2FD5A

The crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
180
structure length
180
Chain Sequence
MSDKKTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEAFEQLLGKRRELLGELDPGLSGKERRALAAAFYLSRKHRDAQVDAGCPLPATLAEVARLPEGFREVLSRHVEIMVTSLAESPEETDVALADLVLMIGGLALARALGPGELSDRVLRAAKQAVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator
publication title The crystal structure of a transcriptional regulator from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
total genus 71
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2fd5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fd5A02
2DA5A 1JUMA 2VUMJ 2CRGA 5HBUA 3BT9A 2R5YA 1IJWC 3HE0A 2D6YA 3G1OA 2WAQN 2QOPA 5IP6A 1JKRC 1NK3P 3GZIA 2EZKA 4M3FA 4GCTA 3BTLA 2XSDC 3B81A 1TWFJ 2E2JJ 2DMUA 2ID6A 3BTIA 5IYCJ 1ZKGA 3VP5A 2IBDA 5EDNA 4D7NA 2OF7A 1HF0A 1RKTA 1MBGA 3SDGA 1APLC 4JX5A 9ANTA 4MFEA 3S16J 5E3MA 2NVXJ 1ZTRA 1X2MA 5K7HA 3M4OJ 3JRBA 5F0CA 3VVXA 1Z0XA 3LSJA 1MSFC 1RESA 5E3LA 2FBQA 5F08A 1FIPA 3IH2A 4QSHA 3G7RA 3TP0A 2EQRA 1JKPC 1GDTA 1WI3A 5GP9A 2NP3A 2HQ5A 5EYRA 4C3IJ 2DA6A 1ETYA 5EF6A 1X58A 3NAUA 2QWTA 2AO9A 3QBMA 3PPBA 2CQXA 2NVYJ 2OI8A 4FCYA 2ZOZA 1I3QJ 3BHQA 5FJ8J 2X6OA 3HTJA 3JRCA 3CDLA 5FGLA 3GTOJ 2GFNA 3LWJA 3IV5A 3BG5A 4UUTA 4X1EA 4A3FJ 2ECCA 1A6IA 2N8GA 5J1UA 4XRSG 5M3FJ 2W53A 1ORKA 5FKKA 4B3AA 4GCLA 1UHSA 5CW8A 5CXIA 2H1KA 3S15J 2FJ1A 3HGYA 4GFBA 3HOUJ 2UXHA 1ZR4A 2OERA 4DW6A 2XGCA 1JKQC 4M3GA 3T6NA 2Y31A 3DCFA 1ETKA 3ZQCA 4AYBN 2L7MP 3E7LA 2VPRA 1WPKA 2HXOA 3A01B 3CMYA 3K2AA 3HOVJ 3BQYA 4M6VA 4I6ZA 5D1RA 3A01A 1MBEA 2HXIA 3EUPA 2UXIA 3NARA 3ZOBA 1MBFA 1SANA 2M8GX 4MO7A 3HOZJ 2O8KA 2DJNA 3A02A 1JT0A 1UI6A 4IHVA 5K58A 4G12A 5GPAA 3ZQHA 1Y1WJ 3VW2A 5HAWA 3CQZJ 2ME6A 4LOCA 2X9DA 3G1LA 3PM1A 3BRUA 3K7AJ 3KKCA 3FISA 2GBYA 1WGXA 1LE8B 2P81A 3VOKA 2MG4A 3V6GA 1JUPA 3BR0A 1LE8A 3IH3A 1LFUP 5J3LA 2RASA 1ENHA 3O8HA 3S1NJ 4ICHA 1XC5A 2FQ4A 3OIOA 2KDZA 5F27A 3TW7A 2JA5J 3S5RA 1UG2A 4JL3A 3NRGA 1TWAJ 2NVTJ 1VFCA 3M3YJ 3C07A 3KNWA 2MGQA 4UDSA 2CU7A 1BJZA 1X2NA 3BQZA 2TCTA 4M3DA 5EG0B 3JRIA 4AF5A 4B1RA 4A3MJ 2DA4A 1U78A 5E3OA 2LLKA 2Y2ZA 4JP0A 5EG0A 2O9LA 2I10A 2IEKA 4A93J 1WCMJ 5J1YA 2ZOYA 2GM4A 3ON2A 1RKWA 4C3JJ 1CQTA 3JR9A 1U8BA 2PZ9A 2Y30A 3BJBA 3GTKJ 2ID3A 4BY7J 4UUSB 1XS9A 1MNMC 3BTCA 2R7ZJ 3LHQA 4UUSA 2LP0A 3L1PA 1ZGWA 2X48A 2CQQA 2G7GA 2E19A 2QIBA 5EEAA 5M5WJ 2LKXA 2WV1A 1FJLA 2B63J 3Q3SA 2L7FP 3IH4A 3HGGA 5JLWA 2R5ZA 3OSGA 3FK7A 3NI7A 1QVTA 3NXCA 5BNGA 3HDDA 1PUFB 2VKVA 4XIDA 3VPRA 3NNRA 3S1RJ 4IEJA 1JTYA 1PUFA 5DTDA 4A3EJ 1BL0A 3DEWA 3Q0WA 2YU9J 4AC0A 3DPJA 4L62A 3CCYA 4AC6A 2DTZA 4MIMA 3W6VA 3BTJA 4NN1A 5K7ZA 1BW6A 1VI0A 2K40A 2COBA 2M34A 4XICA 3RD3A 2L7ZA 3NPIA 2HOTA 5E3NA 3MNLA 2JA8J 3GEUA 4PXIA 2YVHA 1POGA 3HBLA 3B6AA 5IOYA 1K61A 5C4XJ 2DMQA 4MFDA 5F1JA 1HLVA 1OJLA 2ZCMA 1AU7A 4BY1J 2NVQJ 4A3IJ 5HSZA 5IOZA 2Y9YA 2XB0X 4IHWA 2EH3A 2K9QA 2DA2A 1H88C 2DA7A 5IYBJ 3WHCA 3ZQIA 2WB1N 1HDDC 3GTGJ 2HOAA 1IDZA 1ETWA 1ZQ3P 3VW0A 2R92J 3VOXA 2HOSA 2XPUA 5M3MJ 4D5CA 2LFBA 1HDPA 3FKIJ 4FISA 5C4JJ 2XRLA 2GENA 1I50J 1U9NA 3RQIA 3LJLA 4MK6A 4YZEA 3LOCA 5J1RA 1ZR2A 2JMWA 2GUHA 3VIBA 2IU5A 3ON4A 4KWAA 1FTTA 4B4CA 1GV2A 3F1BA 3AQTA 4XRMA 1JJ8C 1GV5A 1W0UA 1WH5A 5FKLA 3SFIA 3ZQGA 5FKOA 5FKMA 1AKHB 4BBSJ 1OCPA 1WH7A 2NS7A 5C3EJ 3KKDA 3G1MA 3HM5A 1AKHA 1TWGJ 1IV6A 3S1MJ 1ZK8A 2VI6A 1TWHJ 2Y0SN 5F0HA 3H3VK 4XK4A 4RDUA 2FD5A 2ELKA 5EZHA 1GUUA 1B8IA 4CYCB 3OSFA 1B72A 4XRSA 2KT0A 1K83J 2WGBA 4DYRA 2LK2A 1Q1VA 4CYCA 3GTJJ 3SJMA 3UKGA 4W1UA 2YVEA 2OPTA 2M9HA 1EF4A 4GFLA 2UXUA 4DYCA 3S2HJ 3BCGA 2NS8A 3B6CA 4I76A 2E1OA 1OFCX 1P7JA 3BR2A 4JX6A 4JX4A 2DA3A 2W48A 2K9SA 2R93J 2M2EA 1UMQA 4L5EA 5F04A 2HKUA 1IDYA 2IAIA 3A03A 2H8RA 2JA7J 3MN2A 4A3BJ 4MXMA 3HIMA 2YS9A 3Q0VA 1DU0A 2FX0A 2LTPA 1OCTC 3ZQLA 1MH3A 1QRYA 3O8GA 2PBXA 2Q24A 1ITYA 3VUQA 3HOWJ 2JWTA 5HODA 5C4YA 3P9TA 2DMNA 2O7OA 1GT0C 3HKZN 2GLOA 3AQSA 2DG8A 2ZB9A 3TP3A 5JLXA 2NX4A 2K9NA 3JREA 3G56A 4MLOA 4CGRA 3S14J 5DAJA 2DMPA 2ZCNA 4Y7NJ 1NK2P 2CUEA 3LSRA 1R9TJ 2V57A 2ZCXA 2G7SA 2G3BA 2HYJA 3PO2J 5DS9A 1ETVA 4QIWN 3ANPA 3S1QJ 4A3DJ 5GPCA 1FTZA 2XDNA 2REKA 3VVYA 3GTLJ 3PO3J 1JTXA 3LSGA 4AUXA 2DN0A 5EGOB 1SFOJ 1RR7A 2LVSA 2R0QC 1A5JA 3JSJA 5FHPA 1XG1A 5IYDJ 4C3HJ 5EGOA 5M5YJ 1FEXA 1O4XA 1MBJA 4FE7A 5IPAA 4V2GA 3LSPA 1MH4A 2JN6A 2JA6J 1HOMA 3COLA 4C2MJ 3FRQA 2XGEA 1P7IA 2EZIA 1SGMA 2EZHA 2LR8A 3S17J 2QTQA 1ETOA 1JKOC 3I4NJ 2HDDA 3BR3A 1G2HA 2XGDA 3VVZA 4GCKA 4GFKA 4ME9A 2ME0A 2LD5A 2QKOA 4D5FA 3ZQFA 3GTQJ 5EZGA 4QTRA 5C44J 4JNNA 4A3KJ 4NDLA 2WUIA 1IUFA 3EGQA 1TWCJ 2UXPA 2L0KA 2DMTA 2DG7A 4DYQA 1RPWA 3QQAA 2Y9ZA 3HOXJ 2D5VA 4W97A 3I4MJ 3FK6A 2JJ7A 1IG7A 1NTCA 2XB5A 1RETA 4J19A 1QPIA 3HOYJ 3CRJA 1MBKA 5M5XJ 1HCRA 3MKLA 3BR6A 2NP5A 3HTIA 1IGNA 2QF7A 1T56A 2ECBA 1JGGA 3ANGA 3HTHA 4JKZA 3RZDJ 3IUVA 2LY9A 2HYTA 1JT6A 1H8AC 5FKNA 1GVDA 2YUSA 3H0GJ 5K7FA 2UXOA 1Z77A 3HEFA 1JJ6C 2E2HJ 3CWRA 3FIWA 1D5YA 2HI3A 4S0HB 3HTAA 4NELA 1BA5A 3V78A 4A69C 4ACIA 1JUSA 1W0TA 2MSYA 3BG3A 1UI5A 1ETXA 2XPWA 4DZJA 3S2DJ 1B8IB 1MBHA 5IP9J 3PASA 1ETQA 1IRZA 5FMPA 3JRFA 1B72B 3E7QA 4HKUA 1LFBA 5AQCA 2G0EA 3RKQA 4JYKA 3BR5A 5EFYA 4EEFG 4BKXA 3QKXA 3WHBA 3BG9A 4Y52J 2QCOA 4IHYA 2XPVA 3C2BA 4M3BA 2EBIA 1TC3C 1S7EA 2CJJA 5F0FA 2MW8A 5FLMJ 3JRAA 5FLVA 3GTMJ 1YRNB 3GTPJ 1VF9A 3TW6A 1IC8A 3LNQA 4RBOA 2JK3A 1YRNA 1QVUA 5D19A 2RAEA 1F36A 3D1NI 5IP7J 2RHAA 3TEDA 1Y1VJ 2CUFA 3QPSA 4M3EA 3GBGA 2M0CA 4V2FA 3RH2A 2PMZN 3KZ9A 2L9RA 1H89C 2TRTA 3Q0UA 3O60A 4FTHA 3VW1A 1E3OC 3HB9A 4A3CJ 3BR1A 4BXXJ 1FIAA 1AHDP 1BW5A 5H9TA 4IHXA 3BNIA 3JRDA 2DA1A 3OOUA 2NOGA 1T33A 2G7LA 5D18A 1VNDA 2E2IJ 4A3LJ 4D7MA 4A3GJ 4X6AJ 4ABZA 1F43A 2O7TA 4HNVA 3RZOJ 4DZPA 3JRHA 2EZLA 3MVPA 3QPLA 1DU6A 3CJDA 3JRGA 5CXGA 1U9OA 1MSEC 3F0CA 4FE4A 2R5ZB 1I6HJ 4BBRJ 4A3JJ 2F07A 2R5YB 2AHQA 2VKEA
chains in the Genus database with same CATH superfamily
2VUMJ 1JUMA 5E1ZB 3TBIA 2OA4A 1XTAA 4HQEA 1S6LA 4EJVA 2L4MA 5BOXA 2IT0A 2D6YA 1HSTA 3EQLF 3SDBA 2X6WA 1OCZH 2KZGA 3KX2A 2LF7A 4GCTA 3BJ6A 3FXRA 4NC8A 1TWFJ 2E2JJ 2ID6A 2GXBA 3VP5A 2IBDA 3OL4A 2FNPA 3A2KA 2HU9A 2FRHA 4CCOA 2M1BA 4KMFA 3SDGA 2W7NA 1APLC 3PSFA 3S16J 2NVXJ 1E3PA 1QGPA 2DT7B 3E97A 3ERMA 3IWFA 1FYLA 3TMOA 2JQ7A 2B1EA 4H4KC 1Z0XA 4G9YA 3BG6A 5E3LA 4KFCA 1U5TA 2KP6A 3ESWB 3G7RA 5CQEA 3TP0A 3CC2I 1NG6A 2KJCA 3K4MA 2NP3A 2XV4S 4CO8A 1N75A 3WGHA 3VTIA 3GX4X 3PPBA 3HPHA 2EFQA 3R6SA 1WJCA 2VJ5A 3VOEA 4FCYA 1AA7A 2ZOZA 1I3QJ 4ESJA 1V5FA 2KKOA 5ICCA 4LLLA 5FJ8J 4BGDA 4FETA 1OR7C 3DTKA 3WTSC 4GRIA 3GZ6A 5FGLA 3LWJA 3IV5A 3GMEA 4UUTA 1VQ9I 1H9GA 4A3FJ 2ZBKA 1A6IA 4XRSG 3PL8A 5B5EC 5FKKA 2EFOA 5CXIA 2H1KA 5GADJ 4KNYA 1TQPA 2IGOA 4GFBA 3FBIB 3ZQQA 5HLIA 4BH9A 1O3TA 3LSKA 1ZGAA 2XGCA 4DW6A 3OR1C 3DV8A 1YW7A 2YX7A 1FLIA 2M7BA 4FX4A 4IQ4A 4XKBA 3REOA 4EQQA 3K8PC 2GIZA 2VPRA 4CXFA 1VQ4I 3TDUC 5HOOA 3QP6A 3CMYA 4KMUX 3HOVJ 4M6VA 5D1RA 3BLYA 3V7RA 1MBEA 2Q2EB 1SD5A 1MIJA 2HXIA 2CG4A 3I64A 5L3DA 1VQNI 5JI6A 3PNVA 2RNGA 2Q2EA 1UG0A 3PNTA 5LFAA 1V5GA 3ZQHA 5D6EA 2XUBA 1T08B 4U87A 2JT1A 3I71A 3VW2A 4C9YA 1UFMA 3PNYA 1SVMA 1ON2A 4UXNA 2V9KA 2EB7A 3G1LA 2OZUA 3BRUA 4WCGA 2DFHA 3KKCA 3FISA 4B44A 1F5TA 2D2WA 3M8JA 2CYYA 4HG2A 3BJAA 4YFXF 1X1BA 1JUPA 3ABKH 3OYHA 3CCQI 1LFUP 4XLNF 4GDFA 3B02A 1EV7A 1M1EB 2TDXA 4ICHA 1XC5A 4PGGA 2NYXA 2W00A 3MFKA 4A2UA 3QODA 1Z6TA 4UY8I 3NRGA 1TWAJ 2M45A 5E18F 2NVTJ 1VFCA 3M3YJ 5FLXK 2VKHA 5L3GA 1LPQA 4MQVA 3BQZA 1X2NA 4M3DA 3JRIA 5LBQA 3E3VA 2EA2A 4U0WA 3J81K 3ZP5A 2PX9A 4DBQA 3K1NA 3AG1H 3ON2A 4A12A 4C3JJ 2W84A 5L3EA 1HA8A 2Y30A 3JTHA 2BEOA 2DOFA 2P7CB 3KETA 1LJ9A 1IO2A 5J47A 2ID3A 2L4AA 1XS9A 4JQFA 4E7HA 3NRVA 4OINF 4HBLA 4TV7A 4WX9A 3LHQA 2JSCA 3W2VA 1ZGWA 5JHUA 3G6EI 2V6CA 2BY1A 2HQNA 2G7GA 1BI2A 3Q3SA 1R4MB 2JUCA 2L7FP 3BCBA 3IH4A 5CVIA 5HVQC 3OSGA 3FK7A 2OQRA 1UHMA 2STTA 3HDDA 3BJOA 1BM9A 1TZLA 3JSPA 3NNRA 3S1RJ 1RC9A 4IEJA 4AC0A 4KT5C 1W7PD 4AC6A 4R8HA 3W6VA 4F92B 4HSTA 5K5QA 2K40A 1VI0A 2M34A 2D45A 4HRIA 2L7ZA 1KQ9A 2HOTA 3G2BA 3AAFA 2QUFA 2JA8J 1VQPI 2K5CA 4NHJA 1POGA 3GCMA 4BE0A 4L9JA 3BY6A 2R7WA 3FX3A 2DU9A 1KA8A 1Z7LA 3E6BA 1SFEA 3CDHA 3GF2A 5IOYA 3I56I 1QZZA 2MBFA 1XMKA 3CMEI 1OJLA 2CQNA 4F3QA 4D1QA 4LIUA 3U1KA 3CESA 2Y9YA 4RLQA 4HQMA 2DFIA 2OUMA 3K1MA 5TJJA 3L2WA 1R1VA 3H1CA 2K9QA 3IKVA 4I02A 2DA7A 2M87A 3BOQA 3DKXA 3ZQIA 2WB1N 1MKMA 1REPC 3GTGJ 2FJI1 4MEXF 2HOAA 4S04A 1ZQ3P 5TGTA 4DOZA 2HOSA 2A3SA 1J2XA 2XPUA 5M3MJ 3U2RA 2LFBA 2A5WA 3FKIJ 2VC0A 2DPDA 2IGMA 2GENA 2ETHA 3LJLA 4YZEA 3F6VA 3KLNA 1ZR2A 1B9MA 1PP7U 1XX5A 2VIXA 4EM0B 2UZKA 4KWAA 1BI3A 4Y3OA 2QGUA 1JJ8C 2B0LA 4RGUA 1WH5A 4ITVA 2A6TA 4I2OA 3CC4I 2HQAA 1AKHB 2DDAA 5DUIA 2XDVA 2Y75A 5HDKA 3KKDA 3HM5A 1AKHA 1AWCA 2DJIA 1ZK8A 1LEAA 4PJNA 3F8FA 1G3SA 1DUXC 1G8XA 1XMXA 5H6QA 4RDUA 2FD5A 1GUUA 2XASA 2FSWA 2XIGA 4RAFA 2XAHA 4B47A 4CYCB 3MEXA 2BE5F 5J8FA 1B72A 4XLPF 2KT0A 4UB6C 1HKTA 1OISA 4LB6B 4DYRA 4CYCA 1WSUA 3FXLA 3DPUA 4LK1F 3SJMA 4W1UA 2UXUA 1PYVA 3H5RA 4DYCA 4L0ZB 3MAJA 3S2HJ 1R49A 2QSFX 2UWMA 1FNNA 4NC6A 1QA6A 3CLQA 2FMYA 4CICA 2VKDA 2NAZA 1IF1A 4JX4A 4IXAA 2WTEA 3RJPA 2W48A 4BJ6C 3FXUA 2M2EA 1TNSA 4L5EA 3HOSA 4BHBA 1IDYA 3J7YJ 2JA7J 2NNYA 3SZTA 5BPDA 1QHGA 3Q0VA 1VQOI 2K3PA 1FOXA 5JVGF 2FX0A 1RI7A 5TRDA 4E7ZA 1OCTC 3WU1B 1Z1DA 3RPQA 1MH3A 3MZHA 3H0DA 1ITYA 4HF0A 4UHTA 3P9TA 3GFLA 5A2QZ 2GLOA 3G73A 5JLXA 3G56A 3JREA 2XKPA 3GFMA 4RM2A 2D1HA 2F4MB 2DMPA 2VASA 3OYBA 4DBRA 4Y7NJ 4ANJA 2CUEA 3LSRA 2M4KA 2ZCXA 2G7SA 1Z91A 3NS4A 5BMZA 4BACA 5DS9A 1BOBA 1TL8A 3LA3A 2EFPA 2VJIA 1ETVA 3ANPA 1QZEA 2LRDA 1D3YA 1OPCA 5JR3A 1Y6IA 2XDNA 2IS2A 1R22A 4ZYHA 1MNDA 2LVSA 5FHPA 3ZPLA 1MZBA 1W5CC 5KAIC 4BDYA 4C3HJ 1XPXA 5M5YJ 1IW7F 3P9CA 5HNFA 3LSPA 2JA6J 3COLA 4C2MJ 