2FCLA

Crystal structure of a putative nucleotidyltransferase (tm1012) from thermotoga maritima at 1.35 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
142
Chain Sequence
MIRPEYLRVLRIYDRLNEVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIFSEFVSVRFSSTEICSHFGELIIDGIVEIMGDIRRLEDGTWEDPVDLNYRFVETHGMIPVLSLEYEYQAYLLGRVEAETLRWLNER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TM1012
publication title Crystal structure of hypothetical protein (tm1012) from Thermotoga maritima at 1.35 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 37
structure length 142
sequence length 156
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2fclA00
4FO1A 2FCLA 4XJEA 4WH5A 5CFTA 5CFUA 4WQLA 2EWRA 4WQKA 5CFSA 4HX0A
chains in the Genus database with same CATH superfamily
1BPEA 4YD2A 4QZIA 4RWPA 3C2KA 2ZH8A 3JCFA 3HJ4A 1NO5A 1ZQZA 3JPTA 4O67A 7ICEA 3L9DA 4UD4A 1ZQVA 3MDCA 4YD1A 5J0QA 7ICIA 4M5DA 4AT9B 4X4SA 4Z6CA 3PHZA 5HRBA 8ICSA 5CFUA 2DVIA 1Q78A 2B56A 4GXIA 8ICVA 3B0YA 4F5RA 4NM1A 4K97A 1JMSA 4O5KA 5J2AA 4I27A 3UXOA 4R66A 4I2AA 5HRIA 7ICFA 1F5AA 5IINA 4M9GA 4X5VA 3RJHA 1TV9A 8ICYA 3MGHA 5J2IA 4F5QA 1ZQSA 4OAGA 2I9GA 4K98A 1ZQPA 1ZQUA 5DDMA 4PPXA 9ICXA 5IIJA 2DR5A 4XJEA 5CHGA 5J0OA 4O5EA 5IIKA 3PMLA 2ZH3A 3HWTA 4LEVA 3RH5A 3C2LA 4X4VA 5DKWA 1UETA 4UAWA 4LZGA 1FA0A 3RH6A 4YMOA 4I28A 3V7LA 4AT8A 4PH5A 2B4VA 1BPDA 4WBZA 4UBCA 4WQKA 1ZQWA 4QZAA 1OU5A 3OVBA 4I2IA 5CHEA 4RT3A 3JPOA 4LT6A 7ICGA 1XSPA 4FH3A 4RPYA 5D49A 8ICEA 4WC1A 4X4OA 8ICKA 1TFWA 8ICMA 4M9NA 4QZCA 4GXKA 8ICGA 3AQLA 3JPQA 4NKTA 3C2MA 3OWGA 9ICFA 4NKUA 5DB9A 5J2JA 8ICUA 5HR9A 2IUBA 4UBBA 2PFPA 3JPSA 1GPJA 4FH5A 3RJIA 1MQ3A 1Q79A 4O68A 9ICOA 3HX0A 4NLKA 3JYYA 2BE3A 4WCWA 4PGYA 4R63A 5B3PA 7ICSA 4YCXA 4UAYA 1ZQAA 4PGXA 3ER9B 1PX5A 2B51A 5CJ7A 4Z6EA 1ZQQA 4UB5A 4LZDA 4NY8A 2FMPA 1UEVA 4HX0A 4EBJA 1MIVA 4YN4A 4NXWA 4FO6A 4RQ8A 5D46A 1ZQRA 5DB6A 5J0YA 4AT7B 2HN2A 4K9BA 5CA7A 4NXXA 4FHYA 4IG8A 5HC9A 1RZTA 4X4NA 4X4PA 4O6AA 1ZQYA 3OUYB 4RQ1A 4M47A 4FHWA 1ZQTA 3MDAA 