA 3B3TA 2B3UA 3DNSA 1UFHA 3TE4A 2PJCA 3IEHA 4QVTA 4WJBA 5IV0A 3BI0A 3E0KA 4ZY2A 2O4HA 4A30A 3S6HA 5J8CA 3H8GA 2OB0A 3BI1A 1TF8A 4L8AA 2V8GA 4EVYA 3P2FA 4DJLA 5KTDA 5DWMA 2Z3MA 1TIQA 3R9EA 4AVCA 1JQGA 2G9DA 2Q0YA 3B7IA 3LD2A 2F5IA 4BINA 3PP9A 3TOBA 2PSWA 1S7FA 1XRYA 4QBJA 3QAYA 4NSQA 2BCOA 2Z3LA 2G0BA 2P6EA 4FD4A 3PRTA 4II9A 4G1PA 4H2KA 1F57A 2R8VA 4YFJA 1BAVA 3HUVA 3B3WA 1XEBA 3H5ZA 4A33A 1X12A 1YQEA 2VBQA 4OIDA 5A28A 3GB0A 4OKOA 4FWUA 1TF9A 3S9MA 2PJ7A 3IWWA 3SJGA 1GYTA 1QSNA 1QSMA 2FSRA 2VXKA 5CNPA 5F48A 3IU2A 5LYDA 3WC5A 2CNMA 4MFLA 4C2YA 2K5TA 1YVOA 4XNHB 2PR8A 2Z0ZA 2Q4YA 3A9LA 4E8OA 1M1DA 4PSWA 4MRIA 3T90A 4RI1A 1IY7A 4XPDB 3SI0A 2PJ0A 2BSWA 1LOKA 3N7ZA 1B6BA 1ARMA 4NGMA 2ZENA 3JUWA 3MGDA 3FBUA 2JEVA 4OC1A 5LRKA 2DPSA 4A38A 2AFZA 5FVJA 2QIRA 2F8HA 4MY0A 3K9UA 4GXHA 3RO0A 3PFOA 4FUUA 5AG4A 3TCVA 4OC5A 4ZBGA 3SXNA 1I12A 4MBUA 1U6MA 4KOYA 3D8PA 1ZLHA 1XBUA 1QSOA 3GLJA 3KL9A 2AFXA 4FD6A 4AG7A 4UWJA 4UEEA 1M4IA 4R3LA 1CP7A 3VH9A 5JGFA 4HNWB 5G20A 4GM5A 1S7LA 4PXBA 1BOBA 4XPDC 5E96A 2J8RA 5BWAB 1BLLE 2BL1A 3FB3A 2P0WA 4RS2A 3GYAA 3QB8A 5F49A 4ZY1A 3TOAA 1UWYA 3FEDA 2QVPA 5F46A 1IU8A 3B3VA 4O23A 4Z65A 4CGNA 1VIXA 2PR1A 3IGRA 4A39A 4B11A 1VHSA 2QMLA 4JD6A 4PQAA 4ZX9A 1XJOA 1ZG7A 2ZEHA 3TTHA 4UBRA 2ZW6A 4PPZA 3NA6A 4KS9A 4CRZB 1QSTA 4H6ZA 4HNXB 4MFPA 4OP4A 4C68A 4UF4A 1N71A 5HMNA 2Y0MA 4CGOA 4Q7AA 3DGVA 3SHPA 2ZXVA 4MCPA 4F8ZA 4HPSA 2BOAA 2R7HA 4Q36A 4AXVA 4QB9A 1PUAA 4B13A 2F7VA 1M4LA 4KVOE 4JZ0A 5CPAA 4E2AA 2HV2A 3CT9A 2AFWA 4MCQA 2OZHA 4F0XA 2GLJA 2ZEOA 3PBBA 4KUBA 4MJ8A 1K4JA 4NF1A 4NXYA 2C6PA 3SI2A 4AVBA 2PE3A 3NE8A 4NGQA 2JEWA 4UFVA 1NSAA 3F0AA 4DYOA 4Y49B 2JDCA 5KTCA 4U5YA 4YWYA 4F9VA 2ATRA 5JPHA 4OMEA 4MCRA 2P6GA 2PRQA 2CTCA 2WPWA 3LMSA 4F6AA 2ZEGA 2O53A 5LYFA 5AG7A 5EMIA 3D7GA 2IL4A 2H5MA 4LQ6A 1Z5RA 1AYEA 2IJZA 5LRJA 3D7DA 4UCMA 2A4NA 3D2PA 4ZI6A 2Q7SA 3MN8A 3TT2A 4KZTA 4JLYA 1S3ZA 3F5BA 4MI4A 1BPNA 4NJRA 4Q38A 2B58A 4AVAA 3EC4A 3JVNA 3KZWA 4CGLA 2FS5A 4Y49C 1LRZA 4MY3A 3PB9X 5ELYA 2GE3A 1CJWA 4OAEA 3S9LA 2O28A 3KHZA 3PB8X 1FNOA 3NH5A 2CF4A 1SQHA 1IOFA 3L2NA 4KOSA 4JYWA 3D3SA 4HNYB 2PJBA 1ZG8A 1L0CA 1YR0A 4DNCA 2NYQA 3R9GA 2PQ8A 2EO8A 4X8IA 2OOTA 4NGRA 2ZEEA 1FY7A 3GUXA 4UCNA 3FNCA 1A2ZA 2Q44A 1CG2A 1I21A 2EK8A 3MRUA 5HH1A 3TC8A 1Z4EA 2B3VA 4KOTA 6CPAA 3OWCA 4M6HA 4B14A 1S60A 2HC9A 1Y7EA 4B10A 2HB6A 4C7HA 5I4MA 4UEFA 2VQYA 4IK2A 4MXUA 3EFAA 3EY5A 3PB7X 3JTKA 1B87A 4MHDA 4P10A 1S7KA 3PBEA 2OR4A 1ZG9A 5KTAA 2FCKA 1IOIA 4U9YA 2I00A 4PSXA 4R76A 2FE7A 2WUUA 4C2ZA 4CYNA 1QMUA 4H6UA 4CYPA 2R1IA 4P4BA 1ZO0A 4P4FA 4A94A 1KUVA 4BMHA 2AE6A 3I9SA 3PB6X 1X10A 4P44A 3VWEA 2CY2A 3W91A 3BXMA 1ELLP 1MJAA 2XEIA 1CP6A 4L89A 4P4IA 4UCPA 4W9YA 4CAXA 3KQXA 4B6ZA 1YSJA 3K9TA 3VWDA 1IGBA 1IYLA 3GKRA 1I1DA 2YNDA 4ONWA 2AFSA 4PV6A 2OZGA 1LCPA 3D68A 4CAFA 1IIDA 2DPTA 4X3RA 5J8FA 5K8NA 2VZZA 2PJAA 1Y7RA 3GY9A 4X5KA 3CXSA 2FIAA 2HQYA 1S5KA 5H84A 1Z8TA 3T9YA 2B4DB 3IWEA 4C7IA 2PVVA 1Z8XA 2ABZA 2EUIA 4PXDA 4B5OA 1MK4A 3B3SA 3CPAA 3NFZA 1RXTA 2DF5A 3B3CA 4OC2A 1V0CA 3W6SA 3IU1A 3KI9A 4NCZA 4A37A 4EWTA 3BLNA 2YNEA 1BPMA 1RTQA 4NJQA 4R8FA 4A2ZA 4U9ZA 4FD7A 1Z8WA 2C6CA 2CIJA 3FECA 1ARLA 1TKJA 2CTBA 5EBVA 1NSLA 3R96A 2Q51A 5DWNA 1YVKA 2RB7A 3FH4A 5LRGA 4NGTA 5H86A 3VARA 1S7NA 3CZXA 2ANPA 3FIXA 4IUSA 2ZELA 3KASA 2PJ3A 3SJXA 1P4NA 4CAEA 3HLPA 3IC1A 4KOXA 2CNSA 2C27A 2PJ6A 2BEIA 5F09A 4TNUA 1HDQA 1VKCA 2ZEPA 2OH1A 4KSFA 1PCAA 4PK2A 3EXNA 2ZEDA 3TO6A 2JBJA 5AGEA 1YGHA 2ODFA 5D8NA 2EK9A 5K8PA 4H89A 3LWUA 3FEEA 1ZLIA 4KVME 3VATA 