4EGZA 3FRQA 4UVBA 1P7IA 2OJED 2VXDA 1P2FA 2EZHA 5ERIA 2QTQA 4XR6A 3QOEA 2BBYA 5D6FA 1U3EM 3ERED 1IRXA 3ZQFA 3GTQJ 3AG2H 3U1DA 5EZGA 2ZNZA 3EGQA 1OMIA 3KFWX 5AIPA 3HG9A 2M0MA 2UXPA 5EJCA 2L0KA 1DDNA 4XORA 3KEYA 2KRCA 1MJ9A 3QQAA 2JJ7A 3AG4H 4L18B 1FOWA 1LB2A 1VQ6I 4RB0A 1SVLA 3KZYA 5M5XJ 3MKLA 1USTA 3BR6A 1L3LA 1HC8A 1IGNA 4JKZA 1YJ9I 2ZSHB 3JSOA 3IUVA 4NNJA 4C2TA 1JT6A 1H8AC 2XHKA 1GVDA 5IT3A 3KP7A 2IXSA 4GYGA 4L0YB 3GZNB 1XSDA 3GVAA 4NQWB 3FZVA 1BA5A 1OLTA 2VBXA 3OYGA 3RI4A 3ABLH 2PFVA 2F5EA 3BG3A 2Z99A 4WWCA 3S2DJ 1MBHA 2XF5A 3CCLI 1JE8A 3MCZA 2DXIA 2VB6A 5FD6A 3QKXA 1QU3A 3DU6A 4KJZA 3SFZA 1R5HA 4Y52J 3MD2A 4IZZA 2QCOA 1R23A 4HV5A 4WK8F 3C2BA 2EBIA 3W2AA 4O6JA 1TC3C 1K79A 2IGKA 2E71A 3JRAA 1YRNB 2YU3A 5HS8A 3BZ6A 1MNEA 1IC8A 1FSHA 3I5UA 1YRNA 5D19A 3DBRB 4KICA 5KHDA 1UAAA 2A5YB 3TEDA 1HKQA 4V2FA 5ILUA 1TW3A 2X85A 2MH9A 2L9RA 1LVKA 1H89C 2EIJH 2TRTA 3Q0UA 2L9NA 4P9UA 3O60A 5ILSA 5ICEA 3HRMA 3FWEA 1E3OC 1FYKA 1KU9A 1T0FC 1BW5A 2L5QA 3K9TA 3BNIA 3F22A 1MGTA 3TKYA 5J40A 5D18A 4IX7A 2G7LA 3S8PA 1F43A 2O7TA 4HNVA 3RZOJ 4OIRF 3JRHA 2O0YA 2Q1ZB 5JFRA 3JRGA 4E7JA 5J6XA 2V6EA 1I6HJ 2R5YB 2AHQA 2VKEA 1G3WA 2JUGA 3M7GA 5HBUA 2DODA 2B9SA 2R5YA 1DPRA 2MLGA 2Z3YA 2WAQN 3VDXA 5FRNA 1D8JA 4FQGA 1NK3P 2EZKA 4M3FA 2IA2A 2XSDC 3B81A 2OU2A 3BTIA 1ZKGA 1ONVA 5EDNA 2X1DA 2K02A 2R7DA 2OF7A 2EPFA 3CLOA 1RZ4A 2X4HA 4MFEA 5E3MA 1Y39A 2DQRA 2FBIA 3EUAA 2OCEA 4AWXB 3GLXA 1G6NA 3DPLC 1VZ0A 3QU6A 4RM3A 1R5ID 1U6GA 2VJJA 1YW8A 3RCOA 2L54A 1TT5B 4M9XA 1RESA 2HKXA 3NWSA 5F08A 3IH2A 4O5VA 3IP4B 2QKLB 3QRFF 2EQRA 1GDTA 3DF8A 5LHIA 5GP9A 3UNGC 4C3IJ 2DA6A 4PJLA 2L01A 4XRFA 4RS8A 1X58A 3FXMA 2LC2A 1QPMA 2CQXA 2HTJA 1NG7A 5DD8A 2OI8A 1TTYA 3E5XA 3H36A 3H92A 3KZIC 1WJEA 3HTJA 2FOWA 3CJRB 2ICWG 3CDLA 3K0LA 1J0RA 3BG5A 3ZN0A 4X1EA 3NWTA 5D8LB 2Y0MA 2AS5F 3RPUA 4B3AA 5GAGJ 1UHSA 1K6OA 3ASOH 5CW8A 3S15J 1P4XA 3CCUI 2FJ1A 3WTZA 3HGYA 2Z5UA 2GXGA 3SEQA 2RDPA 1HBXG 3WU2C 2P5VA 1SD6A 2BGCA 2EIKH 4HNTA 1U0JA 2A2FX 1ZLKA 1ZH5A 3BCAA 2IJLA 2V1UA 4AYBN 4UVAA 1XB4A 5D4SA 4MTEA 2VQHA 3A01B 1CF7B 3HSFA 2GXAA 4G7ZF 4I7HA 4I6ZA 1T8IA 3T5XA 1N25A 3VYSB 3A01A 1CF7A 3EUPA 4HNUA 3NARA 4EATA 2XAQA 1ZARA 4LG3A 3HOZJ 1JT0A 3RYRA 3OIQA 2H1LA 4HPQA 4N4NB 3V8LA 4EGYA 1VQKI 5HAWA 2KIFA 1R6RA 1QNTA 2KIMA 1KONA 4FT8A 4RGSA 5GTHC 1STZA 2I5UA 4BJTA 4AIHA 4ENNA 3K7AJ 5DD4A 5GAHJ 4XKCA 1WKMA 3CUOA 2KLOA 3EDPA 2K9LA 2V9VA 2A07F 4OIOF 3IH3A 4YEJA 1ACIA 4PZJA 5L3CA 2ADUA 5J3LA 3KP4A 5D5VB 1V55H 1H9TA 3WGIA 4KIBA 4UVCA 1FZPB 2JA5J 1UG2A 2F4IA 1QHHD 2HYFA 2P6SA 3HKZA 4N9IA 2MGQA 4IPAA 4P5OA 4CH7A 2KPMA 4B1RA 2DA4A 3LQQA 2QVOA 3CO6C 5IT9Z 3WG9A 1A04A 2O9LA 2FE3A 2I10A 2IEKA 4A93J 1WCMJ 5J1YA 3FMQA 4S05A 3WGGA 4U7DA 2V4JC 3Q5FA 2ZOYA 2LKPA 2W24A 4AIJA 4M9SA 5KCMA 3JR9A 2ZJPF 4ENKA 4XNFA 2EJRA 1U8BA 3FXQA 1K78B 4U88A 2BZTA 1X3WB 4RAZA 3BDDA 5GAEJ 2ZJQF 4Y4RA 3GTKJ 1B59A 4CGZA 2ZO4A 1K78A 2QQ8A 4BY7J 4RB3C 3M8EA 3OYMA 5LRRA 2R7ZJ 2CW0F 5KNLA 2LP0A 3CO7C 2LY2A 4OD4A 2QIBA 3QP5A 5CQGA 5M5WJ 1FJLA 3P5JA 1WJAA 2VOOA 3PQJA 3HGGA 3C1DA 1FOKA 2L9SA 3EYIA 2ZXHA 2BVMA 3SHFA 1U5TB 4BE1A 3BPXA 4ZYDA 1PUFB 3CF5F 2VKVA 1D0XA 3ZMVA 4XIDA 1QBJA 4U0VA 1GVJA 2HZTA 2A6EF 3WE3A 3DLLF 3GXOA 2OTJI 1PUFA 4A3EJ 1BL0A 3Q0WA 3QPHA 3CCYA 4BQNA 2DTZA 2FBHA 4PUSA 1A6QA 3FDYA 3I4PA 4OMYA 1BW6A 3LFUA 3QPTA 4XICA 3OYEA 2ISYA 2VC1A 4PXIA 1U5TC 1Z05A 2LBFB 3DXJF 5HNHA 3HBLA 1QZYA 2LYCA 3K10A 5ILVA 2ESNA 2LBFA 4OOIA 1K61A 1IXCA 3A1YA 4RAGA 4ZYAA 3J80Z 4Z2YA 1FOYA 1KGSA 2WY7Q 1Z21A 4PSWA 5DV5A 4A3IJ 2F5CA 4E6KG 3EUHA 3OS2A 1H88C 1KQ0A 1ZG5A 2FXAA 3OL3A 2HVQA 2IGNA 1JGSA 3MKZA 2A6HF 2R7UA 4D5CA 1P9QC 2BXZA 1R7JA 4BS9A 4D0PA 1I50J 1U9NA 1GXQA 3DKYA 1RUOA 2R7SA 5CVJA 3FF5A 3EUHC 3L00A 3R0JA 4HW0A 5J1RA 2GUHA 4LGWA 3E6MA 3ON4A 1GV2A 5F1RA 4NC7A 4J01A 1IRGA 3F1BA 2GIVA 1GV5A 5EEGA 2PQ8A 1S8NA 4G94A 3K70D 3SQNA 1OCPA 5C3EJ 3LWFA 4RGXA 1DP7P 4UNOA 2XGXA 1IN6A 1TWGJ 2JVHA 1IV6A 3CCJI 3HZJA 1R00A 3K4CA 1G3YA 3TDZC 2BW3B 4CCNA 4BNCA 1ZRFA 3A0HC 5F0HA 3H3VK 3ECHA 2BW3A 5EZHA 1FP1D 1J7KA 1OYWA 2LOOA 3DEEA 4XBFA 1B8IA 3OMYA 2F48A 3BPVA 2CV1A 4A0YA 3LSHA 3R61A 2VN2A 3A0BC 2AXTC 4PGHA 2F5VA 2LK2A 2E35A 3DLAA 2VQLA 3UKGA 2NVUB 2OPTA 1EF4A 4G7HF 1V4RA 3LQRA 5JHFA 4Y33A 3RKWA 2HPIA 1LQ1A 2IS1A 2VOPA 2NOJB 3RKXA 1K4TA 2CV0A 2YSRA 2ZXIA 3BG7A 3TO6A 1MJAA 3CP2A 1ZYRF 2ZKZA 1MMAA 3OV8A 2DA3A 2K9SA 3E5QA 4UUVA 3SXYA 3V7SA 3CMAI 4DIQA 3RSNA 2H8RA 4A3BJ 4MXMA 1Y56A 3HIMA 2YS9A 1WFXA 2WV0A 2OAZA 4M71A 1JXSA 4BJ5C 3OYFA 2X6XA 3RDIA 2QA4I 1QRYA 3WODF 4YFKF 1Z3YA 2GA2A 2Q24A 4I99C 2W4SA 3DPTA 1KYZA 3LAJA 3CD6I 2JWTA 4KIFA 2O7OA 4RAYA 2GA1A 3TP3A 5FB2A 2NX4A 1GXPA 1I3AA 1IZ1A 4ZTFA 1N77A 4MLOA 2MH2A 4CGRA 5DAJA 3O6BB 2ZCNA 2JTVA 4ZYGA 1MMDA 2R7XA 1T38A 1BI1A 3AFHA 5H2FC 2IW5A 2HYJA 3PO2J 4ESBA 2PI0A 1P4AA 3ZMTA 4KDPA 5FO5A 2KIQA 3S1QJ 4Y15A 1P6RA 1XGNA 5KVRA 3L7WA 5GPCA 3P9KA 3VVYA 4LLGF 5DM7F 1FBQA 3ML6A 3GTLJ 3PO3J 3LSGA 4AUXA 3VSLA 3OIPA 2FU4A 3OYDA 1E3HA 4YFNF 1A5JA 3R60A 2DI3A 1XG1A 2A68F 5IYDJ 2BHZA 1O4XA 5FD5A 5CVVA 1BR1A 1RRJA 1HOMA 4I98B 1F4KA 3LA7A 3MWMA 4RB2C 2EZIA 3FMSA 1SGMA 3HTUA 2L9VA 2LR8A 3KP5A 3DFGA 4BHPA 2CGPA 2EFNA 2IS4A 3MKYB 3K4NA 1ETOA 4CYDA 1JKOC 5D5UB 1BC7C 1HSJA 1B9NA 3PIOF 1TQMA 4Y13A 4Q5SF 2LMDA 2QKOA 5LGTA 1WWXA 3LFKA 5C44J 3HPGA 3U9GA 1G3TA 2F5FA 3CJNA 4HX8A 1TWCJ 2DMTA 2DG7A 2WAEA 1F9NA 2Y9ZA 4FASD 1L0OC 1FMVA 3I53A 4BL0B 4HOBA 1RETA 2KRFA 3GYHX 3H9GA 3W3CA 4JBAA 4XOTA 2NXNB 2NP5A 3A4CA 2CW7A 4AVZA 2ECBA 2Z1DA 3IRQA 1UB9A 2LH9A 3KYCB 5HLTA 2F4OB 5FKNA 2P8TA 2YUSA 3H0GJ 4BQQA 1G59A 1XSVA 3F21A 3PFIA 4Y17A 4DVYP 3J80K 4S0HB 1EKEA 4HSRA 4BQOA 3CC7I 4NELA 3V78A 2PMUA 4ACIA 3EUKL 1W0TA 1YFHA 4XMYA 1LKXA 2P6TA 3CCVI 3EETA 3PASA 3TGNA 5IP9J 1WRJA 1ETQA 1K4SA 1XGSA 3FXKA 5FMPA 3JRFA 2DCEA 4QWQA 3TO7A 1B72B 4HKUA 2R7QA 5AQCA 2GQQA 2C6YA 4PFPA 3BR5A 4F93B 1YHQI 4WF2A 2V1DA 3BG9A 1IV8A 1QO0D 3FHZA 2FEZA 2HQRA 3E0JB 4F7ZA 1SEUA 4IHYA 3K4LA 4M3BA 4NUBA 1W7PB 2BY3A 1S7EA 1X3UA 2PN6A 2MW8A 3Q9VA 5FLMJ 3MKWB 1X1CA 3TW6A 1SAXA 1W7PA 2X1EA 3WTUC 3N97A 2RAEA 1F36A 3D1NI 1I1GA 2RHAA 4EV0A 3V8KA 3QPSA 4L5IA 3ULQB 2M0CA 2PMZN 3KZ9A 2ELHA 3S2WA 3QAHA 2IP2A 1IN7A 3T0YA 3HB9A 4WXDA 4BXXJ 1FIAA 2XAGA 5KAFC 1AHDP 5H9TA 2OD5A 4IHXA 3JRDA 1EA3A 2DA1A 3OOUA 2PEXA 3C3WA 2NOGA 1T33A 5FRMA 4PK4A 4KIGA 2E2IJ 4RA2A 1HQCA 4B8XA 1XCVA 4DZPA 3QPLA 5CXGA 1U9OA 1MSEC 3F0CA 4MQ9F 2GOMA 4B48A 4A3JJ 2DO7A 2F07A 1O7LA 3VYTB 1R58A 2WA0A 1IJWC 3PJRA 2OQGA 2P5LC 4HLXA 1XMAA 1GLNA 2J5PA 5CJ9A 3MZYA 2Z16A 4I0BA 3CCMI 3GZIA 1MW7A 3D5SC 2M4GA 3BTLA 2DMUA 5IYCJ 1MMSA 5J4VA 4D7NA 2DQLA 5DCMB 3OYNA 1HF0A 4RGRA 1SAUA 1UELB 5DCMA 9ANTA 3ONQA 5LD2C 3DBLB 3Q9SA 3T8RA 1X2MA 5K7HA 3M4OJ 3JRBA 1V54H 2HKOA 3VYUB 3ECOA 3LSJA 1MSFC 2FBQA 5ED4A 2X51A 2CQ7A 1UCRA 4IOAF 3LMMA 1KYWA 1TNTA 1JKPC 1WI3A 5K5RA 2HQ5A 2JVGA 2R3SA 2ISZA 5CVRA 3E1SA 3KEOA 4BUPA 1RNLA 2O5RA 5EF6A 3I58A 1B1BA 2COMA 3I9V2 3QBMA 2LKSA 5B1BH 2DYSH 3ABMH 1YYVA 1BBYA 1X1PA 1MMNA 3H5AA 3VYRB 1TT0A 2KHMA 1YJWI 5KK1A 1TLHB 3GTOJ 4FHTA 2PLYA 2LDUA 4XN3A 2ECCA 3L2UA 5J1UA 5M3FJ 4XKWA 1ORKA 4GCLA 4EJWA 3CUQB 4XQFA 4O3MA 4CA0A 4L5JA 2R7OA 2M8EA 2UV1A 3HOUJ 3CUQA 3X2QH 2OERA 3OOPA 3KZZA 4XLFA 3ASNH 1JHHA 2PFBA 3OYKA 3WG7H 3D5LA 3ZGKA 1UHWA 3DCFA 5B66C 1ETKA 3ZQCA 4KA4A 1O3RA 3IKTA 3F8CA 3KLOA 1WPKA 3K2AA 3JAMZ 3GUDA 3BQYA 3KEQA 3SZPA 2UXIA 2XF7A 1I27A 1BJAA 1K6YA 1MBFA 2E5NA 4XLAA 4IO9F 2O8KA 2DJNA 1WQ2A 1ULYA 1UI6A 3H9QA 2MLKA 3G3ZA 1Y1WJ 2RQQA 4XONA 3ZXSA 2MD5A 2ZSIB 1I39A 2DOAA 2H6BA 1RIOH 2J5OA 1D0ZA 3WE2A 4LOCA 3CZ6A 5E8GA 3BC8A 2X9DA 3LSMA 5FFZA 1X4OA 1ON1A 2FNAA 1Y0UA 1V3FA 3ZMDA 1XN7A 2F2EA 4PDKA 4AM3A 4BDZA 1LE8B 1MD0A 2L3DA 1WI9A 2JRMA 2I8DA 2MG4A 2QSHX 3BWGA 3VEPA 1LE8A 3DKWA 3IWZA 4M6XA 2QQ9A 4OU0A 4ASNA 1W36D 1ENHA 3O8HA 3S1NJ 2FQ4A 4HDUA 3OIOA 1PJRA 5DEQA 4BAYA 1OCOH 5F27A 4P9FA 1BC8C 1LDJA 3S5RA 2V7FA 3HHGA 2K27A 2CFXA 3U21A 2V1XA 1HW5A 4X0GA 3S3MA 4WXCA 3C07A 3KNWA 1Z6RA 4YIRX 2IPQX 3AKZA 2ZCWA 2CU7A 4AF5A 1GHCA 1U78A 2Y2ZA 2DFFA 3TO9A 4OD5A 2VODA 4PSXA 2GM4A 1RKWA 3KP6A 4A0ZA 3ZR8X 3HTSB 5JVTA 2PZ9A 4F55A 2E1MB 3F8NA 3QWLA 1MNMC 1FWZA 1T2KA 2CUZA 3F8MA 1HXDA 1ZAOA 1U2WA 4CCJA 3SEZA 2CQQA 2KIUA 2E19A 3M8FA 5EEAA 2HTSA 1KZHA 2LKXA 1PVEA 2DBBA 1SFKA 3F3XA 5JLWA 4LK0F 3EPZA 3NI7A 1SVOA 3NXCA 3M9AA 2Q8KA 5BNGA 2MYSA 4EVIA 1A31A 3VPRA 2AQFA 2QQBA 4ZDOA 3MMYB 5TISC 4E4HA 3KIOA 1D0YA 1S5LC 1YOVB 3RYPA 2YU9J 4IKFA 1JHFA 4MIMA 5HDNA 5A2QK 1D8KA 3BTJA 1ZRDA 4NN1A 1USSA 6PAXA 4OIQF 2QQAA 4R79A 3NPIA 1BR4A 3FM5A 5E3NA 1IUYA 1Y8QB 4MNUA 4E70A 1O3SA 3MNLA 2QZ8A 3GEUA 2YVHA 4HA8A 3T8TA 1YIOA 3AL0B 1D1AA 1EH8A 3O2PE 1IN5A 5C4XJ 1FBSA 2DMQA 4MFDA 4CUGA 5F1JA 1HLVA 2JA2A 4V19K 3ABUA 1AU7A 2NVQJ 1YIJI 2DFEA 3FBNB 3GLLA 3PSIA 4H0EA 3JTGA 1IAWA 4IL6C 4IHWA 1EJ9A 2EH3A 3EYYA 3RQ4A 2DA2A 3L2RA 5IYBJ 4HX7A 3P7NA 5L3BA 1SC7A 1IDZA 2ESHA 1VQMI 3MZ8A 1FYMA 3VOXA 2CO5A 2O61A 2Y0SA 2HWVA 4XN0A 3QOPA 1DGWY 2YX4A 3K4JA 5C4JJ 1A35A 2XRLA 1X3ZB 2KMUA 1FT9A 3RQIA 2E5ZA 2MFZA 3LOCA 4ZZLA 1EH7A 1LDDA 3VIBA 4C2MA 4LIVA 2IU5A 1FTTA 2RN7A 4CCKA 1DP3A 1OCRH 4XRMA 2A69F 1W0UA 3FHNA 1TW2A 2Y48A 3K2ZA 3HYIA 5FKOA 3L2QA 1R4NB 2PG4A 4XLEA 3G71I 4BBSJ 1WH7A 4CSWA 1IN8A 3G1MA 1E17A 5AIQA 3S1MJ 1YITI 3KP2A 4I0AA 2VE8A 1TWHJ 1HW1A 2XAFA 1VQ7I 4XK4A 5HDGA 3J81Z 1P4WA 5D5WB 1P92A 4KT6A 2V26A 4XSXF 2XAUA 3PUFA 2EILH 4XRSA 3DU5A 2QEXI 1K83J 4IOCF 3GTJJ 4GFLA 2YVEA 2FOKA 3CTAA 5LRSA 3W6KB 5D4RA 2NS8A 3B6CA 2R7RA 4IF4A 4I76A 3JCUC 1V5EA 2E1OA 1P7JA 1YTYA 3DWLE 4JX6A 5F64A 4OWRB 2R93J 3LL7A 1UMQA 1FP2A 2WAQA 4KUMA 2W82A 4HAMA 2HKUA 1MDMB 2QBYB 3ZRGA 2IAIA 3A03A 5BQTA 3MN2A 2B3WA 1MDMA 2QBYA 3GO5A 1DU0A 3GWZA 4EJOA 4XL9A 2P7VB 3ZQLA 4QLCU 1T6SA 2IS6A 