2FCLA

Crystal structure of a putative nucleotidyltransferase (tm1012) from thermotoga maritima at 1.35 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
142
Chain Sequence
MIRPEYLRVLRIYDRLNEVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIFSEFVSVRFSSTEICSHFGELIIDGIVEIMGDIRRLEDGTWEDPVDLNYRFVETHGMIPVLSLEYEYQAYLLGRVEAETLRWLNER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (tm1012) from Thermotoga maritima at 1.35 A resolution
rcsb
molecule keywords hypothetical protein TM1012
molecule tags Transferase
source organism Thermotoga maritima
total genus 37
structure length 142
sequence length 156
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2fclA00
4FO1A 4XJEA 4WQLA 5CFUA 4WH5A 4WQKA 2FCLA 2EWRA 5CFSA 5CFTA 4HX0A
chains in the Genus database with same CATH superfamily
4NXZA 4E7XA 1ZQWA 5IILA 2ZH5A 4LZGA 4M0AA 3MGIA 5J0XA 4UB1A 1RZTA 3B0XA 4KB6A 4YMOA 4LEWA 9ICWA 1BPZA 4KLFA 2ZHAA 5IIJA 5CFUA 5CFSA 2DVIA 5B3PA 3V7LA 2ZH8A 5J2IA 2RFFA 5J2FA 1BPYA 5DEDA 1ZQZA 4AT9A 4AT8B 4P4OA 2HN2A 4WC2A 4I2DA 1V4AA 4OAHA 1NO5A 4TUPA 2DR7A 4KLUA 5IIOA 4NLNA 4X4SA 4AT7A 1ZQLA 1TFYA 4I0UA 4WC0A 1UETA 8ICJA 3JYYA 2BCQA 5CHEA 4K96A 2O5AA 3UXOA 4E80A 4X0BA 4O6AA 8ICNA 1Q78A 4QZ8A 4NKTA 4KM5A 7ICLA 3C18A 4Z6EA 4PGQA 8ICGA 5IIIA 4RQ2A 4PH5A 3OVSA 3UXNA 3JPQA 1ZQTA 9ICFA 4NKUA 3WFOA 3EF2A 1BPXA 8ICKA 4FHWA 3PNCA 1ZQOA 9ICAA 4LEZA 3LK9A 9ICTA 2ISOA 1ZJMA 2B4VA 5DBAA 2M2UA 5J2KA 4UB3A 4Z6CA 2NRKA 4TUSA 4I29A 5J29A 3NKUA 4HX0A 3OVBA 2O1PA 2PFQA 5HRIA 4XJEA 4PHDA 4F5PA 5IINA 4IQUA 2BCVA 2I9GA 4YN4A 8ICLA 8ICWA 5J0WA 4FH5A 4KLJA 3V7JA 4K4GA 1R8BA 2EWRA 3JZ0A 1XSNA 4M9JA 1TVAA 4QZAA 8ICZA 2M2VA 5CHGA 4QZGA 1MIVA 4AT9B 7ICUA 2ZHBA 4AT8A 2GA9D 4I2IA 4QZDA 8ICPA 4FHXA 1WOTA 4I2EA 3AQNA 1UEVA 3PHZA 4P4PA 4M5DA 2BCUA 9ICSA 5J2AA 8ICMA 4P2HA 8ICVA 3C66A 3TFRA 1ZQJA 2DR5A 1ZQEA 7ICPA 2BPGA 5J0YA 3B0YA 4KLOA 4X4OA 4PGYA 1R89A 4KLLA 4E8FA 4YMNA 4K4IA 4GXIA 4Z6FA 1ZQCA 3JPTA 1R8AA 2GWSA 4UD4A 8ICYA 2FMSA 4NM1A 4I2HA 4MFCA 5F2VO 1TV9A 1ZQBA 