3D2MA 2PRBA 3D7HA 2Q7BA 1Q7LA 3SXOA 5HVGA 3PFEA 4A32A 4AG9A 4IHMA 1Q2YA 2I3CA 2Q4ZA 1CBXA 3NH8A 2B5GA 3F8KA 3NH4A 2JLMA 1YLEA 4YGOA 4CAVA 2Q04A 3P2HA 2XEGA 2FIWA 3T8WA 4A31A 4UEZA 2IQ6A 4GS4A 1H8LA 4M3SA 2ZW4A 4P4JA 1LAPA 1Z9UA 4ZGYB 3R9FA 1F2PA 2YGWA 2J9AA 3N5FA 3S6KA 1FT7A 2J8MA 1Q2DA 2ZOGA 4LUAA 5IB0A 2VEZA 4YRHA 3BHXA 4EFDA 2WZNA 2JBKA 2QECA 2GREA 1Z8LA 2C6GA 4CS0B 5J1QA 5LYIA 2REFA 2DEAA 1EE3P 3ISZA 4MFZA 4NGNA 2PIYA 4LX9A 4NFRA 3B35A 3RNZA 2V77A 3FF3A 1Z4RA 4P45A 4IAVA 4EMEA 5AG6A 1RO5A 3H8FA 4ORFA 4NEXA 5A27A 3G8WA 4P6YA 4NGPA 1DE4C 2GLFA 1YK3A 3QAHA 2NSMA 4OC3A 2RC4A 5JM6A 1Y0YA 1CX8A 3D7FA 5EC4A 4HKFA 5HVHA 3FMCA 2EBJA 2CNTA 1XMBA 2GFQA 2DXQA 4ZX8A 1VGYA 3I1UA 4UIAA 2PCUA 2BO9A 1YMEA 2EVNA 1YW6A 2AFMA 1KZFA 4UA3A 2D4PA 5HVFA 3TO9A 5G21A 1IB1E 4PXEA 3V7ZA 2ZPAA 2X7BA 3DLJA 4C2XA 3DSBA 5F47A 4CYOA 3SI1A 3RAMA 2ZW5A 3TO7A 3LODA 3PEIA 2POKA 4KLWA 4AB7A 3ZZIA 5G1ZA 4JJXA 3IWGA 3H8EA 4CGMA 5THWA 1CM0A 4LQGA 4P4EA 4UIBA 3BJ7A 4RN7A 1ELMP 4NGSA 5G22A 1ON0A 4R6TA 3H4QA 3B8GA 3FX6A 2FXFA 2Q43A 3GIUA 4B5PA 2YNCA 2ZEFA 2AFUA 2OU2A 4KORA 4ONUA 8CPAA 2I79A 3WT4A 3PZJA 1XOVA 4MFKA 1HEEA 1XFOA 1R3NA 3IJ3A 1CPXA 4UWIA 3WC7A 4MHNA 4FD5A 4K3NA 2WSAA 3D66A 3LACA 4M6IA 3JRUA 4FAIA 1OBRA 5K8MA 1JWQA 2C1CA 1XE4A 2PJ5A 2OZUA 1IICA 2Z3PA 2B5GB 2ZW7A 1DTDA 4CGPA 3DR8A 2XEJA 2NMTA 1Y9WA 1VHEA 3W6XA 4KOWA 4KSAA 4E0AA 3IO1A 4MCSA 4JXRA 5ISVA 4CPAA 3V38A 1KWMA 3S6FA 3NE7A 2AJ6A 4WWVA 4BBHA 4DUKA 2JDDA 3SJEA 4R3KA 3CDXA 2PC1A 5D29A 3S9NA 2Z3NA 1TKHA 2PIZA 1LAMA 1AUGA 4UFWA 2VI7A 1Y0RA 3C26A 2Z3OA 4KVXA 3UY5A 2Q4VA 1MJBA 1MJ9A 3I3GA 4KOUA 5C88A 1AMPA 5CBMA 3CXPA 2QJ8A 2PDOA 1PU9A 3KHXA 3FYNA 1GHEA 1YX0A 3DDDA 5GCNA 3FXTA 2EWBA 1NE9A 3KR5A 4MMOA 2WPXA 4JXQA 4RUHA 4J3GA 4ZYQA 2PJ8A 1VHOA 4CAWA 4TWEA 3TFYA 3EO4A 3RBUA 2V8VA 4MHPA 1TXRA 4XNHC 4F9UA 2Z10A 4PK3A 2P6FA 4XPKA 2PJ9A 1TKFA 3PB4X 3WABA 1F2OA 2ARHA 3K2KA 4B12A 4IF5A 1YREA 4PXCA 1M4DA 1WWZA 5AG5A 1LFWA 2G3TA 3WC6A 4KLVA 5K8OA 1QQ9A 4MFJA 1M44A 2Z11A 3BJ8A 1CPSA 2PJ4A 4JWPA 3KKWA 4KUAA 1QSRA 1PYTB 2G3AA 4UFXA 1R57A 1YLOA 3G3SA 2Z3KA 1IYKA 1Z2LA 4OADA 4M6GA 5IB9A 3TX8A 4KOVA 2V8DA
chains in the Genus database with same CATH topology
2HUZA 4B5PB 4CYQA 2GIVA 3FRMA 2R98A 2D4OA 3V8IA 2CXAA 4MFQA 4R87A 4R57A 3DR6A 3CXQA 5IX3A 1NMTA 3R1KA 2GANA 1KUXA 1Q2CA 5C82A 1KUYA 4CRYB 4QUSA 4K30A 3WR7A 4XPLA 2B4BA 1BO4A 4R9MA 1Y9KA 4OLLA 2VZYA 3R95A 4QC6A 3PGPA 5JQ4A 4F0YA 5I0CA 4M85A 2YNCC 1XF8A 1WK4A 1P0HA 2B4DA 3RYOA 3S6GA 1J4JA 3ZJ0A 1M4GA 4A95A 1OZPA 2BUEA 2J8NA 2KCWA 2FL4A 4I49A 2REEA 1XMTA 1XIXA 2FT0A 2B3UA 3DNSA 1UFHA 3TE4A 4QVTA 5IV0A 3E0KA 4A30A 3S6HA 5J8CA 2OB0A 4L8AA 4EVYA 3P2FA 5KTDA 5DWMA 2Z3MA 1TIQA 3R9EA 4AVCA 2Q0YA 3LD2A 2F5IA 3PP9A 3TOBA 2PSWA 1S7FA 4QBJA 4NSQA 4FD4A 2Z3LA 2G0BA 2P6EA 4II9A 2R8VA 4YFJA 1XEBA 3H5ZA 4A33A 2VBQA 5A28A 1QSNA 1QSMA 2FSRA 2VXKA 5CNPA 5F48A 3IU2A 2CNMA 4MFLA 4C2YA 2K5TA 1YVOA 4XNHB 2PR8A 2Z0ZA 2Q4YA 3A9LA 4E8OA 1M1DA 4PSWA 3T90A 4RI1A 4XPDB 2BSWA 3N7ZA 1B6BA 3JUWA 3MGDA 3FBUA 2JEVA 2DPSA 5FVJA 2QIRA 4MY0A 3K9UA 5AG4A 3TCVA 4ZBGA 3SXNA 1I12A 4MBUA 1U6MA 4KOYA 3D8PA 1QSOA 4FD6A 4AG7A 4UWJA 1M4IA 4R3LA 4HNWB 5G20A 1S7LA 1BOBA 4XPDC 5E96A 2J8RA 5BWAB 2BL1A 3FB3A 2P0WA 4RS2A 3GYAA 3QB8A 5F49A 3TOAA 5F46A 4CGNA 2PR1A 3IGRA 4B11A 1VHSA 2QMLA 4JD6A 3TTHA 4UBRA 2ZW6A 4KS9A 4CRZB 1QSTA 4H6ZA 4HNXB 4MFPA 4C68A 5HMNA 1N71A 2Y0MA 4CGOA 3SHPA 2ZXVA 2R7HA 4Q36A 4QB9A 1PUAA 4B13A 4KVOE 4E2AA 2HV2A 2OZHA 4F0XA 4KUBA 4MJ8A 1K4JA 4NF1A 4NXYA 4AVBA 4UFVA 5KTCA 