4IRVA 2ZC2A 5H20A 2EK5A 5FFXA 3VUQA 3QYFA 1BR2A 2M30A 5C4YA 2QSGX 1GT0C 3WTTC 1YO5C 1A36A 2ZB9A 4A6DA 2K9NA 2L2OA 4ZYEA 4YELA 3S14J 2EV5A 4DNCA 5IY5H 2V57A 1R9TJ 3HL2A 5J4YA 2G7HA 1D5VA 4LFUA 2MA3A 1MJBA 3HC7A 2EFWA 2HEOA 3OYLA 2GWRA 1SMYF 1JTXA 1SFUA 1VQ5I 2RNJA 2DN0A 1FPQA 3OYAA 2HS5A 1B6AA 5LHGA 2R0QC 1SFOJ 3JSJA 1ZG3A 2H94A 2DAOA 4BYYA 3FM3A 1MBJA 4FE7A 1W5SA 5IPAA 1MH4A 3L09A 5GTIC 2UUZA 1R5GA 2KZVA 2E7XA 2XGEA 2CH0A 4UV9A 2VJ4A 2HR3A 1OR7A 4RB1A 1AOYA 2B7EA 1D1BA 1HW2A 4IJAA 2WAFA 2MABA 1XGOA 2HDDA 3F72A 1WJ5A 5CVUA 2XGDA 4AYBA 3CF2A 3VVZA 4GCKA 4GFKA 3W6JB 2ME0A 3PIPF 4GO1A 4KISA 2DT6A 2DOEA 5LLQA 3JW4A 4IRIA 4A3KJ 5CKTA 2JPBA 4NDLA 3CMMA 1IUFA 2WUIA 4YRVA 2DK5A 2IRFG 5DM6F 2X0LA 4DYQA 2D5VA 3IC7A 4W97A 3I4MJ 1NTCA 1OYIA 2ZMEB 1QPIA 2PJPA 3HOYJ 1FC3A 3CRJA 1HCRA 3H3UA 2ZMEA 4ZDLA 2P4WA 1LUJB 1MMGA 5FGMA 3OS0A 2QF7A 1T56A 1JGGA 3ANGA 3HTHA 3RZDJ 4MEYF 2VT3A 2LY9A 4BEHB 1J59A 4EJTA 5K7FA 3HEFA 4U0YA 4BEHA 2ZFUA 1TBXA 1U8RA 2P5KA 3PUBA 1DPUA 4AVPA 3HTAA 2GZWA 3WTWC 2ZMEC 1JUSA 2M7AA 2XPWA 1W4MA 5HS9A 4DZJA 1B8IB 3J7ZI 2PMHA 1IRZA 2F6CA 4B3XA 3OYJA 1ZG1A 4HYEA 5B3SH 1WHUA 3KPHA 3RKQA 3HXLA 4JYKA 2K9MA 4A5NA 4BKXA 3IL2A 1LFPA 3WHBA 2QLZA 2VBYA 3OS1A 3HOTA 4GCVA 1SD7A 1DGRM 2EV6A 2XPVA 3FMRA 5K5OA 5LEJA 4MHGA 2KJBA 5F0FA 4II2A 4F52A 5FLVA 3GTMJ 3GTPJ 2W25A 3C2HA 3OWTA 1VF9A 2EA4A 3W2WA 4HV6A 1BIBA 1IXRC 4PCQA 4IVNA 1PP8F 1Y1VJ 1PUEE 1KQ8A 3RH2A 5H6RA 5DDGA 1J5YA 4PFOA 4ENJA 2VONA 2BOLA 2P0WA 4FTHA 4U9NA 3VW1A 3B73A 4II3A 4OAZA 4Z6YA 3UR3C 1Z3XA 2DW4A 3FXJA 2R7TA 4L9NA 2JZYA 3TOBA 1VNDA 1ZN2A 3KP3A 4GYIA 4GGGA 4ABZA 1KU7A 3I59B 2DTRA 1DU6A 3BZCA 3K1PA 2Z33A 4BE2A 1XSXA 3I59A 4ZJZA 1ODDA 1IN4A 2L7KA 1VTNC 1IRFA 4M73A 4HLYA 2DA5A 2CRGA 3BROA 3BT9A 3HE0A 4K2EA 1R36A 4A5MA 4G6DA 3G1OA 1RUNA 5IP6A 1JKRC 1EH6A 3OR2C 4ZTJA 5CPRB 5IT9K 3K69A 1YX5A 2A05A 3GFJA 2FMLA 2CMPA 2GAUA 3WTYC 1RKTA 1MBGA 2K3FA 3BZKA 1WZ2A 4OIPF 1YLFA 4JX5A 5ICFA 3P9IA 2JRTA 1ZTRA 4CCMA 3VVXA 3F8BA 5F0CA 1VQLI 2LREA 1FIPA 4QSHA 3MQ0A 2W85A 2CQKA 4M9ZA 1PDNC 5EYRA 4BXFA 4IRHA 1S72I 1KU2A 1WJBA 1ETYA 1Y0NA 2E34A 3NAUA 4ESFA 2AO9A 3SYTA 2XROA 2QWTA 2NVYJ 3SWHA 2VXZA 3GFIA 3K70C 4N0BA 1XDSA 3S3OA 1YG2A 2MD0A 3K4BA 3HRUA 3BHQA 2X6OA 2BXYA 1Q1HA 4E7IA 3JRCA 2M3AA 4L9TA 1X4PA 2GFNA 3O3KA 3N05A 2ZXJA 3ABTA 4LITA 2N8GA 4P96A 4IHSA 4LB5A 1ZGJA 2W53A 2PBIA 4DQ2A 4MTDA 4ZDPA 2HGCA 2KQRA 2UXHA 1ZR4A 2DPUA 1ZELA 1JKQC 2HZDA 3KCCA 5DCFA 2XVCA 3R4KA 4M3GA 3T6NA 1YW9A 3ZMUA 2Y31A 4AU7A 5ICGA 2KL4A 3CCSI 1DQUA 1K7AA 1R71A 2L7MP 3E7LA 2HXOA 2VPLA 4Q48A 1RR8C 2VT2A 1SFXA 2LSOA 3QYBA 2NRAC 4IQJA 2ZFWA 4RMNA 1ERDA 2E36A 1YX3A 1Y8RB 2WBMA 1XCBA 3TQNA 3ZOBA 1SANA 2M8GX 4MO7A 2K85A 3A02A 3VB2A 4IHVA 2VE9A 5K58A 1QQIA 1S7OA 3CDIA 4G12A 3DTIA 5GPAA 3S93A 4CHUA 3CQZJ 2ME6A 4EJUA 4HEA2 2ELJA 3QYEA 3I55I 3CJQB 3C7JA 2H27A 3PM1A 3K6GA 4EM1A 2VBZA 3RIRA 4ETSA 4J00A 2GBYA 4YIFA 1WGXA 3V42A 2ZY9A 2P81A 3VOKA 3E6CC 3V6GA 3BR0A 3RTRA 4QPOA 2OZ6A 4AIKA 1XDUA 2RASA 4HX4A 4XM3A 4XSZF 2RC4A 2L02A 2OBPA 2IA0A 4G6TB 2KDZA 2NS0A 2VQCA 3ZCOA 3TW7A 4JL3A 1FSEA 2LG4A 4XLCA 2PJRB 3J7AO 1T39A 2XAJA 4ZZDA 4NB5A 1YI2I 4UDSA 2KISA 1BJZA 2PJRA 2TCTA 5EG0B 5D8KB 4QPQA 3VFZA 4A3MJ 3HRTA 5E3OA 2LLKA 2DYRH 4JP0A 5EG0A 4G7OF 2BY0A 4E7LA 1BOAA 1T95A 1X1AA 3H9JA 1X1DA 1J9IA 1CQTA 1UJ8A 1NH3A 3OY9A 3BJBA 1Z7UA 5DYMA 5HLGA 4UUSB 5E79C 3T1BA 3BTCA 2CUJA 2O8XA 3NEUA 1OKRA 4A6EA 4UUSA 3L1PA 3K4KA 2YVXA 2X48A 3V7CA 3F9KA 4B09A 2GOXB 2WV1A 3L2VA 3ZN1A 2QWWA 2B63J 4ZH4F 3VSKA 2ACJA 2V9PA 1O7FA 1OYYA 1QVTA 1S3JA 4NBQA 4XLHA 2E60A 3CJTB 1UZCA 2HDCA 3H3ZA 3PFYA 4N9HA 4GXOA 3G4SI 3QU3A 3CCEI 1JTYA 2STWA 5DTDA 3DEWA 3DPJA 1W1WE 2WB1A 3C2GA 4M74A 4KITB 2RREA 3SZGA 4E7SA 5K7ZA 2HYGD 2R7FA 2COBA 3RD3A 2HVRA 3L2CA 1O57A 2H09A 2KDOA 4HF2A 2ZJ2A 1BIAA 5J8CA 4FX0A 3WTXC 1YJNI 2YR2A 2VBWA 2RVCA 3B6AA 5E8IA 4YG2F 2BVLA 5LGUA 2FBKA 2ZNYA 1VQ8I 2ZCMA 4BY1J 5HS7A 1Z9CA 5HSZA 4BHCA 5IOZA 2XB0X 2E7WA 4B43A 4DGWB 2LY1A 3E6DA 2HPMA 1C0WA 5L3FA 3WHCA 2K86A 4AD9A 3IHUA 4Q4ZF 1HDDC 3S32A 3RKYA 1SD4A 1I6XA 2EV0A 2VLAA 1ETWA 3VW0A 3DTEA 2R92J 4I09A 3ZQ7A 2OCCH 4CCLA 3LAPA 3ISPA 1HDPA 1S9HA 2E1CA 5K1YA 4FISA 3ZMZA 3HSEA 5B1AH 2M5WA 4MK6A 4PJJA 2JMWA 3CUQC 3WU0A 2HVSA 1YS7A 1ZHFA 4LMYA 4C30A 4B4CA 4PJMA 3AQTA 4N4OB 4M6YA 2FA5A 2V1NA 5FKLA 3CP8A 3R0AA 3SFIA 3ZQGA 2HNHA 1W5TA 2V79A 3M07A 4AIDA 5FKMA 2EINH 2KRHA 3HSRA 4PJ0C 2NS7A 5BPIA 2VQGA 2YPRA 4LJZF 1OCCH 3ZMSA 2CWEA 2AQEA 2OV7A 3IAS2 2VI6A 2Y69H 3FKJA 4NQWA 4KYWA 2F5DA 2Y0SN 2PMZA 1WJFA 2E1NA 5AONA 5LHHA 3OYIA 2ELKA 3I0TA 5F6FA 5E20A 2MC4A 2VL8A 2Q0OA 2R7VA 3COAC 3VODA 3OSFA 2XRNA 4KN4X 2HOEA 1BI0A 4ON0A 2WGBA 1Q1VA 3FXOA 2M9HA 3HRSA 1B4AA 3TL4X 4HDVA 1BN5A 3BCGA 2RKHA 3DP7A 3RPUD 3C18A 1T0FA 3BP8A 2HDWA 2O6GE 1OFCX 3BR2A 2RGVA 1FBUA 2AXLA 1I5ZA 5F04A 1NHAA 2H6CA 4LD5A 1KU3A 1XGMA 2BY2A 1I1SA 3ELKA 4RLFA 3NQOA 3DEUA 1LNWA 2LTPA 2LNBA 3GZ5A 1D1CA 1JI8A 2PBXA 3LA2A 3O8GA 5HLHA 3CCRI 2RV8A 5CLSA 2X1CA 1ZRCA 4UB8C 1CGPA 4G6QA 3V4GA 3HOWJ 1N78A 5HODA 1E0EA 1IXSB 2DMNA 3OYCA 2JPCA 3HKZN 3AQSA 2DG8A 1WJDA 4D9JA 2K7LA 2HFHA 1NK2P 1FY7A 3D0SA 1X19A 4ENMA 2QM3A 4LG0B 2G3BA 2X6YA 2E1MC 1H0MA 3VWBA 4WXHA 4LG0A 4QIWN 1J09A 3D5RC 4A3DJ 1FTZA 4KN7X 2REKA 4EMSA 2ZXWH 2XSJC 4IRGA 5EGOB 3V8JA 2CV2A 4BQAA 1RR7A 1ZLJA 2WY8Q 2R4GA 2FUG2 2K4JA 4HF1A 3I3LA 2EWNA 5EGOA 1FEXA 3S3NA 1G4DA 4V2GA 2JN6A 4CZCA 2UXNA 5E1XA 5DUKA 4MGRA 2QENA 3F23A 3HIFA 3S17J 2QKMB 2BV6A 2XF6A 3I4NJ 3AG3H 4A0XA 3BR3A 1S7AA 5FROA 4OAYA 4XKVA 4E7KA 1G2HA 3E5UA 1O3QA 1OQYA 4ME9A 2IVMA 2LD5A 3ROUA 4D5FA 2D1VA 4QTRA 3M1EA 4I01A 4JNNA 3HJEA 1E2XA 4CZZA 3AL0C 1T98A 1F1ZA 4IHTA 2NNNA 1RPWA 3DBHB 4M72A 3HOXJ 3FK6A 4YIIA 1YS6A 1IG7A 2XB5A 4J19A 2CW8A 5LEKA 2ZJRF 1W36C 2WADA 1MBKA 4UV8A 3TOAA 4F91B 1YE9A 3HTIA 3M1CA 2OC6A 5LGNA 4LLNA 2HYTA 3I54A 3GEZA 2UXOA 1Z77A 1JJ6C 2E2HJ 2W57A 2G7UA 3CWRA 3FIWA 3DQVC 1TP4A 3H35A 4DJAA 1D5YA 2HI3A 3H5NA 2FF4A 2Z9OA 5FLXZ 4A69C 2G9WA 2MSYA 2DDBA 4R1HA 2OTLI 1UI5A 1ETXA 1R1TA 3J7AY 5D5XB 1FX7A 2DLLA 5BS6A 2O03A 4OMZA 4U9LA 4ZC3A 3HUGB 3E7QA 1LFBA 2DK8A 1S29A 4G8XA 2G0EA 4HZFA 5EEHA 2H8WA 3HUGA 5EFYA 4Q47A 4EEFG 3L9FA 2K4BA 1SMTA 2O3FA 3KYDB 3PQKA 4WIBA 2BYVE 5E1WA 5E17F 3WTVC 3N4MA 1LEBA 3LSTA 3KYLA 3LSIA 4XOPA 3JAMK 1LDKB 2CJJA 2RQPA 4BXUA 2XC7A 3F6OA 4JK1X 4CDGA 3LNQA 4RBOA 2JK3A 2QYOA 1QVUA 2W1OA 1XD7A 5IP7J 2UXXA 2CUFA 2FQ3A 4M3EA 3GBGA 2CSOA 3KE2A 2WWYA 2CS3A 2IA1A 1J75A 3IUOA 2LF8A 4C2UA 3GW2A 4BU2A 4A3CJ 1LVAA 1TQIA 3BR1A 1WVRA 2CFOA 2WC2A 4JOMA 4P55A 2A61A 2JSPA 2XKOA 4EM2A 2Z2SB 2DT5A 1FMWA 4A3LJ 4D7MA 1ZREA 4A3GJ 4X6AJ 2QOPA 4U7BA 2BHYA 3IRRA 3CJDA 4L62A 2EZLA 1YQAA 2KFDA 2MC3A 3MVPA 2EIMH 4P1WA 4L9VA 4FE4A 2R5ZB 3IAM2 1HKSA 1R1UA 1Z67A 4BBRJ 3HHHA 5CYVA 2R5ZA
chains in the Genus database with same CATH topology
2DA5A 1JUMA 2VUMJ 2CRGA 5HBUA 3BT9A 2R5YA 1IJWC 3HE0A 2D6YA 3G1OA 2WAQN 2QOPA 5IP6A 1JKRC 1NK3P 3GZIA 2EZKA 4M3FA 4GCTA 3BTLA 2XSDC 3B81A 1TWFJ 2E2JJ 2DMUA 2ID6A 3BTIA 5IYCJ 1ZKGA 3VP5A 2IBDA 5EDNA 4D7NA 2OF7A 1HF0A 1RKTA 1MBGA 3SDGA 1APLC 4JX5A 9ANTA 4MFEA 3S16J 5E3MA 2NVXJ 1ZTRA 1X2MA 5K7HA 3M4OJ 3JRBA 5F0CA 3VVXA 1Z0XA 3LSJA 1MSFC 1RESA 5E3LA 2FBQA 5F08A 1FIPA 3IH2A 4QSHA 3G7RA 3TP0A 2EQRA 1JKPC 1GDTA 1WI3A 5GP9A 2NP3A 2HQ5A 5EYRA 4C3IJ 2DA6A 1ETYA 5EF6A 1X58A 3NAUA 2QWTA 2AO9A 3QBMA 3PPBA 2CQXA 2NVYJ 2OI8A 4FCYA 2ZOZA 1I3QJ 3BHQA 5FJ8J 2X6OA 3HTJA 3JRCA 3CDLA 5FGLA 3GTOJ 2GFNA 3LWJA 3IV5A 3BG5A 4UUTA 4X1EA 4A3FJ 2ECCA 1A6IA 2N8GA 5J1UA 4XRSG 5M3FJ 2W53A 1ORKA 5FKKA 4B3AA 4GCLA 1UHSA 5CW8A 5CXIA 2H1KA 3S15J 2FJ1A 3HGYA 4GFBA 3HOUJ 2UXHA 1ZR4A 2OERA 4DW6A 2XGCA 1JKQC 4M3GA 3T6NA 2Y31A 3DCFA 1ETKA 3ZQCA 4AYBN 2L7MP 3E7LA 2VPRA 1WPKA 2HXOA 3A01B 3CMYA 3K2AA 3HOVJ 3BQYA 4M6VA 4I6ZA 5D1RA 3A01A 1MBEA 2HXIA 3EUPA 2UXIA 3NARA 3ZOBA 1MBFA 1SANA 2M8GX 4MO7A 3HOZJ 2O8KA 2DJNA 3A02A 1JT0A 1UI6A 4IHVA 5K58A 4G12A 5GPAA 3ZQHA 1Y1WJ 3VW2A 5HAWA 3CQZJ 2ME6A 4LOCA 2X9DA 3G1LA 3PM1A 3BRUA 3K7AJ 3KKCA 3FISA 2GBYA 1WGXA 1LE8B 2P81A 3VOKA 2MG4A 3V6GA 1JUPA 3BR0A 1LE8A 3IH3A 1LFUP 5J3LA 2RASA 1ENHA 3O8HA 3S1NJ 4ICHA 1XC5A 2FQ4A 3OIOA 2KDZA 5F27A 3TW7A 2JA5J 3S5RA 1UG2A 4JL3A 3NRGA 1TWAJ 2NVTJ 1VFCA 3M3YJ 3C07A 3KNWA 2MGQA 4UDSA 2CU7A 1BJZA 1X2NA 3BQZA 2TCTA 4M3DA 5EG0B 3JRIA 4AF5A 4B1RA 4A3MJ 2DA4A 1U78A 5E3OA 2LLKA 2Y2ZA 4JP0A 5EG0A 2O9LA 2I10A 2IEKA 4A93J 1WCMJ 5J1YA 2ZOYA 2GM4A 3ON2A 1RKWA 4C3JJ 1CQTA 3JR9A 1U8BA 2PZ9A 2Y30A 3BJBA 3GTKJ 2ID3A 4BY7J 4UUSB 1XS9A 1MNMC 3BTCA 2R7ZJ 3LHQA 4UUSA 2LP0A 3L1PA 1ZGWA 2X48A 2CQQA 2G7GA 2E19A 2QIBA 5EEAA 5M5WJ 2LKXA 2WV1A 1FJLA 2B63J 3Q3SA 2L7FP 3IH4A 3HGGA 5JLWA 2R5ZA 3OSGA 3FK7A 3NI7A 1QVTA 3NXCA 5BNGA 3HDDA 1PUFB 2VKVA 4XIDA 3VPRA 3NNRA 3S1RJ 4IEJA 1JTYA 1PUFA 5DTDA 4A3EJ 1BL0A 3DEWA 3Q0WA 2YU9J 4AC0A 3DPJA 4L62A 3CCYA 4AC6A 2DTZA 4MIMA 3W6VA 3BTJA 4NN1A 5K7ZA 1BW6A 1VI0A 2K40A 2COBA 2M34A 4XICA 3RD3A 2L7ZA 3NPIA 2HOTA 5E3NA 3MNLA 2JA8J 3GEUA 4PXIA 2YVHA 1POGA 3HBLA 3B6AA 5IOYA 1K61A 5C4XJ 2DMQA 4MFDA 5F1JA 1HLVA 1OJLA 2ZCMA 1AU7A 4BY1J 2NVQJ 4A3IJ 5HSZA 5IOZA 2Y9YA 2XB0X 4IHWA 2EH3A 2K9QA 2DA2A 1H88C 2DA7A 5IYBJ 3WHCA 3ZQIA 2WB1N 1HDDC 3GTGJ 2HOAA 1IDZA 1ETWA 1ZQ3P 3VW0A 2R92J 3VOXA 2HOSA 2XPUA 5M3MJ 4D5CA 2LFBA 1HDPA 3FKIJ 4FISA 5C4JJ 2XRLA 2GENA 1I50J 1U9NA 3RQIA 3LJLA 4MK6A 4YZEA 3LOCA 5J1RA 1ZR2A 2JMWA 2GUHA 3VIBA 2IU5A 3ON4A 4KWAA 1FTTA 4B4CA 1GV2A 3F1BA 3AQTA 4XRMA 1JJ8C 1GV5A 1W0UA 1WH5A 5FKLA 3SFIA 3ZQGA 5FKOA 5FKMA 1AKHB 4BBSJ 1OCPA 1WH7A 2NS7A 5C3EJ 3KKDA 3G1MA 3HM5A 1AKHA 1TWGJ 1IV6A 3S1MJ 1ZK8A 2VI6A 1TWHJ 2Y0SN 5F0HA 3H3VK 4XK4A 4RDUA 2FD5A 2ELKA 5EZHA 1GUUA 1B8IA 4CYCB 3OSFA 1B72A 4XRSA 2KT0A 1K83J 2WGBA 4DYRA 2LK2A 1Q1VA 4CYCA 3GTJJ 