2BCSA 3LK9A 2ZHBA 2GAFD 8ICNA 4KLGA 4I2HA 2GA9D 5TZVA 5J2BA 7ICLA 1MIWA 4WC4A 2BBJA 5IIOA 4TUSA 1ZQOA 2ISPA 4KLJA 4O69A 4EV6A 9ICRA 4WC2A 5DB7A 4DOCA 5HRKA 4YMMA 3JPRA 9ICPA 2DR9A 2PFOA 3OVAA 3JPPA 4QZ9A 2O1PA 2M2WA 4I2FA 3CK6A 1R8CA 3PMNA 4KLQA 2HN1A 4GXJA 4S3NA 2HHPA 3RJGA 9ICUA 2ID1A 7ICPA 5J2EA 5J2DA 3AUOA 1BPBA 3OVSA 1V4AA 8ICWA 9ICNA 2M2UA 4QZGA 9ICLA 5J2GA 4NXUA 1ZQDA 4X4QA 9ICVA 4TURA 8ICCA 4P2HA 1NOMA 4WC0A 3UXNA 8ICOA 4N7RA 5CWRA 1ZQHA 4KLOA 2BCVA 4P4OA 7ICOA 5DECA 4KLTA 7ICHA 4KLLA 5J29A 9ICJA 4PHEA 4X0BA 4ATBA 4FHPA 4RQ6A 3WFOA 7ICUA 4RWQA 5J0WA 4FO1A 3MBYA 4X4RA 1KDHA 4AT8B 3NYBA 5CFTA 1BPZA 5D62A 4MKPA 3V7JA 3UQ2A 4KLSA 4Z6FA 7ICMA 4QZ8A 4NLZA 4DO9A 5IILA 4XA5A 4K96A 3RJEA 3RJFA 3AU2A 1RPLA 1XSNA 4OAHA 3C5FA 3H38A 1HUZA 5DBBA 8ICFA 4RQ3A 1ZQIA 5J2HA 1TFYA 4QZEA 4YMNA 4EEBA 4X0AA 4WC6A 1JQRA 4K9AA 2BPFA 4I2DA 5DBCA 2DRAA 4K4IA 1XSLA 4IQWA 1R89A 4IQUA 1VJ7A 2FCLA 4NM2A 2ZH2A 3PNCA 4KM5A 4RPZA 9ICBA 5DEDA 8ICHA 3C18A 8ICLA 4RT2A 1UEUA 4JWNA 5HRDA 1KNYA 4LEZA 4KLMA 3EF2A 4UB3A 7ICQA 4KLHA 4QZFA 3AU6A 2FMQA 8ICBA 4RWNA 2ZHAA 9ICEA 1ZQLA 4XQ8A 4KLUA 3B0XA 4EEDA 4F5NA 1ZQEA 9ICSA 3C66A 4I2GA 4R64A 4IQVA 1JN3A 1HUOA 4M0AA 5F2VO 4UB4A 1YLQA 4WOYA 3GDXA 7ICVA 4UAZA 4PHAA 4RQ0A 4M9LA 4P4MA 7ICRA 4I2JA 5J2CA 4X4TA 3OGUA 1ZQMA 5J0SA 4LEYA 2VANA 3NWIA 4WQLA 5HRLA 5DBAA 5J0TA 4LVSA 4QZHA 2M2VA 4MFCA 4WC7A 3WFSC 3V72A 4NXVA 4TUPA 1ZQXA 4M9JA 1R8BA 8ICAA 3H39A 1ZQFA 3JZ0A 3WFQE 4M2YA 4IQTA 4TUQA 4UB1A 2O5AA 4I2EA 2RFFA 4RPXA 3ISBA 3OV7A 4PHPA 4UD5A 4PHDA 9ICAA 3ER8C 3TFSA 4AT9A 4PGQA 4FHXA 4M9HA 1ZQKA 5HRGA 5J0UA 2FMSA 5J0PA 3JPNA 4I2BA 2BCUA 1MIYA 3RH4A 4O9MA 4F5OA 3WFPA 4NLNA 4DOAA 5DDYA 4KLFA 5CP2A 4O5CA 4KLEA 1ZQGA 9ICQA 4NXTA 5JTGA 5BOLA 2BBHA 4K4HA 9ICKA 2ZH7A 4LEWA 3C5GA 4UB2A 2BCRA 1ZQCA 4MFFA 2Q66A 3K75D 1R8AA 3HW8A 2ZH5A 4XRHA 8ICQA 9ICMA 3NKUA 5DB8A 4ATBB 2PFNA 3ERCC 4QZDA 4DOBA 3RJKA 5J2FA 1TVAA 8ICRA 2ZH9A 5J0XA 7ICJA 1ZQNA 7ICNA 2ZH1A 5HHIA 8ICPA 3H3AA 3AQKA 3LQCB 4RQ4A 2BPGA 2EWRA 4WC5A 3ISCA 4RQ7A 