3F0AA 4Y49B 2JDCA 4U5YA 2ATRA 5JPHA 2P6GA 2WPWA 4F6AA 5AG7A 2IL4A 2H5MA 4UCMA 2A4NA 3D2PA 3TT2A 4KZTA 4JLYA 1S3ZA 3F5BA 4MI4A 4Q38A 2B58A 4AVAA 3EC4A 3JVNA 4CGLA 2FS5A 4Y49C 1LRZA 4MY3A 2GE3A 1CJWA 4OAEA 2O28A 1SQHA 4KOSA 3D3SA 4HNYB 1L0CA 1YR0A 4DNCA 3R9GA 2PQ8A 1FY7A 4UCNA 3FNCA 2Q44A 1I21A 5HH1A 1Z4EA 2B3VA 4KOTA 3OWCA 4B14A 1S60A 4B10A 4C7HA 2VQYA 3EFAA 3EY5A 3JTKA 1B87A 4MHDA 1S7KA 5KTAA 2FCKA 4U9YA 2I00A 4PSXA 2FE7A 2WUUA 4C2ZA 4CYNA 4H6UA 4CYPA 2R1IA 1ZO0A 1KUVA 4BMHA 2AE6A 3I9SA 3VWEA 2CY2A 3W91A 1MJAA 4L89A 4UCPA 4CAXA 3VWDA 1IYLA 3GKRA 1I1DA 2YNDA 4PV6A 2OZGA 4CAFA 1IIDA 2DPTA 5J8FA 2VZZA 1Y7RA 3GY9A 4X5KA 3CXSA 2FIAA 2HQYA 1S5KA 5H84A 3T9YA 4C7IA 2B4DB 3IWEA 2EUIA 4B5OA 1MK4A 1RXTA 3W6SA 1V0CA 3IU1A 4NCZA 3BLNA 2YNEA 4A2ZA 4U9ZA 4FD7A 5EBVA 1NSLA 3R96A 5DWNA 1YVKA 5H86A 1S7NA 3FIXA 4IUSA 1P4NA 4CAEA 4KOXA 2CNSA 2C27A 2BEIA 1VKCA 2OH1A 4KSFA 4PK2A 3EXNA 3TO6A 5AGEA 1YGHA 4H89A 4KVME 3D2MA 2PRBA 2Q7BA 3SXOA 4A32A 4AG9A 1Q2YA 2B5GA 3F8KA 4YGOA 2JLMA 1YLEA 4CAVA 2Q04A 3P2HA 4A31A 2FIWA 4GS4A 4M3SA 2ZW4A 1Z9UA 4ZGYB 3R9FA 2YGWA 3S6KA 2J8MA 1Q2DA 4LUAA 5IB0A 2VEZA 4YRHA 2QECA 4CS0B 2REFA 4MFZA 4LX9A 1Z4RA 5AG6A 1RO5A 4ORFA 4NEXA 5A27A 3G8WA 1YK3A 3QAHA 2RC4A 5EC4A 4HKFA 2CNTA 2DXQA 2EVNA 1KZFA 4UA3A 2D4PA 3TO9A 5G21A 1IB1E 2ZPAA 2X7BA 4C2XA 3DSBA 5F47A 4CYOA 2ZW5A 3TO7A 3LODA 4KLWA 4AB7A 3ZZIA 5G1ZA 4JJXA 3IWGA 4CGMA 1CM0A 3BJ7A 5G22A 1ON0A 3H4QA 3B8GA 2FXFA 4B5PA 2YNCA 4KORA 2OU2A 4ONUA 2I79A 3PZJA 4MFKA 4UWIA 4FD5A 2WSAA 1XE4A 2OZUA 1IICA 2Z3PA 2B5GB 2ZW7A 4CGPA 3DR8A 2NMTA 1Y9WA 3W6XA 4KOWA 4KSAA 4E0AA 5ISVA 4JXRA 3S6FA 3NE7A 2AJ6A 4BBHA 2JDDA 4R3KA 2PC1A 2Z3NA 4UFWA 2VI7A 3C26A 2Z3OA 4KVXA 3UY5A 2Q4VA 1MJBA 1MJ9A 3I3GA 4KOUA 5C88A 3CXPA 2PDOA 1PU9A 3FYNA 1GHEA 1YX0A 3DDDA 5GCNA 3FXTA 1NE9A 2WPXA 4JXQA 4J3GA 4CAWA 3TFYA 3EO4A 4XNHC 2Z10A 4PK3A 2P6FA 4XPKA 2ARHA 4B12A 4IF5A 1YREA 1M4DA 1WWZA 5AG5A 2G3TA 4KLVA 4MFJA 1M44A 2Z11A 3BJ8A 4JWPA 3KKWA 4KUAA 1QSRA 2G3AA 4UFXA 1R57A 3G3SA 2Z3KA 1IYKA 4OADA 4KOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUZ A;  4B5P B;  2GIV A;  3FRM A;  2R98 A;  2D4O A;  3V8I A;  4R87 A;  4R57 A;  3DR6 A;  3CXQ A;  5IX3 A;  1NMT A;  3R1K A;  2GAN A;  1KUX A;  1Q2C A;  5C82 A;  1KUY A;  4CRY B;  4QUS A;  4K30 A;  3WR7 A;  4XPL A;  2B4B A;  1BO4 A;  4R9M A;  1Y9K A;  4OLL A;  2VZY A;  3R95 A;  4QC6 A;  3PGP A;  5JQ4 A;  4F0Y A;  5I0C A;  4M85 A;  1XF8 A;  1WK4 A;  1P0H A;  2B4D A;  3RYO A;  3S6G A;  1J4J A;  3ZJ0 A;  1M4G A;  1OZP A;  2BUE A;  2J8N A;  2KCW A;  2FL4 A;  4I49 A;  2REE A;  1XMT A;  1XIX A;  2FT0 A;  2B3U A;  3DNS A;  1UFH A;  3TE4 A;  4QVT A;  5IV0 A;  3E0K A;  3S6H A;  5J8C A;  2OB0 A;  4L8A A;  4EVY A;  3P2F A;  5KTD A;  5DWM A;  1TIQ A;  3R9E A;  4AVC A;  2Q0Y A;  3LD2 A;  2F5I A;  3PP9 A;  3TOB A;  2PSW A;  1S7F A;  4QBJ A;  4NSQ A;  4FD4 A;  2G0B A;  2P6E A;  4II9 A;  2R8V A;  4YFJ A;  1XEB A;  2VBQ A;  1QSN A;  1QSM A;  2FSR A;  2VXK A;  5CNP A;  5F48 A;  2CNM A;  2K5T A;  1YVO A;  4XNH B;  2PR8 A;  2Z0Z A;  2Q4Y A;  4E8O A;  1M1D A;  4PSW A;  3T90 A;  4RI1 A;  4XPD B;  2BSW A;  3N7Z A;  1B6B A;  3JUW A;  3MGD A;  3FBU A;  2JEV A;  5FVJ A;  2QIR A;  4MY0 A;  3K9U A;  3TCV A;  4ZBG A;  3SXN A;  1I12 A;  4MBU A;  1U6M A;  4KOY A;  3D8P A;  1QSO A;  4FD6 A;  4AG7 A;  4UWJ A;  1M4I A;  4R3L A;  4HNW B;  1S7L A;  1BOB A;  4XPD C;  5E96 A;  2J8R A;  2BL1 A;  3FB3 A;  2P0W A;  4RS2 A;  3GYA A;  3QB8 A;  5F49 A;  3TOA A;  5F46 A;  2PR1 A;  