3SJMA 3UKGA 4W1UA 2YVEA 2OPTA 2M9HA 1EF4A 4GFLA 2UXUA 4DYCA 3S2HJ 3BCGA 2NS8A 3B6CA 4I76A 2E1OA 1OFCX 1P7JA 3BR2A 4JX6A 4JX4A 2DA3A 2W48A 2K9SA 2R93J 2M2EA 1UMQA 4L5EA 5F04A 2HKUA 1IDYA 2IAIA 3A03A 2H8RA 2JA7J 3MN2A 4A3BJ 4MXMA 3HIMA 2YS9A 3Q0VA 1DU0A 2FX0A 2LTPA 1OCTC 3ZQLA 1MH3A 1QRYA 3O8GA 2PBXA 2Q24A 1ITYA 3VUQA 3HOWJ 2JWTA 5HODA 5C4YA 3P9TA 2DMNA 2O7OA 1GT0C 3HKZN 2GLOA 3AQSA 2DG8A 2ZB9A 3TP3A 5JLXA 2NX4A 2K9NA 3JREA 3G56A 4MLOA 4CGRA 3S14J 5DAJA 2DMPA 2ZCNA 4Y7NJ 1NK2P 2CUEA 3LSRA 1R9TJ 2V57A 2ZCXA 2G7SA 2G3BA 2HYJA 3PO2J 5DS9A 1ETVA 4QIWN 3ANPA 3S1QJ 4A3DJ 5GPCA 1FTZA 2XDNA 2REKA 3VVYA 3GTLJ 3PO3J 1JTXA 3LSGA 4AUXA 2DN0A 5EGOB 1SFOJ 1RR7A 2LVSA 2R0QC 1A5JA 3JSJA 5FHPA 1XG1A 5IYDJ 4C3HJ 5EGOA 5M5YJ 1FEXA 1O4XA 1MBJA 4FE7A 5IPAA 4V2GA 3LSPA 1MH4A 2JN6A 2JA6J 1HOMA 3COLA 4C2MJ 3FRQA 2XGEA 1P7IA 2EZIA 1SGMA 2EZHA 2LR8A 3S17J 2QTQA 1ETOA 1JKOC 3I4NJ 2HDDA 3BR3A 1G2HA 2XGDA 3VVZA 4GCKA 4GFKA 4ME9A 2ME0A 2LD5A 2QKOA 4D5FA 3ZQFA 3GTQJ 5EZGA 4QTRA 5C44J 4JNNA 4A3KJ 4NDLA 2WUIA 1IUFA 3EGQA 1TWCJ 2UXPA 2L0KA 2DMTA 2DG7A 4DYQA 1RPWA 3QQAA 2Y9ZA 3HOXJ 2D5VA 4W97A 3I4MJ 3FK6A 2JJ7A 1IG7A 1NTCA 2XB5A 1RETA 4J19A 1QPIA 3HOYJ 3CRJA 1MBKA 5M5XJ 1HCRA 3MKLA 3BR6A 2NP5A 3HTIA 1IGNA 2QF7A 1T56A 2ECBA 1JGGA 3ANGA 3HTHA 4JKZA 3RZDJ 3IUVA 2LY9A 2HYTA 1JT6A 1H8AC 5FKNA 1GVDA 2YUSA 3H0GJ 5K7FA 2UXOA 1Z77A 3HEFA 1JJ6C 2E2HJ 3CWRA 3FIWA 1D5YA 2HI3A 4S0HB 3HTAA 4NELA 1BA5A 3V78A 4A69C 4ACIA 1JUSA 1W0TA 2MSYA 3BG3A 1UI5A 1ETXA 2XPWA 4DZJA 3S2DJ 1B8IB 1MBHA 5IP9J 3PASA 1ETQA 1IRZA 5FMPA 3JRFA 1B72B 3E7QA 4HKUA 1LFBA 5AQCA 2G0EA 3RKQA 4JYKA 3BR5A 5EFYA 4EEFG 4BKXA 3QKXA 3WHBA 3BG9A 4Y52J 2QCOA 4IHYA 2XPVA 3C2BA 4M3BA 2EBIA 1TC3C 1S7EA 2CJJA 5F0FA 2MW8A 5FLMJ 3JRAA 5FLVA 3GTMJ 1YRNB 3GTPJ 1VF9A 3TW6A 1IC8A 3LNQA 4RBOA 2JK3A 1YRNA 1QVUA 5D19A 2RAEA 1F36A 3D1NI 5IP7J 2RHAA 3TEDA 1Y1VJ 2CUFA 3QPSA 4M3EA 3GBGA 2M0CA 4V2FA 3RH2A 2PMZN 3KZ9A 2L9RA 1H89C 2TRTA 3Q0UA 3O60A 4FTHA 3VW1A 1E3OC 3HB9A 4A3CJ 3BR1A 4BXXJ 1FIAA 1AHDP 1BW5A 5H9TA 4IHXA 3BNIA 3JRDA 2DA1A 3OOUA 2NOGA 1T33A 2G7LA 5D18A 1VNDA 2E2IJ 4A3LJ 4D7MA 4A3GJ 4X6AJ 4ABZA 1F43A 2O7TA 4HNVA 3RZOJ 4DZPA 3JRHA 2EZLA 3MVPA 3QPLA 1DU6A 3CJDA 3JRGA 5CXGA 1U9OA 1MSEC 3F0CA 4FE4A 2R5ZB 1I6HJ 4BBRJ 4A3JJ 2F07A 2R5YB 2AHQA 2VKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA5 A;  1JUM A;  2VUM J;  2CRG A;  5HBU A;  3BT9 A;  2R5Y A;  1IJW C;  3HE0 A;  2D6Y A;  3G1O A;  2WAQ N;  2QOP A;  5IP6 A;  1JKR C;  1NK3 P;  3GZI A;  2EZK A;  4M3F A;  4GCT A;  3BTL A;  2XSD C;  3B81 A;  1TWF J;  2E2J J;  2DMU A;  2ID6 A;  3BTI A;  5IYC J;  1ZKG A;  3VP5 A;  2IBD A;  5EDN A;  4D7N A;  2OF7 A;  1HF0 A;  1RKT A;  1MBG A;  3SDG A;  1APL C;  4JX5 A;  9ANT A;  4MFE A;  3S16 J;  5E3M A;  2NVX J;  1ZTR A;  1X2M A;  5K7H A;  3M4O J;  3JRB A;  5F0C A;  3VVX A;  1Z0X A;  3LSJ A;  1MSF C;  1RES A;  5E3L A;  2FBQ A;  5F08 A;  1FIP A;  3IH2 A;  4QSH A;  3G7R A;  3TP0 A;  2EQR A;  1JKP C;  1GDT A;  1WI3 A;  5GP9 A;  2NP3 A;  2HQ5 A;  5EYR A;  4C3I J;  2DA6 A;  1ETY A;  5EF6 A;  1X58 A;  3NAU A;  2QWT A;  2AO9 A;  3QBM A;  3PPB A;  2CQX A;  2NVY J;  2OI8 A;  4FCY A;  2ZOZ A;  1I3Q J;  3BHQ A;  5FJ8 J;  2X6O A;  3HTJ A;  3JRC A;  3CDL A;  5FGL A;  3GTO J;  2GFN A;  3LWJ A;  3IV5 A;  3BG5 A;  4UUT A;  4X1E A;  4A3F J;  2ECC A;  1A6I A;  2N8G A;  5J1U A;  4XRS G;  5M3F J;  2W53 A;  1ORK A;  5FKK A;  4B3A A;  4GCL A;  1UHS A;  5CW8 A;  5CXI A;  2H1K A;  3S15 J;  2FJ1 A;  3HGY A;  4GFB A;  3HOU J;  2UXH A;  1ZR4 A;  2OER A;  4DW6 A;  2XGC A;  1JKQ C;  4M3G A;  3T6N A;  2Y31 A;  3DCF A;  1ETK A;  3ZQC A;  4AYB N;  2L7M P;  3E7L A;  2VPR A;  1WPK A;  2HXO A;  3A01 B;  3CMY A;  3K2A A;  3HOV J;  3BQY A;  4M6V A;  4I6Z A;  5D1R A;  3A01 A;  1MBE A;  2HXI A;  3EUP A;  2UXI A;  3NAR A;  3ZOB A;  1MBF A;  1SAN A;  2M8G X;  4MO7 A;  3HOZ J;  2O8K A;  2DJN A;  3A02 A;  1JT0 A;  1UI6 A;  4IHV A;  5K58 A;  4G12 A;  5GPA A;  3ZQH A;  1Y1W J;  3VW2 A;  5HAW A;  3CQZ J;  2ME6 A;  4LOC A;  2X9D A;  3G1L A;  3PM1 A;  3BRU A;  3K7A J;  3KKC A;  3FIS A;  2GBY A;  1WGX A;  1LE8 B;  2P81 A;  3VOK A;  2MG4 A;  3V6G A;  1JUP A;  3BR0 A;  1LE8 A;  3IH3 A;  1LFU P;  5J3L A;  2RAS A;  1ENH A;  3O8H A;  3S1N J;  4ICH A;  1XC5 A;  2FQ4 A;  3OIO A;  2KDZ A;  5F27 A;  3TW7 A;  2JA5 J;  3S5R A;  1UG2 A;  4JL3 A;  3NRG A;  1TWA J;  2NVT J;  1VFC A;  3M3Y J;  3C07 A;  3KNW A;  2MGQ A;  4UDS A;  2CU7 A;  1BJZ A;  1X2N A;  3BQZ A;  2TCT A;  4M3D A;  5EG0 B;  3JRI A;  4AF5 A;  4B1R A;  4A3M J;  2DA4 A;  1U78 A;  5E3O A;  2LLK A;  2Y2Z A;  4JP0 A;  5EG0 A;  2O9L A;  2I10 A;  2IEK A;  4A93 J;  1WCM J;  5J1Y A;  2ZOY A;  2GM4 A;  3ON2 A;  1RKW A;  4C3J J;  1CQT A;  3JR9 A;  1U8B A;  2PZ9 A;  2Y30 A;  3BJB A;  3GTK J;  2ID3 A;  4BY7 J;  4UUS B;  1XS9 A;  1MNM C;  3BTC A;  2R7Z J;  3LHQ A;  4UUS A;  2LP0 A;  3L1P A;  1ZGW A;  2X48 A;  2CQQ A;  2G7G A;  2E19 A;  2QIB A;  5EEA A;  5M5W J;  2LKX A;  2WV1 A;  1FJL A;  2B63 J;  3Q3S A;  2L7F P;  3IH4 A;  3HGG A;  5JLW A;  2R5Z A;  3OSG A;  3FK7 A;  3NI7 A;  1QVT A;  3NXC A;  5BNG A;  3HDD A;  1PUF B;  2VKV A;  4XID A;  3VPR A;  3NNR A;  3S1R J;  4IEJ A;  1JTY A;  1PUF A;  5DTD A;  4A3E J;  1BL0 A;  3DEW A;  3Q0W A;  2YU9 J;  4AC0 A;  3DPJ A;  4L62 A;  3CCY A;  4AC6 A;  2DTZ A;  4MIM A;  3W6V A;  3BTJ A;  4NN1 A;  5K7Z A;  1BW6 A;  1VI0 A;  2K40 A;  2COB A;  2M34 A;  4XIC A;  3RD3 A;  2L7Z A;  3NPI A;  2HOT A;  5E3N A;  3MNL A;  2JA8 J;  3GEU A;  4PXI A;  2YVH A;  1POG A;  3HBL A;  3B6A A;  5IOY A;  1K61 A;  5C4X J;  2DMQ A;  4MFD A;  5F1J A;  1HLV A;  1OJL A;  2ZCM A;  1AU7 A;  4BY1 J;  2NVQ J;  4A3I J;  5HSZ A;  5IOZ A;  2Y9Y A;  2XB0 X;  4IHW A;  2EH3 A;  2K9Q A;  2DA2 A;  1H88 C;  2DA7 A;  5IYB J;  3WHC A;  3ZQI A;  2WB1 N;  1HDD C;  3GTG J;  2HOA A;  1IDZ A;  1ETW A;  1ZQ3 P;  3VW0 A;  2R92 J;  3VOX A;  2HOS A;  2XPU A;  5M3M J;  4D5C A;  2LFB A;  1HDP A;  3FKI J;  4FIS A;  5C4J J;  2XRL A;  2GEN A;  1I50 J;  1U9N A;  3RQI A;  3LJL A;  4MK6 A;  4YZE A;  3LOC A;  5J1R A;  1ZR2 A;  2JMW A;  2GUH A;  3VIB A;  2IU5 A;  3ON4 A;  4KWA A;  1FTT A;  4B4C A;  1GV2 A;  3F1B A;  3AQT A;  4XRM A;  1JJ8 C;  1GV5 A;  1W0U A;  1WH5 A;  5FKL A;  3SFI A;  3ZQG A;  5FKO A;  5FKM A;  1AKH B;  4BBS J;  1OCP A;  1WH7 A;  2NS7 A;  5C3E J;  3KKD A;  3G1M A;  3HM5 A;  1AKH A;  1TWG J;  1IV6 A;  3S1M J;  1ZK8 A;  2VI6 A;  1TWH J;  2Y0S N;  5F0H A;  3H3V K;  4XK4 A;  4RDU A;  2FD5 A;  2ELK A;  5EZH A;  1GUU A;  1B8I A;  4CYC B;  3OSF A;  1B72 A;  4XRS A;  2KT0 A;  1K83 J;  2WGB A;  4DYR A;  2LK2 A;  1Q1V A;  4CYC A;  3GTJ J;  3SJM A;  3UKG A;  4W1U A;  2YVE A;  2OPT A;  2M9H A;  1EF4 A;  4GFL A;  2UXU A;  4DYC A;  3S2H J;  3BCG A;  2NS8 A;  3B6C A;  4I76 A;  2E1O A;  1OFC X;  1P7J A;  3BR2 A;  4JX6 A;  4JX4 A;  2DA3 A;  2W48 A;  2K9S A;  2R93 J;  2M2E A;  1UMQ A;  4L5E A;  5F04 A;  2HKU A;  1IDY A;  2IAI A;  3A03 A;  2H8R A;  2JA7 J;  3MN2 A;  4A3B J;  4MXM A;  3HIM A;  2YS9 A;  3Q0V A;  1DU0 A;  2FX0 A;  2LTP A;  1OCT C;  3ZQL A;  1MH3 A;  1QRY A;  3O8G A;  2PBX A;  2Q24 A;  1ITY A;  3VUQ A;  3HOW J;  2JWT A;  5HOD A;  5C4Y A;  3P9T A;  2DMN A;  2O7O A;  1GT0 C;  3HKZ N;  2GLO A;  3AQS A;  2DG8 A;  2ZB9 A;  3TP3 A;  5JLX A;  2NX4 A;  2K9N A;  3JRE A;  3G56 A;  4MLO A;  4CGR A;  3S14 J;  5DAJ A;  2DMP A;  2ZCN A;  4Y7N J;  1NK2 P;  2CUE A;  3LSR A;  1R9T J;  2V57 A;  2ZCX A;  2G7S A;  2G3B A;  2HYJ A;  3PO2 J;  5DS9 A;  1ETV A;  4QIW N;  3ANP A;  3S1Q J;  4A3D J;  5GPC A;  1FTZ A;  2XDN A;  2REK A;  3VVY A;  3GTL J;  3PO3 J;  1JTX A;  3LSG A;  4AUX A;  2DN0 A;  5EGO B;  1SFO J;  1RR7 A;  2LVS A;  2R0Q C;  1A5J A;  3JSJ A;  5FHP A;  1XG1 A;  5IYD J;  4C3H J;  5EGO A;  5M5Y J;  1FEX A;  1O4X A;  1MBJ A;  4FE7 A;  5IPA A;  4V2G A;  3LSP A;  1MH4 A;  2JN6 A;  2JA6 J;  1HOM A;  3COL A;  4C2M J;  3FRQ A;  2XGE A;  1P7I A;  2EZI A;  1SGM A;  2EZH A;  2LR8 A;  3S17 J;  2QTQ A;  1ETO A;  1JKO C;  3I4N J;  2HDD A;  3BR3 A;  1G2H A;  2XGD A;  3VVZ A;  4GCK A;  4GFK A;  4ME9 A;  2ME0 A;  2LD5 A;  2QKO A;  4D5F A;  3ZQF A;  3GTQ J;  5EZG A;  4QTR A;  5C44 J;  4JNN A;  4A3K J;  4NDL A;  2WUI A;  1IUF A;  3EGQ A;  1TWC J;  2UXP A;  2L0K A;  2DMT A;  2DG7 A;  4DYQ A;  1RPW A;  3QQA A;  2Y9Z A;  3HOX J;  2D5V A;  4W97 A;  3I4M J;  3FK6 A;  2JJ7 A;  1IG7 A;  1NTC A;  2XB5 A;  1RET A;  4J19 A;  1QPI A;  3HOY J;  3CRJ A;  1MBK A;  5M5X J;  1HCR A;  3MKL A;  3BR6 A;  2NP5 A;  3HTI A;  1IGN A;  2QF7 A;  1T56 A;  2ECB A;  1JGG A;  3ANG A;  3HTH A;  4JKZ A;  3RZD J;  3IUV A;  2LY9 A;  2HYT A;  1JT6 A;  1H8A C;  5FKN A;  1GVD A;  2YUS A;  3H0G J;  5K7F A;  2UXO A;  1Z77 A;  3HEF A;  1JJ6 C;  2E2H J;  3CWR A;  3FIW A;  1D5Y A;  2HI3 A;  4S0H B;  3HTA A;  4NEL A;  1BA5 A;  3V78 A;  4A69 C;  4ACI A;  1JUS A;  1W0T A;  2MSY A;  3BG3 A;  1UI5 A;  1ETX A;  2XPW A;  4DZJ A;  3S2D J;  1B8I B;  1MBH A;  5IP9 J;  3PAS A;  1ETQ A;  1IRZ A;  5FMP A;  3JRF A;  1B72 B;  3E7Q A;  4HKU A;  1LFB A;  5AQC A;  2G0E A;  3RKQ A;  4JYK A;  3BR5 A;  5EFY A;  4EEF G;  4BKX A;  3QKX A;  3WHB A;  3BG9 A;  4Y52 J;  2QCO A;  4IHY A;  2XPV A;  3C2B A;  4M3B A;  2EBI A;  1TC3 C;  1S7E A;  2CJJ A;  5F0F A;  2MW8 A;  5FLM J;  3JRA A;  5FLV A;  3GTM J;  1YRN B;  3GTP J;  1VF9 A;  3TW6 A;  1IC8 A;  3LNQ A;  4RBO A;  2JK3 A;  1YRN A;  1QVU A;  5D19 A;  2RAE A;  1F36 A;  3D1N I;  5IP7 J;  2RHA A;  3TED A;  1Y1V J;  2CUF A;  3QPS A;  4M3E A;  3GBG A;  2M0C A;  4V2F A;  3RH2 A;  2PMZ N;  3KZ9 A;  2L9R A;  1H89 C;  2TRT A;  3Q0U A;  3O60 A;  4FTH A;  3VW1 A;  1E3O C;  3HB9 A;  4A3C J;  3BR1 A;  4BXX J;  1FIA A;  1AHD P;  1BW5 A;  5H9T A;  4IHX A;  3BNI A;  3JRD A;  2DA1 A;  3OOU A;  2NOG A;  1T33 A;  2G7L A;  5D18 A;  1VND A;  2E2I J;  4A3L J;  4D7M A;  4A3G J;  4X6A J;  4ABZ A;  1F43 A;  2O7T A;  4HNV A;  3RZO J;  4DZP A;  3JRH A;  2EZL A;  3MVP A;  3QPL A;  1DU6 A;  3CJD A;  3JRG A;  5CXG A;  1U9O A;  1MSE C;  3F0C A;  4FE4 A;  2R5Z B;  1I6H J;  4BBR J;  4A3J J;  2F07 A;  2R5Y B;  2AHQ A;  2VKE A; 