7ICSA 9ICQA 4NY8A 4NXTA 5J0QA 1Q79A 5IIKA 3K7DA 4FHVA 4F5QA 5B3QA 8ICOA 4QZBA 3HX0A 4M2YA 3RJGA 4MFAA 2VANA 3RH6A 4WC7A 4X4QA 2BPFA 5J0TA 4PGXA 5HREA 4JWMA 3NYBA 2P66A 1MQ3A 1ZQMA 9ICRA 2ID1A 4O69A 5HRDA 4M9GA 1KNYA 3RH4A 4KLIA 1HUOA 3AQMA 3MBYA 5J2DA 3ER8C 9ICHA 4NXWA 1ZQUA 9ICLA 7ICHA 3PMNA 2DR9A 1FA0A 4KLQA 2HHPA 4R65A 4JLXA 4WBZA 5BPCA 5IIMA 4DO9A 4XQ8A 4RWQA 4FHPA 2IUBA 5HC9A 5CR0A 4KLSA 4FHYA 1ZQPA 5D49A 1TFWA 4EGWA 4S3NA 3NVOA 4RT3A 3RJJA 5D62A 4RQ5A 4XUSA 4OAIZ 4R64A 4WC1A 4EEBA 8ICFA 3RJIA 4PHAA 5HRGA 4DOBA 3H37A 8ICUA 4NM2A 1MIWA 4KLEA 4MKPA 4WH5A 5JTGA 9ICVA 4K98A 3K75D 4YD1A 4RWPA 1ZQIA 4PHEA 4NLZA 4YD2A 2BCSA 3ISBA 4K9AA 1YLQA 1UEUA 3GDXA 4JWNA 4YMMA 5DECA 4GXJA 2FMPA 5CJ7A 4RWOA 4RT2A 3UXPA 4RWNA 5J0PA 4RQ4A 1PX5A 4OAFA 2FMQA 8ICRA 4DOCA 5EOZA 4EV6A 4NXVA 4O5EA 8ICXA 8ICQA 4X4RA 5HR9A 2DRBA 4K9BA 9ICUA 1JN3A 1ZQAA 4X4TA 1KDHA 3PMLA 1ZQVA 4QZHA 1R8CA 2BBJA 5DBBA 7ICKA 2HN1A 7ICJA 4R66A 4WQKA 8ICEA 4XA5A 4UB2A 4FO1A 2M2WA 1ZQYA 1ZQDA 2BPCA 3UQ2A 1BPBA 3AUOA 4PPXA 4LZDA 2ISPA 5DDMA 5DB9A 3C2KA 3ERCC 3CK6A 1ZQXA 3MGHA 4F5NA 4O67A 3ISDA 3RJKA 4RPZA 7ICIA 2DR8A 5J0SA 3L9DA 3OUYA 4MF8A 3HWTA 5HRFA 4WBYA 7ICMA 9ICBA 1NOMA 4O9MA 4M04A 4UB4A 8ICAA 2PXIA 3V72A 4UAYA 5CB1A 3C2MA 2IHOA 3H38A 4K97A 9ICNA 4WC3A 4WCWA 9ICPA 1ZQSA 5DB8A 5D4BA 4UBBA 4FO6A 2ZH3A 4RQ1A 4M9HA 7ICOA 1JAJA 4PHPA 4WQLA 4MFFA 7ICVA 1XSLA 4KLDA 4IG8A 2B56A 5J2JA 4EEDA 3V7KA 4GXKA 4ATBB 3OVAA 4O5CA 2DRAA 8ICCA 3HJ4A 5J2EA 3TFSA 7ICFA 5CP2A 9ICKA 5HHIA 1HUZA 3H3AA 4Z6DA 5CA7A 4LEVA 5BOLA 4KLGA 9ICEA 3WFQE 3RH5A 5DDYA 7ICRA 2BBHA 4YCXA 4X4VA 3H39A 8ICBA 3AU2A 2IHMA 4EBJA 3HIYA 3RJEA 5HHHA 9ICXA 3UQ0A 4K8VA 3WFSC 8ICSA 3OUYB 2W9MA 4I2CA 4X5VA 4NXUA 4KLTA 7ICTA 4I27A 5DKWA 5CWRA 9ICOA 2ZH9A 4K4HA 5CFTA 4I2JA 4UB5A 1ZQFA 1RPLA 4K99A 4IQVA 5J2BA 9ICJA 3WFPA 4I2GA 2ZH6A 2BE3A 5J2GA 1VFGA 4LEYA 1MIYA 4I2BA 4LVSA 3JPRA 5BOMA 3OV7A 1KEJA 2Q66A 4RQ7A 4WOYA 3C2LA 3JPPA 4WC5A 3RJHA 7ICGA 7ICNA 2B51A 3AQKA 3HJ1A 5HRHA 4TURA 5J0OA 3JPNA 3NWIA 7ICEA 1JMSA 4P4MA 