3IGR A;  1VHS A;  2QML A;  4JD6 A;  3TTH A;  4UBR A;  2ZW6 A;  4CRZ B;  1QST A;  4H6Z A;  4HNX B;  5HMN A;  1N71 A;  2Y0M A;  3SHP A;  2ZXV A;  2R7H A;  4QB9 A;  1PUA A;  4KVO E;  4E2A A;  2HV2 A;  2OZH A;  4KUB A;  4MJ8 A;  1K4J A;  4NF1 A;  4NXY A;  4AVB A;  5KTC A;  3F0A A;  4Y49 B;  2JDC A;  4U5Y A;  2ATR A;  5JPH A;  2P6G A;  2WPW A;  4F6A A;  2IL4 A;  2H5M A;  2A4N A;  3D2P A;  3TT2 A;  4KZT A;  4JLY A;  1S3Z A;  3F5B A;  4MI4 A;  2B58 A;  4AVA A;  3EC4 A;  3JVN A;  2FS5 A;  4Y49 C;  1LRZ A;  4MY3 A;  2GE3 A;  1CJW A;  4OAE A;  2O28 A;  1SQH A;  4KOS A;  3D3S A;  4HNY B;  1L0C A;  1YR0 A;  4DNC A;  3R9G A;  2PQ8 A;  1FY7 A;  3FNC A;  2Q44 A;  1I21 A;  5HH1 A;  1Z4E A;  2B3V A;  4KOT A;  3OWC A;  1S60 A;  2VQY A;  3EFA A;  3EY5 A;  1B87 A;  4MHD A;  1S7K A;  5KTA A;  2FCK A;  4U9Y A;  2I00 A;  4PSX A;  2FE7 A;  4H6U A;  2R1I A;  1KUV A;  4BMH A;  2AE6 A;  3I9S A;  3VWE A;  2CY2 A;  3W91 A;  1MJA A;  4L89 A;  4CAX A;  3VWD A;  1IYL A;  3GKR A;  1I1D A;  4PV6 A;  2OZG A;  1IID A;  5J8F A;  2VZZ A;  1Y7R A;  3GY9 A;  4X5K A;  3CXS A;  2FIA A;  2HQY A;  1S5K A;  5H84 A;  3T9Y A;  2B4D B;  2EUI A;  4B5O A;  1MK4 A;  1RXT A;  3W6S A;  1V0C A;  4NCZ A;  3BLN A;  4U9Z A;  4FD7 A;  5EBV A;  1NSL A;  3R96 A;  5DWN A;  1YVK A;  5H86 A;  1S7N A;  3FIX A;  4IUS A;  1P4N A;  4KOX A;  2CNS A;  2C27 A;  2BEI A;  1VKC A;  2OH1 A;  4PK2 A;  3EXN A;  3TO6 A;  1YGH A;  4H89 A;  4KVM E;  3D2M A;  2PRB A;  2Q7B A;  3SXO A;  4AG9 A;  1Q2Y A;  2B5G A;  3F8K A;  4YGO A;  2JLM A;  1YLE A;  4CAV A;  2Q04 A;  3P2H A;  2FIW A;  4GS4 A;  4M3S A;  2ZW4 A;  1Z9U A;  3R9F A;  3S6K A;  2J8M A;  4LUA A;  1Q2D A;  5IB0 A;  2VEZ A;  4YRH A;  2QEC A;  4CS0 B;  2REF A;  4LX9 A;  1Z4R A;  1RO5 A;  4ORF A;  4NEX A;  3G8W A;  1YK3 A;  3QAH A;  2RC4 A;  5EC4 A;  4HKF A;  2CNT A;  2DXQ A;  2EVN A;  1KZF A;  4UA3 A;  2D4P A;  3TO9 A;  1IB1 E;  2ZPA A;  2X7B A;  3DSB A;  5F47 A;  2ZW5 A;  3TO7 A;  3LOD A;  4KLW A;  4AB7 A;  3ZZI A;  4JJX A;  3IWG A;  1CM0 A;  3BJ7 A;  1ON0 A;  3H4Q A;  3B8G A;  2FXF A;  4B5P A;  4KOR A;  2OU2 A;  4ONU A;  2I79 A;  3PZJ A;  4UWI A;  4FD5 A;  1XE4 A;  2OZU A;  1IIC A;  2B5G B;  2ZW7 A;  3DR8 A;  2NMT A;  1Y9W A;  3W6X A;  4KOW A;  4E0A A;  5ISV A;  4JXR A;  3S6F A;  3NE7 A;  2AJ6 A;  2JDD A;  4R3K A;  2PC1 A;  2VI7 A;  3C26 A;  3UY5 A;  4KVX A;  2Q4V A;  1MJB A;  1MJ9 A;  3I3G A;  4KOU A;  5C88 A;  3CXP A;  2PDO A;  1PU9 A;  3FYN A;  1GHE A;  1YX0 A;  3DDD A;  5GCN A;  3FXT A;  1NE9 A;  2WPX A;  4JXQ A;  4J3G A;  4CAW A;  3TFY A;  3EO4 A;  4XNH C;  2Z10 A;  4PK3 A;  2P6F A;  4XPK A;  2ARH A;  4IF5 A;  1YRE A;  1M4D A;  1WWZ A;  2G3T A;  4KLV A;  1M44 A;  2Z11 A;  3BJ8 A;  4JWP A;  3KKW A;  4KUA A;  1QSR A;  2G3A A;  1R57 A;  3G3S A;  1IYK A;  4OAD A;  4KOV A; 
#chains in the Genus database with same CATH topology
 3KGQ A;  2HUZ A;  2RFH A;  3KR4 A;  4B5P B;  4CYQ A;  4FBE A;  2GIV A;  3FRM A;  2R98 A;  2D4O A;  3V8I A;  5HXD A;  4MHY A;  2IMO A;  2CXA A;  3QNV A;  4MFQ A;  4R87 A;  4R57 A;  3DR6 A;  4OC0 A;  3CXQ A;  3IIB A;  1R43 A;  3SJF A;  5IX3 A;  3D67 A;  2FVG A;  3ISX A;  1NMT A;  3R1K A;  1YW4 A;  1KUX A;  1Q2C A;  2GAN A;  1HDU A;  1KUY A;  5C82 A;  4CRY B;  4QUS A;  4K30 A;  3D4U A;  3WR7 A;  4XPL A;  4X2T A;  5JH9 A;  2QYV A;  4P4D A;  2WYR A;  3FVL A;  2B4B A;  1BO4 A;  4R9M A;  4R7M A;  1Y9K A;  5LYL A;  4OLL A;  4BD9 A;  4MHZ A;  2VZY A;  7CPA A;  3R95 A;  4QC6 A;  2AFO A;  3PGP A;  5JQ4 A;  3KQZ A;  3FJU A;  4OC4 A;  4F0Y A;  5I0C A;  4M85 A;  3CPX A;  2ZOF A;  1LAN A;  2YNC C;  1XF8 A;  2PVW A;  4KSI A;  4YU9 A;  1WK4 A;  3RZA A;  1P0H A;  2B4D A;  2GU2 A;  2PJ2 A;  3RYO A;  3S6G A;  1J4J A;  2ZEM A;  3ZJ0 A;  1M4G A;  4OIW A;  4A95 A;  5DS0 A;  1OZP A;  2BUE A;  4ZY0 A;  3IFE A;  2J8N A;  2KCW A;  2FL4 A;  4I49 A;  2REE A;  1XMT A;  2XEF A;  1XIX A;  2FT0 A;  2VL1 A;  2PJ1 A;  2V8H A;  3B2Y A;  3B3T A;  2B3U A;  3DNS A;  1UFH A;  3TE4 A;  2PJC A;  3IEH A;  4QVT A;  4WJB A;  5IV0 A;  3BI0 A;  3E0K A;  4ZY2 A;  2O4H A;  4A30 A;  3S6H A;  5J8C A;  3H8G A;  2OB0 A;  3BI1 A;  1TF8 A;  4L8A A;  2V8G A;  4EVY A;  3P2F A;  4DJL A;  5KTD A;  5DWM A;  2Z3M A;  1TIQ A;  3R9E A;  4AVC A;  1JQG A;  2G9D A;  2Q0Y A;  3B7I A;  3LD2 A;  2F5I A;  4BIN A;  3PP9 A;  3TOB A;  2PSW A;  1S7F A;  1XRY A;  4QBJ A;  3QAY A;  4NSQ A;  2BCO A;  2Z3L A;  2G0B A;  2P6E A;  4FD4 A;  3PRT A;  4II9 A;  4G1P A;  4H2K A;  1F57 A;  2R8V A;  4YFJ A;  1BAV A;  3HUV A;  3B3W A;  1XEB A;  3H5Z A;  4A33 A;  1X12 A;  1YQE A;  2VBQ A;  4OID A;  5A28 A;  3GB0 A;  4OKO A;  4FWU A;  1TF9 A;  3S9M A;  2PJ7 A;  3IWW A;  3SJG A;  1GYT A;  1QSN A;  1QSM A;  2FSR A;  2VXK A;  5CNP A;  5F48 A;  3IU2 A;  5LYD A;  3WC5 A;  2CNM A;  4MFL A;  4C2Y A;  2K5T A;  1YVO A;  4XNH B;  2PR8 A;  2Z0Z A;  2Q4Y A;  3A9L A;  4E8O A;  1M1D A;  4PSW A;  4MRI A;  3T90 A;  4RI1 A;  1IY7 A;  4XPD B;  3SI0 A;  2PJ0 A;  2BSW A;  1LOK A;  3N7Z A;  1B6B A;  1ARM A;  4NGM A;  2ZEN A;  3JUW A;  3MGD A;  3FBU A;  2JEV A;  4OC1 A;  5LRK A;  2DPS A;  4A38 A;  2AFZ A;  5FVJ A;  2QIR A;  2F8H A;  4MY0 A;  3K9U A;  4GXH A;  3RO0 A;  3PFO A;  4FUU A;  5AG4 A;  3TCV A;  4OC5 A;  4ZBG A;  3SXN A;  1I12 A;  4MBU A;  1U6M A;  4KOY A;  3D8P A;  1ZLH A;  1XBU A;  1QSO A;  3GLJ A;  3KL9 A;  2AFX A;  4FD6 A;  4AG7 A;  4UWJ A;  4UEE A;  1M4I A;  4R3L A;  1CP7 A;  3VH9 A;  5JGF A;  4HNW B;  5G20 A;  4GM5 A;  1S7L A;  4PXB A;  1BOB A;  4XPD C;  5E96 A;  2J8R A;  5BWA B;  1BLL E;  2BL1 A;  3FB3 A;  2P0W A;  4RS2 A;  3GYA A;  3QB8 A;  5F49 A;  4ZY1 A;  3TOA A;  1UWY A;  3FED A;  2QVP A;  5F46 A;  1IU8 A;  3B3V A;  4O23 A;  4Z65 A;  4CGN A;  1VIX A;  2PR1 A;  3IGR A;  4A39 A;  4B11 A;  1VHS A;  2QML A;  4JD6 A;  4PQA A;  4ZX9 A;  1XJO A;  1ZG7 A;  2ZEH A;  3TTH A;  4UBR A;  2ZW6 A;  4PPZ A;  3NA6 A;  4KS9 A;  4CRZ B;  1QST A;  4H6Z A;  4HNX B;  4MFP A;  4OP4 A;  4C68 A;  4UF4 A;  1N71 A;  5HMN A;  2Y0M A;  4CGO A;  4Q7A A;  3DGV A;  3SHP A;  2ZXV A;  4MCP A;  4F8Z A;  4HPS A;  2BOA A;  2R7H A;  4Q36 A;  4AXV A;  4QB9 A;  1PUA A;  4B13 A;  2F7V A;  1M4L A;  4KVO E;  4JZ0 A;  5CPA A;  4E2A A;  2HV2 A;  3CT9 A;  2AFW A;  4MCQ A;  2OZH A;  4F0X A;  2GLJ A;  2ZEO A;  3PBB A;  4KUB A;  4MJ8 A;  1K4J A;  4NF1 A;  4NXY A;  2C6P A;  3SI2 A;  4AVB A;  2PE3 A;  3NE8 A;  4NGQ A;  2JEW A;  4UFV A;  1NSA A;  3F0A A;  4DYO A;  4Y49 B;  2JDC A;  5KTC A;  4U5Y A;  4YWY A;  4F9V A;  2ATR A;  5JPH A;  4OME A;  4MCR A;  2P6G A;  2PRQ A;  2CTC A;  2WPW A;  3LMS A;  4F6A A;  2ZEG A;  2O53 A;  5LYF A;  5AG7 A;  5EMI A;  3D7G A;  2IL4 A;  2H5M A;  4LQ6 A;  1Z5R A;  1AYE A;  2IJZ A;  5LRJ A;  3D7D A;  4UCM A;  2A4N A;  3D2P A;  4ZI6 A;  2Q7S A;  3MN8 A;  3TT2 A;  4KZT A;  4JLY A;  1S3Z A;  3F5B A;  4MI4 A;  1BPN A;  4NJR A;  4Q38 A;  2B58 A;  4AVA A;  3EC4 A;  3JVN A;  3KZW A;  4CGL A;  2FS5 A;  4Y49 C;  1LRZ A;  4MY3 A;  3PB9 X;  5ELY A;  2GE3 A;  1CJW A;  4OAE A;  3S9L A;  2O28 A;  3KHZ A;  3PB8 X;  