#chains in the Genus database with same CATH topology
 2VUM J;  1JUM A;  5E1Z B;  3TBI A;  2OA4 A;  1XTA A;  4HQE A;  1S6L A;  4EJV A;  2L4M A;  5BOX A;  2IT0 A;  2D6Y A;  1HST A;  3EQL F;  3SDB A;  2X6W A;  1OCZ H;  2KZG A;  3KX2 A;  2LF7 A;  4GCT A;  3BJ6 A;  3FXR A;  4NC8 A;  1TWF J;  2E2J J;  2ID6 A;  2GXB A;  3VP5 A;  2IBD A;  3OL4 A;  2FNP A;  3A2K A;  2HU9 A;  2FRH A;  4CCO A;  2M1B A;  4KMF A;  3SDG A;  2W7N A;  1APL C;  3PSF A;  3S16 J;  2NVX J;  1E3P A;  1QGP A;  2DT7 B;  3E97 A;  3ERM A;  3IWF A;  1FYL A;  3TMO A;  2JQ7 A;  2B1E A;  4H4K C;  1Z0X A;  4G9Y A;  3BG6 A;  5E3L A;  4KFC A;  1U5T A;  2KP6 A;  3ESW B;  3G7R A;  5CQE A;  3TP0 A;  3CC2 I;  1NG6 A;  2KJC A;  3K4M A;  2NP3 A;  2XV4 S;  4CO8 A;  1N75 A;  3WGH A;  3VTI A;  3GX4 X;  3PPB A;  3HPH A;  2EFQ A;  3R6S A;  1WJC A;  2VJ5 A;  3VOE A;  4FCY A;  1AA7 A;  2ZOZ A;  1I3Q J;  4ESJ A;  1V5F A;  2KKO A;  5ICC A;  4LLL A;  5FJ8 J;  4BGD A;  4FET A;  1OR7 C;  3DTK A;  3WTS C;  4GRI A;  3GZ6 A;  5FGL A;  3LWJ A;  3IV5 A;  3GME A;  4UUT A;  1VQ9 I;  1H9G A;  4A3F J;  2ZBK A;  1A6I A;  4XRS G;  3PL8 A;  5B5E C;  5FKK A;  2EFO A;  5CXI A;  2H1K A;  5GAD J;  4KNY A;  1TQP A;  2IGO A;  4GFB A;  3FBI B;  3ZQQ A;  5HLI A;  4BH9 A;  1O3T A;  3LSK A;  1ZGA A;  2XGC A;  4DW6 A;  3OR1 C;  3DV8 A;  1YW7 A;  2YX7 A;  1FLI A;  2M7B A;  4FX4 A;  4IQ4 A;  4XKB A;  3REO A;  4EQQ A;  3K8P C;  2GIZ A;  2VPR A;  4CXF A;  1VQ4 I;  3TDU C;  5HOO A;  3QP6 A;  3CMY A;  4KMU X;  3HOV J;  4M6V A;  5D1R A;  3BLY A;  3V7R A;  1MBE A;  2Q2E B;  1SD5 A;  1MIJ A;  2HXI A;  2CG4 A;  3I64 A;  5L3D A;  1VQN I;  5JI6 A;  3PNV A;  2RNG A;  2Q2E A;  1UG0 A;  3PNT A;  5LFA A;  1V5G A;  3ZQH A;  5D6E A;  2XUB A;  1T08 B;  4U87 A;  2JT1 A;  3I71 A;  3VW2 A;  4C9Y A;  1UFM A;  3PNY A;  1SVM A;  1ON2 A;  4UXN A;  2V9K A;  2EB7 A;  3G1L A;  2OZU A;  3BRU A;  4WCG A;  2DFH A;  3KKC A;  3FIS A;  4B44 A;  1F5T A;  2D2W A;  3M8J A;  2CYY A;  4HG2 A;  3BJA A;  4YFX F;  1X1B A;  1JUP A;  3ABK H;  3OYH A;  3CCQ I;  1LFU P;  4XLN F;  4GDF A;  3B02 A;  1EV7 A;  1M1E B;  2TDX A;  4ICH A;  1XC5 A;  4PGG A;  2NYX A;  2W00 A;  3MFK A;  4A2U A;  3QOD A;  1Z6T A;  4UY8 I;  3NRG A;  1TWA J;  2M45 A;  5E18 F;  2NVT J;  1VFC A;  3M3Y J;  5FLX K;  2VKH A;  5L3G A;  1LPQ A;  4MQV A;  3BQZ A;  1X2N A;  4M3D A;  3JRI A;  5LBQ A;  3E3V A;  2EA2 A;  4U0W A;  3J81 K;  3ZP5 A;  2PX9 A;  4DBQ A;  3K1N A;  3AG1 H;  3ON2 A;  4A12 A;  4C3J J;  2W84 A;  5L3E A;  1HA8 A;  2Y30 A;  3JTH A;  2BEO A;  2DOF A;  2P7C B;  3KET A;  1LJ9 A;  1IO2 A;  5J47 A;  2ID3 A;  2L4A A;  1XS9 A;  4JQF A;  4E7H A;  3NRV A;  4OIN F;  4HBL A;  4TV7 A;  4WX9 A;  3LHQ A;  2JSC A;  3W2V A;  1ZGW A;  5JHU A;  3G6E I;  2V6C A;  2BY1 A;  2HQN A;  2G7G A;  1BI2 A;  3Q3S A;  1R4M B;  2JUC A;  2L7F P;  3BCB A;  3IH4 A;  5CVI A;  5HVQ C;  3OSG A;  3FK7 A;  2OQR A;  1UHM A;  2STT A;  3HDD A;  3BJO A;  1BM9 A;  1TZL A;  3JSP A;  3NNR A;  3S1R J;  1RC9 A;  4IEJ A;  4AC0 A;  4KT5 C;  1W7P D;  4AC6 A;  4R8H A;  3W6V A;  4F92 B;  4HST A;  5K5Q A;  2K40 A;  1VI0 A;  2M34 A;  2D45 A;  4HRI A;  2L7Z A;  1KQ9 A;  2HOT A;  3G2B A;  3AAF A;  2QUF A;  2JA8 J;  1VQP I;  2K5C A;  4NHJ A;  1POG A;  3GCM A;  4BE0 A;  4L9J A;  3BY6 A;  2R7W A;  3FX3 A;  2DU9 A;  1KA8 A;  1Z7L A;  3E6B A;  1SFE A;  3CDH A;  3GF2 A;  5IOY A;  3I56 I;  1QZZ A;  2MBF A;  1XMK A;  3CME I;  1OJL A;  2CQN A;  4F3Q A;  4D1Q A;  4LIU A;  3U1K A;  3CES A;  2Y9Y A;  4RLQ A;  4HQM A;  2DFI A;  2OUM A;  3K1M A;  5TJJ A;  3L2W A;  1R1V A;  3H1C A;  2K9Q A;  3IKV A;  4I02 A;  2DA7 A;  2M87 A;  3BOQ A;  3DKX A;  3ZQI A;  2WB1 N;  1MKM A;  1REP C;  3GTG J;  2FJI 1;  4MEX F;  2HOA A;  4S04 A;  1ZQ3 P;  5TGT A;  4DOZ A;  2HOS A;  2A3S A;  1J2X A;  2XPU A;  5M3M J;  3U2R A;  2LFB A;  2A5W A;  3FKI J;  2VC0 A;  2DPD A;  2IGM A;  2GEN A;  2ETH A;  3LJL A;  4YZE A;  3F6V A;  3KLN A;  1ZR2 A;  1B9M A;  1PP7 U;  1XX5 A;  2VIX A;  4EM0 B;  2UZK A;  4KWA A;  1BI3 A;  4Y3O A;  2QGU A;  1JJ8 C;  2B0L A;  4RGU A;  1WH5 A;  4ITV A;  2A6T A;  4I2O A;  3CC4 I;  2HQA A;  1AKH B;  2DDA A;  5DUI A;  2XDV A;  2Y75 A;  5HDK A;  3KKD A;  3HM5 A;  1AKH A;  1AWC A;  2DJI A;  1ZK8 A;  1LEA A;  4PJN A;  3F8F A;  1G3S A;  1DUX C;  1G8X A;  1XMX A;  5H6Q A;  4RDU A;  2FD5 A;  1GUU A;  2XAS A;  2FSW A;  2XIG A;  4RAF A;  2XAH A;  4B47 A;  4CYC B;  3MEX A;  2BE5 F;  5J8F A;  1B72 A;  4XLP F;  2KT0 A;  4UB6 C;  1HKT A;  1OIS A;  4LB6 B;  4DYR A;  4CYC A;  1WSU A;  3FXL A;  3DPU A;  4LK1 F;  3SJM A;  4W1U A;  2UXU A;  1PYV A;  3H5R A;  4DYC A;  4L0Z B;  3MAJ A;  3S2H J;  1R49 A;  2QSF X;  2UWM A;  1FNN A;  4NC6 A;  1QA6 A;  3CLQ A;  2FMY A;  4CIC A;  2VKD A;  2NAZ A;  1IF1 A;  4JX4 A;  4IXA A;  2WTE A;  3RJP A;  2W48 A;  4BJ6 C;  3FXU A;  2M2E A;  1TNS A;  4L5E A;  3HOS A;  4BHB A;  1IDY A;  3J7Y J;  2JA7 J;  2NNY A;  3SZT A;  5BPD A;  1QHG A;  3Q0V A;  1VQO I;  2K3P A;  1FOX A;  5JVG F;  2FX0 A;  1RI7 A;  5TRD A;  4E7Z A;  1OCT C;  3WU1 B;  1Z1D A;  3RPQ A;  1MH3 A;  3MZH A;  3H0D A;  1ITY A;  4HF0 A;  4UHT A;  3P9T A;  3GFL A;  5A2Q Z;  2GLO A;  3G73 A;  5JLX A;  3G56 A;  3JRE A;  2XKP A;  3GFM A;  4RM2 A;  2D1H A;  2F4M B;  2DMP A;  2VAS A;  3OYB A;  4DBR A;  4Y7N J;  4ANJ A;  2CUE A;  3LSR A;  2M4K A;  2ZCX A;  2G7S A;  1Z91 A;  3NS4 A;  5BMZ A;  4BAC A;  5DS9 A;  1BOB A;  1TL8 A;  3LA3 A;  2EFP A;  2VJI A;  1ETV A;  3ANP A;  1QZE A;  2LRD A;  1D3Y A;  1OPC A;  5JR3 A;  1Y6I A;  2XDN A;  2IS2 A;  1R22 A;  4ZYH A;  1MND A;  2LVS A;  5FHP A;  3ZPL A;  1MZB A;  1W5C C;  5KAI C;  4BDY A;  4C3H J;  1XPX A;  5M5Y J;  1IW7 F;  3P9C A;  5HNF A;  3LSP A;  2JA6 J;  3COL A;  4C2M J;  4EGZ A;  3FRQ A;  4UVB A;  1P7I A;  2OJE D;  2VXD A;  1P2F A;  2EZH A;  5ERI A;  2QTQ A;  4XR6 A;  3QOE A;  2BBY A;  5D6F A;  1U3E M;  3ERE D;  1IRX A;  3ZQF A;  3GTQ J;  3AG2 H;  3U1D A;  5EZG A;  2ZNZ A;  3EGQ A;  1OMI A;  3KFW X;  5AIP A;  3HG9 A;  2M0M A;  2UXP A;  5EJC A;  2L0K A;  1DDN A;  4XOR A;  3KEY A;  2KRC A;  1MJ9 A;  3QQA A;  2JJ7 A;  3AG4 H;  4L18 B;  1FOW A;  1LB2 A;  1VQ6 I;  4RB0 A;  1SVL A;  3KZY A;  5M5X J;  3MKL A;  1UST A;  3BR6 A;  1L3L A;  1HC8 A;  1IGN A;  4JKZ A;  1YJ9 I;  2ZSH B;  3JSO A;  3IUV A;  4NNJ A;  4C2T A;  1JT6 A;  1H8A C;  2XHK A;  1GVD A;  5IT3 A;  3KP7 A;  2IXS A;  4GYG A;  4L0Y B;  3GZN B;  1XSD A;  3GVA A;  4NQW B;  3FZV A;  1BA5 A;  1OLT A;  2VBX A;  3OYG A;  3RI4 A;  3ABL H;  2PFV A;  2F5E A;  3BG3 A;  2Z99 A;  4WWC A;  3S2D J;  1MBH A;  2XF5 A;  3CCL I;  1JE8 A;  3MCZ A;  2DXI A;  2VB6 A;  5FD6 A;  3QKX A;  1QU3 A;  3DU6 A;  4KJZ A;  3SFZ A;  1R5H A;  4Y52 J;  3MD2 A;  4IZZ A;  2QCO A;  1R23 A;  4HV5 A;  4WK8 F;  3C2B A;  2EBI A;  3W2A A;  4O6J A;  1TC3 C;  1K79 A;  2IGK A;  2E71 A;  3JRA A;  1YRN B;  2YU3 A;  5HS8 A;  3BZ6 A;  1MNE A;  1IC8 A;  1FSH A;  3I5U A;  1YRN A;  5D19 A;  3DBR B;  4KIC A;  5KHD A;  1UAA A;  2A5Y B;  3TED A;  1HKQ A;  4V2F A;  5ILU A;  1TW3 A;  2X85 A;  2MH9 A;  2L9R A;  1LVK A;  1H89 C;  2EIJ H;  2TRT A;  3Q0U A;  2L9N A;  4P9U A;  3O60 A;  5ILS A;  5ICE A;  3HRM A;  3FWE A;  1E3O C;  1FYK A;  1KU9 A;  1T0F C;  1BW5 A;  2L5Q A;  3K9T A;  3BNI A;  3F22 A;  1MGT A;  3TKY A;  5J40 A;  5D18 A;  4IX7 A;  2G7L A;  3S8P A;  1F43 A;  2O7T A;  4HNV A;  3RZO J;  4OIR F;  3JRH A;  2O0Y A;  2Q1Z B;  5JFR A;  3JRG A;  4E7J A;  5J6X A;  2V6E A;  1I6H J;  2R5Y B;  2AHQ A;  2VKE A;  1G3W A;  2JUG A;  3M7G A;  5HBU A;  2DOD A;  2B9S A;  2R5Y A;  1DPR A;  2MLG A;  2Z3Y A;  2WAQ N;  3VDX A;  5FRN A;  1D8J A;  4FQG A;  1NK3 P;  2EZK A;  4M3F A;  2IA2 A;  2XSD C;  3B81 A;  2OU2 A;  3BTI A;  1ZKG A;  1ONV A;  5EDN A;  2X1D A;  2K02 A;  2R7D A;  2OF7 A;  2EPF A;  3CLO A;  1RZ4 A;  2X4H A;  4MFE A;  5E3M A;  1Y39 A;  2DQR A;  2FBI A;  3EUA A;  2OCE A;  4AWX B;  3GLX A;  1G6N A;  3DPL C;  1VZ0 A;  3QU6 A;  4RM3 A;  1R5I D;  1U6G A;  2VJJ A;  1YW8 A;  3RCO A;  2L54 A;  1TT5 B;  4M9X A;  1RES A;  2HKX A;  3NWS A;  5F08 A;  3IH2 A;  4O5V A;  3IP4 B;  2QKL B;  3QRF F;  2EQR A;  1GDT A;  3DF8 A;  5LHI A;  5GP9 A;  3UNG C;  4C3I J;  2DA6 A;  4PJL A;  2L01 A;  4XRF A;  4RS8 A;  1X58 A;  3FXM A;  2LC2 A;  1QPM A;  2CQX A;  2HTJ A;  1NG7 A;  5DD8 A;  2OI8 A;  1TTY A;  3E5X A;  3H36 A;  3H92 A;  3KZI C;  1WJE A;  3HTJ A;  2FOW A;  3CJR B;  2ICW G;  3CDL A;  3K0L A;  1J0R A;  3BG5 A;  3ZN0 A;  4X1E A;  3NWT A;  5D8L B;  2Y0M A;  2AS5 F;  3RPU A;  4B3A A;  5GAG J;  1UHS A;  1K6O A;  3ASO H;  5CW8 A;  3S15 J;  1P4X A;  3CCU I;  2FJ1 A;  3WTZ A;  3HGY A;  2Z5U A;  2GXG A;  3SEQ A;  2RDP A;  1HBX G;  3WU2 C;  2P5V A;  1SD6 A;  2BGC A;  2EIK H;  4HNT A;  1U0J A;  2A2F X;  1ZLK A;  1ZH5 A;  3BCA A;  2IJL A;  2V1U A;  4AYB N;  4UVA A;  1XB4 A;  5D4S A;  4MTE A;  2VQH A;  3A01 B;  1CF7 B;  3HSF A;  2GXA A;  4G7Z F;  4I7H A;  4I6Z A;  1T8I A;  3T5X A;  1N25 A;  3VYS B;  3A01 A;  1CF7 A;  3EUP A;  4HNU A;  3NAR A;  4EAT A;  2XAQ A;  1ZAR A;  4LG3 A;  3HOZ J;  1JT0 A;  3RYR A;  3OIQ A;  2H1L A;  4HPQ A;  4N4N B;  3V8L A;  4EGY A;  1VQK I;  5HAW A;  2KIF A;  1R6R A;  1QNT A;  2KIM A;  1KON A;  4FT8 A;  4RGS A;  