2FD5A

The crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
180
structure length
180
Chain Sequence
MSDKKTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEAFEQLLGKRRELLGELDPGLSGKERRALAAAFYLSRKHRDAQVDAGCPLPATLAEVARLPEGFREVLSRHVEIMVTSLAESPEETDVALADLVLMIGGLALARALGPGELSDRVLRAAKQAVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator
publication title The crystal structure of a transcriptional regulator from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
total genus 71
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2fd5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fd5A02
3G56A 4JX4A 4C3HJ 2DMNA 1W0UA 1FIPA 4B3AA 2L7ZA 3OSFA 4JX5A 4D5FA 4KWAA 4A3BJ 5M5XJ 2AHQA 3HB9A 5FLVA 2OPTA 4D7MA 4BY7J 1IUFA 1K61A 3MNLA 1HOMA 3RD3A 5IYCJ 2NS8A 2JA8J 2HKUA 3WHCA 1P7IA 1I6HJ 3BQZA 1FIAA 5IP9J 3JR9A 4C3JJ 5EGOB 5M3MJ 3FK6A 5HODA 1GV5A 3NNRA 2JN6A 4M6VA 1GDTA 1QVTA 3V6GA 1B8IA 2E2JJ 3NPIA 5DAJA 2P81A 3GTOJ 2QIBA 3GTGJ 3S1QJ 2ID3A 4BXXJ 5JLXA 2G7SA 3UKGA 4L62A 3M3YJ 1UG2A 2EZIA 1JT6A 4QIWN 1WGXA 2QTQA 2HOTA 2Y30A 3K2AA 3RKQA 1ETYA 2LD5A 5C4YA 3BR1A 1RKTA 2YUSA 3ANGA 3LSGA 3E7LA 2PZ9A 1TWGJ 3SFIA 9ANTA 3NXCA 5FKMA 3SDGA 3MKLA 2YU9J 2NX4A 3F1BA 4DW6A 3V78A 1TWHJ 2IU5A 4GCTA 4AC0A 2XSDC 4M3FA 4DZJA 1LE8A 1RPWA 1QRYA 3H0GJ 3VW1A 5EZGA 5HBUA 2R5ZB 2GFNA 3RZOJ 3B6AA 1PUFB 3BG3A 3ON4A 5C3EJ 1DU0A 2F07A 1TWFJ 2X6OA 1AU7A 1ZTRA 2R93J 1I50J 3RZDJ 2XPUA 5C44J 2ZCXA 2DN0A 2DA5A 1ZQ3P 3TW6A 3FKIJ 1WH7A 1H89C 2HOSA 4ABZA 1GV2A 1FTZA 1NTCA 3QPSA 3S5RA 2JJ7A 2AO9A 4XRMA 3S2DJ 1B72A 3COLA 3VIBA 3GEUA 2O7TA 1MBJA 3HOWJ 5FKNA 3GTMJ 2EQRA 3BNIA 3NARA 1IV6A 2K40A 2ME0A 2HOAA 4UUSA 1X2NA 3CRJA 5EG0B 2UXPA 5K7ZA 4FE4A 1VFCA 3MVPA 3HTHA 2HDDA 3A03A 1TWAJ 3VOXA 1H88C 2K9SA 2UXIA 2D6YA 4GFLA 1ZR4A 2DJNA 2DA2A 2OERA 3VP5A 2XDNA 3EUPA 3OOUA 4Y52J 1FJLA 2XB0X 3HGYA 5CXIA 1JUPA 2R92J 2R5YA 2JA7J 2QKOA 4B4CA 1JUMA 4M3BA 5BNGA 2IBDA 2G7LA 5M3FJ 2X48A 3TP3A 3ZQGA 2LVSA 2L7MP 3HKZN 1POGA 3NAUA 2DMTA 5EZHA 4A3FJ 1YRNB 3ON2A 5EYRA 5IP6A 3OIOA 2ZOYA 2O9LA 3B81A 1NK3P 3HOUJ 2VKEA 3GTKJ 1OFCX 5FKLA 3AQTA 3BHQA 5EDNA 1UI5A 3TW7A 3KZ9A 5D1RA 5EGOA 1U9OA 1UI6A 1FTTA 4CGRA 1AKHB 3VVXA 4XRSA 4QSHA 2DTZA 4GFKA 3CCYA 3HOYJ 4XICA 2V57A 2CUFA 3JRGA 2H8RA 3MN2A 5JLWA 3ZQIA 1HCRA 1BW5A 1JKPC 1FEXA 2UXHA 5H9TA 2QCOA 2RAEA 1ETKA 1JGGA 3S14J 3GTLJ 4UUTA 2NP3A 3NI7A 1ZK8A 3K7AJ 1NK2P 3QPLA 3E7QA 3HTIA 4NN1A 3QKXA 3I4MJ 1ORKA 2Y0SN 3ZOBA 4IHWA 3HEFA 2RASA 4BY1J 3IH3A 2OF7A 1ETQA 1VF9A 4I6ZA 4BBSJ 1PUFA 2G3BA 2MG4A 5E3OA 2MGQA 2JA5J 3VUQA 1IRZA 3H3VK 4A3LJ 1BW6A 2E2IJ 5F0HA 2Q24A 3FK7A 2M2EA 1JJ6C 3JREA 2Y2ZA 4M3GA 1A5JA 4MK6A 4X1EA 5J1UA 5HSZA 2CUEA 5GPCA 4DYCA 2Y9YA 3VPRA 3BJBA 3GTJJ 1HLVA 5K58A 4Y7NJ 5IYBJ 2EZKA 2UXUA 1W0TA 1Q1VA 2TRTA 3GBGA 2NS7A 4V2FA 3PO2J 2NOGA 1CQTA 1U9NA 1MSFC 2Y9ZA 3G1LA 3C07A 3C2BA 1ETOA 2NVXJ 1EF4A 2ZCNA 1X2MA 2MSYA 5D19A 3T6NA 3ZQHA 1F43A 4MO7A 3O8GA 3KKDA 1XG1A 3G1MA 3CMYA 1ZR2A 3B6CA 1OJLA 1AHDP 2R7ZJ 3S17J 4AUXA 1APLC 2QF7A 4IHYA 2L7FP 3BT9A 2LLKA 2Y31A 2FX0A 2M8GX 4A3IJ 2K9QA 4BKXA 4ME9A 4LOCA 4JL3A 1JUSA 4GFBA 4JX6A 4A3DJ 2DA3A 1JKRC 5FKKA 2XB5A 2GENA 1T56A 3VW2A 3HGGA 2WAQN 1HDDC 1XC5A 5IP7J 3BR2A 3BG5A 5DS9A 3A01A 1MBGA 2QOPA 2NVQJ 1YRNA 3GZIA 4A69C 1RKWA 1IG7A 4JYKA 3GTQJ 1MBHA 2TCTA 2R0QC 2VUMJ 4GCKA 3LWJA 3HTJA 3Q0WA 4DYQA 1MBFA 3RH2A 5FLMJ 4IEJA 2O7OA 3Q0UA 5E3LA 1E3OC 2REKA 3BCGA 4G12A 3QBMA 3RQIA 4FCYA 2HI3A 3S1RJ 2LTPA 3Q0VA 2PMZN 3JRAA 1GVDA 4AYBN 5CW8A 3FISA 2D5VA 3ZQLA 1AKHA 2NVTJ 4JNNA 1QVUA 4HKUA 3W6VA 3S15J 2K9NA 3VVYA 4L5EA 2NVYJ 2XPVA 1S7EA 3FRQA 5E3MA 2DMQA 5IOYA 2KDZA 4GCLA 2I10A 4IHXA 3CWRA 3S1NJ 1JKOC 4D5CA 3BTLA 1TC3C 2GBYA 2CQXA 2G7GA 1XS9A 1HDPA 2G0EA 3BQYA 3LSJA 5GP9A 3BR3A 3HOZJ 1T33A 3IH2A 5AQCA 3LNQA 2LKXA 3JSJA 2B63J 4JKZA 3JRDA 3JRFA 3Q3SA 1VNDA 2LFBA 3HE0A 4PXIA 2DA7A 5F27A 5DTDA 4A3KJ 2DA4A 1BL0A 1RR7A 3A02A 3CQZJ 1G2HA 3PPBA 3I4NJ 1MNMC 2HYJA 4V2GA 3VOKA 3LJLA 2LR8A 2OI8A 1U8BA 3VVZA 4AC6A 1A6IA 5D18A 2UXOA 1WCMJ 2DA1A 4DZPA 1LFUP 4JP0A 3TEDA 2XGDA 5K7FA 4M3EA 2FBQA 3BR0A 1MH4A 2PBXA 2YVEA 1I3QJ 2NP5A 1SGMA 2O8KA 4ICHA 5EEAA 2FQ4A 2R5ZA 1GT0C 1WI3A 5IPAA 1IC8A 4W97A 1QPIA 4A3GJ 2HYTA 2VKVA 4CYCB 2EBIA 1OCPA 3LOCA 2KT0A 4XK4A 3BTJA 4A93J 1ITYA 3BTCA 3G1OA 2WUIA 1K83J 1X58A 3TP0A 4RBOA 1OCTC 2VI6A 2DA6A 2XRLA 5M5YJ 4QTRA 2CJJA 3L1PA 3ZQCA 3SJMA 1JJ8C 3PASA 3AQSA 4XRSG 1MH3A 3JRIA 2COBA 5FHPA 2LY9A 3HTAA 1BJZA 5FJ8J 2JWTA 4A3EJ 2M0CA 2LK2A 3O60A 2YS9A 1Z77A 2RHAA 5J3LA 5EFYA 2ELKA 2HXOA 4A3JJ 2EZLA 4M3DA 2DMUA 4BBRJ 5IYDJ 5EG0A 2GM4A 1ENHA 1ETVA 2W53A 2FJ1A 3HIMA 2E19A 1VI0A 4MFEA 1GUUA 1RESA 4MXMA 4MLOA 3S16J 1H8AC 5J1YA 2MW8A 5J1RA 1U78A 1HF0A 1IGNA 2WGBA 2QWTA 3EGQA 4NELA 4C2MJ 2ECBA 3ANPA 1IJWC 3DEWA 4YZEA 1B8IB 5C4XJ 4MIMA 4AF5A 3HBLA 1JTYA 2ZCMA 2E2HJ 2IEKA 1R9TJ 2XGEA 5IOZA 2VPRA 1TWCJ 2M9HA 1ZGWA 1MSEC 2DG7A 3IH4A 3PO3J 4ACIA 1SANA 2DMPA 1IDZA 4A3CJ 1MBKA 4W1UA 4XIDA 5HAWA 1MBEA 4S0HB 4I76A 4UDSA 2WB1N 5F1JA 3OSGA 5FKOA 3IUVA 2XPWA 2H1KA 5CXGA 1Y1VJ 1LE8B 1UMQA 2ZOZA 3VW0A 5GPAA 1ZKGA 2FD5A 2N8GA 1DU6A 4HNVA 4IHVA 5F0CA 3HM5A 4FTHA 3CDLA 4FISA 1P7JA 3WHBA 4J19A 2XGCA 2JA6J 2GLOA 2IAIA 1Z0XA 2X9DA 2DG8A 3HOXJ 5C4JJ 2W48A 2ZB9A 3JRBA 4X6AJ 3LSPA 4EEFG 1WPKA 1SFOJ 3ZQFA 3G7RA 5F04A 1JT0A 3D1NI 3BG9A 2HQ5A 3DCFA 3LSRA 5M5WJ 1JKQC 5K7HA 5FMPA 2JK3A 2EZHA 1RETA 1B72B 3HDDA 5FGLA 4MFDA 1WH5A 3IV5A 3S2HJ 4D7NA 3FIWA 2YVHA 5F08A 2ID6A 3CJDA 3LHQA 3A01B 3KKCA 4FE7A 5F0FA 2CQQA 1D5YA 4UUSB 4NDLA 3PM1A 3P9TA 2WV1A 3QQAA 2ECCA 1JTXA 4A3MJ 4RDUA 4B1RA 2GUHA 4DYRA 2LP0A 2M34A 1Y1WJ 3GTPJ 1ETXA 3BR6A 3F0CA 5E3NA 4CYCA 1O4XA 2ME6A 2CU7A 3DPJA 3JRCA 1LFBA 3S1MJ 5EF6A 3HOVJ 3BRUA 1UHSA 1BA5A 3BR5A 1IDYA 1ETWA 2EH3A 3BTIA 3NRGA 2E1OA 3O8HA 2R5YB 2HXIA 3M4OJ 3KNWA 2L9RA 3JRHA 2JMWA 1F36A 2L0KA 2CRGA 4C3IJ
chains in the Genus database with same CATH superfamily
3CMAI 4C3HJ 3K8PC 3GXOA 3HUGB 1KYWA 3CUOA 1LPQA 2GIVA 4LLGF 2AHQA 2YPRA 2JSCA 5FLVA 1K79A 2QKMB 2ZBKA 2DDBA 3GEZA 1IRGA 3LSMA 2HKUA 3WHCA 3ABTA 3R0JA 1Y0UA 3CUQC 2BV6A 2LY2A 3M1EA 3V8LA 4C3JJ 5IP9J 5EGOB 3ZN0A 2KIQA 2FRHA 3NNRA 5CJ9A 1EH7A 4KDPA 1FLIA 2P81A 3GTGJ 1YHQI 4Y33A 3P5JA 2L54A 5JLXA 3PIOF 4G7ZF 1KU3A 2PJRA 1GVJA 4KNYA 2M7BA 1SD6A 4EJTA 2VOOA 1AOYA 3DPLC 2V1XA 1JT6A 1UJ8A 4CXFA 2DFIA 2LD5A 1X1AA 2EWNA 2VQGA 1SEUA 4LG0B 3CO7C 1Z91A 2G7HA 4DW6A 3V78A 1IZ1A 3I54A 4EJOA 2IU5A 4RGSA 2FXAA 2O3FA 2EIKH 4M3FA 4DZJA 2ZJQF 2W25A 2XDVA 2R5ZB 1OYIA 1X19A 3LSIA 2IXSA 1TNSA 3BG3A 1N75A 3GLLA 3PNVA 3K2ZA 1DU0A 1X3ZB 2JA2A 4KICA 2F07A 2CFOA 2X6OA 4JQFA 4XMYA 1AU7A 1ZTRA 1I50J 3RZDJ 2W24A 4KFCA 1KYZA 2DN0A 2PLYA 3TW6A 2P8TA 3FKIJ 2B0LA 4MNUA 2OTLI 1NTCA 4PFOA 1XCVA 3COLA 2O7TA 2DT7B 2FJI1 2X6YA 3KEOA 3MD2A 4IX7A 3CUQA 3HRUA 3TDUC 2UXNA 2M0MA 2DI3A 4YFXF 3FZVA 2R7SA 3CRJA 3HRSA 4BEHB 2ZMEC 2WA0A 1MDMB 2XASA 2HDDA 1E0EA 3BCAA 3FHNA 3P9CA 3WTZA 4HV6A 3VOXA 1ON1A 1N78A 2UXIA 2R7TA 1IXSB 2E60A 1ZR4A 2DJNA 3CDIA 4UV8A 4ZDLA 2OERA 3LA2A 3VP5A 1ZH5A 4QLCU 3EPZA 5J6XA 4OMYA 4E70A 3HGYA 3Q5FA 2R5YA 5LLQA 1AWCA 5TJJA 4XR6A 1A6QA 3KE2A 4M3BA 3QYBA 5M3FJ 2X48A 3ZQGA 2LVSA 2L7MP 2A05A 3HKZN 1UHMA 4Z6YA 5EZHA 4OIRF 4A3FJ 2WAFA 3KFWX 4U0VA 5EYRA 3OIOA 4OINF 3ON2A 1TBXA 2QWWA 4RGXA 1C0WA 2IS1A 3B81A 4C2MA 4CHUA 3GZ5A 2VKEA 3KCCA 3AQTA 4LGWA 4OMZA 5EDNA 2VBXA 3VWBA 2Y75A 1UI5A 3CJTB 2R7QA 1R23A 4E6KG 4HG2A 1U9OA 3VFZA 1UI6A 3F6VA 2QSHX 1I1GA 2OA4A 2A2FX 1YOVB 4XRSA 4QSHA 1HC8A 1GXQA 4KITB 2KMUA 1B9MA 3CZ6A 5JLWA 3J7AO 1BW5A 3RTRA 2ZCWA 3FXMA 2RAEA 1JGGA 2X6WA 2WAQA 1XSVA 4Y15A 5DCFA 1ZK8A 1R1TA 2F48A 1HSJA 2A5YB 2AS5F 1G6NA 2L7KA 4E7LA 