1FNO A;  3NH5 A;  2CF4 A;  1SQH A;  1IOF A;  3L2N A;  4KOS A;  4JYW A;  3D3S A;  4HNY B;  2PJB A;  1ZG8 A;  1L0C A;  1YR0 A;  4DNC A;  2NYQ A;  3R9G A;  2PQ8 A;  2EO8 A;  4X8I A;  2OOT A;  4NGR A;  2ZEE A;  1FY7 A;  3GUX A;  4UCN A;  3FNC A;  1A2Z A;  2Q44 A;  1CG2 A;  1I21 A;  2EK8 A;  3MRU A;  5HH1 A;  3TC8 A;  1Z4E A;  2B3V A;  4KOT A;  6CPA A;  3OWC A;  4M6H A;  4B14 A;  1S60 A;  2HC9 A;  1Y7E A;  4B10 A;  2HB6 A;  4C7H A;  5I4M A;  4UEF A;  2VQY A;  4IK2 A;  4MXU A;  3EFA A;  3EY5 A;  3PB7 X;  3JTK A;  1B87 A;  4MHD A;  4P10 A;  1S7K A;  3PBE A;  2OR4 A;  1ZG9 A;  5KTA A;  2FCK A;  1IOI A;  4U9Y A;  2I00 A;  4PSX A;  4R76 A;  2FE7 A;  2WUU A;  4C2Z A;  4CYN A;  1QMU A;  4H6U A;  4CYP A;  2R1I A;  4P4B A;  1ZO0 A;  4P4F A;  4A94 A;  1KUV A;  4BMH A;  2AE6 A;  3I9S A;  3PB6 X;  1X10 A;  4P44 A;  3VWE A;  2CY2 A;  3W91 A;  3BXM A;  1ELL P;  1MJA A;  2XEI A;  1CP6 A;  4L89 A;  4P4I A;  4UCP A;  4W9Y A;  4CAX A;  3KQX A;  4B6Z A;  1YSJ A;  3K9T A;  3VWD A;  1IGB A;  1IYL A;  3GKR A;  1I1D A;  2YND A;  4ONW A;  2AFS A;  4PV6 A;  2OZG A;  1LCP A;  3D68 A;  4CAF A;  1IID A;  2DPT A;  4X3R A;  5J8F A;  5K8N A;  2VZZ A;  2PJA A;  1Y7R A;  3GY9 A;  4X5K A;  3CXS A;  2FIA A;  2HQY A;  1S5K A;  5H84 A;  1Z8T A;  3T9Y A;  2B4D B;  3IWE A;  4C7I A;  2PVV A;  1Z8X A;  2ABZ A;  2EUI A;  4PXD A;  4B5O A;  1MK4 A;  3B3S A;  3CPA A;  3NFZ A;  1RXT A;  2DF5 A;  3B3C A;  4OC2 A;  1V0C A;  3W6S A;  3IU1 A;  3KI9 A;  4NCZ A;  4A37 A;  4EWT A;  3BLN A;  2YNE A;  1BPM A;  1RTQ A;  4NJQ A;  4R8F A;  4A2Z A;  4U9Z A;  4FD7 A;  1Z8W A;  2C6C A;  2CIJ A;  3FEC A;  1ARL A;  1TKJ A;  2CTB A;  5EBV A;  1NSL A;  3R96 A;  2Q51 A;  5DWN A;  1YVK A;  2RB7 A;  3FH4 A;  5LRG A;  4NGT A;  5H86 A;  3VAR A;  1S7N A;  3CZX A;  2ANP A;  3FIX A;  4IUS A;  2ZEL A;  3KAS A;  2PJ3 A;  3SJX A;  1P4N A;  4CAE A;  3HLP A;  3IC1 A;  4KOX A;  2CNS A;  2C27 A;  2PJ6 A;  2BEI A;  5F09 A;  4TNU A;  1HDQ A;  1VKC A;  2ZEP A;  2OH1 A;  4KSF A;  1PCA A;  4PK2 A;  3EXN A;  2ZED A;  3TO6 A;  2JBJ A;  5AGE A;  1YGH A;  2ODF A;  5D8N A;  2EK9 A;  5K8P A;  4H89 A;  3LWU A;  3FEE A;  1ZLI A;  4KVM E;  3VAT A;  3D2M A;  2PRB A;  3D7H A;  2Q7B A;  1Q7L A;  3SXO A;  5HVG A;  3PFE A;  4A32 A;  4AG9 A;  4IHM A;  1Q2Y A;  2I3C A;  2Q4Z A;  1CBX A;  3NH8 A;  2B5G A;  3F8K A;  3NH4 A;  2JLM A;  1YLE A;  4YGO A;  4CAV A;  2Q04 A;  3P2H A;  2XEG A;  2FIW A;  3T8W A;  4A31 A;  4UEZ A;  2IQ6 A;  4GS4 A;  1H8L A;  4M3S A;  2ZW4 A;  4P4J A;  1LAP A;  1Z9U A;  4ZGY B;  3R9F A;  1F2P A;  2YGW A;  2J9A A;  3N5F A;  3S6K A;  1FT7 A;  2J8M A;  1Q2D A;  2ZOG A;  4LUA A;  5IB0 A;  2VEZ A;  4YRH A;  3BHX A;  4EFD A;  2WZN A;  2JBK A;  2QEC A;  2GRE A;  1Z8L A;  2C6G A;  4CS0 B;  5J1Q A;  5LYI A;  2REF A;  2DEA A;  1EE3 P;  3ISZ A;  4MFZ A;  4NGN A;  2PIY A;  4LX9 A;  4NFR A;  3B35 A;  3RNZ A;  2V77 A;  3FF3 A;  1Z4R A;  4P45 A;  4IAV A;  4EME A;  5AG6 A;  1RO5 A;  3H8F A;  4ORF A;  4NEX A;  5A27 A;  3G8W A;  4P6Y A;  4NGP A;  1DE4 C;  2GLF A;  1YK3 A;  3QAH A;  2NSM A;  4OC3 A;  2RC4 A;  5JM6 A;  1Y0Y A;  1CX8 A;  3D7F A;  5EC4 A;  4HKF A;  5HVH A;  3FMC A;  2EBJ A;  2CNT A;  1XMB A;  2GFQ A;  2DXQ A;  4ZX8 A;  1VGY A;  3I1U A;  4UIA A;  2PCU A;  2BO9 A;  1YME A;  2EVN A;  1YW6 A;  2AFM A;  1KZF A;  4UA3 A;  2D4P A;  5HVF A;  3TO9 A;  5G21 A;  1IB1 E;  4PXE A;  3V7Z A;  2ZPA A;  2X7B A;  3DLJ A;  4C2X A;  3DSB A;  5F47 A;  4CYO A;  3SI1 A;  3RAM A;  2ZW5 A;  3TO7 A;  3LOD A;  