2ZH7A 4TUQA 4RQ3A 4KLHA 2PFPA 4JLZA 2ZH2A 3C5GA 8ICIA 3MDAA 3RJFA 5HRBA 4M47A 4FH3A 1JQRA 4QZFA 4QZEA 4WC6A 4NLKA 3C5FA 1ZQHA 4XQ7A 4EBKA 4X4NA 3WFRE 4ATBA 1BPEA 3JCFA 3MDCA 2ZH1A 3HW8A 5DBCA 5D63A 1ZQRA 5TZVA 5DB7A 2PBEA 4QZIA 4IQWA 1ZQQA 4QZ9A 1ZQKA 8ICTA 5HRKA 4X4UA 5J0RA 4F5RA 2GAFD 4UBCA 4LT6A 3AU6A 1F5AA 3MCRA 4R63A 9ICMA 4UAZA 3ER9B 7ICQA 4IQTA 1BPDA 2M2TA 1OU5A 5J2CA 1ZQGA 2PFOA 2FCLA 4AT7B 3JPSA 4I2AA 9ICIA 4NXXA 4M9NA 4N7RA 4EP7A 4UAWA 3LQCB 4O68A 5D61A 9ICGA 4RQ8A 3UPQA 5HRLA 1GPJA 4KLMA 4QZCA 4RPYA 4RPXA 4RQ0A 4O5KA 5DB6A 8ICHA 3ISCA 1MQ2A 1VJ7A 3OGUA 4RQ6A 2PFNA 9ICCA 1XSPA 3AQLA 4DOAA 5J0UA 4OAGA 4I28A 3UPSA 3OWGA 4UD5A 1ZJNA 2ZH4A 4I2FA 4XRHA 4X0AA 2BCRA 4X4PA 5J2HA 5D46A 4M9LA 4F5OA 4MF2A 1ZQNA 3JPOA 4WC4A
chains in the Genus database with same CATH topology
2B51A 4OAHA 1GPJA 2EWRA 5CFTA 3ERCC 2IHOA 4K97A 4O67A 4JLZA 4K9BA 3EF2A 4K99A 2GAFD 5D62A 5CHEA 4KB6A 4K96A 4LEZA 4LEWA 3MCRA 4K9AA 2GA9D 2B4VA 4LEVA 3ER9B 4OAIZ 4O69A 4OAGA 5B3QA 4LEYA 4K98A 3OWGA 4WQLA 5CFUA 5CFSA 4WQKA 2FCLA 3ER8C 4NXWA 4NXXA 3NKUA 4HX0A 4NXTA 4O6AA 5B3PA 4N7RA 3PHZA 4FO1A 4XJEA 4OAFA 4K8VA 4KM5A 3K7DA 4O68A 2B56A 5D61A 4MKPA 4WH5A 4JLXA 4WOYA 5D63A 4NXVA 4NXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO1 A;  4XJE A;  4WQL A;  5CFU A;  4WH5 A;  4WQK A;  2FCL A;  2EWR A;  5CFS A;  5CFT A;  4HX0 A; 
#chains in the Genus database with same CATH topology
 4NXZ A;  4E7X A;  1ZQW A;  5IIL A;  2ZH5 A;  4LZG A;  4M0A A;  3MGI A;  5J0X A;  4UB1 A;  1RZT A;  3B0X A;  4KB6 A;  4YMO A;  4LEW A;  9ICW A;  1BPZ A;  4KLF A;  2ZHA A;  5IIJ A;  5CFU A;  5CFS A;  2DVI A;  5B3P A;  3V7L A;  2ZH8 A;  5J2I A;  2RFF A;  5J2F A;  1BPY A;  5DED A;  1ZQZ A;  4AT9 A;  4AT8 B;  4P4O A;  2HN2 A;  4WC2 A;  4I2D A;  1V4A A;  4OAH A;  1NO5 A;  4TUP A;  2DR7 A;  4KLU A;  5IIO A;  4NLN A;  4X4S A;  4AT7 A;  1ZQL A;  1TFY A;  4I0U A;  4WC0 A;  1UET A;  8ICJ A;  3JYY A;  2BCQ A;  5CHE A;  4K96 A;  2O5A A;  3UXO A;  4E80 A;  4X0B A;  4O6A A;  8ICN A;  1Q78 