5GTH C;  1STZ A;  2I5U A;  4BJT A;  4AIH A;  4ENN A;  3K7A J;  5DD4 A;  5GAH J;  4XKC A;  1WKM A;  3CUO A;  2KLO A;  3EDP A;  2K9L A;  2V9V A;  2A07 F;  4OIO F;  3IH3 A;  4YEJ A;  1ACI A;  4PZJ A;  5L3C A;  2ADU A;  5J3L A;  3KP4 A;  5D5V B;  1V55 H;  1H9T A;  3WGI A;  4KIB A;  4UVC A;  1FZP B;  2JA5 J;  1UG2 A;  2F4I A;  1QHH D;  2HYF A;  2P6S A;  3HKZ A;  4N9I A;  2MGQ A;  4IPA A;  4P5O A;  4CH7 A;  2KPM A;  4B1R A;  2DA4 A;  3LQQ A;  2QVO A;  3CO6 C;  5IT9 Z;  3WG9 A;  1A04 A;  2O9L A;  2FE3 A;  2I10 A;  2IEK A;  4A93 J;  1WCM J;  5J1Y A;  3FMQ A;  4S05 A;  3WGG A;  4U7D A;  2V4J C;  3Q5F A;  2ZOY A;  2LKP A;  2W24 A;  4AIJ A;  4M9S A;  5KCM A;  3JR9 A;  2ZJP F;  4ENK A;  4XNF A;  2EJR A;  1U8B A;  3FXQ A;  1K78 B;  4U88 A;  2BZT A;  1X3W B;  4RAZ A;  3BDD A;  5GAE J;  2ZJQ F;  4Y4R A;  3GTK J;  1B59 A;  4CGZ A;  2ZO4 A;  1K78 A;  2QQ8 A;  4BY7 J;  4RB3 C;  3M8E A;  3OYM A;  5LRR A;  2R7Z J;  2CW0 F;  5KNL A;  2LP0 A;  3CO7 C;  2LY2 A;  4OD4 A;  2QIB A;  3QP5 A;  5CQG A;  5M5W J;  1FJL A;  3P5J A;  1WJA A;  2VOO A;  3PQJ A;  3HGG A;  3C1D A;  1FOK A;  2L9S A;  3EYI A;  2ZXH A;  2BVM A;  3SHF A;  1U5T B;  4BE1 A;  3BPX A;  4ZYD A;  1PUF B;  3CF5 F;  2VKV A;  1D0X A;  3ZMV A;  4XID A;  1QBJ A;  4U0V A;  1GVJ A;  2HZT A;  2A6E F;  3WE3 A;  3DLL F;  3GXO A;  2OTJ I;  1PUF A;  4A3E J;  1BL0 A;  3Q0W A;  3QPH A;  3CCY A;  4BQN A;  2DTZ A;  2FBH A;  4PUS A;  1A6Q A;  3FDY A;  3I4P A;  4OMY A;  1BW6 A;  3LFU A;  3QPT A;  4XIC A;  3OYE A;  2ISY A;  2VC1 A;  4PXI A;  1U5T C;  1Z05 A;  2LBF B;  3DXJ F;  5HNH A;  3HBL A;  1QZY A;  2LYC A;  3K10 A;  5ILV A;  2ESN A;  2LBF A;  4OOI A;  1K61 A;  1IXC A;  3A1Y A;  4RAG A;  4ZYA A;  3J80 Z;  4Z2Y A;  1FOY A;  1KGS A;  2WY7 Q;  1Z21 A;  4PSW A;  5DV5 A;  4A3I J;  2F5C A;  4E6K G;  3EUH A;  3OS2 A;  1H88 C;  1KQ0 A;  1ZG5 A;  2FXA A;  3OL3 A;  2HVQ A;  2IGN A;  1JGS A;  3MKZ A;  2A6H F;  2R7U A;  4D5C A;  1P9Q C;  2BXZ A;  1R7J A;  4BS9 A;  4D0P A;  1I50 J;  1U9N A;  1GXQ A;  3DKY A;  1RUO A;  2R7S A;  5CVJ A;  3FF5 A;  3EUH C;  3L00 A;  3R0J A;  4HW0 A;  5J1R A;  2GUH A;  4LGW A;  3E6M A;  3ON4 A;  1GV2 A;  5F1R A;  4NC7 A;  4J01 A;  1IRG A;  3F1B A;  2GIV A;  1GV5 A;  5EEG A;  2PQ8 A;  1S8N A;  4G94 A;  3K70 D;  3SQN A;  1OCP A;  5C3E J;  3LWF A;  4RGX A;  1DP7 P;  4UNO A;  2XGX A;  1IN6 A;  1TWG J;  2JVH A;  1IV6 A;  3CCJ I;  3HZJ A;  1R00 A;  3K4C A;  1G3Y A;  3TDZ C;  2BW3 B;  4CCN A;  4BNC A;  1ZRF A;  3A0H C;  5F0H A;  3H3V K;  3ECH A;  2BW3 A;  5EZH A;  1FP1 D;  1J7K A;  1OYW A;  2LOO A;  3DEE A;  4XBF A;  1B8I A;  3OMY A;  2F48 A;  3BPV A;  2CV1 A;  4A0Y A;  3LSH A;  3R61 A;  2VN2 A;  3A0B C;  2AXT C;  4PGH A;  2F5V A;  2LK2 A;  2E35 A;  3DLA A;  2VQL A;  3UKG A;  2NVU B;  2OPT A;  1EF4 A;  4G7H F;  1V4R A;  3LQR A;  5JHF A;  4Y33 A;  3RKW A;  2HPI A;  1LQ1 A;  2IS1 A;  2VOP A;  2NOJ B;  3RKX A;  1K4T A;  2CV0 A;  2YSR A;  2ZXI A;  3BG7 A;  3TO6 A;  1MJA A;  3CP2 A;  1ZYR F;  2ZKZ A;  1MMA A;  3OV8 A;  2DA3 A;  2K9S A;  3E5Q A;  4UUV A;  3SXY A;  3V7S A;  3CMA I;  4DIQ A;  3RSN A;  2H8R A;  4A3B J;  4MXM A;  1Y56 A;  3HIM A;  2YS9 A;  1WFX A;  2WV0 A;  2OAZ A;  4M71 A;  1JXS A;  4BJ5 C;  3OYF A;  2X6X A;  3RDI A;  2QA4 I;  1QRY A;  3WOD F;  4YFK F;  1Z3Y A;  2GA2 A;  2Q24 A;  4I99 C;  2W4S A;  3DPT A;  1KYZ A;  3LAJ A;  3CD6 I;  2JWT A;  4KIF A;  2O7O A;  4RAY A;  2GA1 A;  3TP3 A;  5FB2 A;  2NX4 A;  1GXP A;  1I3A A;  1IZ1 A;  4ZTF A;  1N77 A;  4MLO A;  2MH2 A;  4CGR A;  5DAJ A;  3O6B B;  2ZCN A;  2JTV A;  4ZYG A;  1MMD A;  2R7X A;  1T38 A;  1BI1 A;  3AFH A;  5H2F C;  2IW5 A;  2HYJ A;  3PO2 J;  4ESB A;  2PI0 A;  1P4A A;  3ZMT A;  4KDP A;  5FO5 A;  2KIQ A;  3S1Q J;  4Y15 A;  1P6R A;  1XGN A;  5KVR A;  3L7W A;  5GPC A;  3P9K A;  3VVY A;  4LLG F;  5DM7 F;  1FBQ A;  3ML6 A;  3GTL J;  3PO3 J;  3LSG A;  4AUX A;  3VSL A;  3OIP A;  2FU4 A;  3OYD A;  1E3H A;  4YFN F;  1A5J A;  3R60 A;  2DI3 A;  1XG1 A;  2A68 F;  5IYD J;  2BHZ A;  1O4X A;  5FD5 A;  5CVV A;  1BR1 A;  1RRJ A;  1HOM A;  4I98 B;  1F4K A;  3LA7 A;  3MWM A;  4RB2 C;  2EZI A;  3FMS A;  1SGM A;  3HTU A;  2L9V A;  2LR8 A;  3KP5 A;  3DFG A;  4BHP A;  2CGP A;  2EFN A;  2IS4 A;  3MKY B;  3K4N A;  1ETO A;  4CYD A;  1JKO C;  5D5U B;  1BC7 C;  1HSJ A;  1B9N A;  3PIO F;  1TQM A;  4Y13 A;  4Q5S F;  2LMD A;  2QKO A;  5LGT A;  1WWX A;  3LFK A;  5C44 J;  3HPG A;  3U9G A;  1G3T A;  2F5F A;  3CJN A;  4HX8 A;  1TWC J;  2DMT A;  2DG7 A;  2WAE A;  1F9N A;  2Y9Z A;  4FAS D;  1L0O C;  1FMV A;  3I53 A;  4BL0 B;  4HOB A;  1RET A;  2KRF A;  3GYH X;  3H9G A;  3W3C A;  4JBA A;  4XOT A;  2NXN B;  2NP5 A;  3A4C A;  2CW7 A;  4AVZ A;  2ECB A;  2Z1D A;  3IRQ A;  1UB9 A;  2LH9 A;  3KYC B;  5HLT A;  2F4O B;  5FKN A;  2P8T A;  2YUS A;  3H0G J;  4BQQ A;  1G59 A;  1XSV A;  3F21 A;  3PFI A;  4Y17 A;  4DVY P;  3J80 K;  4S0H B;  1EKE A;  4HSR A;  4BQO A;  3CC7 I;  4NEL A;  3V78 A;  2PMU A;  4ACI A;  3EUK L;  1W0T A;  1YFH A;  4XMY A;  1LKX A;  2P6T A;  3CCV I;  3EET A;  3PAS A;  3TGN A;  5IP9 J;  1WRJ A;  1ETQ A;  1K4S A;  1XGS A;  3FXK A;  5FMP A;  3JRF A;  2DCE A;  4QWQ A;  3TO7 A;  1B72 B;  4HKU A;  2R7Q A;  5AQC A;  2GQQ A;  2C6Y A;  4PFP A;  3BR5 A;  4F93 B;  1YHQ I;  4WF2 A;  2V1D A;  3BG9 A;  1IV8 A;  1QO0 D;  3FHZ A;  2FEZ A;  2HQR A;  3E0J B;  4F7Z A;  1SEU A;  4IHY A;  3K4L A;  4M3B A;  4NUB A;  1W7P B;  2BY3 A;  1S7E A;  1X3U A;  2PN6 A;  2MW8 A;  3Q9V A;  5FLM J;  3MKW B;  1X1C A;  3TW6 A;  1SAX A;  1W7P A;  2X1E A;  3WTU C;  3N97 A;  2RAE A;  1F36 A;  3D1N I;  1I1G A;  2RHA A;  4EV0 A;  3V8K A;  3QPS A;  4L5I A;  3ULQ B;  2M0C A;  2PMZ N;  3KZ9 A;  2ELH A;  3S2W A;  3QAH A;  2IP2 A;  1IN7 A;  3T0Y A;  3HB9 A;  4WXD A;  4BXX J;  1FIA A;  2XAG A;  5KAF C;  1AHD P;  5H9T A;  2OD5 A;  4IHX A;  3JRD A;  1EA3 A;  2DA1 A;  3OOU A;  2PEX A;  3C3W A;  2NOG A;  1T33 A;  5FRM A;  4PK4 A;  4KIG A;  2E2I J;  4RA2 A;  1HQC A;  4B8X A;  1XCV A;  4DZP A;  3QPL A;  5CXG A;  1U9O A;  1MSE C;  3F0C A;  4MQ9 F;  2GOM A;  4B48 A;  4A3J J;  2DO7 A;  2F07 A;  1O7L A;  3VYT B;  1R58 A;  2WA0 A;  1IJW C;  3PJR A;  2OQG A;  2P5L C;  4HLX A;  1XMA A;  1GLN A;  2J5P A;  5CJ9 A;  3MZY A;  2Z16 A;  4I0B A;  3CCM I;  3GZI A;  1MW7 A;  3D5S C;  2M4G A;  3BTL A;  2DMU A;  5IYC J;  1MMS A;  5J4V A;  4D7N A;  2DQL A;  5DCM B;  3OYN A;  1HF0 A;  4RGR A;  1SAU A;  1UEL B;  5DCM A;  9ANT A;  3ONQ A;  5LD2 C;  3DBL B;  3Q9S A;  3T8R A;  1X2M A;  5K7H A;  3M4O J;  3JRB A;  1V54 H;  2HKO A;  3VYU B;  3ECO A;  3LSJ A;  1MSF C;  2FBQ A;  5ED4 A;  2X51 A;  2CQ7 A;  1UCR A;  4IOA F;  3LMM A;  1KYW A;  1TNT A;  1JKP C;  1WI3 A;  5K5R A;  2HQ5 A;  2JVG A;  2R3S A;  2ISZ A;  5CVR A;  3E1S A;  3KEO A;  4BUP A;  1RNL A;  2O5R A;  5EF6 A;  3I58 A;  1B1B A;  2COM A;  3I9V 2;  3QBM A;  2LKS A;  5B1B H;  2DYS H;  3ABM H;  1YYV A;  1BBY A;  1X1P A;  1MMN A;  3H5A A;  3VYR B;  1TT0 A;  2KHM A;  1YJW I;  5KK1 A;  1TLH B;  3GTO J;  4FHT A;  2PLY A;  2LDU A;  4XN3 A;  2ECC A;  3L2U A;  5J1U A;  5M3F J;  4XKW A;  1ORK A;  4GCL A;  4EJW A;  3CUQ B;  4XQF A;  4O3M A;  4CA0 A;  4L5J A;  2R7O A;  2M8E A;  2UV1 A;  3HOU J;  3CUQ A;  3X2Q H;  2OER A;  3OOP A;  3KZZ A;  4XLF A;  3ASN H;  1JHH A;  2PFB A;  3OYK A;  3WG7 H;  3D5L A;  3ZGK A;  1UHW A;  3DCF A;  5B66 C;  1ETK A;  3ZQC A;  4KA4 A;  1O3R A;  3IKT A;  3F8C A;  3KLO A;  1WPK A;  3K2A A;  3JAM Z;  3GUD A;  3BQY A;  3KEQ A;  3SZP A;  2UXI A;  2XF7 A;  1I27 A;  1BJA A;  1K6Y A;  1MBF A;  2E5N A;  4XLA A;  4IO9 F;  2O8K A;  2DJN A;  1WQ2 A;  1ULY A;  1UI6 A;  3H9Q A;  2MLK A;  3G3Z A;  1Y1W J;  2RQQ A;  4XON A;  3ZXS A;  2MD5 A;  2ZSI B;  1I39 A;  2DOA A;  2H6B A;  1RIO H;  2J5O A;  1D0Z A;  3WE2 A;  4LOC A;  3CZ6 A;  5E8G A;  3BC8 A;  2X9D A;  3LSM A;  5FFZ A;  1X4O A;  1ON1 A;  2FNA A;  1Y0U A;  1V3F A;  3ZMD A;  1XN7 A;  2F2E A;  4PDK A;  4AM3 A;  4BDZ A;  1LE8 B;  1MD0 A;  2L3D A;  1WI9 A;  2JRM A;  2I8D A;  2MG4 A;  2QSH X;  3BWG A;  3VEP A;  1LE8 A;  3DKW A;  3IWZ A;  4M6X A;  2QQ9 A;  4OU0 A;  4ASN A;  1W36 D;  1ENH A;  3O8H A;  3S1N J;  2FQ4 A;  4HDU A;  3OIO A;  1PJR A;  5DEQ A;  4BAY A;  1OCO H;  5F27 A;  4P9F A;  1BC8 C;  1LDJ A;  3S5R A;  2V7F A;  3HHG A;  2K27 A;  2CFX A;  3U21 A;  2V1X A;  1HW5 A;  4X0G A;  3S3M A;  4WXC A;  3C07 A;  3KNW A;  1Z6R A;  4YIR X;  2IPQ X;  3AKZ A;  2ZCW A;  2CU7 A;  4AF5 A;  1GHC A;  1U78 A;  2Y2Z A;  2DFF A;  3TO9 A;  4OD5 A;  2VOD A;  4PSX A;  2GM4 A;  1RKW A;  3KP6 A;  4A0Z A;  3ZR8 X;  3HTS B;  5JVT A;  2PZ9 A;  4F55 A;  2E1M B;  3F8N A;  3QWL A;  1MNM C;  1FWZ A;  1T2K A;  2CUZ A;  3F8M A;  1HXD A;  1ZAO A;  1U2W A;  4CCJ A;  3SEZ A;  2CQQ A;  2KIU A;  2E19 A;  3M8F A;  5EEA A;  2HTS A;  1KZH A;  2LKX A;  1PVE A;  2DBB A;  1SFK A;  3F3X A;  5JLW A;  4LK0 F;  3EPZ A;  3NI7 A;  1SVO A;  3NXC A;  3M9A A;  2Q8K A;  5BNG A;  2MYS A;  4EVI A;  1A31 A;  3VPR A;  2AQF A;  2QQB A;  4ZDO A;  3MMY B;  5TIS C;  4E4H A;  3KIO A;  1D0Y A;  1S5L C;  1YOV B;  3RYP A;  2YU9 J;  4IKF A;  1JHF A;  4MIM A;  5HDN A;  5A2Q K;  1D8K A;  3BTJ A;  1ZRD A;  4NN1 A;  1USS A;  6PAX A;  4OIQ F;  2QQA A;  4R79 A;  3NPI A;  1BR4 A;  3FM5 A;  5E3N A;  1IUY A;  1Y8Q B;  4MNU A;  4E70 A;  1O3S A;  3MNL A;  2QZ8 A;  3GEU A;  2YVH A;  4HA8 A;  3T8T A;  1YIO A;  3AL0 B;  1D1A A;  1EH8 A;  3O2P E;  1IN5 A;  5C4X J;  1FBS A;  2DMQ A;  4MFD A;  4CUG A;  5F1J A;  1HLV A;  2JA2 A;  4V19 K;  3ABU A;  1AU7 A;  2NVQ J;  1YIJ I;  2DFE A;  3FBN B;  3GLL A;  3PSI A;  4H0E A;  3JTG A;  1IAW A;  4IL6 C;  4IHW A;  1EJ9 A;  2EH3 A;  3EYY A;  