3PEI A;  2POK A;  4KLW A;  4AB7 A;  3ZZI A;  5G1Z A;  4JJX A;  3IWG A;  3H8E A;  4CGM A;  5THW A;  1CM0 A;  4LQG A;  4P4E A;  4UIB A;  3BJ7 A;  4RN7 A;  1ELM P;  4NGS A;  5G22 A;  1ON0 A;  4R6T A;  3H4Q A;  3B8G A;  3FX6 A;  2FXF A;  2Q43 A;  3GIU A;  4B5P A;  2YNC A;  2ZEF A;  2AFU A;  2OU2 A;  4KOR A;  4ONU A;  8CPA A;  2I79 A;  3WT4 A;  3PZJ A;  1XOV A;  4MFK A;  1HEE A;  1XFO A;  1R3N A;  3IJ3 A;  1CPX A;  4UWI A;  3WC7 A;  4MHN A;  4FD5 A;  4K3N A;  2WSA A;  3D66 A;  3LAC A;  4M6I A;  3JRU A;  4FAI A;  1OBR A;  5K8M A;  1JWQ A;  2C1C A;  1XE4 A;  2PJ5 A;  2OZU A;  1IIC A;  2Z3P A;  2B5G B;  2ZW7 A;  1DTD A;  4CGP A;  3DR8 A;  2XEJ A;  2NMT A;  1Y9W A;  1VHE A;  3W6X A;  4KOW A;  4KSA A;  4E0A A;  3IO1 A;  4MCS A;  4JXR A;  5ISV A;  4CPA A;  3V38 A;  1KWM A;  3S6F A;  3NE7 A;  2AJ6 A;  4WWV A;  4BBH A;  4DUK A;  2JDD A;  3SJE A;  4R3K A;  3CDX A;  2PC1 A;  5D29 A;  3S9N A;  2Z3N A;  1TKH A;  2PIZ A;  1LAM A;  1AUG A;  4UFW A;  2VI7 A;  1Y0R A;  3C26 A;  2Z3O A;  4KVX A;  3UY5 A;  2Q4V A;  1MJB A;  1MJ9 A;  3I3G A;  4KOU A;  5C88 A;  1AMP A;  5CBM A;  3CXP A;  2QJ8 A;  2PDO A;  1PU9 A;  3KHX A;  3FYN A;  1GHE A;  1YX0 A;  3DDD A;  5GCN A;  3FXT A;  2EWB A;  1NE9 A;  3KR5 A;  4MMO A;  2WPX A;  4JXQ A;  4RUH A;  4J3G A;  4ZYQ A;  2PJ8 A;  1VHO A;  4CAW A;  4TWE A;  3TFY A;  3EO4 A;  3RBU A;  2V8V A;  4MHP A;  1TXR A;  4XNH C;  4F9U A;  2Z10 A;  4PK3 A;  2P6F A;  4XPK A;  2PJ9 A;  1TKF A;  3PB4 X;  3WAB A;  1F2O A;  2ARH A;  3K2K A;  4B12 A;  4IF5 A;  1YRE A;  4PXC A;  1M4D A;  1WWZ A;  5AG5 A;  1LFW A;  2G3T A;  3WC6 A;  4KLV A;  5K8O A;  1QQ9 A;  4MFJ A;  1M44 A;  2Z11 A;  3BJ8 A;  1CPS A;  2PJ4 A;  4JWP A;  3KKW A;  4KUA A;  1QSR A;  1PYT B;  2G3A A;  4UFX A;  1R57 A;  1YLO A;  3G3S A;  2Z3K A;  1IYK A;  1Z2L A;  4OAD A;  4M6G A;  5IB9 A;  3TX8 A;  4KOV A;  2V8D A; 
#chains in the Genus database with same CATH homology
 2HUZ A;  4B5P B;  4CYQ A;  2GIV A;  3FRM A;  2R98 A;  2D4O A;  3V8I A;  2CXA A;  4MFQ A;  4R87 A;  4R57 A;  3DR6 A;  3CXQ A;  5IX3 A;  1NMT A;  3R1K A;  2GAN A;  1KUX A;  1Q2C A;  5C82 A;  1KUY A;  4CRY B;  4QUS A;  4K30 A;  3WR7 A;  4XPL A;  2B4B A;  1BO4 A;  4R9M A;  1Y9K A;  4OLL A;  2VZY A;  3R95 A;  4QC6 A;  3PGP A;  5JQ4 A;  4F0Y A;  5I0C A;  4M85 A;  2YNC C;  1XF8 A;  1WK4 A;  1P0H A;  2B4D A;  3RYO A;  3S6G A;  1J4J A;  3ZJ0 A;  1M4G A;  4A95 A;  1OZP A;  2BUE A;  2J8N A;  2KCW A;  2FL4 A;  4I49 A;  2REE A;  1XMT A;  1XIX A;  2FT0 A;  2B3U A;  3DNS A;  1UFH A;  3TE4 A;  4QVT A;  5IV0 A;  3E0K A;  4A30 A;  3S6H A;  5J8C A;  2OB0 A;  4L8A A;  4EVY A;  3P2F A;  5KTD A;  5DWM A;  2Z3M A;  1TIQ A;  3R9E A;  4AVC A;  2Q0Y A;  3LD2 A;  2F5I A;  3PP9 A;  3TOB A;  2PSW A;  1S7F A;  4QBJ A;  4NSQ A;  4FD4 A;  2Z3L A;  2G0B A;  2P6E A;  4II9 A;  2R8V A;  4YFJ A;  1XEB A;  3H5Z A;  4A33 A;  2VBQ A;  5A28 A;  1QSN A;  1QSM A;  2FSR A;  2VXK A;  5CNP A;  5F48 A;  3IU2 A;  2CNM A;  4MFL A;  4C2Y A;  2K5T A;  1YVO A;  4XNH B;  2PR8 A;  2Z0Z A;  2Q4Y A;  3A9L A;  4E8O A;  1M1D A;  4PSW A;  3T90 A;  4RI1 A;  4XPD B;  2BSW A;  3N7Z A;  1B6B A;  3JUW A;  3MGD A;  3FBU A;  2JEV A;  2DPS A;  5FVJ A;  2QIR A;  4MY0 A;  3K9U A;  5AG4 A;  3TCV A;  4ZBG A;  3SXN A;  1I12 A;  4MBU A;  1U6M A;  4KOY A;  3D8P A;  1QSO A;  4FD6 A;  4AG7 A;  4UWJ A;  1M4I A;  4R3L A;  4HNW B;  5G20 A;  1S7L A;  1BOB A;  4XPD C;  5E96 A;  2J8R A;  5BWA B;  2BL1 A;  3FB3 A;  2P0W A;  4RS2 A;  3GYA A;  3QB8 A;  5F49 