2FCWB

Structure of a complex between the pair of the ldl receptor ligand-binding modules 3-4 and the receptor associated protein (rap).
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
KTCSQAEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an LDLR-RAP Complex Reveals a General Mode for Ligand Recognition by Lipoprotein Receptors
pubmed doi rcsb
molecule keywords Alpha-2-macroglobulin receptor-associated protein
molecule tags Lipid transport/endocytosis/chaperone
source organism Homo sapiens
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2fcwB02
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2fcwB01
2I1PA 2M7PA 1LDLA 1J8EA 2FCWB 2FYLB 2LGPA 2M0PA 2KNXA 2JM4A 1D2JA 1N7DA 1JRFA 1LDRA 2KNYA 1CR8A 2M96A 2FYJA 1K7BA 1F5YA 1D2LA 1XFEA
chains in the Genus database with same CATH superfamily
2I1PA 2M7PA 1LDLA 1J8EA 2FCWB 2FYLB 2LGPA 2M0PA 2KNXA 2JM4A 1D2JA 1N7DA 1JRFA 1LDRA 2KNYA 1CR8A 2M96A 2FYJA 1K7BA 1F5YA 1D2LA 1XFEA
chains in the Genus database with same CATH topology
2I1PA 2M7PA 1LDLA 1J8EA 2FCWB 2FYLB 2LGPA 2M0PA 2KNXA 2JM4A 1D2JA 1N7DA 1JRFA 1LDRA 2KNYA 1CR8A 2M96A 2FYJA 1K7BA 1F5YA 1D2LA 1XFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1P A;  2M7P A;  1LDL A;  1J8E A;  2FCW B;  2FYL B;  2LGP A;  2M0P A;  2KNX A;  2JM4 A;  1D2J A;  1N7D A;  1JRF A;  1LDR A;  2KNY A;  1CR8 A;  2M96 A;  2FYJ A;  1K7B A;  1F5Y A;  1D2L A;  1XFE A; 
#chains in the Genus database with same CATH topology
 2I1P A;  2M7P A;  1LDL A;  1J8E A;  2FCW B;  2FYL B;  2LGP A;  2M0P A;  2KNX A;  2JM4 A;  1D2J A;  1N7D A;  1JRF A;  1LDR A;  2KNY A;  1CR8 A;  2M96 A;  2FYJ A;  1K7B A;  1F5Y A;  1D2L A;  1XFE A; 
#chains in the Genus database with same CATH homology
 2I1P A;  2M7P A;  1LDL A;  1J8E A;  2FCW B;  2FYL B;  2LGP A;  2M0P A;  2KNX A;  2JM4 A;  1D2J A;  1N7D A;  1JRF A;  1LDR A;  2KNY A;  1CR8 A;  2M96 A;  2FYJ A;  1K7B A;  1F5Y A;  1D2L A;  1XFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...