A;  4QZ8 A;  4NKT A;  4KM5 A;  7ICL A;  3C18 A;  4Z6E A;  4PGQ A;  8ICG A;  5III A;  4RQ2 A;  4PH5 A;  3OVS A;  3UXN A;  3JPQ A;  1ZQT A;  9ICF A;  4NKU A;  3WFO A;  3EF2 A;  1BPX A;  8ICK A;  4FHW A;  3PNC A;  1ZQO A;  9ICA A;  4LEZ A;  3LK9 A;  9ICT A;  2ISO A;  1ZJM A;  2B4V A;  5DBA A;  2M2U A;  5J2K A;  4UB3 A;  4Z6C A;  2NRK A;  4TUS A;  4I29 A;  5J29 A;  3NKU A;  4HX0 A;  3OVB A;  2O1P A;  2PFQ A;  5HRI A;  4XJE A;  4PHD A;  4F5P A;  5IIN A;  4IQU A;  2BCV A;  2I9G A;  4YN4 A;  8ICL A;  8ICW A;  5J0W A;  4FH5 A;  4KLJ A;  3V7J A;  4K4G A;  1R8B A;  2EWR A;  3JZ0 A;  1XSN A;  4M9J A;  1TVA A;  4QZA A;  8ICZ A;  2M2V A;  5CHG A;  4QZG A;  1MIV A;  4AT9 B;  7ICU A;  2ZHB A;  4AT8 A;  2GA9 D;  4I2I A;  4QZD A;  8ICP A;  4FHX A;  1WOT A;  4I2E A;  3AQN A;  1UEV A;  3PHZ A;  4P4P A;  4M5D A;  2BCU A;  9ICS A;  5J2A A;  8ICM A;  4P2H A;  8ICV A;  3C66 A;  3TFR A;  1ZQJ A;  2DR5 A;  1ZQE A;  7ICP A;  2BPG A;  5J0Y A;  3B0Y A;  4KLO A;  4X4O A;  4PGY A;  1R89 A;  4KLL A;  4E8F A;  4YMN A;  4K4I A;  4GXI A;  4Z6F A;  1ZQC A;  3JPT A;  1R8A A;  2GWS A;  4UD4 A;  8ICY A;  2FMS A;  4NM1 A;  4I2H A;  4MFC A;  5F2V O;  1TV9 A;  1ZQB A;  7ICS A;  9ICQ A;  4NY8 A;  4NXT A;  5J0Q A;  1Q79 A;  5IIK A;  3K7D A;  4FHV A;  4F5Q A;  5B3Q A;  8ICO A;  4QZB A;  3HX0 A;  4M2Y A;  3RJG A;  4MFA A;  2VAN A;  3RH6 A;  4WC7 A;  4X4Q A;  2BPF A;  5J0T A;  4PGX A;  5HRE A;  4JWM A;  3NYB A;  2P66 A;  1MQ3 A;  1ZQM A;  9ICR A;  2ID1 A;  4O69 A;  5HRD A;  4M9G A;  1KNY A;  3RH4 A;  4KLI A;  1HUO A;  3AQM A;  3MBY A;  5J2D A;  3ER8 C;  9ICH A;  4NXW A;  1ZQU A;  9ICL A;  7ICH A;  3PMN A;  2DR9 A;  1FA0 A;  4KLQ A;  2HHP A;  4R65 A;  4JLX A;  4WBZ A;  5BPC A;  5IIM A;  4DO9 A;  4XQ8 A;  4RWQ A;  4FHP A;  2IUB A;  5HC9 A;  5CR0 A;  4KLS A;  4FHY A;  1ZQP A;  5D49 A;  1TFW A;  4EGW A;  4S3N A;  3NVO A;  4RT3 A;  3RJJ A;  5D62 A;  4RQ5 A;  4XUS A;  4OAI Z;  4R64 A;  4WC1 A;  4EEB A;  8ICF A;  3RJI A;  4PHA A;  5HRG A;  4DOB A;  3H37 A;  8ICU A;  4NM2 