A;  3TOA A;  5F46 A;  4CGN A;  2PR1 A;  3IGR A;  4B11 A;  1VHS A;  2QML A;  4JD6 A;  3TTH A;  4UBR A;  2ZW6 A;  4KS9 A;  4CRZ B;  1QST A;  4H6Z A;  4HNX B;  4MFP A;  4C68 A;  5HMN A;  1N71 A;  2Y0M A;  4CGO A;  3SHP A;  2ZXV A;  2R7H A;  4Q36 A;  4QB9 A;  1PUA A;  4B13 A;  4KVO E;  4E2A A;  2HV2 A;  2OZH A;  4F0X A;  4KUB A;  4MJ8 A;  1K4J A;  4NF1 A;  4NXY A;  4AVB A;  4UFV A;  5KTC A;  3F0A A;  4Y49 B;  2JDC A;  4U5Y A;  2ATR A;  5JPH A;  2P6G A;  2WPW A;  4F6A A;  5AG7 A;  2IL4 A;  2H5M A;  4UCM A;  2A4N A;  3D2P A;  3TT2 A;  4KZT A;  4JLY A;  1S3Z A;  3F5B A;  4MI4 A;  4Q38 A;  2B58 A;  4AVA A;  3EC4 A;  3JVN A;  4CGL A;  2FS5 A;  4Y49 C;  1LRZ A;  4MY3 A;  2GE3 A;  1CJW A;  4OAE A;  2O28 A;  1SQH A;  4KOS A;  3D3S A;  4HNY B;  1L0C A;  1YR0 A;  4DNC A;  3R9G A;  2PQ8 A;  1FY7 A;  4UCN A;  3FNC A;  2Q44 A;  1I21 A;  5HH1 A;  1Z4E A;  2B3V A;  4KOT A;  3OWC A;  4B14 A;  1S60 A;  4B10 A;  4C7H A;  2VQY A;  3EFA A;  3EY5 A;  3JTK A;  1B87 A;  4MHD A;  1S7K A;  5KTA A;  2FCK A;  4U9Y A;  2I00 A;  4PSX A;  2FE7 A;  2WUU A;  4C2Z A;  4CYN A;  4H6U A;  4CYP A;  2R1I A;  1ZO0 A;  1KUV A;  4BMH A;  2AE6 A;  3I9S A;  3VWE A;  2CY2 A;  3W91 A;  1MJA A;  4L89 A;  4UCP A;  4CAX A;  3VWD A;  1IYL A;  3GKR A;  1I1D A;  2YND A;  4PV6 A;  2OZG A;  4CAF A;  1IID A;  2DPT A;  5J8F A;  2VZZ A;  1Y7R A;  3GY9 A;  4X5K A;  3CXS A;  2FIA A;  2HQY A;  1S5K A;  5H84 A;  3T9Y A;  4C7I A;  2B4D B;  3IWE A;  2EUI A;  4B5O A;  1MK4 A;  1RXT A;  3W6S A;  1V0C A;  3IU1 A;  4NCZ A;  3BLN A;  2YNE A;  4A2Z A;  4U9Z A;  4FD7 A;  5EBV A;  1NSL A;  3R96 A;  5DWN A;  1YVK A;  5H86 A;  1S7N A;  3FIX A;  4IUS A;  1P4N A;  4CAE A;  4KOX A;  2CNS A;  2C27 A;  2BEI A;  1VKC A;  2OH1 A;  4KSF A;  4PK2 A;  3EXN A;  3TO6 A;  5AGE A;  1YGH A;  4H89 A;  4KVM E;  3D2M A;  2PRB A;  2Q7B A;  3SXO A;  4A32 A;  4AG9 A;  1Q2Y A;  2B5G A;  3F8K A;  4YGO A;  2JLM A;  1YLE A;  4CAV A;  2Q04 A;  3P2H A;  4A31 A;  2FIW A;  4GS4 A;  4M3S A;  2ZW4 A;  1Z9U A;  4ZGY B;  3R9F A;  2YGW A;  3S6K A;  2J8M A;  1Q2D A;  4LUA A;  5IB0 A;  2VEZ A;  4YRH A;  2QEC A;  4CS0 B;  2REF A;  4MFZ A;  4LX9 A;  1Z4R A;  5AG6 A;  1RO5 A;  4ORF A;  4NEX A;  5A27 A;  3G8W A;  1YK3 A;  3QAH A;  2RC4 A;  5EC4 A;  4HKF A;  2CNT A;  2DXQ A;  2EVN A;  1KZF A;  4UA3 A;  2D4P A;  3TO9 A;  5G21 A;  1IB1 E;  2ZPA A;  2X7B A;  4C2X A;  3DSB A;  5F47 A;  4CYO A;  2ZW5 A;  3TO7 A;  3LOD A;  4KLW A;  4AB7 A;  3ZZI A;  5G1Z A;  4JJX A;  3IWG A;  4CGM A;  1CM0 A;  3BJ7 A;  5G22 A;  1ON0 A;  3H4Q A;  3B8G A;  2FXF A;  4B5P A;  2YNC A;  4KOR A;  2OU2 A;  4ONU A;  2I79 A;  3PZJ A;  4MFK A;  4UWI A;  4FD5 A;  2WSA A;  1XE4 A;  2OZU A;  1IIC A;  2Z3P A;  2B5G B;  2ZW7 A;  4CGP A;  3DR8 A;  2NMT A;  1Y9W A;  3W6X A;  4KOW A;  4KSA A;  4E0A A;  5ISV A;  4JXR A;  3S6F A;  3NE7 A;  2AJ6 A;  4BBH A;  2JDD A;  4R3K A;  2PC1 A;  2Z3N A;  4UFW A;  2VI7 A;  3C26 A;  2Z3O A;  4KVX A;  3UY5 A;  2Q4V A;  1MJB A;  1MJ9 A;  3I3G A;  4KOU A;  5C88 A;  3CXP A;  2PDO A;  1PU9 A;  3FYN A;  1GHE A;  1YX0 A;  3DDD A;  5GCN A;  3FXT A;  1NE9 A;  2WPX A;  4JXQ A;  4J3G A;  4CAW A;  3TFY A;  3EO4 A;  4XNH C;  2Z10 A;  4PK3 A;  2P6F A;  4XPK A;  2ARH A;  4B12 A;  4IF5 A;  1YRE A;  1M4D A;  1WWZ A;  5AG5 A;  2G3T A;  4KLV A;  4MFJ A;  1M44 A;  2Z11 A;  3BJ8 A;  4JWP A;  3KKW A;  4KUA A;  1QSR A;  2G3A A;  4UFX A;  1R57 A;  3G3S A;  2Z3K A;  1IYK A;  4OAD A;  4KOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...