5DCMB 2QBYA 2BYVE 3QPHA 2VQCA 3PQJA 1BR1A 2BW3B 3ZOBA 2PJPA 3OL4A 4E7HA 2OF7A 2AXTC 1PDNC 4L9VA 1ETQA 4I6ZA 4B43A 3WTXC 1B9NA 4CCLA 5L3EA 2IPQX 1W1WE 4TV7A 4L0YB 4XBFA 1VQKI 4N9HA 1QHGA 3H3VK 5F0HA 2Q24A 3FK7A 3FXUA 1JJ6C 1S8NA 2ISYA 3PNTA 4DBRA 4ZYAA 5HSZA 1FSHA 1UB9A 4DYCA 4YIFA 4XKBA 2OZUA 1N77A 4HSRA 1HLVA 2LOOA 4Y7NJ 1G3WA 1ZLKA 5TGTA 1V5GA 2OJED 4CCOA 3FXQA 4IHSA 3BJAA 1V54H 2C6YA 4OAYA 5TRDA 2Y9ZA 3K69A 1ETOA 1RC9A 1EF4A 3VDXA 2ZCNA 2V9PA 4PJNA 3DQVC 3ZQHA 1F43A 1R4MB 3KKDA 2W57A 1FP1D 2MABA 2RC4A 1ZR2A 2CGPA 3C1DA 1ODDA 5JVGF 2NYXA 2R7ZJ 3KX2A 3TGNA 4I09A 2M8GX 2K9QA 4BKXA 4LOCA 4GFBA 4JX6A 3GUDA 4CCNA 1JKRC 2VJJA 3V8JA 5E8GA 4P96A 1T56A 1V5FA 2Y69H 3LL7A 1YFHA 3VW2A 4ZYGA 2VQHA 5IP7J 3BG5A 1MBGA 2UV1A 2PBIA 1FMWA 2F4MB 2VL8A 3QWLA 2K27A 3ZMZA 2QSGX 1R4NB 2QENA 5CVRA 3P7NA 3GTQJ 1SVMA 1XB4A 1W7PA 3OR1C 3QP6A 4HX4A 1MBFA 3ZGKA 3F8FA 2HQRA 1O3QA 4IEJA 5H6RA 3DF8A 4HBLA 2REKA 2IS6A 3V7SA 4G12A 2P7VB 5GAHJ 4WXDA 4FCYA 3Q0VA 4XM3A 3JRAA 1T2KA 1GVDA 4AYBN 3R61A 5K1YA 1FT9A 4RB1A 3ZN1A 4Q4ZF 1W36C 1ZELA 3FM3A 3W6VA 3OYFA 3I3LA 2CV0A 1OCOH 2CUJA 3K0LA 2XPVA 3V42A 2DO7A 1D1CA 5IOYA 3S3NA 4GCLA 3C3WA 3KP7A 1R5ID 4HLXA 4JBAA 1QQIA 1SFUA 2OCEA 3FBIB 4JK1X 1A31A 1ERDA 2FQ3A 4A12A 2R7WA 1F9NA 3BTLA 4XN0A 1O3SA 5F6FA 5LGNA 3NQOA 2CQXA 3TMOA 3TL4X 3BQYA 2ISZA 2VJ5A 3IH2A 2A07F 2KHMA 5K5OA 3MZHA 3N05A 2PG4A 3J81Z 3VTIA 1RUOA 1OMIA 2YVXA 2DA7A 3ESWB 5F27A 5DTDA 3F23A 4ZYDA 3CQZJ 5J40A 2PFBA 4I0AA 5E20A 3CC2I 4HAMA 3HZJA 4BL0B 3I4NJ 4V2GA 3PPBA 1R1VA 3VOKA 2LR8A 2HVQA 4M6XA 1IUYA 4I99C 2UXOA 1WCMJ 2A3SA 1LFUP 1XGOA 1P4WA 2FA5A 1EH8A 2XGDA 2YU3A 4KN7X 4M3EA 2JSPA 3FDYA 4DQ2A 2L9VA 2YVEA 2EFPA 4AVZA 3HL2A 1SGMA 5TISC 1VQ5I 1QPIA 3OYLA 1GXPA 4LD5A 5BS6A 1FOKA 2HU9A 4A3GJ 1PP7U 3PJRA 1WFXA 2HYTA 4CYCB 3LOCA 1DGRM 1A04A 4A93J 3G1OA 3W6JB 1K83J 3FF5A 3VSLA 3BP8A 3TP0A 2M4GA 3ASOH 4RGRA 5M5YJ 1ZAOA 3ZP5A 4QTRA 5HLIA 2QQ9A 4BGDA 3L1PA 2H09A 2HR3A 3LAPA 3BG6A 3SJMA 4ON0A 1J2XA 3UR3C 3AQSA 1MH3A 2YX7A 3BC8A 4KIGA 3HTAA 5E17F 2LK2A 1ZGAA 2YS9A 3E6DA 5J3LA 1S29A 5EFYA 5BMZA 1EJ9A 2QUFA 5JFRA 4ZDOA 1QA6A 4BBRJ 2R4GA 1IRXA 3H1CA 4UVAA 5A2QK 3F72A 1GUUA 4M73A 2LNBA 3AL0B 3WG7H 4KYWA 1YI2I 1H8AC 3ELKA 5FD6A 1BOBA 5J1YA 4BE0A 2WGBA 3DLAA 2A6TA 2KRCA 2ECBA 3R60A 1Z6TA 4Y3OA 3DEWA 2P5KA 2B9SA 2NNNA 2LREA 2K3PA 3M7GA 4H0EA 5FO5A 3SXYA 2UXXA 2LBFA 1MSEC 3SHFA 4ACIA 3MKWB 3PO3J 4NNJA 1SANA 5CVIA 2DMPA 1IDZA 5DV5A 1QHHD 5FB2A 4F91B 2DT5A 5H2FC 2FBKA 4I76A 1NH3A 3H9QA 5FLXK 1LQ1A 4DVYP 5D5WB 1FBUA 3DU6A 1P92A 2H1KA 1WJFA 3FKJA 1UMQA 4HEA2 3EQLF 2FD5A 2PEXA 2N8GA 1LDJA 5HS7A 3X2QH 5FFXA 4FTHA 2GLOA 3RPUA 3DV8A 1JHHA 1YQAA 3PFYA 2BY3A 2E5ZA 2P6TA 5ICCA 2IJLA 4G8XA 2QM3A 3CD6I 2HWVA 2W48A 2HFHA 4FHTA 4CUGA 2JQ7A 4BYYA 3G7RA 1YO5C 1S5LC 4UB6C 1DPRA 2DJIA 1TT5B 5M5WJ 4LB5A 3HC7A 5FMPA 1B72B 3HDDA 4XLHA 3OYJA 3S2HJ 1LDKB 4P55A 4L9TA 5IY5H 3OYDA 1YIJI 3A01B 3SWHA 3KKCA 4FE7A 2QA4I 2CQQA 4UUSB 3CMEI 2H94A 4PSXA 4XLNF 2ECCA 3K4CA 1IN4A 2G9WA 3D5RC 4RDUA 3MWMA 5HS9A 2XIGA 3HPHA 5E3NA 5LRRA 5DD4A 2ME6A 3S1MJ 3LFKA 3HOVJ 3H92A 5ILSA 1BA5A 1IDYA 2ZSHB 3BTIA 3NRGA 5L3BA 2VC1A 2HXIA 1WHUA 1J75A 5LBQA 2L9RA 2QZ8A 1MGTA 3W3CA 2JMWA 4EJVA 4HNTA 3DBRB 2CRGA 3IWFA 2M7AA 2CH0A 4EMSA 2CV1A 3G56A 4JX4A 3CCJI 2F4IA 2ZFUA 4DJAA 1S7AA 2DMNA 2IW5A 3K4NA 5B3SH 3OSFA 4JX5A 4ESJA 2IGNA 3ML6A 4BXFA 4KWAA 4BHCA 1JXSA 2OPTA 4D7MA 2RNGA 4XNFA 2ESHA 2XV4S 2O0YA 1K61A 4M6YA 2DAOA 3ROUA 1I3AA 2E1MC 3VYRB 1P7IA 3ERED 3VODA 4JOMA 2Z16A 4IXAA 3DKWA 1BR4A 5LHIA 3BJOA 1R36A 2LF8A 4II2A 2M8EA 1I39A 5FRNA 1FP2A 3CC4I 1Y0NA 4XKVA 3RSNA 1QVTA 3ABMH 3V6GA 5CVVA 4HOBA 1VQPI 2EA2A 2Q2EA 2E2JJ 3GTOJ 3OYEA 3NPIA 3S1QJ 2ID3A 1XDUA 5IT3A 2HTSA 2G7SA 4B44A 3ABKH 4BHBA 1QBJA 2X85A 4L62A 3ECOA 3S32A 1UG2A 1WGXA 3E6MA 5AONA 1S3JA 1BJAA 5HDNA 1YJNI 3K2AA 1K78A 2HOTA 2QTQA 4OIQF 4KUMA 2YUSA 3SFIA 5FKMA 5B1BH 3MKLA 1FOXA 2LC2A 2W00A 1B1BA 1LUJB 2KZVA 4HX7A 4GCTA 1LE8A 1RPWA 1SMTA 3T5XA 3H0GJ 2WV0A 1DGWY 2DFFA 4I98B 3VOEA 5HBUA 5FGMA 2KKOA 2O03A 1D5VA 2CW8A 1IRFA 4OOIA 1MMGA 2DCEA 3U21A 2F2EA 1D1AA 2UZKA 2GWRA 5C3EJ 4ZTFA 2BBYA 3VSKA 1OQYA 4J00A 1J7KA 2XPUA 3W2AA 4XOPA 2QLZA 2KRFA 1FX7A 1FTZA 1ULYA 3OS2A 1O3RA 4XRMA 1BI0A 2GAUA 1MBJA 4ZDPA 2FE3A 5FKNA 1XX5A 3T0YA 2V79A 2KIUA 2EJRA 3GTMJ 1YX3A 2EQRA 3NARA 3CJQB 4BUPA 4MGRA 3BNIA 2ME0A 4ESBA 3DKXA 1LVKA 1D0XA 1X2NA 5FRMA 3L00A 1HW5A 2FOKA 4DNCA 5ICGA 3MVPA 4Q48A 2IS2A 3M8JA 3HTHA 3LQQA 4FETA 4ZYHA 3CCSI 3A03A 3PUFA 1W5SA 1YX5A 4CGZA 3ZMDA 4RM2A 1E2XA 2QQ8A 4XL9A 1OKRA 2Y48A 2WBMA 3SEQA 3WGGA 2D6YA 1YYVA 2NNYA 4HDUA 2E7XA 4IRHA 4UB8C 4Y52J 2HEOA 2XB0X 3S2WA 5CXIA 3KP4A 4WF2A 5DM7F 1LKXA 2V7FA 4B4CA 3OL3A 1JUMA 3QU6A 4B8XA 5FLXZ 1X4OA 1X1PA 2Q0OA 1X1CA 5LEKA 1U5TB 1W7PD 2M4KA 3KP5A 1POGA 1D3YA 1YRNB 3HUGA 4IOAF 4O3MA 2K9MA 4H4KC 4S05A 3WODF 5CVUA 3FM5A 3ZMUA 4A0ZA 4E7SA 1K6OA 4LLNA 2WWYA 3GCMA 1IN7A 1MJBA 1U2WA 4LK0F 2F4OB 3KZ9A 2YR2A 1H9TA 3IAM2 4BNCA 5EGOA 5D1RA 2DYSH 3A1YA 1IV8A 1FTTA 4BE1A 2XAHA 2K85A 2FU4A 3DWLE 3LMMA 4RAYA 2DT6A 2DQLA 3CCYA 3DPTA 2I5UA 1R71A 2K3FA 3KPHA 1XSXA 2CUFA 2JRTA 3LFUA 2E36A 1R58A 1HCRA 5DDGA 3WU1B 3ZMSA 1VQLI 3KEYA 2QCOA 2OD5A 2L5QA 2H6BA 5CLSA 4DBQA 4CZZA 4A0YA 2Q8KA 3S14J 1D0ZA 4M9ZA 4LG0A 2NXNB 2E1NA 1YJWI 3TQNA 3E7QA 3EDPA 4WK8F 1XTAA 3KZYA 3OYHA 3I4MJ 4WIBA 2Y0SN 4IHWA 3HEFA 2ZFWA 2X1DA 5GTHC 2MH2A 3G71I 3H3ZA 2Z1DA 1TTYA 2K02A 3GFJA 4K2EA 1Z21A 3DBHB 4P9UA 3LQRA 4RMNA 2W84A 1QNTA 2M2EA 1VQ7I 4ANJA 2P5VA 2Y2ZA 1V55H 4RGUA 1RRJA 3BJBA 3SZPA 3VYTB 3GTJJ 5K58A 5IYBJ 2EZKA 3OR2C 5J8FA 1GLNA 3TO9A 2NS7A 3PO2J 1CQTA 2WC2A 3EYIA 3OYBA 3C2BA 2NVXJ 4F52A 3CLOA 2J5PA 3L2UA 2I8DA 2HKXA 3KYDB 3O8GA 2JUGA 1MDMA 2MYSA 1FSEA 3QYEA 2OC6A 1OJLA 1EKEA 2KJCA 1AHDP 1WJ5A 4IHYA 2CQNA 3BT9A 1LB2A 2CWEA 2FX0A 2Y31A 4L9JA 2GXGA 2V4JC 3U9GA 2DA3A 2GXBA 2COMA 3M07A 1OR7C 3G3ZA 2M3AA 4YIRX 1HDDC 1MKMA 2MD0A 3BR2A 5CPRB 4ETSA 1R22A 2L01A 3NS4A 2IVMA 3K1PA 4E7ZA 2NVQJ 3F22A 1LEAA 3V4GA 4A69C 1IG7A 4B3XA 5ICEA 3JTGA 3H9GA 4MEXF 3ZRGA 2L9NA 3SEZA 4IJAA 3LWJA 4HSTA 4DYQA 3HTJA 3RH2A 1ON2A 5FLMJ 3GMEA 2O7OA 3TOBA 3BCGA 1MZBA 2BXYA 3QP5A 2EK5A 2PMHA 3KYCB 2HI3A 3S1RJ 2LTPA 2PMZN 3ZMTA 4LJZF 4Y13A 1HW1A 5HNFA 4RB2C 1Z9CA 1IN6A 4NQWB 4I7HA 3FISA 3ZQLA 2M87A 4N0BA 3ABLH 4JNNA 3HPGA 2K9NA 2L9SA 2DBBA 1S7EA 2DMQA 1EH6A 3RPUD 2I10A 3I5UA 2CV2A 3MKZA 2KIMA 4IHXA 3RYPA 1LJ9A 4AM3A 3HJEA 3CJRB 5K5QA 3I59B 1ZG1A 2OTJI 1SFXA 3HSEA 5DCMA 1XS9A 2G0EA 3GFMA 1IN8A 3LSJA 3VB2A 4PJJA 2BW3A 2VKHA 3WU2C 3DKYA 3F8BA 3V8KA 3LNQA 1P9QC 1YE9A 2EINH 3JRFA 3TKYA 3WGHA 1OR7A 4V19K 2BGCA 4AIKA 1OYWA 2CW7A 1G2HA 1WJCA 3EUKL 4E7JA 4GO1A 2ZO4A 2OI8A 3IRRA 3T8RA 2ACJA 5BPDA 1A6IA 2L02A 4DZPA 3OYNA 2ZMEA 3CP8A 3O6BB 2Z33A 1USSA 3BR0A 2NAZA 2QVOA 3Q9SA 1MH4A 4MQVA 4KA4A 1I3QJ 2NP5A 1OCCH 1ZN2A 1Z6RA 2FQ4A 1WI3A 2WB1A 3R4KA 3KZIC 4J01A 3KIOA 4L9NA 3H5NA 2B1EA 4HX8A 1DP3A 2KT0A 2Z5UA 5HS8A 1SFKA 1X58A 1A36A 2OCCH 4CICA 1OCTC 3W2VA 1J59A 2CJJA 3GLXA 4R1HA 4Y17A 3HOTA 3ZQCA 1MJAA 3I9V2 3MZ8A 2E35A 4XRSG 3KETA 2EV5A 4F7ZA 1BI3A 2LY9A 3AAFA 1Z77A 5F64A 2ELKA 3FMSA 5JVTA 2HXOA 4OD5A 3AG3H 2XC7A 1FY7A 4D0PA 5IYDJ 1J5YA 4PGHA 5EG0A 2IA0A 1ENHA 2E71A 1WJEA 4BDYA 3I56I 2B7EA 1IXRC 2DOEA 4ZYEA 4XLCA 5J1RA 1U78A 4EGYA 3E97A 2FBHA 3GX4X 2H27A 1G3SA 3K70C 4YZEA 2LKSA 1MD0A 1B8IB 4CCMA 4IPAA 3VEPA 2VPLA 2B3WA 4MIMA 4AF5A 3UNGC 3WTWC 2ZCMA 1TW3A 2GQQA 2E2HJ 4RAGA 2VT2A 2XGEA 4LIVA 2VPRA 4LK1F 4ENKA 2M5WA 3IH4A 3REOA 1MBKA 2ZJ2A 4EV0A 4XIDA 3IKVA 4S0HB 3F3XA 3M8EA 3IP4B 4UDSA 4Q5SF 5FKOA 3IUVA 1Y1VJ 3VW0A 2BE5F 1ZKGA 1T08B 2IP2A 1DU6A 4IRIA 4IHVA 3F8CA 2D2WA 3K6GA 