5HRHA 1WOTA 1JAJA 4I0UA 5IIIA 2BPCA 4EP7A 4F5PA 3NVOA 5EOZA 5D4BA 2BCQA 7ICTA 8ICZA 2PBEA 2W9MA 4XUSA 5BPCA 4NXZA 4MFAA 9ICIA 5CR0A 2PXIA 1KEJA 3AQMA 4XQ7A 3H37A 7ICKA 4Z6DA 4EBKA 4P4PA 1ZJNA 2IHMA 3HJ1A 2ZH6A 2IHOA 3WFRE 9ICHA 2M2TA 3RJJA 4FHVA 3K7DA 5D63A 4KLDA 2ISOA 1BPXA 2PFQA 4E8FA 5CB1A 4WC3A 9ICCA 1BPYA 3UPQA 3UQ0A 4I29A 4WH5A 4QZBA 4MF8A 3TFRA 4EGWA 3HIYA 1ZJMA 8ICIA 4X4UA 5J0RA 5HREA 4K8VA 3ISDA 5B3QA 3MGIA 2DRBA 2GWSA 1ZQJA 4I2CA 9ICTA 2NRKA 2DR8A 4KLIA 4E7XA 4AT7A 4RQ5A 4MF2A 5BOMA 4KB6A 3V7KA 5IIMA 5D61A 5HRFA 4M04A 4JLXA 3UPSA 4K99A 4JWMA 4K4GA 3OUYA 9ICWA 4OAFA 4JLZA 1VFGA 2P66A 4OAIZ 4RWOA 3MCRA 5J2KA 4R65A 3UXPA 2DR7A 1ZQBA 2ZH4A 4WBYA 8ICJA 8ICTA 5HHHA 1MQ2A 9ICGA 8ICXA 4E80A 5CFSA 3AQNA 4RQ2A
chains in the Genus database with same CATH topology
4LEZA 3EF2A 4LEYA 1GPJA 4LEWA 4NXWA 2GA9D 2B4VA 4WQLA 4O68A 4KB6A 4WQKA 3ER8C 4K9AA 4FO1A 4O67A 4O69A 5D61A 5CHEA 4OAGA 4WH5A 4JLXA 5CFTA 5D62A 4MKPA 3NKUA 5B3PA 4NXVA 4K98A 4K9BA 4K99A 3ERCC 4NXUA 4OAFA 4JLZA 3ER9B 2FCLA 4NXXA 4K8VA 4XJEA 3PHZA 4OAIZ 2B51A 5B3QA 2GAFD 4KM5A 4WOYA 5CFUA 2B56A 3MCRA 4O6AA 4K96A 4LEVA 4K97A 4NXTA 3OWGA 4N7RA 2IHOA 2EWRA 4OAHA 5CFSA 4HX0A 5D63A 3K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO1 A;  2FCL A;  4XJE A;  4WH5 A;  5CFT A;  5CFU A;  4WQL A;  2EWR A;  4WQK A;  5CFS A;  4HX0 A; 
#chains in the Genus database with same CATH topology
 1BPE A;  4YD2 A;  4QZI A;  4RWP A;  3C2K A;  2ZH8 A;  3JCF A;  3HJ4 A;  1NO5 A;  1ZQZ A;  3JPT A;  4O67 A;  7ICE A;  3L9D A;  4UD4 A;  1ZQV A;  3MDC A;  4YD1 A;  5J0Q A;  7ICI A;  4M5D A;  4AT9 B;  4X4S A;  4Z6C A;  3PHZ A;  5HRB A;  8ICS A;  5CFU A;  2DVI A;  1Q78 A;  2B56 A;  4GXI A;  8ICV A;  3B0Y A;  4F5R A;  4NM1 A;  4K97 A;  1JMS A;  4O5K A;  5J2A A;  4I27 A;  3UXO A;  4R66 A;  4I2A A;  5HRI A;  7ICF A;  1F5A A;  5IIN A;  4M9G A;  4X5V A;  3RJH A;  1TV9 A;  8ICY A;  3MGH A;  5J2I A;  4F5Q A;  1ZQS A;  4OAG A;  2I9G A;  4K98 A;  1ZQP A;  1ZQU A;  5DDM A;  4PPX A;  9ICX A;  5IIJ A;  2DR5 A;  4XJE A;  5CHG A;  5J0O A;  4O5E A;  5IIK A;  3PML A;  2ZH3 A;  3HWT A;  4LEV A;  3RH5 A;  3C2L A;  4X4V A;  5DKW A;  1UET A;  4UAW A;  4LZG A;  1FA0 A;  3RH6 A;  4YMO A;  4I28 A;  3V7L A;  4AT8 A;  4PH5 A;  2B4V A;  1BPD A;  4WBZ A;  4UBC A;  4WQK A;  1ZQW A;  4QZA A;  1OU5 A;  3OVB A;  4I2I A;  5CHE A;  4RT3 A;  3JPO A;  4LT6 A;  7ICG A;  1XSP A;  4FH3 A;  4RPY A;  5D49 A;  8ICE A;  4WC1 A;  4X4O A;  8ICK A;  1TFW A;  8ICM A;  4M9N A;  4QZC A;  4GXK A;  8ICG A;  3AQL A;  3JPQ A;  4NKT A;  3C2M A;  3OWG A;  9ICF A;  4NKU A;  5DB9 A;  5J2J A;  8ICU A;  5HR9 A;  2IUB A;  4UBB A;  2PFP A;  3JPS A;  1GPJ A;  4FH5 A;  3RJI A;  1MQ3 A;  1Q79 A;  4O68 A;  9ICO A;  3HX0 A;  4NLK A;  3JYY A;  2BE3 A;  4WCW A;  4PGY A;  4R63 A;  5B3P A;  7ICS A;  4YCX A;  4UAY A;  1ZQA A;  4PGX A;  3ER9 B;  1PX5 A;  2B51 A;  5CJ7 A;  4Z6E A;  1ZQQ A;  4UB5 A;  4LZD A;  4NY8 A;  2FMP A;  1UEV A;  4HX0 A;  4EBJ A;  1MIV A;  4YN4 A;  4NXW A;  4FO6 A;  4RQ8 A;  5D46 A;  1ZQR A;  5DB6 A;  5J0Y A;  4AT7 B;  2HN2 A;  4K9B A;  5CA7 A;  4NXX A;  4FHY A;  4IG8 A;  5HC9 A;  1RZT A;  4X4N A;  4X4P A;  4O6A A;  1ZQY A;  3OUY B;  4RQ1 A;  4M47 A;  4FHW A;  1ZQT A;  3MDA A;  2BCS A;  3LK9 A;  2ZHB A;  2GAF D;  8ICN A;  4KLG A;  4I2H A;  2GA9 D;  5TZV A;  5J2B A;  7ICL A;  1MIW A;  4WC4 A;  2BBJ A;  5IIO A;  4TUS A;  1ZQO A;  2ISP A;  4KLJ A;  4O69 A;  4EV6 A;  9ICR A;  4WC2 A;  5DB7 A;  4DOC A;  5HRK A;  4YMM A;  3JPR A;  9ICP A;  2DR9 A;  2PFO A;  3OVA A;  3JPP A;  4QZ9 A;  2O1P A;  2M2W A;  4I2F A;  3CK6 A;  1R8C A;  3PMN A;  4KLQ A;  2HN1 A;  4GXJ A;  4S3N A;  2HHP A;  3RJG A;  9ICU A;  2ID1 A;  7ICP A;  5J2E A;  5J2D A;  3AUO A;  1BPB A;  3OVS A;  1V4A A;  8ICW A;  9ICN A;  2M2U A;  4QZG A;  9ICL A;  5J2G A;  4NXU A;  1ZQD A;  4X4Q A;  9ICV A;  4TUR A;  8ICC A;  4P2H A;  1NOM A;  4WC0 A;  3UXN A;  8ICO A;  4N7R A;  5CWR A;  1ZQH A;  4KLO A;  2BCV A;  4P4O A;  7ICO A;  5DEC A;  4KLT A;  7ICH A;  4KLL A;  5J29 A;  9ICJ A;  4PHE A;  4X0B A;  