A;  1MIW A;  4KLE A;  4MKP A;  4WH5 A;  5JTG A;  9ICV A;  4K98 A;  3K75 D;  4YD1 A;  4RWP A;  1ZQI A;  4PHE A;  4NLZ A;  4YD2 A;  2BCS A;  3ISB A;  4K9A A;  1YLQ A;  1UEU A;  3GDX A;  4JWN A;  4YMM A;  5DEC A;  4GXJ A;  2FMP A;  5CJ7 A;  4RWO A;  4RT2 A;  3UXP A;  4RWN A;  5J0P A;  4RQ4 A;  1PX5 A;  4OAF A;  2FMQ A;  8ICR A;  4DOC A;  5EOZ A;  4EV6 A;  4NXV A;  4O5E A;  8ICX A;  8ICQ A;  4X4R A;  5HR9 A;  2DRB A;  4K9B A;  9ICU A;  1JN3 A;  1ZQA A;  4X4T A;  1KDH A;  3PML A;  1ZQV A;  4QZH A;  1R8C A;  2BBJ A;  5DBB A;  7ICK A;  2HN1 A;  7ICJ A;  4R66 A;  4WQK A;  8ICE A;  4XA5 A;  4UB2 A;  4FO1 A;  2M2W A;  1ZQY A;  1ZQD A;  2BPC A;  3UQ2 A;  1BPB A;  3AUO A;  4PPX A;  4LZD A;  2ISP A;  5DDM A;  5DB9 A;  3C2K A;  3ERC C;  3CK6 A;  1ZQX A;  3MGH A;  4F5N A;  4O67 A;  3ISD A;  3RJK A;  4RPZ A;  7ICI A;  2DR8 A;  5J0S A;  3L9D A;  3OUY A;  4MF8 A;  3HWT A;  5HRF A;  4WBY A;  7ICM A;  9ICB A;  1NOM A;  4O9M A;  4M04 A;  4UB4 A;  8ICA A;  2PXI A;  3V72 A;  4UAY A;  5CB1 A;  3C2M A;  2IHO A;  3H38 A;  4K97 A;  9ICN A;  4WC3 A;  4WCW A;  9ICP A;  1ZQS A;  5DB8 A;  5D4B A;  4UBB A;  4FO6 A;  2ZH3 A;  4RQ1 A;  4M9H A;  7ICO A;  1JAJ A;  4PHP A;  4WQL A;  4MFF A;  7ICV A;  1XSL A;  4KLD A;  4IG8 A;  2B56 A;  5J2J A;  4EED A;  3V7K A;  4GXK A;  4ATB B;  3OVA A;  4O5C A;  2DRA A;  8ICC A;  3HJ4 A;  5J2E A;  3TFS A;  7ICF A;  5CP2 A;  9ICK A;  5HHI A;  1HUZ A;  3H3A A;  4Z6D A;  5CA7 A;  4LEV A;  5BOL A;  4KLG A;  9ICE A;  3WFQ E;  3RH5 A;  5DDY A;  7ICR A;  2BBH A;  4YCX A;  4X4V A;  3H39 A;  8ICB A;  3AU2 A;  2IHM A;  4EBJ A;  3HIY A;  3RJE A;  5HHH A;  9ICX A;  3UQ0 A;  4K8V A;  3WFS C;  8ICS A;  3OUY B;  2W9M A;  4I2C A;  4X5V A;  4NXU A;  4KLT A;  7ICT A;  4I27 A;  5DKW A;  5CWR A;  9ICO A;  2ZH9 A;  4K4H A;  5CFT A;  4I2J A;  4UB5 A;  1ZQF A;  1RPL A;  4K99 A;  4IQV A;  5J2B A;  9ICJ A;  3WFP A;  4I2G A;  2ZH6 A;  2BE3 A;  5J2G A;  1VFG A;  4LEY A;  1MIY A;  4I2B A;  4LVS A;  3JPR A;  5BOM A;  3OV7 A;  1KEJ A;  2Q66 A;  