3HM5A 1Y39A 2PMUA 4KJZA 3S8PA 3CDLA 2JZYA 2LH9A 3G4SI 2XGCA 1ZARA 3HSFA 4FX0A 3T8TA 1Z0XA 2HOEA 1X3UA 5KHDA 2XF6A 2GA1A 3E1SA 2HKOA 5HNHA 1MMDA 1ZG5A 5C4JJ 3AL0C 4GYIA 3LSPA 1WPKA 1V3FA 1WQ2A 1TW2A 4U9NA 3M9AA 3DCFA 4B48A 5J4YA 4RB3C 5BOXA 4U9LA 2AXLA 1FBQA 4A2UA 3KZZA 3ZPLA 2IS4A 3IV5A 1V5EA 3G73A 2YVHA 5F08A 3CJDA 1G3TA 1FOYA 5D5XB 2EV6A 3KEQA 4NDLA 1TLHB 5D5UB 2H1LA 3MEXA 3C7JA 2LYCA 1T98A 4BQQA 4B1RA 5F1RA 4DYRA 2CO5A 2LP0A 1Y1WJ 3K1NA 2CUZA 1ETXA 3IKTA 3BR6A 4PZJA 4CYCA 1O4XA 2QSFX 3OYAA 5BPIA 1P6RA 3BRUA 3I58A 4S04A 2VBYA 3IWZA 1Z7UA 5D6FA 3M4OJ 3KNWA 3OWTA 2NVUB 3H5RA 2V9KA 2DA1A 1F36A 2IGKA 4HV5A 4B3AA 2NOJB 3RPQA 2ZY9A 4O6JA 3JSOA 1F5TA 5ICFA 2L4AA 1IUFA 3DP7A 3LSTA 4BY7J 2DYRH 2V1DA 5HLGA 4ZZLA 4AD9A 1HOMA 2NS8A 3U1KA 2JA8J 2NS0A 2JPCA 3NWTA 3G6EI 2RREA 3O2PE 2HNHA 1WJDA 2KZGA 3JR9A 3BWGA 5M3MJ 3FK6A 5HODA 1GV5A 1GDTA 2LMDA 1O57A 1ZGJA 1DUXC 5DAJA 3RKYA 2QIBA 4HF2A 3I53A 3M3YJ 4G6TB 2OU2A 2Y30A 3RKQA 1ZYRF 1L0OC 1RKTA 4A6EA 3ANGA 4XRFA 3E7LA 4E4HA 2GOXB 3NXCA 1D0YA 2WTEA 2EFOA 3J80K 2NX4A 2P4WA 3HKZA 3SYTA 1G59A 3F1BA 1TWHJ 4YFKF 2ZJPF 2R7OA 2E1CA 2EILH 1P4XA 1QRYA 4B47A 1AA7A 4G6QA 3VW1A 2ESNA 2GFNA 3RZOJ 1PUFB 3H36A 2ICWG 4PFPA 1TWFJ 3DTKA 4PJMA 2OV7A 4BS9A 2R93J 1PUEE 2VQLA 1PP8F 3BOQA 3FBNB 1W4MA 2ZKZA 3OMYA 4UXNA 4P1WA 4UHTA 1Z67A 2IGMA 3MFKA 1WH7A 1YLFA 3T1BA 1H89C 2HOSA 4ABZA 1GV2A 1QZEA 3K4BA 3QPSA 2D45A 3GZNB 4E7IA 2JJ7A 5E8IA 4EGZA 4IKFA 3R6SA 1B72A 2F5EA 1T0FC 3RJPA 4D9JA 3HRTA 4U0YA 5GADJ 1ZRDA 1IV6A 2PX9A 2LDUA 4UUSA 2UXPA 3LSKA 3A0BC 3PUBA 1TWAJ 1RNLA 3V7CA 4CCJA 3WGIA 4GFLA 4GYGA 2DA2A 4GRIA 1ACIA 1X3WB 2XDNA 1J09A 1YS7A 1FYMA 2R92J 1XD7A 2MD5A 2CMPA 4MTDA 3CF2A 3H35A 5BNGA 2DXIA 2DLLA 4UVBA 3TP3A 2V26A 1X1BA 2DMTA 3FMQA 2ZOYA 3ULQB 3H9JA 5IP6A 4LG3A 1USTA 1XMXA 2H8WA 1NK3P 3WTVC 2OQRA 2O6GE 3HOUJ 4MHGA 4WXHA 4I2OA 3GTKJ 2QQAA 2UWMA 1QPMA 1UAAA 5K5RA 5IT9K 1PJRA 4A5NA 3CCMI 2VC0A 3PL8A 3HIFA 3TO7A 1MMNA 3CLQA 1AKHB 3GZ6A 2KFDA 2DTZA 1YW7A 4XSZF 3HOYJ 2HS5A 1T0FA 4XICA 1TNTA 1VTNC 1FMVA 3HYIA 3RI4A 5E1XA 2H8RA 1QGPA 3MN2A 2RNJA 1O7LA 1XN7A 2EPFA 3IL2A 4L18B 5H9TA 1ETKA 2STWA 3GTLJ 1U0JA 4UUTA 2CG4A 3NI7A 3K7AJ 1NK2P 4U0WA 4NN1A 3QKXA 1KQ0A 4HDVA 1U5TC 1OYYA 3L09A 3WE2A 1MIJA 2GIZA 1KU9A 1VZ0A 2HVSA 4BY1J 2CW0F 2XRNA 3E0JB 5B5EC 1UHWA 4BBSJ 4F93B 2EFWA 2G3BA 3K1MA 2MG4A 5E3OA 2YSRA 2OQGA 1SMYF 3OS1A 1NG6A 3EYYA 4A3LJ 3DEEA 4ZJZA 3JTHA 1TL8A 3JAMK 3JREA 3F8MA 5DUKA 2XAFA 1A5JA 4X1EA 3BPVA 5KVRA 4AYBA 5GPCA 2Y9YA 3VPRA 2G7UA 2XUBA 1ZREA 1F1ZA 5L3FA 3OIPA 1MJ9A 5KNLA 1W0TA 2F5FA 4IL6C 2R7XA 2JUCA 1Q1VA 1IF1A 3L2WA 3E5XA 4V2FA 5DUIA 2NOGA 3E3VA 1U9NA 1RZ4A 2KJBA 3MZYA 1MSFC 3G1LA 3RIRA 3C07A 3Q9VA 1S6LA 1X2MA 5HDKA 3CC7I 2MSYA 3T6NA 3L9FA 4MO7A 3GFIA 4QWQA 5GAGJ 2V9VA 3G1MA 4EM1A 2DK5A 2KISA 4NC7A 3FX3A 4L5IA 2W1OA 4EATA 3S17J 4AUXA 2K86A 3J7AY 4U88A 4HF1A 4ME9A 1UG0A 2E5NA 2ZC2A 5A2QZ 2WAEA 3FXRA 1PVEA 5FKKA 2XB5A 2GENA 3J80Z 2WAQN 3IC7A 4HA8A 3L2VA 1OPCA 1XC5A 2ZXIA 1X1DA 2OAZA 1YJ9I 2VBWA 5DS9A 3MQ0A 4I02A 2V6CA 4YG2F 3JW4A 4CCKA 1U5TA 4HPQA 1R5GA 2RV8A 1YRNA 3GZIA 4C9YA 2HPMA 4EJWA 2VONA 2VLAA 1MBHA 3EUAA 4FT8A 3QRFF 2RKHA 2VUMJ 1VQMI 4UUVA 2O61A 2VBZA 4EVIA 2HQAA 1SAXA 1CF7B 1UCRA 2HYFA 3KP3A 5E3LA 1E3OC 1Z1DA 2KLOA 3L2QA 3QBMA 2MLGA 2CSOA 3CMMA 3CDHA 4IZZA 3PNYA 1SC7A 1T39A 5HVQC 2NVTJ 3JCUC 3WTTC 5EEHA 4FQGA 4L5EA 2NVYJ 3VYSB 1STZA 5E3MA 2KL4A 2LY1A 1P2FA 3SZGA 2KDZA 2OBPA 3C2HA 2HTJA 1HA8A 2BZTA 2HYGD 2O8XA 1LVAA 3P9IA 1FNNA 1JKOC 3S1NJ 2A69F 2HVRA 2HZDA 1F4KA 2R3SA 2IGOA 4RAFA 4KIFA 1TC3C 1W5CC 5LHHA 2G7GA 1HDPA 2XHKA 5GP9A 1T33A 3L7WA 1J0RA 3CESA 2LKXA 2FSWA 2B63J 3E6CC 5ERIA 3FHZA 2P5LC 3Q3SA 3RCOA 1BR2A 2ETHA 2LFBA 3OYCA 3HE0A 1XMKA 4Y4RA 2PQ8A 1BL0A 3SZTA 2RVCA 2HQNA 2HYJA 1MNMC 5L3DA 3LJLA 1VQ8I 2LG4A 2QQBA 2Z99A 4EJUA 1U8BA 3VVZA 3K70D 4AC6A 2AQFA 3QAHA 3K4KA 3KYLA 2PN6A 3TEDA 1XMAA 1OCZH 2W4SA 4XSXF 1Y8RB 2FBQA 1R6RA 1I6XA 2K7LA 5LFAA 1OCRH 1NHAA 5CYVA 3PIPF 1CGPA 5IT9Z 4LITA 2O8KA 5GTIC 2WY7Q 4IF4A 2R5ZA 1IC8A 5B1AH 3ZR8X 4CO8A 4G94A 1VQNI 2EBIA 4D1QA 5J8CA 4XK4A 1ITYA 5D4RA 3BTCA 4A5MA 3E5QA 3A4CA 2WUIA 3F9KA 3H3UA 4N4NB 2GOMA 1OLTA 5ED4A 2VI6A 2DA6A 3BZKA 2R7VA 4BQAA 1JJ8C 3PASA 4DIQA 3PQKA 2KQRA 4A0XA 2COBA 1VQ6I 4OWRB 5FJ8J 2JWTA 4A3EJ 2M0CA 4BXUA 1W36D 1HXDA 3O60A 2ZNYA 1KQ8A 2R7RA 4KMFA 4M71A 1KGSA 2Z2SB 2ZXJA 4M3DA 3LWFA 2DDAA 5KAIC 4N4OB 4GXOA 2DMUA 4ITVA 3L2CA 2GM4A 1ETVA 3BPXA 3DU5A 5FD5A 2W53A 3HIMA 4BEHA 1VI0A 1KU2A 5HDGA 2MH9A 1RESA 3S16J 4M9XA 4RLQA 3EGQA 5E79C 3K9TA 4NELA 4C2MJ 3OYKA 2MC4A 1Z3XA 3K4MA 3JAMZ 5L3CA 1IJWC 4GCVA 3WE3A 3GW2A 1EV7A 4BACA 3HBLA 2PJRB 2CFXA 2JVGA 1FC3A 1KU7A 5IOZA 1TWCJ 2ZSIB 4NQWA 1JHFA 4HRIA 2IRFG 3FWEA 2DG7A 1TQIA 2EFNA 1K4TA 1OISA 4IRVA 4XLFA 4BU2A 4A3CJ 2XSJC 3CCUI 2GXAA 2OUMA 3DEUA 5HAWA 3MCZA 2HPIA 1BBYA 2FNAA 3DXJF 3GO5A 2XKOA 3OV8A 4KT6A 2ZOZA 4AU7A 1WZ2A 4LIUA 4HNVA 4RS8A 5F0CA 3I59A 4CYDA 2RDPA 1BIAA 1P7JA 3WHBA 4IOCF 2IAIA 3DFGA 3BG7A 1T95A 3KP2A 4XOTA 2AQEA 1G3YA 2DG8A 3HOXJ 2XAJA 1SVLA 1UELB 2ZB9A 2BY2A 3JRBA 1VQ4I 1N25A 4EEFG 1TQPA 3ZQFA 1TQMA 4GGGA 1SFOJ 2EIJH 5F04A 4EQQA 3D1NI 3BG9A 4LB6B 4MTEA 4ASNA 1SFEA 1B6AA 3LSRA 3V7RA 5EEGA 4KT5C 2JT1A 4MFDA 4P5OA 1WH5A 4L5JA 1KA8A 4L0ZB 3C2GA 2VOPA 3FIWA 4M74A 3CUQB 2ID6A 3J81K 4G7OF 3LHQA 1WSUA 1LFPA 2O5RA 4G9YA 4EM0B 1BIBA 3WU0A 1K4SA 2XVCA 4BAYA 4XONA 5LHGA 3P9TA 1HBXG 2OZ6A 5JI6A 1JTXA 4A3MJ 5DD8A 2KDOA 2GUHA 1QZZA 1IN5A 2BOLA 2M34A 1G4DA 1BC8C 4QPQA 3F0CA 5H6QA 3BZ6A 3DPJA 4WWCA 2MLKA 2XF5A 4G6DA 1XCBA 1MMSA 2ZJRF 2EH3A 2XAUA 1UZCA 2R5YB 1DP7P 3M8FA 1LNWA 5DYMA 4RAZA 1RR8C 2M45A 1R1UA 2DODA 2L0KA 1FPQA 4YRVA 3SDBA 1H9GA 4DOZA 1W0UA 1FIPA 2L7ZA 2LF7A 3EUHC 4U7BA 4D5FA 2XAQA 2A6EF 4A3BJ 4BQOA 2XF7A 4O5VA 5M5XJ 3BY6A 3HB9A 2BY0A 3MNLA 3RD3A 5IYCJ 3DTEA 6PAXA 5E1ZB 1HSTA 5FROA 3BQZA 1I6HJ 1FIAA 3D5LA 2DFHA 4AWXB 1ZRFA 2BXZA 2MFZA 2RQQA 1FWZA 4HYEA 2JN6A 2EV0A 3AG1H 4M6VA 3HTUA 4HLYA 5CQGA 1TP4A 3ZCOA 1B8IA 2DTRA 4BXXJ 5ILVA 1T6SA 3H5AA 1YG2A 2XKPA 5AIQA 3UKGA 4ENMA 1H0MA 5HLTA 4NC8A 2EZIA 4QIWN 5HLHA 2V6EA 3AG4H 1ETYA 3ZXSA 1MW7A 5C4YA 3BR1A 1XSDA 1YW9A 2ZMEB 3LSGA 2PZ9A 1TWGJ 9ANTA 2QEXI 3SDGA 3GWZA 3TOAA 2YU9J 1S9HA 2QBYB 3OY9A 4R79A 2NRAC 2P0WA 4PGGA 2BVMA 4AC0A 2XSDC 2DW4A 2F6CA 3E5UA 1T8IA 4HF0A 4BDZA 2A6HF 5EZGA 3U2RA 3HHGA 2VE9A 2W85A 3B6AA 4PSWA 3ON4A 4WXCA 2K5CA 3CTAA 3RKWA 4CH7A 4BE2A 2DQRA 1S7OA 2EIMH 4XLEA 4HNUA 3C18A 4KN4X 1Y8QB 5JHFA 2HDWA 4CSWA 2X6XA 2MC3A 3LAJA 2FBIA 5C44J 1E17A 2ZCXA 2RN7A 2DA5A 3EUHA 1ZQ3P 4UNOA 3MMYB 1FZPB 5EJCA 1RI7A 3QOPA 4YELA 1SD5A 2JRMA 4Z2YA 2X4HA 3S5RA 2AO9A 2LKPA 3WG9A 3S2DJ 3VIBA 3GEUA 1HQCA 3HOWJ 2ELJA 1HKTA 3H0DA 4II3A 4AIDA 4RM3A 1X4PA 2K40A 2HOAA 3A2KA 3PSIA 2M1BA 3EETA 3NEUA 5EG0B 1TZLA 4FE4A 5K7ZA 3CF5F 1LDDA 1VFCA 1A35A 3TO6A 3ABUA 5L3GA 3BJ6A 3LSHA 2FMYA 2Y0SA 5CQEA 2VB6A 1H88C 1ZRCA 2CS3A 1IAWA 2K9SA 3F21A 2J5OA 1QU3A 2FUG2 3EUPA 3OOUA 1FJLA 3IAS2 5HOOA 1JUPA 2JA7J 2QKOA 2X0LA 2IBDA 3G2BA 2G7LA 1VQ9I 1PYVA 4HZFA 3NAUA 3L2RA 5JR3A 3ZMVA 3BDDA 5D8KB 4U87A 2O9LA 2BY1A 2WADA 1O3TA 1DQUA 3W6KB 5B66C 2DPUA 1FOWA 1W7PB 2DFEA 4OU0A 4IQJA 2KIFA 1OFCX 1WVRA 2H6CA 5FKLA 4AIHA 1RIOH 3BHQA 1L3LA 3DBLB 1I5ZA 3TW7A 2X1CA 1KZHA 4PJLA 4DGWB 3GVAA 4CGRA 4BHPA 4XKWA 4MEYF 1WJBA 3VVXA 1FYKA 1MNEA 3FXJA 4I0BA 4BJ6C 3DLLF 4GFKA 2F5CA 2A5WA 4KIBA 2V57A 5D8LB 3JRGA 3S93A 5E1WA 1XDSA 3U1DA 4NC6A 3ZQIA 4YIIA 1JKPC 3OS0A 1FEXA 2UXHA 4OAZA 2XAGA 1KQ9A 3I71A 5KAFC 3HXLA 1E3HA 2NP3A 3RKXA 5D4SA 3QPLA 5FFZA 4F3QA 3HTIA 3LA7A 1U8RA 1ORKA 2RASA 4ESFA 3IUOA 3IH3A 4PCQA 5CKTA 3F8NA 3ISPA 2VKDA 4BQNA 1VF9A 4CDGA 1PUFA 