4ATB A;  4FHP A;  4RQ6 A;  3WFO A;  7ICU A;  4RWQ A;  5J0W A;  4FO1 A;  3MBY A;  4X4R A;  1KDH A;  4AT8 B;  3NYB A;  5CFT A;  1BPZ A;  5D62 A;  4MKP A;  3V7J A;  3UQ2 A;  4KLS A;  4Z6F A;  7ICM A;  4QZ8 A;  4NLZ A;  4DO9 A;  5IIL A;  4XA5 A;  4K96 A;  3RJE A;  3RJF A;  3AU2 A;  1RPL A;  1XSN A;  4OAH A;  3C5F A;  3H38 A;  1HUZ A;  5DBB A;  8ICF A;  4RQ3 A;  1ZQI A;  5J2H A;  1TFY A;  4QZE A;  4YMN A;  4EEB A;  4X0A A;  4WC6 A;  1JQR A;  4K9A A;  2BPF A;  4I2D A;  5DBC A;  2DRA A;  4K4I A;  1XSL A;  4IQW A;  1R89 A;  4IQU A;  1VJ7 A;  2FCL A;  4NM2 A;  2ZH2 A;  3PNC A;  4KM5 A;  4RPZ A;  9ICB A;  5DED A;  8ICH A;  3C18 A;  8ICL A;  4RT2 A;  1UEU A;  4JWN A;  5HRD A;  1KNY A;  4LEZ A;  4KLM A;  3EF2 A;  4UB3 A;  7ICQ A;  4KLH A;  4QZF A;  3AU6 A;  2FMQ A;  8ICB A;  4RWN A;  2ZHA A;  9ICE A;  1ZQL A;  4XQ8 A;  4KLU A;  3B0X A;  4EED A;  4F5N A;  1ZQE A;  9ICS A;  3C66 A;  4I2G A;  4R64 A;  4IQV A;  1JN3 A;  1HUO A;  4M0A A;  5F2V O;  4UB4 A;  1YLQ A;  4WOY A;  3GDX A;  7ICV A;  4UAZ A;  4PHA A;  4RQ0 A;  4M9L A;  4P4M A;  7ICR A;  4I2J A;  5J2C A;  4X4T A;  3OGU A;  1ZQM A;  5J0S A;  4LEY A;  2VAN A;  3NWI A;  4WQL A;  5HRL A;  5DBA A;  5J0T A;  4LVS A;  4QZH A;  2M2V A;  4MFC A;  4WC7 A;  3WFS C;  3V72 A;  4NXV A;  4TUP A;  1ZQX A;  4M9J A;  1R8B A;  8ICA A;  3H39 A;  1ZQF A;  3JZ0 A;  3WFQ E;  4M2Y A;  4IQT A;  4TUQ A;  4UB1 A;  2O5A A;  4I2E A;  2RFF A;  4RPX A;  3ISB A;  3OV7 A;  4PHP A;  4UD5 A;  4PHD A;  9ICA A;  3ER8 C;  3TFS A;  4AT9 A;  4PGQ A;  4FHX A;  4M9H A;  1ZQK A;  5HRG A;  5J0U A;  2FMS A;  5J0P A;  3JPN A;  4I2B A;  2BCU A;  1MIY A;  3RH4 A;  4O9M A;  4F5O A;  3WFP A;  4NLN A;  4DOA A;  5DDY A;  4KLF A;  5CP2 A;  4O5C A;  4KLE A;  1ZQG A;  9ICQ A;  4NXT A;  5JTG A;  5BOL A;  2BBH A;  4K4H A;  9ICK A;  2ZH7 A;  4LEW A;  3C5G A;  4UB2 A;  2BCR A;  1ZQC A;  4MFF A;  2Q66 A;  3K75 D;  1R8A A;  3HW8 A;  2ZH5 A;  4XRH A;  8ICQ A;  9ICM A;  3NKU A;  5DB8 A;  4ATB B;  2PFN A;  3ERC C;  4QZD A;  4DOB A;  