4RQ7 A;  4WOY A;  3C2L A;  3JPP A;  4WC5 A;  3RJH A;  7ICG A;  7ICN A;  2B51 A;  3AQK A;  3HJ1 A;  5HRH A;  4TUR A;  5J0O A;  3JPN A;  3NWI A;  7ICE A;  1JMS A;  4P4M A;  2ZH7 A;  4TUQ A;  4RQ3 A;  4KLH A;  2PFP A;  4JLZ A;  2ZH2 A;  3C5G A;  8ICI A;  3MDA A;  3RJF A;  5HRB A;  4M47 A;  4FH3 A;  1JQR A;  4QZF A;  4QZE A;  4WC6 A;  4NLK A;  3C5F A;  1ZQH A;  4XQ7 A;  4EBK A;  4X4N A;  3WFR E;  4ATB A;  1BPE A;  3JCF A;  3MDC A;  2ZH1 A;  3HW8 A;  5DBC A;  5D63 A;  1ZQR A;  5TZV A;  5DB7 A;  2PBE A;  4QZI A;  4IQW A;  1ZQQ A;  4QZ9 A;  1ZQK A;  8ICT A;  5HRK A;  4X4U A;  5J0R A;  4F5R A;  2GAF D;  4UBC A;  4LT6 A;  3AU6 A;  1F5A A;  3MCR A;  4R63 A;  9ICM A;  4UAZ A;  3ER9 B;  7ICQ A;  4IQT A;  1BPD A;  2M2T A;  1OU5 A;  5J2C A;  1ZQG A;  2PFO A;  2FCL A;  4AT7 B;  3JPS A;  4I2A A;  9ICI A;  4NXX A;  4M9N A;  4N7R A;  4EP7 A;  4UAW A;  3LQC B;  4O68 A;  5D61 A;  9ICG A;  4RQ8 A;  3UPQ A;  5HRL A;  1GPJ A;  4KLM A;  4QZC A;  4RPY A;  4RPX A;  4RQ0 A;  4O5K A;  5DB6 A;  8ICH A;  3ISC A;  1MQ2 A;  1VJ7 A;  3OGU A;  4RQ6 A;  2PFN A;  9ICC A;  1XSP A;  3AQL A;  4DOA A;  5J0U A;  4OAG A;  4I28 A;  3UPS A;  3OWG A;  4UD5 A;  1ZJN A;  2ZH4 A;  4I2F A;  4XRH A;  4X0A A;  2BCR A;  4X4P A;  5J2H A;  5D46 A;  4M9L A;  4F5O A;  4MF2 A;  1ZQN A;  3JPO A;  4WC4 A; 
#chains in the Genus database with same CATH homology
 2B51 A;  4OAH A;  1GPJ A;  2EWR A;  5CFT A;  3ERC C;  2IHO A;  4K97 A;  4O67 A;  4JLZ A;  4K9B A;  3EF2 A;  4K99 A;  2GAF D;  5D62 A;  5CHE A;  4KB6 A;  4K96 A;  4LEZ A;  4LEW A;  3MCR A;  4K9A A;  2GA9 D;  2B4V A;  4LEV A;  3ER9 B;  4OAI Z;  4O69 A;  4OAG A;  5B3Q A;  4LEY A;  4K98 A;  3OWG A;  4WQL A;  5CFU A;  5CFS A;  4WQK A;  2FCL A;  3ER8 C;  4NXW A;  4NXX A;  3NKU A;  4HX0 A;  4NXT A;  4O6A A;  5B3P A;  4N7R A;  3PHZ A;  4FO1 A;  4XJE A;  4OAF A;  4K8V A;  4KM5 A;  3K7D A;  4O68 A;  2B56 A;  5D61 A;  4MKP A;  4WH5 A;  4JLX A;  4WOY A;  5D63 A;  4NXV A;  4NXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...