4NBQA 2BHYA 2MGQA 2JTVA 2JA5J 3VUQA 2R7FA 1LEBA 1IRZA 1BW6A 2E2IJ 4GDFA 4G7HF 2PMZA 4M3GA 3QOEA 3B02A 1R7JA 4MK6A 5J1UA 2CUEA 2EFQA 3ZQ7A 3HOSA 3P9KA 3MAJA 3WTYC 2BVLA 2UXUA 3TDZC 3K4JA 4BJTA 2DOFA 1ZG3A 2TRTA 3GBGA 2ADUA 3RYRA 2Z9OA 2GZWA 3SFZA 1WI9A 5LGTA 2DOAA 3AG2H 4N9IA 4NHJA 3KLNA 5CVJA 4NB5A 2L4MA 2R7DA 3WTUC 2D1HA 3NRVA 5D19A 3IRQA 2FEZA 1XG1A 4A6DA 1O7FA 1WRJA 3CMYA 2QGUA 3B6CA 1Y6IA 2K4JA 1Z7LA 1EA3A 1APLC 2MA3A 2QF7A 2RQPA 3KP6A 1BN5A 2L7FP 4QPOA 2LLKA 4A3IJ 4JL3A 2E34A 1JUSA 1K6YA 3HSRA 3OOPA 4A3DJ 3ECHA 3QU3A 3D0SA 1G8XA 3HGGA 1XPXA 3OIQA 5JHUA 1NG7A 3A01A 1UFMA 2QOPA 4HQEA 5ILUA 1JGSA 3I0TA 2F5DA 4P9FA 4IQ4A 3D5SC 2K9LA 4YFNF 2LRDA 4HQMA 1IO2A 4BH9A 4XLPF 4RLFA 1RKWA 3LA3A 4JYKA 2TCTA 2R0QC 2HGCA 2JVHA 4GCKA 2BEOA 3Q0WA 1U6GA 2X1EA 4PUSA 4NUBA 1DPUA 3ZQQA 3Q0UA 2VJIA 1BI1A 3RQIA 1QZYA 4RB0A 4R8HA 1BI2A 4IRGA 4F92B 5LGUA 4LLLA 2LBFB 4EM2A 5CW8A 2D5VA 1AKHA 2KPMA 2JPBA 2L2OA 1QVUA 1IW7F 3CJNA 3S15J 4HKUA 1Q1HA 3VVYA 2CQ7A 3FRQA 2RGVA 3I55I 2P6SA 4OIOF 4X0GA 2STTA 1QO0D 3CWRA 2DU9A 3B73A 1V4RA 4D5CA 4F55A 2GBYA 2DK8A 4KISA 2ZXHA 4IVNA 4XQFA 4WCGA 4LMYA 3HTSB 2IT0A 3GFLA 3ERMA 1T38A 1P4AA 4RA2A 2M30A 3BR3A 2FMLA 3QODA 3MKYB 3HOZJ 5AQCA 4ZZDA 2W7NA 2QYOA 2R7UA 3JSJA 2F5VA 3BZCA 3N4MA 3OYIA 2V1NA 3ONQA 3JRDA 2P7CB 4JKZA 1VNDA 2GA2A 1I27A 3GF2A 4PXIA 4AIJA 3CO6C 4A3KJ 2DA4A 2Q1ZB 3NWSA 1VQOI 1RR7A 3A02A 2ELHA 2HZTA 3QYFA 2VODA 1WKMA 5D18A 2VXZA 1REPC 4XORA 4PDKA 4JP0A 2VIXA 1HW2A 1Y56A 2VJ4A 4Q47A 5K7FA 1S72I 4U7DA 1RUNA 2PBXA 3IHUA 3OYMA 2QKLB 5J4VA 2VXDA 4ICHA 5EEAA 1GT0C 1DDNA 5IPAA 1MMAA 2KP6A 4W97A 1FYLA 4ENNA 3DTIA 2VKVA 2X51A 1OCPA 5D6EA 3BTJA 3N97A 2UUZA 2WY8Q 4FASD 4PK4A 4FX4A 1JE8A 4RBOA 3E6BA 1HKQA 4E7KA 2XRLA 2A61A 4XKCA 3HHHA 1HKSA 1SD4A 1W5TA 3CCRI 3FXKA 4MQ9F 5BQTA 2E7WA 1XGMA 3COAC 3BLYA 3CP2A 3JRIA 4IHTA 4CA0A 1BOAA 5FHPA 3HRMA 1K7AA 1BJZA 5LD2C 4I01A 4YEJA 5GAEJ 2RHAA 3K10A 2KRHA 2YX4A 4BJ5C 4A3JJ 2EZLA 1I1SA 2XROA 1YS6A 2EB7A 4M9SA 2FJ1A 3A0HC 1YITI 2E19A 4MFEA 1ONVA 2K4BA 4MXMA 4MLOA 3CCQI 1MNDA 2MW8A 1IGNA 1HF0A 4XLAA 2QWTA 3HG9A 5H20A 5AIPA 3SQNA 3CCLI 3ANPA 3PFIA 1M1EB 1CF7A 3QPTA 2Y0MA 3CCVI 3F6OA 2Q2EB 5C4XJ 3W2WA 3O3KA 1JTYA 2VASA 2HDCA 4M72A 1SD7A 2VE8A 4UV9A 2IEKA 5KK1A 4XN3A 3BROA 1R9TJ 1R49A 4KMUX 1BC7C 2M9HA 1ZGWA 3BCBA 1GHCA 1K78B 2CYYA 1J9IA 2A68F 2ZNZA 4W1UA 5DEQA 3CCEI 1MBEA 3PSFA 3J7ZI 4IO9F 1JI8A 3K4LA 1D8KA 2TDXA 2V1UA 2WB1N 5F1JA 3R0AA 3OSGA 1WWXA 2XPWA 5CXGA 2VN2A 5J47A 1LE8B 2CQKA 5GPAA 1R00A 2DPDA 4ZC3A 2PFVA 4AVPA 1B59A 1KONA 2FF4A 2Z3YA 1U3EM 4FISA 1YTYA 4C2UA 2JA6J 4J19A 2BHZA 1B4AA 1TT0A 3VYUB 1WJAA 2IA2A 2X9DA 2ZXWH 5E18F 3KLOA 1Z05A 2LSOA 1D1BA 1ZLJA 3WTSC 3AFHA 3S3MA 4OIPF 4X6AJ 4UVCA 2L3DA 3TBIA 4WX9A 4PJ0C 4C30A 1JT0A 2FNPA 4LFUA 3FXLA 2HQ5A 2MBFA 2W82A 1JKQC 5K7HA 2JK3A 2EZHA 1RETA 5FGLA 2E1MB 1R5HA 3JSPA 5LEJA 4D7NA 4CZCA 3OYGA 1D8JA 1E3PA 3M1CA 5KCMA 5F0FA 1D5YA 1ZHFA 4B09A 5DM6F 4HW0A 3PM1A 1YW8A 2WV1A 3QQAA 1IXCA 3DPUA 1XGSA 4C2TA 2XGXA 4ENJA 4ZTJA 3RDIA 2VT3A 3GTPJ 1Z3YA 2EA4A 5D5VB 3RQ4A 2CU7A 4UY8I 3JRCA 1LFBA 3J7YJ 1BM9A 5LRSA 2PI0A 5EF6A 4OD4A 2FOWA 1FBSA 3FXOA 1UHSA 1SVOA 3GYHX 3BR5A 1ETWA 3FMRA 2E1OA 3O8HA 3S3OA 1SAUA 3I4PA 1XGNA 2IA1A 3I64A 2D1VA 3ASNH 4ZH4F 3JRHA 3AKZA 4C3IJ 1YIOA
chains in the Genus database with same CATH topology
3G56A 4JX4A 4C3HJ 2DMNA 1W0UA 1FIPA 4B3AA 2L7ZA 3OSFA 4JX5A 4D5FA 4KWAA 4A3BJ 5M5XJ 2AHQA 3HB9A 5FLVA 2OPTA 4D7MA 4BY7J 1IUFA 1K61A 3MNLA 1HOMA 3RD3A 5IYCJ 2NS8A 2JA8J 2HKUA 3WHCA 1P7IA 1I6HJ 3BQZA 1FIAA 5IP9J 3JR9A 4C3JJ 5EGOB 5M3MJ 3FK6A 5HODA 1GV5A 3NNRA 2JN6A 4M6VA 1GDTA 1QVTA 3V6GA 1B8IA 2E2JJ 3NPIA 5DAJA 2P81A 3GTOJ 2QIBA 3GTGJ 3S1QJ 2ID3A 4BXXJ 5JLXA 2G7SA 3UKGA 4L62A 3M3YJ 1UG2A 2EZIA 1JT6A 4QIWN 1WGXA 2QTQA 2HOTA 2Y30A 3K2AA 3RKQA 1ETYA 2LD5A 5C4YA 3BR1A 1RKTA 2YUSA 3ANGA 3LSGA 3E7LA 2PZ9A 1TWGJ 3SFIA 9ANTA 3NXCA 5FKMA 3SDGA 3MKLA 2YU9J 2NX4A 3F1BA 4DW6A 3V78A 1TWHJ 2IU5A 4GCTA 4AC0A 2XSDC 4M3FA 4DZJA 1LE8A 1RPWA 1QRYA 3H0GJ 3VW1A 5EZGA 5HBUA 2R5ZB 2GFNA 3RZOJ 3B6AA 1PUFB 3BG3A 3ON4A 5C3EJ 1DU0A 2F07A 1TWFJ 2X6OA 1AU7A 1ZTRA 2R93J 1I50J 3RZDJ 2XPUA 5C44J 2ZCXA 2DN0A 2DA5A 1ZQ3P 3TW6A 3FKIJ 1WH7A 1H89C 2HOSA 4ABZA 1GV2A 1FTZA 1NTCA 3QPSA 3S5RA 2JJ7A 2AO9A 4XRMA 3S2DJ 1B72A 3COLA 3VIBA 3GEUA 2O7TA 1MBJA 3HOWJ 5FKNA 3GTMJ 2EQRA 3BNIA 3NARA 1IV6A 2K40A 2ME0A 2HOAA 4UUSA 1X2NA 3CRJA 5EG0B 2UXPA 5K7ZA 4FE4A 1VFCA 3MVPA 3HTHA 2HDDA 3A03A 1TWAJ 3VOXA 1H88C 2K9SA 2UXIA 2D6YA 4GFLA 1ZR4A 2DJNA 2DA2A 2OERA 3VP5A 2XDNA 3EUPA 3OOUA 4Y52J 1FJLA 2XB0X 3HGYA 5CXIA 1JUPA 2R92J 2R5YA 2JA7J 2QKOA 4B4CA 1JUMA 4M3BA 5BNGA 2IBDA 2G7LA 5M3FJ 2X48A 3TP3A 3ZQGA 2LVSA 2L7MP 3HKZN 1POGA 3NAUA 2DMTA 5EZHA 4A3FJ 1YRNB 3ON2A 5EYRA 5IP6A 3OIOA 2ZOYA 2O9LA 3B81A 1NK3P 3HOUJ 2VKEA 3GTKJ 1OFCX 5FKLA 3AQTA 3BHQA 5EDNA 1UI5A 3TW7A 3KZ9A 5D1RA 5EGOA 1U9OA 1UI6A 1FTTA 4CGRA 1AKHB 3VVXA 4XRSA 4QSHA 2DTZA 4GFKA 3CCYA 3HOYJ 4XICA 2V57A 2CUFA 3JRGA 2H8RA 3MN2A 5JLWA 3ZQIA 1HCRA 1BW5A 1JKPC 1FEXA 2UXHA 5H9TA 2QCOA 2RAEA 1ETKA 1JGGA 3S14J 3GTLJ 4UUTA 2NP3A 3NI7A 1ZK8A 3K7AJ 1NK2P 3QPLA 3E7QA 3HTIA 4NN1A 3QKXA 3I4MJ 1ORKA 2Y0SN 3ZOBA 4IHWA 3HEFA 2RASA 4BY1J 3IH3A 2OF7A 1ETQA 1VF9A 4I6ZA 4BBSJ 1PUFA 2G3BA 2MG4A 5E3OA 2MGQA 2JA5J 3VUQA 1IRZA 3H3VK 4A3LJ 1BW6A 2E2IJ 5F0HA 2Q24A 3FK7A 2M2EA 1JJ6C 3JREA 2Y2ZA 4M3GA 1A5JA 4MK6A 4X1EA 5J1UA 5HSZA 2CUEA 5GPCA 4DYCA 2Y9YA 3VPRA 3BJBA 3GTJJ 1HLVA 5K58A 4Y7NJ 5IYBJ 2EZKA 2UXUA 1W0TA 1Q1VA 2TRTA 3GBGA 2NS7A 4V2FA 3PO2J 2NOGA 1CQTA 1U9NA 1MSFC 2Y9ZA 3G1LA 3C07A 3C2BA 1ETOA 2NVXJ 1EF4A 2ZCNA 1X2MA 2MSYA 5D19A 3T6NA 3ZQHA 1F43A 4MO7A 3O8GA 3KKDA 1XG1A 3G1MA 3CMYA 1ZR2A 3B6CA 1OJLA 1AHDP 2R7ZJ 3S17J 4AUXA 1APLC 2QF7A 4IHYA 2L7FP 3BT9A 2LLKA 2Y31A 2FX0A 2M8GX 4A3IJ 2K9QA 4BKXA 4ME9A 4LOCA 4JL3A 1JUSA 4GFBA 4JX6A 4A3DJ 2DA3A 1JKRC 5FKKA 2XB5A 2GENA 1T56A 3VW2A 3HGGA 2WAQN 1HDDC 1XC5A 5IP7J 3BR2A 3BG5A 5DS9A 3A01A 1MBGA 2QOPA 2NVQJ 1YRNA 3GZIA 4A69C 1RKWA 1IG7A 4JYKA 3GTQJ 1MBHA 2TCTA 2R0QC 2VUMJ 4GCKA 3LWJA 3HTJA 3Q0WA 4DYQA 1MBFA 3RH2A 5FLMJ 4IEJA 2O7OA 3Q0UA 5E3LA 1E3OC 2REKA 3BCGA 4G12A 3QBMA 3RQIA 4FCYA 2HI3A 3S1RJ 2LTPA 3Q0VA 2PMZN 3JRAA 1GVDA 4AYBN 5CW8A 3FISA 2D5VA 3ZQLA 1AKHA 2NVTJ 4JNNA 1QVUA 4HKUA 3W6VA 3S15J 2K9NA 3VVYA 4L5EA 2NVYJ 2XPVA 1S7EA 3FRQA 5E3MA 2DMQA 5IOYA 2KDZA 4GCLA 2I10A 4IHXA 3CWRA 3S1NJ 1JKOC 4D5CA 3BTLA 1TC3C 2GBYA 2CQXA 2G7GA 1XS9A 1HDPA 2G0EA 3BQYA 3LSJA 5GP9A 3BR3A 3HOZJ 1T33A 3IH2A 5AQCA 3LNQA 2LKXA 3JSJA 2B63J 4JKZA 3JRDA 3JRFA 3Q3SA 1VNDA 2LFBA 3HE0A 4PXIA 2DA7A 5F27A 5DTDA 4A3KJ 2DA4A 1BL0A 1RR7A 3A02A 3CQZJ 1G2HA 3PPBA 3I4NJ 1MNMC 2HYJA 4V2GA 3VOKA 3LJLA 2LR8A 2OI8A 1U8BA 3VVZA 4AC6A 1A6IA 5D18A 2UXOA 1WCMJ 2DA1A 4DZPA 1LFUP 4JP0A 3TEDA 2XGDA 5K7FA 4M3EA 2FBQA 3BR0A 1MH4A 2PBXA 2YVEA 1I3QJ 2NP5A 1SGMA 2O8KA 4ICHA 5EEAA 2FQ4A 2R5ZA 1GT0C 1WI3A 5IPAA 1IC8A 4W97A 1QPIA 4A3GJ 2HYTA 2VKVA 4CYCB 2EBIA 1OCPA 3LOCA 2KT0A 4XK4A 3BTJA 4A93J 1ITYA 3BTCA 3G1OA 2WUIA 1K83J 1X58A 3TP0A 4RBOA 1OCTC 2VI6A 2DA6A 2XRLA 5M5YJ 4QTRA 2CJJA 3L1PA 3ZQCA 3SJMA 1JJ8C 3PASA 3AQSA 4XRSG 1MH3A 3JRIA 2COBA 5FHPA 2LY9A 3HTAA 1BJZA 5FJ8J 2JWTA 4A3EJ 2M0CA 2LK2A 3O60A 2YS9A 1Z77A 2RHAA 5J3LA 5EFYA 2ELKA 2HXOA 4A3JJ 2EZLA 4M3DA 2DMUA 4BBRJ 5IYDJ 5EG0A 2GM4A 1ENHA 1ETVA 2W53A 2FJ1A 3HIMA 2E19A 1VI0A 4MFEA 1GUUA 1RESA 4MXMA 4MLOA 3S16J 1H8AC 5J1YA 2MW8A 5J1RA 1U78A 1HF0A 1IGNA 2WGBA 2QWTA 3EGQA 4NELA 4C2MJ 2ECBA 3ANPA 1IJWC 3DEWA 4YZEA 1B8IB 5C4XJ 4MIMA 4AF5A 3HBLA 1JTYA 2ZCMA 2E2HJ 2IEKA 1R9TJ 2XGEA 5IOZA 2VPRA 1TWCJ 2M9HA 1ZGWA 1MSEC 2DG7A 3IH4A 3PO3J 4ACIA 1SANA 2DMPA 