3RQ4 A;  2DA2 A;  3L2R A;  5IYB J;  4HX7 A;  3P7N A;  5L3B A;  1SC7 A;  1IDZ A;  2ESH A;  1VQM I;  3MZ8 A;  1FYM A;  3VOX A;  2CO5 A;  2O61 A;  2Y0S A;  2HWV A;  4XN0 A;  3QOP A;  1DGW Y;  2YX4 A;  3K4J A;  5C4J J;  1A35 A;  2XRL A;  1X3Z B;  2KMU A;  1FT9 A;  3RQI A;  2E5Z A;  2MFZ A;  3LOC A;  4ZZL A;  1EH7 A;  1LDD A;  3VIB A;  4C2M A;  4LIV A;  2IU5 A;  1FTT A;  2RN7 A;  4CCK A;  1DP3 A;  1OCR H;  4XRM A;  2A69 F;  1W0U A;  3FHN A;  1TW2 A;  2Y48 A;  3K2Z A;  3HYI A;  5FKO A;  3L2Q A;  1R4N B;  2PG4 A;  4XLE A;  3G71 I;  4BBS J;  1WH7 A;  4CSW A;  1IN8 A;  3G1M A;  1E17 A;  5AIQ A;  3S1M J;  1YIT I;  3KP2 A;  4I0A A;  2VE8 A;  1TWH J;  1HW1 A;  2XAF A;  1VQ7 I;  4XK4 A;  5HDG A;  3J81 Z;  1P4W A;  5D5W B;  1P92 A;  4KT6 A;  2V26 A;  4XSX F;  2XAU A;  3PUF A;  2EIL H;  4XRS A;  3DU5 A;  2QEX I;  1K83 J;  4IOC F;  3GTJ J;  4GFL A;  2YVE A;  2FOK A;  3CTA A;  5LRS A;  3W6K B;  5D4R A;  2NS8 A;  3B6C A;  2R7R A;  4IF4 A;  4I76 A;  3JCU C;  1V5E A;  2E1O A;  1P7J A;  1YTY A;  3DWL E;  4JX6 A;  5F64 A;  4OWR B;  2R93 J;  3LL7 A;  1UMQ A;  1FP2 A;  2WAQ A;  4KUM A;  2W82 A;  4HAM A;  2HKU A;  1MDM B;  2QBY B;  3ZRG A;  2IAI A;  3A03 A;  5BQT A;  3MN2 A;  2B3W A;  1MDM A;  2QBY A;  3GO5 A;  1DU0 A;  3GWZ A;  4EJO A;  4XL9 A;  2P7V B;  3ZQL A;  4QLC U;  1T6S A;  2IS6 A;  4IRV A;  2ZC2 A;  5H20 A;  2EK5 A;  5FFX A;  3VUQ A;  3QYF A;  1BR2 A;  2M30 A;  5C4Y A;  2QSG X;  1GT0 C;  3WTT C;  1YO5 C;  1A36 A;  2ZB9 A;  4A6D A;  2K9N A;  2L2O A;  4ZYE A;  4YEL A;  3S14 J;  2EV5 A;  4DNC A;  5IY5 H;  2V57 A;  1R9T J;  3HL2 A;  5J4Y A;  2G7H A;  1D5V A;  4LFU A;  2MA3 A;  1MJB A;  3HC7 A;  2EFW A;  2HEO A;  3OYL A;  2GWR A;  1SMY F;  1JTX A;  1SFU A;  1VQ5 I;  2RNJ A;  2DN0 A;  1FPQ A;  3OYA A;  2HS5 A;  1B6A A;  5LHG A;  2R0Q C;  1SFO J;  3JSJ A;  1ZG3 A;  2H94 A;  2DAO A;  4BYY A;  3FM3 A;  1MBJ A;  4FE7 A;  1W5S A;  5IPA A;  1MH4 A;  3L09 A;  5GTI C;  2UUZ A;  1R5G A;  2KZV A;  2E7X A;  2XGE A;  2CH0 A;  4UV9 A;  2VJ4 A;  2HR3 A;  1OR7 A;  4RB1 A;  1AOY A;  2B7E A;  1D1B A;  1HW2 A;  4IJA A;  2WAF A;  2MAB A;  1XGO A;  2HDD A;  3F72 A;  1WJ5 A;  5CVU A;  2XGD A;  4AYB A;  3CF2 A;  3VVZ A;  4GCK A;  4GFK A;  3W6J B;  2ME0 A;  3PIP F;  4GO1 A;  4KIS A;  2DT6 A;  2DOE A;  5LLQ A;  3JW4 A;  4IRI A;  4A3K J;  5CKT A;  2JPB A;  4NDL A;  3CMM A;  1IUF A;  2WUI A;  4YRV A;  2DK5 A;  2IRF G;  5DM6 F;  2X0L A;  4DYQ A;  2D5V A;  3IC7 A;  4W97 A;  3I4M J;  1NTC A;  1OYI A;  2ZME B;  1QPI A;  2PJP A;  3HOY J;  1FC3 A;  3CRJ A;  1HCR A;  3H3U A;  2ZME A;  4ZDL A;  2P4W A;  1LUJ B;  1MMG A;  5FGM A;  3OS0 A;  2QF7 A;  1T56 A;  1JGG A;  3ANG A;  3HTH A;  3RZD J;  4MEY F;  2VT3 A;  2LY9 A;  4BEH B;  1J59 A;  4EJT A;  5K7F A;  3HEF A;  4U0Y A;  4BEH A;  2ZFU A;  1TBX A;  1U8R A;  2P5K A;  3PUB A;  1DPU A;  4AVP A;  3HTA A;  2GZW A;  3WTW C;  2ZME C;  1JUS A;  2M7A A;  2XPW A;  1W4M A;  5HS9 A;  4DZJ A;  1B8I B;  3J7Z I;  2PMH A;  1IRZ A;  2F6C A;  4B3X A;  3OYJ A;  1ZG1 A;  4HYE A;  5B3S H;  1WHU A;  3KPH A;  3RKQ A;  3HXL A;  4JYK A;  2K9M A;  4A5N A;  4BKX A;  3IL2 A;  1LFP A;  3WHB A;  2QLZ A;  2VBY A;  3OS1 A;  3HOT A;  4GCV A;  1SD7 A;  1DGR M;  2EV6 A;  2XPV A;  3FMR A;  5K5O A;  5LEJ A;  4MHG A;  2KJB A;  5F0F A;  4II2 A;  4F52 A;  5FLV A;  3GTM J;  3GTP J;  2W25 A;  3C2H A;  3OWT A;  1VF9 A;  2EA4 A;  3W2W A;  4HV6 A;  1BIB A;  1IXR C;  4PCQ A;  4IVN A;  1PP8 F;  1Y1V J;  1PUE E;  1KQ8 A;  3RH2 A;  5H6R A;  5DDG A;  1J5Y A;  4PFO A;  4ENJ A;  2VON A;  2BOL A;  2P0W A;  4FTH A;  4U9N A;  3VW1 A;  3B73 A;  4II3 A;  4OAZ A;  4Z6Y A;  3UR3 C;  1Z3X A;  2DW4 A;  3FXJ A;  2R7T A;  4L9N A;  2JZY A;  3TOB A;  1VND A;  1ZN2 A;  3KP3 A;  4GYI A;  4GGG A;  4ABZ A;  1KU7 A;  3I59 B;  2DTR A;  1DU6 A;  3BZC A;  3K1P A;  2Z33 A;  4BE2 A;  1XSX A;  3I59 A;  4ZJZ A;  1ODD A;  1IN4 A;  2L7K A;  1VTN C;  1IRF A;  4M73 A;  4HLY A;  2DA5 A;  2CRG A;  3BRO A;  3BT9 A;  3HE0 A;  4K2E A;  1R36 A;  4A5M A;  4G6D A;  3G1O A;  1RUN A;  5IP6 A;  1JKR C;  1EH6 A;  3OR2 C;  4ZTJ A;  5CPR B;  5IT9 K;  3K69 A;  1YX5 A;  2A05 A;  3GFJ A;  2FML A;  2CMP A;  2GAU A;  3WTY C;  1RKT A;  1MBG A;  2K3F A;  3BZK A;  1WZ2 A;  4OIP F;  1YLF A;  4JX5 A;  5ICF A;  3P9I A;  2JRT A;  1ZTR A;  4CCM A;  3VVX A;  3F8B A;  5F0C A;  1VQL I;  2LRE A;  1FIP A;  4QSH A;  3MQ0 A;  2W85 A;  2CQK A;  4M9Z A;  1PDN C;  5EYR A;  4BXF A;  4IRH A;  1S72 I;  1KU2 A;  1WJB A;  1ETY A;  1Y0N A;  2E34 A;  3NAU A;  4ESF A;  2AO9 A;  3SYT A;  2XRO A;  2QWT A;  2NVY J;  3SWH A;  2VXZ A;  3GFI A;  3K70 C;  4N0B A;  1XDS A;  3S3O A;  1YG2 A;  2MD0 A;  3K4B A;  3HRU A;  3BHQ A;  2X6O A;  2BXY A;  1Q1H A;  4E7I A;  3JRC A;  2M3A A;  4L9T A;  1X4P A;  2GFN A;  3O3K A;  3N05 A;  2ZXJ A;  3ABT A;  4LIT A;  2N8G A;  4P96 A;  4IHS A;  4LB5 A;  1ZGJ A;  2W53 A;  2PBI A;  4DQ2 A;  4MTD A;  4ZDP A;  2HGC A;  2KQR A;  2UXH A;  1ZR4 A;  2DPU A;  1ZEL A;  1JKQ C;  2HZD A;  3KCC A;  5DCF A;  2XVC A;  3R4K A;  4M3G A;  3T6N A;  1YW9 A;  3ZMU A;  2Y31 A;  4AU7 A;  5ICG A;  2KL4 A;  3CCS I;  1DQU A;  1K7A A;  1R71 A;  2L7M P;  3E7L A;  2HXO A;  2VPL A;  4Q48 A;  1RR8 C;  2VT2 A;  1SFX A;  2LSO A;  3QYB A;  2NRA C;  4IQJ A;  2ZFW A;  4RMN A;  1ERD A;  2E36 A;  1YX3 A;  1Y8R B;  2WBM A;  1XCB A;  3TQN A;  3ZOB A;  1SAN A;  2M8G X;  4MO7 A;  2K85 A;  3A02 A;  3VB2 A;  4IHV A;  2VE9 A;  5K58 A;  1QQI A;  1S7O A;  3CDI A;  4G12 A;  3DTI A;  5GPA A;  3S93 A;  4CHU A;  3CQZ J;  2ME6 A;  4EJU A;  4HEA 2;  2ELJ A;  3QYE A;  3I55 I;  3CJQ B;  3C7J A;  2H27 A;  3PM1 A;  3K6G A;  4EM1 A;  2VBZ A;  3RIR A;  4ETS A;  4J00 A;  2GBY A;  4YIF A;  1WGX A;  3V42 A;  2ZY9 A;  2P81 A;  3VOK A;  3E6C C;  3V6G A;  3BR0 A;  3RTR A;  4QPO A;  2OZ6 A;  4AIK A;  1XDU A;  2RAS A;  4HX4 A;  4XM3 A;  4XSZ F;  2RC4 A;  2L02 A;  2OBP A;  2IA0 A;  4G6T B;  2KDZ A;  2NS0 A;  2VQC A;  3ZCO A;  3TW7 A;  4JL3 A;  1FSE A;  2LG4 A;  4XLC A;  2PJR B;  3J7A O;  1T39 A;  2XAJ A;  4ZZD A;  4NB5 A;  1YI2 I;  4UDS A;  2KIS A;  1BJZ A;  2PJR A;  2TCT A;  5EG0 B;  5D8K B;  4QPQ A;  3VFZ A;  4A3M J;  3HRT A;  5E3O A;  2LLK A;  2DYR H;  4JP0 A;  5EG0 A;  4G7O F;  2BY0 A;  4E7L A;  1BOA A;  1T95 A;  1X1A A;  3H9J A;  1X1D A;  1J9I A;  1CQT A;  1UJ8 A;  1NH3 A;  3OY9 A;  3BJB A;  1Z7U A;  5DYM A;  5HLG A;  4UUS B;  5E79 C;  3T1B A;  3BTC A;  2CUJ A;  2O8X A;  3NEU A;  1OKR A;  4A6E A;  4UUS A;  3L1P A;  3K4K A;  2YVX A;  2X48 A;  3V7C A;  3F9K A;  4B09 A;  2GOX B;  2WV1 A;  3L2V A;  3ZN1 A;  2QWW A;  2B63 J;  4ZH4 F;  3VSK A;  2ACJ A;  2V9P A;  1O7F A;  1OYY A;  1QVT A;  1S3J A;  4NBQ A;  4XLH A;  2E60 A;  3CJT B;  1UZC A;  2HDC A;  3H3Z A;  3PFY A;  4N9H A;  4GXO A;  3G4S I;  3QU3 A;  3CCE I;  1JTY A;  2STW A;  5DTD A;  3DEW A;  3DPJ A;  1W1W E;  2WB1 A;  3C2G A;  4M74 A;  4KIT B;  2RRE A;  3SZG A;  4E7S A;  5K7Z A;  2HYG D;  2R7F A;  2COB A;  3RD3 A;  2HVR A;  3L2C A;  1O57 A;  2H09 A;  2KDO A;  4HF2 A;  2ZJ2 A;  1BIA A;  5J8C A;  4FX0 A;  3WTX C;  1YJN I;  2YR2 A;  2VBW A;  2RVC A;  3B6A A;  5E8I A;  4YG2 F;  2BVL A;  5LGU A;  2FBK A;  2ZNY A;  1VQ8 I;  2ZCM A;  4BY1 J;  5HS7 A;  1Z9C A;  5HSZ A;  4BHC A;  5IOZ A;  2XB0 X;  2E7W A;  4B43 A;  4DGW B;  2LY1 A;  3E6D A;  2HPM A;  1C0W A;  5L3F A;  3WHC A;  2K86 A;  4AD9 A;  3IHU A;  4Q4Z F;  1HDD C;  3S32 A;  3RKY A;  1SD4 A;  1I6X A;  2EV0 A;  2VLA A;  1ETW A;  3VW0 A;  3DTE A;  2R92 J;  4I09 A;  3ZQ7 A;  2OCC H;  4CCL A;  3LAP A;  3ISP A;  1HDP A;  1S9H A;  2E1C A;  5K1Y A;  4FIS A;  3ZMZ A;  3HSE A;  5B1A H;  2M5W A;  4MK6 A;  4PJJ A;  2JMW A;  3CUQ C;  3WU0 A;  2HVS A;  1YS7 A;  1ZHF A;  4LMY A;  4C30 A;  4B4C A;  4PJM A;  3AQT A;  4N4O B;  4M6Y A;  2FA5 A;  2V1N A;  5FKL A;  3CP8 A;  3R0A A;  3SFI A;  3ZQG A;  2HNH A;  1W5T A;  2V79 A;  3M07 A;  4AID A;  5FKM A;  2EIN H;  2KRH A;  3HSR A;  4PJ0 C;  2NS7 A;  5BPI A;  2VQG A;  2YPR A;  4LJZ F;  1OCC H;  3ZMS A;  2CWE A;  2AQE A;  2OV7 A;  3IAS 2;  2VI6 A;  2Y69 H;  3FKJ A;  4NQW A;  4KYW A;  2F5D A;  2Y0S N;  2PMZ A;  1WJF A;  2E1N A;  5AON A;  5LHH A;  3OYI A;  2ELK A;  3I0T A;  5F6F A;  5E20 A;  2MC4 A;  2VL8 A;  2Q0O A;  2R7V A;  3COA C;  3VOD A;  3OSF A;  2XRN A;  4KN4 X;  2HOE A;  1BI0 A;  4ON0 A;  2WGB A;  1Q1V A;  3FXO A;  2M9H A;  3HRS A;  1B4A A;  3TL4 X;  4HDV A;  1BN5 A;  3BCG A;  2RKH A;  3DP7 A;  3RPU D;  3C18 A;  1T0F A;  3BP8 A;  2HDW A;  2O6G E;  1OFC X;  3BR2 A;  2RGV A;  1FBU A;  2AXL A;  1I5Z A;  5F04 A;  1NHA A;  2H6C A;  4LD5 A;  1KU3 A;  1XGM A;  2BY2 A;  1I1S A;  3ELK A;  4RLF A;  3NQO A;  3DEU A;  1LNW A;  2LTP A;  2LNB A;  3GZ5 A;  1D1C A;  1JI8 A;  2PBX A;  3LA2 A;  3O8G A;  5HLH A;  3CCR I;  2RV8 A;  5CLS A;  2X1C A;  1ZRC A;  4UB8 C;  1CGP A;  4G6Q A;  3V4G A;  3HOW J;  1N78 A;  5HOD A;  1E0E A;  1IXS B;  2DMN A;  3OYC A;  2JPC A;  3HKZ N;  3AQS A;  2DG8 A;  1WJD A;  4D9J A;  2K7L A;  2HFH A;  1NK2 P;  1FY7 A;  3D0S A;  1X19 A;  4ENM A;  2QM3 A;  4LG0 B;  2G3B A;  2X6Y A;  2E1M C;  1H0M A;  3VWB A;  4WXH A;  4LG0 A;  4QIW N;  1J09 A;  3D5R C;  4A3D J;  1FTZ A;  4KN7 X;  2REK A;  4EMS A;  2ZXW H;  2XSJ C;  4IRG A;  5EGO B;  3V8J A;  2CV2 A;  4BQA A;  1RR7 A;  1ZLJ A;  2WY8 Q;  2R4G A;  2FUG 2;  2K4J A;  4HF1 A;  3I3L A;  2EWN A;  5EGO A;  1FEX A;  3S3N A;  1G4D A;  4V2G A;  2JN6 A;  4CZC A;  2UXN A;  5E1X A;  5DUK A;  4MGR A;  2QEN A;  3F23 A;  3HIF A;  3S17 J;  2QKM B;  2BV6 A;  2XF6 A;  3I4N J;  3AG3 H;  4A0X A;  3BR3 A;  1S7A A;  5FRO A;  4OAY A;  4XKV A;  4E7K A;  1G2H A;  3E5U A;  1O3Q A;  1OQY A;  4ME9 A;  2IVM