3RJK A;  5J2F A;  1TVA A;  8ICR A;  2ZH9 A;  5J0X A;  7ICJ A;  1ZQN A;  7ICN A;  2ZH1 A;  5HHI A;  8ICP A;  3H3A A;  3AQK A;  3LQC B;  4RQ4 A;  2BPG A;  2EWR A;  4WC5 A;  3ISC A;  4RQ7 A;  5HRH A;  1WOT A;  1JAJ A;  4I0U A;  5III A;  2BPC A;  4EP7 A;  4F5P A;  3NVO A;  5EOZ A;  5D4B A;  2BCQ A;  7ICT A;  8ICZ A;  2PBE A;  2W9M A;  4XUS A;  5BPC A;  4NXZ A;  4MFA A;  9ICI A;  5CR0 A;  2PXI A;  1KEJ A;  3AQM A;  4XQ7 A;  3H37 A;  7ICK A;  4Z6D A;  4EBK A;  4P4P A;  1ZJN A;  2IHM A;  3HJ1 A;  2ZH6 A;  2IHO A;  3WFR E;  9ICH A;  2M2T A;  3RJJ A;  4FHV A;  3K7D A;  5D63 A;  4KLD A;  2ISO A;  1BPX A;  2PFQ A;  4E8F A;  5CB1 A;  4WC3 A;  9ICC A;  1BPY A;  3UPQ A;  3UQ0 A;  4I29 A;  4WH5 A;  4QZB A;  4MF8 A;  3TFR A;  4EGW A;  3HIY A;  1ZJM A;  8ICI A;  4X4U A;  5J0R A;  5HRE A;  4K8V A;  3ISD A;  5B3Q A;  3MGI A;  2DRB A;  2GWS A;  1ZQJ A;  4I2C A;  9ICT A;  2NRK A;  2DR8 A;  4KLI A;  4E7X A;  4AT7 A;  4RQ5 A;  4MF2 A;  5BOM A;  4KB6 A;  3V7K A;  5IIM A;  5D61 A;  5HRF A;  4M04 A;  4JLX A;  3UPS A;  4K99 A;  4JWM A;  4K4G A;  3OUY A;  9ICW A;  4OAF A;  4JLZ A;  1VFG A;  2P66 A;  4OAI Z;  4RWO A;  3MCR A;  5J2K A;  4R65 A;  3UXP A;  2DR7 A;  1ZQB A;  2ZH4 A;  4WBY A;  8ICJ A;  8ICT A;  5HHH A;  1MQ2 A;  9ICG A;  8ICX A;  4E80 A;  5CFS A;  3AQN A;  4RQ2 A; 
#chains in the Genus database with same CATH homology
 4LEZ A;  3EF2 A;  4LEY A;  1GPJ A;  4LEW A;  4NXW A;  2GA9 D;  2B4V A;  4WQL A;  4O68 A;  4KB6 A;  4WQK A;  3ER8 C;  4K9A A;  4FO1 A;  4O67 A;  4O69 A;  5D61 A;  5CHE A;  4OAG A;  4WH5 A;  4JLX A;  5CFT A;  5D62 A;  4MKP A;  3NKU A;  5B3P A;  4NXV A;  4K98 A;  4K9B A;  4K99 A;  3ERC C;  4NXU A;  4OAF A;  4JLZ A;  3ER9 B;  2FCL A;  4NXX A;  4K8V A;  4XJE A;  3PHZ A;  4OAI Z;  2B51 A;  5B3Q A;  2GAF D;  4KM5 A;  4WOY A;  5CFU A;  2B56 A;  3MCR A;  4O6A A;  4K96 A;  4LEV A;  4K97 A;  4NXT A;  3OWG A;  4N7R A;  2IHO A;  2EWR A;  4OAH A;  5CFS A;  4HX0 A;  5D63 A;  3K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...