1IDZA 4A3CJ 1MBKA 4W1UA 4XIDA 5HAWA 1MBEA 4S0HB 4I76A 4UDSA 2WB1N 5F1JA 3OSGA 5FKOA 3IUVA 2XPWA 2H1KA 5CXGA 1Y1VJ 1LE8B 1UMQA 2ZOZA 3VW0A 5GPAA 1ZKGA 2FD5A 2N8GA 1DU6A 4HNVA 4IHVA 5F0CA 3HM5A 4FTHA 3CDLA 4FISA 1P7JA 3WHBA 4J19A 2XGCA 2JA6J 2GLOA 2IAIA 1Z0XA 2X9DA 2DG8A 3HOXJ 5C4JJ 2W48A 2ZB9A 3JRBA 4X6AJ 3LSPA 4EEFG 1WPKA 1SFOJ 3ZQFA 3G7RA 5F04A 1JT0A 3D1NI 3BG9A 2HQ5A 3DCFA 3LSRA 5M5WJ 1JKQC 5K7HA 5FMPA 2JK3A 2EZHA 1RETA 1B72B 3HDDA 5FGLA 4MFDA 1WH5A 3IV5A 3S2HJ 4D7NA 3FIWA 2YVHA 5F08A 2ID6A 3CJDA 3LHQA 3A01B 3KKCA 4FE7A 5F0FA 2CQQA 1D5YA 4UUSB 4NDLA 3PM1A 3P9TA 2WV1A 3QQAA 2ECCA 1JTXA 4A3MJ 4RDUA 4B1RA 2GUHA 4DYRA 2LP0A 2M34A 1Y1WJ 3GTPJ 1ETXA 3BR6A 3F0CA 5E3NA 4CYCA 1O4XA 2ME6A 2CU7A 3DPJA 3JRCA 1LFBA 3S1MJ 5EF6A 3HOVJ 3BRUA 1UHSA 1BA5A 3BR5A 1IDYA 1ETWA 2EH3A 3BTIA 3NRGA 2E1OA 3O8HA 2R5YB 2HXIA 3M4OJ 3KNWA 2L9RA 3JRHA 2JMWA 1F36A 2L0KA 2CRGA 4C3IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G56 A;  4JX4 A;  4C3H J;  2DMN A;  1W0U A;  1FIP A;  4B3A A;  2L7Z A;  3OSF A;  4JX5 A;  4D5F A;  4KWA A;  4A3B J;  5M5X J;  2AHQ A;  3HB9 A;  5FLV A;  2OPT A;  4D7M A;  4BY7 J;  1IUF A;  1K61 A;  3MNL A;  1HOM A;  3RD3 A;  5IYC J;  2NS8 A;  2JA8 J;  2HKU A;  3WHC A;  1P7I A;  1I6H J;  3BQZ A;  1FIA A;  5IP9 J;  3JR9 A;  4C3J J;  5EGO B;  5M3M J;  3FK6 A;  5HOD A;  1GV5 A;  3NNR A;  2JN6 A;  4M6V A;  1GDT A;  1QVT A;  3V6G A;  1B8I A;  2E2J J;  3NPI A;  5DAJ A;  2P81 A;  3GTO J;  2QIB A;  3GTG J;  3S1Q J;  2ID3 A;  4BXX J;  5JLX A;  2G7S A;  3UKG A;  4L62 A;  3M3Y J;  1UG2 A;  2EZI A;  1JT6 A;  4QIW N;  1WGX A;  2QTQ A;  2HOT A;  2Y30 A;  3K2A A;  3RKQ A;  1ETY A;  2LD5 A;  5C4Y A;  3BR1 A;  1RKT A;  2YUS A;  3ANG A;  3LSG A;  3E7L A;  2PZ9 A;  1TWG J;  3SFI A;  9ANT A;  3NXC A;  5FKM A;  3SDG A;  3MKL A;  2YU9 J;  2NX4 A;  3F1B A;  4DW6 A;  3V78 A;  1TWH J;  2IU5 A;  4GCT A;  4AC0 A;  2XSD C;  4M3F A;  4DZJ A;  1LE8 A;  1RPW A;  1QRY A;  3H0G J;  3VW1 A;  5EZG A;  5HBU A;  2R5Z B;  2GFN A;  3RZO J;  3B6A A;  1PUF B;  3BG3 A;  3ON4 A;  5C3E J;  1DU0 A;  2F07 A;  1TWF J;  2X6O A;  1AU7 A;  1ZTR A;  2R93 J;  1I50 J;  3RZD J;  2XPU A;  5C44 J;  2ZCX A;  2DN0 A;  2DA5 A;  1ZQ3 P;  3TW6 A;  3FKI J;  1WH7 A;  1H89 C;  2HOS A;  4ABZ A;  1GV2 A;  1FTZ A;  1NTC A;  3QPS A;  3S5R A;  2JJ7 A;  2AO9 A;  4XRM A;  3S2D J;  1B72 A;  3COL A;  3VIB A;  3GEU A;  2O7T A;  1MBJ A;  3HOW J;  5FKN A;  3GTM J;  2EQR A;  3BNI A;  3NAR A;  1IV6 A;  2K40 A;  2ME0 A;  2HOA A;  4UUS A;  1X2N A;  3CRJ A;  5EG0 B;  2UXP A;  5K7Z A;  4FE4 A;  1VFC A;  3MVP A;  3HTH A;  2HDD A;  3A03 A;  1TWA J;  3VOX A;  1H88 C;  2K9S A;  2UXI A;  2D6Y A;  4GFL A;  1ZR4 A;  2DJN A;  2DA2 A;  2OER A;  3VP5 A;  2XDN A;  3EUP A;  3OOU A;  4Y52 J;  1FJL A;  2XB0 X;  3HGY A;  5CXI A;  1JUP A;  2R92 J;  2R5Y A;  2JA7 J;  2QKO A;  4B4C A;  1JUM A;  4M3B A;  5BNG A;  2IBD A;  2G7L A;  5M3F J;  2X48 A;  3TP3 A;  3ZQG A;  2LVS A;  2L7M P;  3HKZ N;  1POG A;  3NAU A;  2DMT A;  5EZH A;  4A3F J;  1YRN B;  3ON2 A;  5EYR A;  5IP6 A;  3OIO A;  2ZOY A;  2O9L A;  3B81 A;  1NK3 P;  3HOU J;  2VKE A;  3GTK J;  1OFC X;  5FKL A;  3AQT A;  3BHQ A;  5EDN A;  1UI5 A;  3TW7 A;  3KZ9 A;  5D1R A;  5EGO A;  1U9O A;  1UI6 A;  1FTT A;  4CGR A;  1AKH B;  3VVX A;  4XRS A;  4QSH A;  2DTZ A;  4GFK A;  3CCY A;  3HOY J;  4XIC A;  2V57 A;  2CUF A;  3JRG A;  2H8R A;  3MN2 A;  5JLW A;  3ZQI A;  1HCR A;  1BW5 A;  1JKP C;  1FEX A;  2UXH A;  5H9T A;  2QCO A;  2RAE A;  1ETK A;  1JGG A;  3S14 J;  3GTL J;  4UUT A;  2NP3 A;  3NI7 A;  1ZK8 A;  3K7A J;  1NK2 P;  3QPL A;  3E7Q A;  3HTI A;  4NN1 A;  3QKX A;  3I4M J;  1ORK A;  2Y0S N;  3ZOB A;  4IHW A;  3HEF A;  2RAS A;  4BY1 J;  3IH3 A;  2OF7 A;  1ETQ A;  1VF9 A;  4I6Z A;  4BBS J;  1PUF A;  2G3B A;  2MG4 A;  5E3O A;  2MGQ A;  2JA5 J;  3VUQ A;  1IRZ A;  3H3V K;  4A3L J;  1BW6 A;  2E2I J;  5F0H A;  2Q24 A;  3FK7 A;  2M2E A;  1JJ6 C;  3JRE A;  2Y2Z A;  4M3G A;  1A5J A;  4MK6 A;  4X1E A;  5J1U A;  5HSZ A;  2CUE A;  5GPC A;  4DYC A;  2Y9Y A;  3VPR A;  3BJB A;  3GTJ J;  1HLV A;  5K58 A;  4Y7N J;  5IYB J;  2EZK A;  2UXU A;  1W0T A;  1Q1V A;  2TRT A;  3GBG A;  2NS7 A;  4V2F A;  3PO2 J;  2NOG A;  1CQT A;  1U9N A;  1MSF C;  2Y9Z A;  3G1L A;  3C07 A;  3C2B A;  1ETO A;  2NVX J;  1EF4 A;  2ZCN A;  1X2M A;  2MSY A;  5D19 A;  3T6N A;  3ZQH A;  1F43 A;  4MO7 A;  3O8G A;  3KKD A;  1XG1 A;  3G1M A;  3CMY A;  1ZR2 A;  3B6C A;  1OJL A;  1AHD P;  2R7Z J;  3S17 J;  4AUX A;  1APL C;  2QF7 A;  4IHY A;  2L7F P;  3BT9 A;  2LLK A;  2Y31 A;  2FX0 A;  2M8G X;  4A3I J;  2K9Q A;  4BKX A;  4ME9 A;  4LOC A;  4JL3 A;  1JUS A;  4GFB A;  4JX6 A;  4A3D J;  2DA3 A;  1JKR C;  5FKK A;  2XB5 A;  2GEN A;  1T56 A;  3VW2 A;  3HGG A;  2WAQ N;  1HDD C;  1XC5 A;  5IP7 J;  3BR2 A;  3BG5 A;  5DS9 A;  3A01 A;  1MBG A;  2QOP A;  2NVQ J;  1YRN A;  3GZI A;  4A69 C;  1RKW A;  1IG7 A;  4JYK A;  3GTQ J;  1MBH A;  2TCT A;  2R0Q C;  2VUM J;  4GCK A;  3LWJ A;  3HTJ A;  3Q0W A;  4DYQ A;  1MBF A;  3RH2 A;  5FLM J;  4IEJ A;  2O7O A;  3Q0U A;  5E3L A;  1E3O C;  2REK A;  3BCG A;  4G12 A;  3QBM A;  3RQI A;  4FCY A;  2HI3 A;  3S1R J;  2LTP A;  3Q0V A;  2PMZ N;  3JRA A;  1GVD A;  4AYB N;  5CW8 A;  3FIS A;  2D5V A;  3ZQL A;  1AKH A;  2NVT J;  4JNN A;  1QVU A;  4HKU A;  3W6V A;  3S15 J;  2K9N A;  3VVY A;  4L5E A;  2NVY J;  2XPV A;  1S7E A;  3FRQ A;  5E3M A;  2DMQ A;  5IOY A;  2KDZ A;  4GCL A;  2I10 A;  4IHX A;  3CWR A;  3S1N J;  1JKO C;  4D5C A;  3BTL A;  1TC3 C;  2GBY A;  2CQX A;  2G7G A;  1XS9 A;  1HDP A;  2G0E A;  3BQY A;  3LSJ A;  5GP9 A;  3BR3 A;  3HOZ J;  1T33 A;  3IH2 A;  5AQC A;  3LNQ A;  2LKX A;  3JSJ A;  2B63 J;  4JKZ A;  3JRD A;  3JRF A;  3Q3S A;  1VND A;  2LFB A;  3HE0 A;  4PXI A;  2DA7 A;  5F27 A;  5DTD A;  4A3K J;  2DA4 A;  1BL0 A;  1RR7 A;  3A02 A;  3CQZ J;  1G2H A;  3PPB A;  3I4N J;  1MNM C;  2HYJ A;  4V2G A;  3VOK A;  3LJL A;  2LR8 A;  2OI8 A;  1U8B A;  3VVZ A;  4AC6 A;  1A6I A;  5D18 A;  2UXO A;  1WCM J;  2DA1 A;  4DZP A;  1LFU P;  4JP0 A;  3TED A;  2XGD A;  5K7F A;  4M3E A;  2FBQ A;  3BR0 A;  1MH4 A;  2PBX A;  2YVE A;  1I3Q J;  2NP5 A;  1SGM A;  2O8K A;  4ICH A;  5EEA A;  2FQ4 A;  2R5Z A;  1GT0 C;  1WI3 A;  5IPA A;  1IC8 A;  4W97 A;  1QPI A;  4A3G J;  2HYT A;  2VKV A;  4CYC B;  2EBI A;  1OCP A;  3LOC A;  2KT0 A;  4XK4 A;  3BTJ A;  4A93 J;  1ITY A;  3BTC A;  3G1O A;  2WUI A;  1K83 J;  1X58 A;  3TP0 A;  4RBO A;  1OCT C;  2VI6 A;  2DA6 A;  2XRL A;  5M5Y J;  4QTR A;  2CJJ A;  3L1P A;  3ZQC A;  3SJM A;  1JJ8 C;  3PAS A;  3AQS A;  4XRS G;  1MH3 A;  3JRI A;  2COB A;  5FHP A;  2LY9 A;  3HTA A;  1BJZ A;  5FJ8 J;  2JWT A;  4A3E J;  2M0C A;  2LK2 A;  3O60 A;  2YS9 A;  1Z77 A;  2RHA A;  5J3L A;  5EFY A;  2ELK A;  2HXO A;  4A3J J;  2EZL A;  4M3D A;  2DMU A;  4BBR J;  5IYD J;  5EG0 A;  2GM4 A;  1ENH A;  1ETV A;  2W53 A;  2FJ1 A;  3HIM A;  2E19 A;  1VI0 A;  4MFE A;  1GUU A;  1RES A;  4MXM A;  4MLO A;  3S16 J;  1H8A C;  5J1Y A;  2MW8 A;  5J1R A;  1U78 A;  1HF0 A;  1IGN A;  2WGB A;  2QWT A;  3EGQ A;  4NEL A;  4C2M J;  2ECB A;  3ANP A;  1IJW C;  3DEW A;  4YZE A;  1B8I B;  5C4X J;  4MIM A;  4AF5 A;  3HBL A;  1JTY A;  2ZCM A;  2E2H J;  2IEK A;  1R9T J;  2XGE A;  5IOZ A;  2VPR A;  1TWC J;  2M9H A;  1ZGW A;  1MSE C;  2DG7 A;  3IH4 A;  3PO3 J;  4ACI A;  1SAN A;  2DMP A;  1IDZ A;  4A3C J;  1MBK A;  4W1U A;  4XID A;  5HAW A;  1MBE A;  4S0H B;  4I76 A;  4UDS A;  2WB1 N;  5F1J A;  3OSG A;  5FKO A;  3IUV A;  2XPW A;  2H1K A;  5CXG A;  1Y1V J;  1LE8 B;  1UMQ A;  2ZOZ A;  3VW0 A;  5GPA A;  1ZKG A;  2FD5 A;  2N8G A;  1DU6 A;  4HNV A;  4IHV A;  5F0C A;  3HM5 A;  4FTH A;  3CDL A;  4FIS A;  1P7J A;  3WHB A;  4J19 A;  2XGC A;  2JA6 J;  2GLO A;  2IAI A;  1Z0X A;  2X9D A;  2DG8 A;  3HOX J;  5C4J J;  2W48 A;  2ZB9 A;  3JRB A;  4X6A J;  3LSP A;  4EEF G;  1WPK A;  1SFO J;  3ZQF A;  3G7R A;  5F04 A;  1JT0 A;  3D1N I;  3BG9 A;  2HQ5 A;  3DCF A;  3LSR A;  5M5W J;  1JKQ C;  5K7H A;  5FMP A;  2JK3 A;  2EZH A;  1RET A;  1B72 B;  3HDD A;  5FGL A;  4MFD A;  1WH5 A;  3IV5 A;  3S2H J;  4D7N A;  3FIW A;  2YVH A;  5F08 A;  2ID6 A;  3CJD A;  3LHQ A;  3A01 B;  3KKC A;  4FE7 A;  5F0F A;  2CQQ A;  1D5Y A;  4UUS B;  4NDL A;  3PM1 A;  3P9T A;  2WV1 A;  3QQA A;  2ECC A;  1JTX A;  4A3M J;  4RDU A;  4B1R A;  2GUH A;  4DYR A;  2LP0 A;  2M34 A;  1Y1W J;  3GTP J;  1ETX A;  3BR6 A;  3F0C A;  5E3N A;  4CYC A;  1O4X A;  2ME6 A;  2CU7 A;  3DPJ A;  3JRC A;  1LFB A;  3S1M J;  5EF6 A;  3HOV J;  3BRU A;  1UHS A;  1BA5 A;  3BR5 A;  1IDY A;  1ETW A;  2EH3 A;  3BTI A;  3NRG A;  2E1O A;  3O8H A;  2R5Y B;  2HXI A;  3M4O J;  3KNW A;  2L9R A;  3JRH A;  2JMW A;  1F36 A;  2L0K A;  2CRG A;  4C3I J; 