A;  2LD5 A;  3ROU A;  4D5F A;  2D1V A;  4QTR A;  3M1E A;  4I01 A;  4JNN A;  3HJE A;  1E2X A;  4CZZ A;  3AL0 C;  1T98 A;  1F1Z A;  4IHT A;  2NNN A;  1RPW A;  3DBH B;  4M72 A;  3HOX J;  3FK6 A;  4YII A;  1YS6 A;  1IG7 A;  2XB5 A;  4J19 A;  2CW8 A;  5LEK A;  2ZJR F;  1W36 C;  2WAD A;  1MBK A;  4UV8 A;  3TOA A;  4F91 B;  1YE9 A;  3HTI A;  3M1C A;  2OC6 A;  5LGN A;  4LLN A;  2HYT A;  3I54 A;  3GEZ A;  2UXO A;  1Z77 A;  1JJ6 C;  2E2H J;  2W57 A;  2G7U A;  3CWR A;  3FIW A;  3DQV C;  1TP4 A;  3H35 A;  4DJA A;  1D5Y A;  2HI3 A;  3H5N A;  2FF4 A;  2Z9O A;  5FLX Z;  4A69 C;  2G9W A;  2MSY A;  2DDB A;  4R1H A;  2OTL I;  1UI5 A;  1ETX A;  1R1T A;  3J7A Y;  5D5X B;  1FX7 A;  2DLL A;  5BS6 A;  2O03 A;  4OMZ A;  4U9L A;  4ZC3 A;  3HUG B;  3E7Q A;  1LFB A;  2DK8 A;  1S29 A;  4G8X A;  2G0E A;  4HZF A;  5EEH A;  2H8W A;  3HUG A;  5EFY A;  4Q47 A;  4EEF G;  3L9F A;  2K4B A;  1SMT A;  2O3F A;  3KYD B;  3PQK A;  4WIB A;  2BYV E;  5E1W A;  5E17 F;  3WTV C;  3N4M A;  1LEB A;  3LST A;  3KYL A;  3LSI A;  4XOP A;  3JAM K;  1LDK B;  2CJJ A;  2RQP A;  4BXU A;  2XC7 A;  3F6O A;  4JK1 X;  4CDG A;  3LNQ A;  4RBO A;  2JK3 A;  2QYO A;  1QVU A;  2W1O A;  1XD7 A;  5IP7 J;  2UXX A;  2CUF A;  2FQ3 A;  4M3E A;  3GBG A;  2CSO A;  3KE2 A;  2WWY A;  2CS3 A;  2IA1 A;  1J75 A;  3IUO A;  2LF8 A;  4C2U A;  3GW2 A;  4BU2 A;  4A3C J;  1LVA A;  1TQI A;  3BR1 A;  1WVR A;  2CFO A;  2WC2 A;  4JOM A;  4P55 A;  2A61 A;  2JSP A;  2XKO A;  4EM2 A;  2Z2S B;  2DT5 A;  1FMW A;  4A3L J;  4D7M A;  1ZRE A;  4A3G J;  4X6A J;  2QOP A;  4U7B A;  2BHY A;  3IRR A;  3CJD A;  4L62 A;  2EZL A;  1YQA A;  2KFD A;  2MC3 A;  3MVP A;  2EIM H;  4P1W A;  4L9V A;  4FE4 A;  2R5Z B;  3IAM 2;  1HKS A;  1R1U A;  1Z67 A;  4BBR J;  3HHH A;  5CYV A;  2R5Z A; 
#chains in the Genus database with same CATH homology
 2DA5 A;  1JUM A;  2VUM J;  2CRG A;  5HBU A;  3BT9 A;  2R5Y A;  1IJW C;  3HE0 A;  2D6Y A;  3G1O A;  2WAQ N;  2QOP A;  5IP6 A;  1JKR C;  1NK3 P;  3GZI A;  2EZK A;  4M3F A;  4GCT A;  3BTL A;  2XSD C;  3B81 A;  1TWF J;  2E2J J;  2DMU A;  2ID6 A;  3BTI A;  5IYC J;  1ZKG A;  3VP5 A;  2IBD A;  5EDN A;  4D7N A;  2OF7 A;  1HF0 A;  1RKT A;  1MBG A;  3SDG A;  1APL C;  4JX5 A;  9ANT A;  4MFE A;  3S16 J;  5E3M A;  2NVX J;  1ZTR A;  1X2M A;  5K7H A;  3M4O J;  3JRB A;  5F0C A;  3VVX A;  1Z0X A;  3LSJ A;  1MSF C;  1RES A;  5E3L A;  2FBQ A;  5F08 A;  1FIP A;  3IH2 A;  4QSH A;  3G7R A;  3TP0 A;  2EQR A;  1JKP C;  1GDT A;  1WI3 A;  5GP9 A;  2NP3 A;  2HQ5 A;  5EYR A;  4C3I J;  2DA6 A;  1ETY A;  5EF6 A;  1X58 A;  3NAU A;  2QWT A;  2AO9 A;  3QBM A;  3PPB A;  2CQX A;  2NVY J;  2OI8 A;  4FCY A;  2ZOZ A;  1I3Q J;  3BHQ A;  5FJ8 J;  2X6O A;  3HTJ A;  3JRC A;  3CDL A;  5FGL A;  3GTO J;  2GFN A;  3LWJ A;  3IV5 A;  3BG5 A;  4UUT A;  4X1E A;  4A3F J;  2ECC A;  1A6I A;  2N8G A;  5J1U A;  4XRS G;  5M3F J;  2W53 A;  1ORK A;  5FKK A;  4B3A A;  4GCL A;  1UHS A;  5CW8 A;  5CXI A;  2H1K A;  3S15 J;  2FJ1 A;  3HGY A;  4GFB A;  3HOU J;  2UXH A;  1ZR4 A;  2OER A;  4DW6 A;  2XGC A;  1JKQ C;  4M3G A;  3T6N A;  2Y31 A;  3DCF A;  1ETK A;  3ZQC A;  4AYB N;  2L7M P;  3E7L A;  2VPR A;  1WPK A;  2HXO A;  3A01 B;  3CMY A;  3K2A A;  3HOV J;  3BQY A;  4M6V A;  4I6Z A;  5D1R A;  3A01 A;  1MBE A;  2HXI A;  3EUP A;  2UXI A;  3NAR A;  3ZOB A;  1MBF A;  1SAN A;  2M8G X;  4MO7 A;  3HOZ J;  2O8K A;  2DJN A;  3A02 A;  1JT0 A;  1UI6 A;  4IHV A;  5K58 A;  4G12 A;  5GPA A;  3ZQH A;  1Y1W J;  3VW2 A;  5HAW A;  3CQZ J;  2ME6 A;  4LOC A;  2X9D A;  3G1L A;  3PM1 A;  3BRU A;  3K7A J;  3KKC A;  3FIS A;  2GBY A;  1WGX A;  1LE8 B;  2P81 A;  3VOK A;  2MG4 A;  3V6G A;  1JUP A;  3BR0 A;  1LE8 A;  3IH3 A;  1LFU P;  5J3L A;  2RAS A;  1ENH A;  3O8H A;  3S1N J;  4ICH A;  1XC5 A;  2FQ4 A;  3OIO A;  2KDZ A;  5F27 A;  3TW7 A;  2JA5 J;  3S5R A;  1UG2 A;  4JL3 A;  3NRG A;  1TWA J;  2NVT J;  1VFC A;  3M3Y J;  3C07 A;  3KNW A;  2MGQ A;  4UDS A;  2CU7 A;  1BJZ A;  1X2N A;  3BQZ A;  2TCT A;  4M3D A;  5EG0 B;  3JRI A;  4AF5 A;  4B1R A;  4A3M J;  2DA4 A;  1U78 A;  5E3O A;  2LLK A;  2Y2Z A;  4JP0 A;  5EG0 A;  2O9L A;  2I10 A;  2IEK A;  4A93 J;  1WCM J;  5J1Y A;  2ZOY A;  2GM4 A;  3ON2 A;  1RKW A;  4C3J J;  1CQT A;  3JR9 A;  1U8B A;  2PZ9 A;  2Y30 A;  3BJB A;  3GTK J;  2ID3 A;  4BY7 J;  4UUS B;  1XS9 A;  1MNM C;  3BTC A;  2R7Z J;  3LHQ A;  4UUS A;  2LP0 A;  3L1P A;  1ZGW A;  2X48 A;  2CQQ A;  2G7G A;  2E19 A;  2QIB A;  5EEA A;  5M5W J;  2LKX A;  2WV1 A;  1FJL A;  2B63 J;  3Q3S A;  2L7F P;  3IH4 A;  3HGG A;  5JLW A;  2R5Z A;  3OSG A;  3FK7 A;  3NI7 A;  1QVT A;  3NXC A;  5BNG A;  3HDD A;  1PUF B;  2VKV A;  4XID A;  3VPR A;  3NNR A;  3S1R J;  4IEJ A;  1JTY A;  1PUF A;  5DTD A;  4A3E J;  1BL0 A;  3DEW A;  3Q0W A;  2YU9 J;  4AC0 A;  3DPJ A;  4L62 A;  3CCY A;  4AC6 A;  2DTZ A;  4MIM A;  3W6V A;  3BTJ A;  4NN1 A;  5K7Z A;  1BW6 A;  1VI0 A;  2K40 A;  2COB A;  2M34 A;  4XIC A;  3RD3 A;  2L7Z A;  3NPI A;  2HOT A;  5E3N A;  3MNL A;  2JA8 J;  3GEU A;  4PXI A;  2YVH A;  1POG A;  3HBL A;  3B6A A;  5IOY A;  1K61 A;  5C4X J;  2DMQ A;  4MFD A;  5F1J A;  1HLV A;  1OJL A;  2ZCM A;  1AU7 A;  4BY1 J;  2NVQ J;  4A3I J;  5HSZ A;  5IOZ A;  2Y9Y A;  2XB0 X;  4IHW A;  2EH3 A;  2K9Q A;  2DA2 A;  1H88 C;  2DA7 A;  5IYB J;  3WHC A;  3ZQI A;  2WB1 N;  1HDD C;  3GTG J;  2HOA A;  1IDZ A;  1ETW A;  1ZQ3 P;  3VW0 A;  2R92 J;  3VOX A;  2HOS A;  2XPU A;  5M3M J;  4D5C A;  2LFB A;  1HDP A;  3FKI J;  4FIS A;  5C4J J;  2XRL A;  2GEN A;  1I50 J;  1U9N A;  3RQI A;  3LJL A;  4MK6 A;  4YZE A;  3LOC A;  5J1R A;  1ZR2 A;  2JMW A;  2GUH A;  3VIB A;  2IU5 A;  3ON4 A;  4KWA A;  1FTT A;  4B4C A;  1GV2 A;  3F1B A;  3AQT A;  4XRM A;  1JJ8 C;  1GV5 A;  1W0U A;  1WH5 A;  5FKL A;  3SFI A;  3ZQG A;  5FKO A;  5FKM A;  1AKH B;  4BBS J;  1OCP A;  1WH7 A;  2NS7 A;  5C3E J;  3KKD A;  3G1M A;  3HM5 A;  1AKH A;  1TWG J;  1IV6 A;  3S1M J;  1ZK8 A;  2VI6 A;  1TWH J;  2Y0S N;  5F0H A;  3H3V K;  4XK4 A;  4RDU A;  2FD5 A;  2ELK A;  5EZH A;  1GUU A;  1B8I A;  4CYC B;  3OSF A;  1B72 A;  4XRS A;  2KT0 A;  1K83 J;  2WGB A;  4DYR A;  2LK2 A;  1Q1V A;  4CYC A;  3GTJ J;  3SJM A;  3UKG A;  4W1U A;  2YVE A;  2OPT A;  2M9H A;  1EF4 A;  4GFL A;  2UXU A;  4DYC A;  3S2H J;  3BCG A;  2NS8 A;  3B6C A;  4I76 A;  2E1O A;  1OFC X;  1P7J A;  3BR2 A;  4JX6 A;  4JX4 A;  2DA3 A;  2W48 A;  2K9S A;  2R93 J;  2M2E A;  1UMQ A;  4L5E A;  5F04 A;  2HKU A;  1IDY A;  2IAI A;  3A03 A;  2H8R A;  2JA7 J;  3MN2 A;  4A3B J;  4MXM A;  3HIM A;  2YS9 A;  3Q0V A;  1DU0 A;  2FX0 A;  2LTP A;  1OCT C;  3ZQL A;  1MH3 A;  1QRY A;  3O8G A;  2PBX A;  2Q24 A;  1ITY A;  3VUQ A;  3HOW J;  2JWT A;  5HOD A;  5C4Y A;  3P9T A;  2DMN A;  2O7O A;  1GT0 C;  3HKZ N;  2GLO A;  3AQS A;  2DG8 A;  2ZB9 A;  3TP3 A;  5JLX A;  2NX4 A;  2K9N A;  3JRE A;  3G56 A;  4MLO A;  4CGR A;  3S14 J;  5DAJ A;  2DMP A;  2ZCN A;  4Y7N J;  1NK2 P;  2CUE A;  3LSR A;  1R9T J;  2V57 A;  2ZCX A;  2G7S A;  2G3B A;  2HYJ A;  3PO2 J;  5DS9 A;  1ETV A;  4QIW N;  3ANP A;  3S1Q J;  4A3D J;  5GPC A;  1FTZ A;  2XDN A;  2REK A;  3VVY A;  3GTL J;  3PO3 J;  1JTX A;  3LSG A;  4AUX A;  2DN0 A;  5EGO B;  1SFO J;  1RR7 A;  2LVS A;  2R0Q C;  1A5J A;  3JSJ A;  5FHP A;  1XG1 A;  5IYD J;  4C3H J;  5EGO A;  5M5Y J;  1FEX A;  1O4X A;  1MBJ A;  4FE7 A;  5IPA A;  4V2G A;  3LSP A;  1MH4 A;  2JN6 A;  2JA6 J;  1HOM A;  3COL A;  4C2M J;  3FRQ A;  2XGE A;  1P7I A;  2EZI A;  1SGM A;  2EZH A;  2LR8 A;  3S17 J;  2QTQ A;  1ETO A;  1JKO C;  3I4N J;  2HDD A;  3BR3 A;  1G2H A;  2XGD A;  3VVZ A;  4GCK A;  4GFK A;  4ME9 A;  2ME0 A;  2LD5 A;  2QKO A;  4D5F A;  3ZQF A;  3GTQ J;  5EZG A;  4QTR A;  5C44 J;  4JNN A;  4A3K J;  4NDL A;  2WUI A;  1IUF A;  3EGQ A;  1TWC J;  2UXP A;  2L0K A;  2DMT A;  2DG7 A;  4DYQ A;  1RPW A;  3QQA A;  2Y9Z A;  3HOX J;  2D5V A;  4W97 A;  3I4M J;  3FK6 A;  2JJ7 A;  1IG7 A;  1NTC A;  2XB5 A;  1RET A;  4J19 A;  1QPI A;  3HOY J;  3CRJ A;  1MBK A;  5M5X J;  1HCR A;  3MKL A;  3BR6 A;  2NP5 A;  3HTI A;  1IGN A;  2QF7 A;  1T56 A;  2ECB A;  1JGG A;  3ANG A;  3HTH A;  4JKZ A;  3RZD J;  3IUV A;  2LY9 A;  2HYT A;  1JT6 A;  1H8A C;  5FKN A;  1GVD A;  2YUS A;  3H0G J;  5K7F A;  2UXO A;  1Z77 A;  3HEF A;  1JJ6 C;  2E2H J;  3CWR A;  3FIW A;  1D5Y A;  2HI3 A;  4S0H B;  3HTA A;  4NEL A;  1BA5 A;  3V78 A;  4A69 C;  4ACI A;  1JUS A;  1W0T A;  2MSY A;  3BG3 A;  1UI5 A;  1ETX A;  2XPW A;  4DZJ A;  3S2D J;  1B8I B;  1MBH A;  5IP9 J;  3PAS A;  1ETQ A;  1IRZ A;  5FMP A;  3JRF A;  1B72 B;  3E7Q A;  4HKU A;  1LFB A;  5AQC A;  2G0E A;  3RKQ A;  4JYK A;  3BR5 A;  5EFY A;  4EEF G;  4BKX A;  3QKX A;  3WHB A;  3BG9 A;  4Y52 J;  2QCO A;  4IHY A;  2XPV A;  3C2B A;  4M3B A;  2EBI A;  1TC3 C;  1S7E A;  2CJJ A;  5F0F A;  2MW8 A;  5FLM J;  3JRA A;  5FLV A;  3GTM J;  1YRN B;  3GTP J;  1VF9 A;  3TW6 A;  1IC8 A;  3LNQ A;  4RBO A;  2JK3 A;  1YRN A;  1QVU A;  5D19 A;  2RAE A;  1F36 A;  3D1N I;  5IP7 J;  2RHA A;  3TED A;  1Y1V J;  2CUF A;  3QPS A;  4M3E A;  3GBG A;  2M0C A;  4V2F A;  3RH2 A;  2PMZ N;  3KZ9 A;  2L9R A;  1H89 C;  2TRT A;  3Q0U A;  3O60 A;  4FTH A;  3VW1 A;  1E3O C;  3HB9 A;  4A3C J;  3BR1 A;  4BXX J;  1FIA A;  1AHD P;  1BW5 A;  5H9T A;  4IHX A;  3BNI A;  3JRD A;  2DA1 A;  3OOU A;  2NOG A;  1T33 A;  2G7L A;  5D18 A;  1VND A;  2E2I J;  4A3L J;  4D7M A;  4A3G J;  4X6A J;  4ABZ A;  1F43 A;  2O7T A;  4HNV A;  3RZO J;  4DZP A;  3JRH A;  2EZL A;  3MVP A;  3QPL A;  1DU6 A;  3CJD A;  3JRG A;  5CXG A;  1U9O A;  1MSE C;  3F0C A;  4FE4 A;  2R5Z B;  1I6H J;  4BBR J;  4A3J J;  2F07 A;  2R5Y B;  2AHQ A;  2VKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...