#chains in the Genus database with same CATH topology
 3CMA I;  4C3H J;  3K8P C;  3GXO A;  3HUG B;  1KYW A;  3CUO A;  1LPQ A;  2GIV A;  4LLG F;  2AHQ A;  2YPR A;  2JSC A;  5FLV A;  1K79 A;  2QKM B;  2ZBK A;  2DDB A;  3GEZ A;  1IRG A;  3LSM A;  2HKU A;  3WHC A;  3ABT A;  3R0J A;  1Y0U A;  3CUQ C;  2BV6 A;  2LY2 A;  3M1E A;  3V8L A;  4C3J J;  5IP9 J;  5EGO B;  3ZN0 A;  2KIQ A;  2FRH A;  3NNR A;  5CJ9 A;  1EH7 A;  4KDP A;  1FLI A;  2P81 A;  3GTG J;  1YHQ I;  4Y33 A;  3P5J A;  2L54 A;  5JLX A;  3PIO F;  4G7Z F;  1KU3 A;  2PJR A;  1GVJ A;  4KNY A;  2M7B A;  1SD6 A;  4EJT A;  2VOO A;  1AOY A;  3DPL C;  2V1X A;  1JT6 A;  1UJ8 A;  4CXF A;  2DFI A;  2LD5 A;  1X1A A;  2EWN A;  2VQG A;  1SEU A;  4LG0 B;  3CO7 C;  1Z91 A;  2G7H A;  4DW6 A;  3V78 A;  1IZ1 A;  3I54 A;  4EJO A;  2IU5 A;  4RGS A;  2FXA A;  2O3F A;  2EIK H;  4M3F A;  4DZJ A;  2ZJQ F;  2W25 A;  2XDV A;  2R5Z B;  1OYI A;  1X19 A;  3LSI A;  2IXS A;  1TNS A;  3BG3 A;  1N75 A;  3GLL A;  3PNV A;  3K2Z A;  1DU0 A;  1X3Z B;  2JA2 A;  4KIC A;  2F07 A;  2CFO A;  2X6O A;  4JQF A;  4XMY A;  1AU7 A;  1ZTR A;  1I50 J;  3RZD J;  2W24 A;  4KFC A;  1KYZ A;  2DN0 A;  2PLY A;  3TW6 A;  2P8T A;  3FKI J;  2B0L A;  4MNU A;  2OTL I;  1NTC A;  4PFO A;  1XCV A;  3COL A;  2O7T A;  2DT7 B;  2FJI 1;  2X6Y A;  3KEO A;  3MD2 A;  4IX7 A;  3CUQ A;  3HRU A;  3TDU C;  2UXN A;  2M0M A;  2DI3 A;  4YFX F;  3FZV A;  2R7S A;  3CRJ A;  3HRS A;  4BEH B;  2ZME C;  2WA0 A;  1MDM B;  2XAS A;  2HDD A;  1E0E A;  3BCA A;  3FHN A;  3P9C A;  3WTZ A;  4HV6 A;  3VOX A;  1ON1 A;  1N78 A;  2UXI A;  2R7T A;  1IXS B;  2E60 A;  1ZR4 A;  2DJN A;  3CDI A;  4UV8 A;  4ZDL A;  2OER A;  3LA2 A;  3VP5 A;  1ZH5 A;  4QLC U;  3EPZ A;  5J6X A;  4OMY A;  4E70 A;  3HGY A;  3Q5F A;  2R5Y A;  5LLQ A;  1AWC A;  5TJJ A;  4XR6 A;  1A6Q A;  3KE2 A;  4M3B A;  3QYB A;  5M3F J;  2X48 A;  3ZQG A;  2LVS A;  2L7M P;  2A05 A;  3HKZ N;  1UHM A;  4Z6Y A;  5EZH A;  4OIR F;  4A3F J;  2WAF A;  3KFW X;  4U0V A;  5EYR A;  3OIO A;  4OIN F;  3ON2 A;  1TBX A;  2QWW A;  4RGX A;  1C0W A;  2IS1 A;  3B81 A;  4C2M A;  4CHU A;  3GZ5 A;  2VKE A;  3KCC A;  3AQT A;  4LGW A;  4OMZ A;  5EDN A;  2VBX A;  3VWB A;  2Y75 A;  1UI5 A;  3CJT B;  2R7Q A;  1R23 A;  4E6K G;  4HG2 A;  1U9O A;  3VFZ A;  1UI6 A;  3F6V A;  2QSH X;  1I1G A;  2OA4 A;  2A2F X;  1YOV B;  4XRS A;  4QSH A;  1HC8 A;  1GXQ A;  4KIT B;  2KMU A;  1B9M A;  3CZ6 A;  5JLW A;  3J7A O;  1BW5 A;  3RTR A;  2ZCW A;  3FXM A;  2RAE A;  1JGG A;  2X6W A;  2WAQ A;  1XSV A;  4Y15 A;  5DCF A;  1ZK8 A;  1R1T A;  2F48 A;  1HSJ A;  2A5Y B;  2AS5 F;  1G6N A;  2L7K A;  4E7L A;  5DCM B;  2QBY A;  2BYV E;  3QPH A;  2VQC A;  3PQJ A;  1BR1 A;  2BW3 B;  3ZOB A;  2PJP A;  3OL4 A;  4E7H A;  2OF7 A;  2AXT C;  1PDN C;  4L9V A;  1ETQ A;  4I6Z A;  4B43 A;  3WTX C;  1B9N A;  4CCL A;  5L3E A;  2IPQ X;  1W1W E;  4TV7 A;  4L0Y B;  4XBF A;  1VQK I;  4N9H A;  1QHG A;  3H3V K;  5F0H A;  2Q24 A;  3FK7 A;  3FXU A;  1JJ6 C;  1S8N A;  2ISY A;  3PNT A;  4DBR A;  4ZYA A;  5HSZ A;  1FSH A;  1UB9 A;  4DYC A;  4YIF A;  4XKB A;  2OZU A;  1N77 A;  4HSR A;  1HLV A;  2LOO A;  4Y7N J;  1G3W A;  1ZLK A;  5TGT A;  1V5G A;  2OJE D;  4CCO A;  3FXQ A;  4IHS A;  3BJA A;  1V54 H;  2C6Y A;  4OAY A;  5TRD A;  2Y9Z A;  3K69 A;  1ETO A;  1RC9 A;  1EF4 A;  3VDX A;  2ZCN A;  2V9P A;  4PJN A;  3DQV C;  3ZQH A;  1F43 A;  1R4M B;  3KKD A;  2W57 A;  1FP1 D;  2MAB A;  2RC4 A;  1ZR2 A;  2CGP A;  3C1D A;  1ODD A;  5JVG F;  2NYX A;  2R7Z J;  3KX2 A;  3TGN A;  4I09 A;  2M8G X;  2K9Q A;  4BKX A;  4LOC A;  4GFB A;  4JX6 A;  3GUD A;  4CCN A;  1JKR C;  2VJJ A;  3V8J A;  5E8G A;  4P96 A;  1T56 A;  1V5F A;  2Y69 H;  3LL7 A;  1YFH A;  3VW2 A;  4ZYG A;  2VQH A;  5IP7 J;  3BG5 A;  1MBG A;  2UV1 A;  2PBI A;  1FMW A;  2F4M B;  2VL8 A;  3QWL A;  2K27 A;  3ZMZ A;  2QSG X;  1R4N B;  2QEN A;  5CVR A;  3P7N A;  3GTQ J;  1SVM A;  1XB4 A;  1W7P A;  3OR1 C;  3QP6 A;  4HX4 A;  1MBF A;  3ZGK A;  3F8F A;  2HQR A;  1O3Q A;  4IEJ A;  5H6R A;  3DF8 A;  4HBL A;  2REK A;  2IS6 A;  3V7S A;  4G12 A;  2P7V B;  5GAH J;  4WXD A;  4FCY A;  3Q0V A;  4XM3 A;  3JRA A;  1T2K A;  1GVD A;  4AYB N;  3R61 A;  5K1Y A;  1FT9 A;  4RB1 A;  3ZN1 A;  4Q4Z F;  1W36 C;  1ZEL A;  3FM3 A;  3W6V A;  3OYF A;  3I3L A;  2CV0 A;  1OCO H;  2CUJ A;  3K0L A;  2XPV A;  3V42 A;  2DO7 A;  1D1C A;  5IOY A;  3S3N A;  4GCL A;  3C3W A;  3KP7 A;  1R5I D;  4HLX A;  4JBA A;  1QQI A;  1SFU A;  2OCE A;  3FBI B;  4JK1 X;  1A31 A;  1ERD A;  2FQ3 A;  4A12 A;  2R7W A;  1F9N A;  3BTL A;  4XN0 A;  1O3S A;  5F6F A;  5LGN A;  3NQO A;  2CQX A;  3TMO A;  3TL4 X;  3BQY A;  2ISZ A;  2VJ5 A;  3IH2 A;  2A07 F;  2KHM A;  5K5O A;  3MZH A;  3N05 A;  2PG4 A;  3J81 Z;  3VTI A;  1RUO A;  1OMI A;  2YVX A;  2DA7 A;  3ESW B;  5F27 A;  5DTD A;  3F23 A;  4ZYD A;  3CQZ J;  5J40 A;  2PFB A;  4I0A A;  5E20 A;  3CC2 I;  4HAM A;  3HZJ A;  4BL0 B;  3I4N J;  4V2G A;  3PPB A;  1R1V A;  3VOK A;  2LR8 A;  2HVQ A;  4M6X A;  1IUY A;  4I99 C;  2UXO A;  1WCM J;  2A3S A;  1LFU P;  1XGO A;  1P4W A;  2FA5 A;  1EH8 A;  2XGD A;  2YU3 A;  4KN7 X;  4M3E A;  2JSP A;  3FDY A;  4DQ2 A;  2L9V A;  2YVE A;  2EFP A;  4AVZ A;  3HL2 A;  1SGM A;  5TIS C;  1VQ5 I;  1QPI A;  3OYL A;  1GXP A;  4LD5 A;  5BS6 A;  1FOK A;  2HU9 A;  4A3G J;  1PP7 U;  3PJR A;  1WFX A;  2HYT A;  4CYC B;  3LOC A;  1DGR M;  1A04 A;  4A93 J;  3G1O A;  3W6J B;  1K83 J;  3FF5 A;  3VSL A;  3BP8 A;  3TP0 A;  2M4G A;  3ASO H;  4RGR A;  5M5Y J;  1ZAO A;  3ZP5 A;  4QTR A;  5HLI A;  2QQ9 A;  4BGD A;  3L1P A;  2H09 A;  2HR3 A;  3LAP A;  3BG6 A;  3SJM A;  4ON0 A;  1J2X A;  3UR3 C;  3AQS A;  1MH3 A;  2YX7 A;  3BC8 A;  4KIG A;  3HTA A;  5E17 F;  2LK2 A;  1ZGA A;  2YS9 A;  3E6D A;  5J3L A;  1S29 A;  5EFY A;  5BMZ A;  1EJ9 A;  2QUF A;  5JFR A;  4ZDO A;  1QA6 A;  4BBR J;  2R4G A;  1IRX A;  3H1C A;  4UVA A;  5A2Q K;  3F72 A;  1GUU A;  4M73 A;  2LNB A;  3AL0 B;  3WG7 H;  4KYW A;  1YI2 I;  1H8A C;  3ELK A;  5FD6 A;  1BOB A;  5J1Y A;  4BE0 A;  2WGB A;  3DLA A;  2A6T A;  2KRC A;  2ECB A;  3R60 A;  1Z6T A;  4Y3O A;  3DEW A;  2P5K A;  2B9S A;  2NNN A;  2LRE A;  2K3P A;  3M7G A;  4H0E A;  5FO5 A;  3SXY A;  2UXX A;  2LBF A;  1MSE C;  3SHF A;  4ACI A;  3MKW B;  3PO3 J;  4NNJ A;  1SAN A;  5CVI A;  2DMP A;  1IDZ A;  5DV5 A;  1QHH D;  5FB2 A;  4F91 B;  2DT5 A;  5H2F C;  2FBK A;  4I76 A;  1NH3 A;  3H9Q A;  5FLX K;  1LQ1 A;  4DVY P;  5D5W B;  1FBU A;  3DU6 A;  1P92 A;  2H1K A;  1WJF A;  3FKJ A;  1UMQ A;  4HEA 2;  3EQL F;  2FD5 A;  2PEX A;  2N8G A;  1LDJ A;  5HS7 A;  3X2Q H;  5FFX A;  4FTH A;  2GLO A;  3RPU A;  3DV8 A;  1JHH A;  1YQA A;  3PFY A;  2BY3 A;  2E5Z A;  2P6T A;  5ICC A;  2IJL A;  4G8X A;  2QM3 A;  3CD6 I;  2HWV A;  2W48 A;  2HFH A;  4FHT A;  4CUG A;  2JQ7 A;  4BYY A;  3G7R A;  1YO5 C;  1S5L C;  4UB6 C;  1DPR A;  2DJI A;  1TT5 B;  5M5W J;  4LB5 A;  3HC7 A;  5FMP A;  1B72 B;  3HDD A;  4XLH A;  3OYJ A;  3S2H J;  1LDK B;  4P55 A;  4L9T A;  5IY5 H;  3OYD A;  1YIJ I;  3A01 B;  3SWH A;  3KKC A;  4FE7 A;  2QA4 I;  2CQQ A;  4UUS B;  3CME I;  2H94 A;  4PSX A;  4XLN F;  2ECC A;  3K4C A;  1IN4 A;  2G9W A;  3D5R C;  4RDU A;  3MWM A;  5HS9 A;  2XIG A;  3HPH A;  5E3N A;  5LRR A;  5DD4 A;  2ME6 A;  3S1M J;  3LFK A;  3HOV J;  3H92 A;  5ILS A;  1BA5 A;  1IDY A;  2ZSH B;  3BTI A;  3NRG A;  5L3B A;  2VC1 A;  2HXI A;  1WHU A;  1J75 A;  5LBQ A;  2L9R A;  2QZ8 A;  1MGT A;  3W3C A;  2JMW A;  4EJV A;  4HNT A;  3DBR B;  2CRG A;  3IWF A;  2M7A A;  2CH0 A;  4EMS A;  2CV1 A;  3G56 A;  4JX4 A;  3CCJ I;  2F4I A;  2ZFU A;  4DJA A;  1S7A A;  2DMN A;  2IW5 A;  3K4N A;  5B3S H;  3OSF A;  4JX5 A;  4ESJ A;  2IGN A;  3ML6 A;  4BXF A;  4KWA A;  4BHC A;  1JXS A;  2OPT A;  4D7M A;  2RNG A;  4XNF A;  2ESH A;  2XV4 S;  2O0Y A;  1K61 A;  4M6Y A;  2DAO A;  3ROU A;  1I3A A;  2E1M C;  3VYR B;  1P7I A;  3ERE D;  3VOD A;  4JOM A;  2Z16 A;  4IXA A;  3DKW A;  1BR4 A;  5LHI A;  3BJO A;  1R36 A;  2LF8 A;  4II2 A;  2M8E A;  1I39 A;  5FRN A;  1FP2 A;  3CC4 I;  1Y0N A;  4XKV A;  3RSN A;  1QVT A;  3ABM H;  3V6G A;  5CVV A;  4HOB A;  1VQP I;  2EA2 A;  2Q2E A;  2E2J J;  3GTO J;  3OYE A;  3NPI A;  3S1Q J;  2ID3 A;  1XDU A;  5IT3 A;  2HTS A;  2G7S A;  4B44 A;  3ABK H;  4BHB A;  1QBJ A;  2X85 A;  4L62 A;  3ECO A;  3S32 A;  1UG2 A;  1WGX A;  3E6M A;  5AON A;  1S3J A;  1BJA A;  5HDN A;  1YJN I;  3K2A A;  1K78 A;  2HOT A;  2QTQ A;  4OIQ F;  4KUM A;  2YUS A;  3SFI A;  5FKM A;  5B1B H;  3MKL A;  1FOX A;  2LC2 A;  2W00 A;  1B1B A;  1LUJ B;  2KZV A;  4HX7 A;  4GCT A;  1LE8 A;  1RPW A;  1SMT A;  3T5X A;  3H0G J;  2WV0 A;  1DGW Y;  2DFF A;  4I98 B;  3VOE A;  5HBU A;  5FGM A;  2KKO A;  2O03 A;  1D5V A;  2CW8 A;  1IRF A;  4OOI A;  1MMG A;  2DCE A;  3U21 A;  2F2E A;  1D1A A;  2UZK A;  2GWR A;  5C3E J;  4ZTF A;  2BBY A;  3VSK A;  1OQY A;  4J00 A;  1J7K A;  2XPU A;  3W2A A;  4XOP A;  2QLZ A;  2KRF A;  1FX7 A;  1FTZ A;  1ULY A;  3OS2 A;  1O3R A;  4XRM A;  1BI0 A;  2GAU A;  1MBJ A;  4ZDP A;  2FE3 A;  5FKN A;  1XX5 A;  3T0Y A;  2V79 A;  2KIU A;  2EJR A;  3GTM J;  1YX3 A;  2EQR A;  3NAR A;  3CJQ B;  4BUP A;  4MGR A;  3BNI A;  2ME0 A;  4ESB A;  3DKX A;  1LVK A;  1D0X A;  1X2N A;  5FRM A;  3L00 A;  1HW5 A;  2FOK A;  4DNC A;  5ICG A;  3MVP A;  4Q48 A;  2IS2 A;  3M8J A;  3HTH A;  3LQQ A;  4FET A;  4ZYH A;  3CCS I;  3A03 A;  3PUF A;  1W5S A;  1YX5 A;  4CGZ A;  3ZMD A;  4RM2 A;  1E2X A;  2QQ8 A;  4XL9 A;  1OKR A;  2Y48 A;  2WBM A;  3SEQ A;  3WGG A;  2D6Y A;  1YYV A;  2NNY A;  4HDU A;  2E7X A;  4IRH A;  4UB8 C;  4Y52 J;  2HEO A;  2XB0 X;  3S2W A;  5CXI A;  3KP4 A;  4WF2 A;  5DM7 F;  1LKX A;  2V7F A;  4B4C A;  3OL3 A;  1JUM A;  3QU6 A;  4B8X A;  5FLX Z;  1X4O A;  1X1P A;  2Q0O A;  1X1C A;  5LEK A;  1U5T B;  1W7P D;  2M4K A;  3KP5 A;  1POG A;  1D3Y A;  1YRN B;  3HUG A;  4IOA F;  4O3M A;  2K9M A;  4H4K C;  4S05 A;  3WOD F;  5CVU A;  3FM5 A;  3ZMU A;  4A0Z A;  4E7S A;  1K6O A;  4LLN A;  2WWY A;  3GCM A;  1IN7 A;  1MJB A;  1U2W A;  4LK0 F;  2F4O B;  3KZ9 A;  2YR2 A;  1H9T A;  3IAM 2;  4BNC A;  5EGO A;  5D1R A;  2DYS H;  3A1Y A;  1IV8 A;  1FTT A;  4BE1 A;  2XAH A;  2K85 A;  2FU4 A;  3DWL E;  3LMM A;  4RAY A;  2DT6 A;  2DQL A;  3CCY A;  3DPT A;  2I5U A;  1R71 A;  2K3F A;  3KPH A;  1XSX A;  2CUF A;  2JRT A;  3LFU A;  2E36 A;  1R58 A;  1HCR A;  5DDG A;  3WU1 B;  3ZMS A;  1VQL I;  3KEY A;  2QCO A;  2OD5 A;  2L5Q A;  2H6B A;  5CLS A;  4DBQ A;  4CZZ A;  4A0Y A;  2Q8K A;  3S14 J;  1D0Z A;  4M9Z A;  4LG0 A;  2NXN B;  2E1N A;  1YJW I;  3TQN A;  3E7Q A;  3EDP A;  4WK8 F;  1XTA A;  3KZY A;  3OYH A;  3I4M J;  4WIB A;  2Y0S N;  4IHW A;  3HEF A;  2ZFW A;  2X1D A;  5GTH C;  2MH2 A;  3G71 I;  3H3Z A;  2Z1D A;  1TTY A;  2K02 A;  3GFJ A;  4K2E A;  1Z21 A;  3DBH B;  4P9U A;  3LQR A;  4RMN A;  2W84 A;  1QNT A;  2M2E A;  1VQ7 I;  4ANJ A;  2P5V A;  2Y2Z A;  1V55 H;  4RGU A;  1RRJ A;  3BJB A;  3SZP A;  3VYT B;  3GTJ J;  5K58 A;  5IYB J;  2EZK A;  3OR2 C;  5J8F A;  1GLN A;  3TO9 A;  2NS7 A;  3PO2 J;  1CQT A;  2WC2 A;  3EYI A;  3OYB A;  3C2B A;  2NVX J;  4F52 A;  3CLO A;  2J5P A;  3L2U A;  2I8D A;  2HKX A;  3KYD B;  3O8G A;  2JUG A;  1MDM A;  2MYS A;  1FSE A;  3QYE A;  2OC6 A;  1OJL A;  1EKE A;  2KJC A;  1AHD P;  1WJ5 A;  4IHY A;  2CQN A;  3BT9 A;  1LB2 A;  2CWE A;  2FX0 A;  2Y31 A;  4L9J A;  2GXG A;  2V4J C;  3U9G A;  2DA3 A;  2GXB A;  2COM A;  3M07 A;  1OR7 C;  3G3Z A;  2M3A A;  4YIR X;  1HDD C;  1MKM A;  2MD0 A;  3BR2 A;  5CPR B;  4ETS A;  1R22 A;  2L01 A;  3NS4 A;  2IVM A;  3K1P A;  4E7Z A;  2NVQ J;  3F22 A;  1LEA A;  3V4G A;  4A69 C;  1IG7 A;  4B3X A;  5ICE A;  3JTG A;  3H9G A;  4MEX F;  3ZRG A;  2L9N A;  3SEZ A;  4IJA A;  3LWJ A;  4HST A;  4DYQ A;  3HTJ A;  3RH2 A;  1ON2 A;  5FLM J;  3GME A;  2O7O A;  3TOB A;  3BCG A;  1MZB A;  2BXY A;  3QP5 A;  2EK5 A;  2PMH A;  3KYC B;  2HI3 A;  3S1R J;  2LTP A;  2PMZ N;  3ZMT A;  4LJZ F;  4Y13 A;  1HW1 A;  5HNF A;  4RB2 C;  1Z9C A;  1IN6 A;  4NQW B;  4I7H A;  3FIS A;  3ZQL A;  2M87 A;  4N0B A;  3ABL H;  4JNN A;  3HPG A;  2K9N A;  2L9S A;  2DBB A;  1S7E A;  2DMQ A;  1EH6 A;  3RPU D;  2I10 A;  3I5U A;  2CV2 A;  3MKZ A;  2KIM A;  4IHX A;  3RYP A;  1LJ9 A;  4AM3 A;  3HJE A;  3CJR B;  5K5Q A;  3I59 B;  1ZG1 A;  2OTJ I;  1SFX A;  3HSE A;  5DCM A;  1XS9 A;  2G0E A;  3GFM A;  1IN8 A;  3LSJ A;  3VB2 A;  4PJJ A;  2BW3 A;  2VKH A;  3WU2 C;  3DKY A;  3F8B A;  3V8K A;  3LNQ A;  1P9Q C;  1YE9 A;  2EIN H;  3JRF A;  3TKY A;  3WGH A;  1OR7 A;  4V19 K;  2BGC A;  4AIK A;  1OYW A;  2CW7 A;  1G2H A;  1WJC A;  3EUK L;  4E7J A;  4GO1 A;  2ZO4 A;  2OI8 A;  3IRR A;  3T8R A;  2ACJ A;  5BPD A;  1A6I A;  2L02 A;  4DZP A;  3OYN A;  2ZME A;  3CP8 A;  3O6B B;  2Z33 A;  1USS A;  3BR0 A;  2NAZ A;  2QVO A;  3Q9S A;  1MH4 A;  4MQV A;  4KA4 A;  1I3Q J;  2NP5 A;  1OCC H;  1ZN2 A;  1Z6R A;  2FQ4 A;  1WI3 A;  2WB1 A;  3R4K A;  3KZI C;  4J01 A;  3KIO A;  4L9N A;  3H5N A;  2B1E A;  4HX8 A;  1DP3 A;  2KT0 A;  2Z5U A;  5HS8 A;  1SFK A;  1X58 A;  1A36 A;  2OCC H;  4CIC A;  1OCT C;  3W2V A;  1J59 A;  2CJJ A;  3GLX A;  4R1H A;  4Y17 A;  3HOT A;  3ZQC A;  1MJA A;  3I9V 2;  3MZ8 A;  2E35 A;  4XRS G;  3KET A;  2EV5 A;  4F7Z A;  1BI3 A;  2LY9 A;  3AAF A;  1Z77 A;  5F64 A;  2ELK A;  3FMS A;  5JVT A;  2HXO A;  4OD5 A;  3AG3 H;  2XC7 A;  1FY7 A;  4D0P A;  5IYD J;  1J5Y A;  4PGH A;  5EG0 A;  2IA0 A;  1ENH A;  2E71 A;  1WJE A;  4BDY A;  3I56 I;  2B7E A;  1IXR C;  2DOE A;  4ZYE A;  4XLC A;  5J1R A;  1U78 A;  4EGY A;  3E97 A;  2FBH A;  3GX4 X;  2H27 A;  1G3S A;  3K70 C;  4YZE A;  2LKS A;  1MD0 A;  1B8I B;  4CCM A;  4IPA A;  3VEP A;  2VPL A;  2B3W A;  4MIM A;  4AF5 A;  3UNG C;  3WTW C;  2ZCM A;  1TW3 A;  2GQQ A;  2E2H J;  4RAG A;  2VT2 A;  2XGE A;  4LIV A;  2VPR A;  4LK1 F;  4ENK A;  2M5W A;  3IH4 A;  3REO A;  1MBK A;  2ZJ2 A;  4EV0 A;  4XID A;  3IKV A;  4S0H B;  3F3X A;  3M8E A;  3IP4 B;  4UDS A;  4Q5S F;  5FKO A;  3IUV A;  1Y1V J;  3VW0 A;  2BE5 F;  1ZKG A;  1T08 B;  2IP2 A;  1DU6 A;  4IRI A;  4IHV A;  3F8C A;  2D2W A;  3K6G A;  3HM5 A;  1Y39 A;  2PMU A;  4KJZ A;  3S8P A;  3CDL A;  2JZY A;  2LH9 A;  3G4S I;  2XGC A;  1ZAR A;  3HSF A;  4FX0 A;  3T8T A;  1Z0X A;  2HOE A;  1X3U A;  5KHD A;  2XF6 A;  2GA1 A;  3E1S A;  2HKO A;  5HNH A;  1MMD A;  1ZG5 A;  5C4J J;  3AL0 C;  4GYI A;  3LSP A;  1WPK A;  1V3F A;  1WQ2 A;  1TW2 A;  4U9N A;  3M9A A;  3DCF A;  4B48 A;  5J4Y A;  4RB3 C;  5BOX A;  4U9L A;  2AXL A;  1FBQ A;  4A2U A;  3KZZ A;  3ZPL A;  2IS4 A;  3IV5 A;  1V5E A;  3G73 A;  2YVH A;  5F08 A;  3CJD A;  1G3T A;  1FOY A;  5D5X B;  2EV6 A;  3KEQ A;  4NDL A;  1TLH B;  5D5U B;  2H1L A;  3MEX A;  3C7J A;  2LYC A;  1T98 A;  4BQQ A;  4B1R A;  5F1R A;  4DYR A;  2CO5 A;  2LP0 A;  1Y1W J;  3K1N A;  2CUZ A;  1ETX A;  3IKT A;  3BR6 A;  4PZJ A;  4CYC A;  1O4X A;  2QSF X;  3OYA A;  5BPI A;  1P6R A;  3BRU A;  3I58 A;  4S04 A;  2VBY A;  3IWZ A;  1Z7U A;  5D6F A;  3M4O J;  3KNW A;  3OWT A;  2NVU B;  3H5R A;  2V9K A;  2DA1 A;  1F36 A;  2IGK A;  4HV5 A;  4B3A A;  2NOJ B;  3RPQ A;  2ZY9 A;  4O6J A;  3JSO A;  1F5T A;  5ICF A;  2L4A A;  1IUF A;  3DP7 A;  3LST A;  4BY7 J;  2DYR H;  2V1D A;  5HLG A;  4ZZL A;  4AD9 A;  1HOM A;  2NS8 A;  3U1K A;  2JA8 J;  2NS0 A;  2JPC A;  3NWT A;  3G6E I;  2RRE A;  3O2P E;  2HNH A;  1WJD A;  2KZG A;  3JR9 A;  3BWG A;  5M3M J;  3FK6 A;  5HOD A;  1GV5 A;  1GDT A;  2LMD A;  1O57 A;  1ZGJ A;  1DUX C;  5DAJ A;  3RKY A;  2QIB A;  4HF2 A;  3I53 A;  3M3Y J;  4G6T B;  2OU2 A;  2Y30 A;  3RKQ A;  1ZYR F;  1L0O C;  1RKT A;  4A6E A;  3ANG A;  4XRF A;  3E7L A;  4E4H A;  2GOX B;  3NXC A;  1D0Y A;  2WTE A;  2EFO A;  3J80 K;  2NX4 A;  2P4W A;  3HKZ A;  3SYT A;  1G59 A;  3F1B A;  1TWH J;  4YFK F;  2ZJP F;  2R7O A;  2E1C A;  2EIL H;  1P4X A;  1QRY A;  4B47 A;  1AA7 A;  4G6Q A;  3VW1 A;  2ESN A;  2GFN A;  3RZO J;  1PUF B;  3H36 A;  2ICW G;  4PFP A;  1TWF J;  3DTK A;  4PJM A;  2OV7 A;  4BS9 A;  2R93 J;  1PUE E;  2VQL A;  1PP8 F;  3BOQ A;  3FBN B;  1W4M A;  2ZKZ A;  3OMY A;  4UXN A;  4P1W A;  4UHT A;  1Z67 A;  2IGM A;  3MFK A;  1WH7 A;  1YLF A;  3T1B A;  1H89 C;  2HOS A;  4ABZ A;  1GV2 A;  1QZE A;  3K4B A;  3QPS A;  2D45 A;  3GZN B;  4E7I A;  2JJ7 A;  5E8I A;  4EGZ A;  4IKF A;  3R6S A;  1B72 A;  2F5E A;  1T0F C;  3RJP A;  4D9J A;  3HRT A;  4U0Y A;  5GAD J;  1ZRD A;  1IV6 A;  2PX9 A;  2LDU A;  4UUS A;  2UXP A;  3LSK A;  3A0B C;  3PUB A;  1TWA J;  1RNL A;  3V7C A;  4CCJ A;  3WGI A;  4GFL A;  4GYG A;  2DA2 A;  4GRI A;  1ACI A;  1X3W B;  2XDN A;  1J09 A;  1YS7 A;  1FYM A;  2R92 J;  1XD7 A;  2MD5 A;  2CMP A;  4MTD A;  3CF2 A;  3H35 A;  5BNG A;  2DXI A;  2DLL A;  4UVB A;  3TP3 A;  2V26 A;  1X1B A;  2DMT A;  3FMQ A;  2ZOY A;  3ULQ B;  3H9J A;  5IP6 A;  4LG3 A;  1UST A;  1XMX A;  2H8W A;  1NK3 P;  3WTV C;  2OQR A;  2O6G E;  3HOU J;  4MHG A;  4WXH A;  4I2O A;  3GTK J;  2QQA A;  2UWM A;  1QPM A;  1UAA A;  5K5R A;  5IT9 K;  1PJR A;  4A5N A;  3CCM I;  2VC0 A;  3PL8 A;  3HIF A;  3TO7 A;  1MMN A;  3CLQ A;  1AKH B;  3GZ6 A;  2KFD A;  2DTZ A;  1YW7 A;  4XSZ F;  3HOY J;  2HS5 A;  1T0F A;  4XIC A;  1TNT A;  1VTN C;  1FMV A;  3HYI A;  3RI4 A;  5E1X A;  2H8R A;  1QGP A;  3MN2 A;  2RNJ A;  1O7L A;  1XN7 A;  2EPF A;  3IL2 A;  4L18 B;  5H9T A;  1ETK A;  2STW A;  3GTL J;  1U0J A;  4UUT A;  2CG4 A;  3NI7 A;  3K7A J;  1NK2 P;  4U0W A;  4NN1 A;  3QKX A;  1KQ0 A;  4HDV A;  1U5T C;  1OYY A;  3L09 A;  3WE2 A;  1MIJ A;  2GIZ A;  1KU9 A;  1VZ0 A;  2HVS A;  4BY1 J;  2CW0 F;  2XRN A;  3E0J B;  5B5E C;  1UHW A;  4BBS J;  4F93 B;  2EFW A;  2G3B A;  3K1M A;  2MG4 A;  5E3O A;  2YSR A;  2OQG A;  1SMY F;  3OS1 A;  1NG6 A;  3EYY A;  4A3L J;  3DEE A;  4ZJZ A;  3JTH A;  1TL8 A;  3JAM K;  3JRE A;  3F8M A;  5DUK A;  2XAF A;  1A5J A;  4X1E A;  3BPV A;  5KVR A;  4AYB A;  5GPC A;  2Y9Y A;  3VPR A;  2G7U A;  2XUB A;  1ZRE A;  1F1Z A;  5L3F A;  3OIP A;  1MJ9 A;  5KNL A;  1W0T A;  2F5F A;  4IL6 C;  2R7X A;  2JUC A;  1Q1V A;  1IF1 A;  3L2W A;  3E5X A;  4V2F A;  5DUI A;  2NOG A;  3E3V A;  1U9N A;  1RZ4 A;  2KJB A;  3MZY A;  1MSF C;  3G1L A;  3RIR A;  3C07 A;  3Q9V A;  1S6L A;  1X2M A;  5HDK A;  3CC7 I;  2MSY A;  3T6N A;  3L9F A;  4MO7 A;  3GFI A;  4QWQ A;  5GAG J;  2V9V A;  3G1M A;  4EM1 A;  2DK5 A;  2KIS A;  4NC7 A;  3FX3 A;  4L5I A;  2W1O A;  4EAT A;  3S17 J;  4AUX A;  2K86 A;  3J7A Y;  4U88 A;  4HF1 A;  4ME9 A;  1UG0 A;  2E5N A;  2ZC2 A;  5A2Q Z;  2WAE A;  3FXR A;  1PVE A;  5FKK A;  2XB5 A;  2GEN A;  3J80 Z;  2WAQ N;  3IC7 A;  4HA8 A;  3L2V A;  1OPC A;  1XC5 A;  2ZXI A;  1X1D A;  2OAZ A;  1YJ9 I;  2VBW A;  5DS9 A;  3MQ0 A;  4I02 A;  2V6C A;  4YG2 F;  3JW4 A;  4CCK A;  1U5T A;  4HPQ A;  1R5G A;  2RV8 A;  1YRN A;  3GZI A;  4C9Y A;  2HPM A;  4EJW A;  2VON A;  2VLA A;  1MBH A;  3EUA A;  4FT8 A;  3QRF F;  2RKH A;  2VUM J;  1VQM I;  4UUV A;  2O61 A;  2VBZ A;  4EVI A;  2HQA A;  1SAX A;  1CF7 B;  1UCR A;  2HYF A;  3KP3 A;  5E3L A;  1E3O C;  1Z1D A;  2KLO A;  3L2Q A;  3QBM A;  2MLG A;  2CSO A;  3CMM A;  3CDH A;  4IZZ A;  3PNY A;  1SC7 A;  1T39 A;  5HVQ C;  2NVT J;  3JCU C;  3WTT C;  5EEH A;  4FQG A;  4L5E A;  2NVY J;  3VYS B;  1STZ A;  5E3M A;  2KL4 A;  2LY1 A;  1P2F A;  3SZG A;  2KDZ A;  2OBP A;  3C2H A;  2HTJ A;  1HA8 A;  2BZT A;  2HYG D;  2O8X A;  1LVA A;  3P9I A;  1FNN A;  1JKO C;  3S1N J;  2A69 F;  2HVR A;  2HZD A;  1F4K A;  2R3S A;  2IGO A;  4RAF A;  4KIF A;  1TC3 C;  1W5C C;  5LHH A;  2G7G A;  1HDP A;  2XHK A;  5GP9 A;  1T33 A;  3L7W A;  1J0R A;  3CES A;  2LKX A;  2FSW A;  2B63 J;  3E6C C;  5ERI A;  3FHZ A;  2P5L C;  3Q3S A;  3RCO A;  1BR2 A;  2ETH A;  2LFB A;  3OYC A;  3HE0 A;  1XMK A;  4Y4R A;  2PQ8 A;  1BL0 A;  3SZT A;  2RVC A;  2HQN A;  2HYJ A;  1MNM C;  5L3D A;  3LJL A;  1VQ8 I;  2LG4 A;  2QQB A;  2Z99 A;  4EJU A;  1U8B A;  3VVZ A;  3K70 D;  4AC6 A;  2AQF A;  3QAH A;  3K4K A;  3KYL A;  2PN6 A;  3TED A;  1XMA A;  1OCZ H;  2W4S A;  4XSX F;  1Y8R B;  2FBQ A;  1R6R A;  1I6X A;  2K7L A;  5LFA A;  1OCR H;  1NHA A;  5CYV A;  3PIP F;  1CGP A;  5IT9 Z;  4LIT A;  2O8K A;  5GTI C;  2WY7 Q;  4IF4 A;  2R5Z A;  1IC8 A;  5B1A H;  3ZR8 X;  4CO8 A;  4G94 A;  1VQN I;  2EBI A;  4D1Q A;  5J8C A;  4XK4 A;  1ITY A;  5D4R A;  3BTC A;  4A5M A;  3E5Q A;  3A4C A;  2WUI A;  3F9K A;  3H3U A;  4N4N B;  2GOM A;  1OLT A;  5ED4 A;  2VI6 A;  2DA6 A;  3BZK A;  2R7V A;  4BQA A;  1JJ8 C;  3PAS A;  4DIQ A;  3PQK A;  2KQR A;  4A0X A;  2COB A;  1VQ6 I;  4OWR B;  5FJ8 J;  2JWT A;  4A3E J;  2M0C A;  4BXU A;  1W36 D;  1HXD A;  3O60 A;  2ZNY A;  1KQ8 A;  2R7R A;  4KMF A;  4M71 A;  1KGS A;  2Z2S B;  2ZXJ A;  4M3D A;  3LWF A;  2DDA A;  5KAI C;  4N4O B;  4GXO A;  2DMU A;  4ITV A;  3L2C A;  2GM4 A;  1ETV A;  3BPX A;  3DU5 A;  5FD5 A;  2W53 A;  3HIM A;  4BEH A;  1VI0 A;  1KU2 A;  5HDG A;  2MH9 A;  1RES A;  3S16 J;  4M9X A;  4RLQ A;  3EGQ A;  5E79 C;  3K9T A;  4NEL A;  4C2M J;  3OYK A;  2MC4 A;  1Z3X A;  3K4M A;  3JAM Z;  5L3C A;  1IJW C;  4GCV A;  3WE3 A;  3GW2 A;  1EV7 A;  4BAC A;  3HBL A;  2PJR B;  2CFX A;  2JVG A;  1FC3 A;  1KU7 A;  5IOZ A;  1TWC J;  2ZSI B;  4NQW A;  1JHF A;  4HRI A;  2IRF G;  3FWE A;  2DG7 A;  1TQI A;  2EFN A;  1K4T A;  1OIS A;  4IRV A;  4XLF A;  4BU2 A;  4A3C J;  2XSJ C;  3CCU I;  2GXA A;  2OUM A;  3DEU A;  5HAW A;  3MCZ A;  2HPI A;  1BBY A;  2FNA A;  3DXJ F;  3GO5 A;  2XKO A;  3OV8 A;  4KT6 A;  2ZOZ A;  4AU7 A;  1WZ2 A;  4LIU A;  4HNV A;  4RS8 A;  5F0C A;  3I59 A;  4CYD A;  2RDP A;  1BIA A;  1P7J A;  3WHB A;  4IOC F;  2IAI A;  3DFG A;  3BG7 A;  1T95 A;  3KP2 A;  4XOT A;  2AQE A;  1G3Y A;  2DG8 A;  3HOX J;  2XAJ A;  1SVL A;  1UEL B;  2ZB9 A;  2BY2 A;  3JRB A;  1VQ4 I;  1N25 A;  4EEF G;  1TQP A;  3ZQF A;  1TQM A;  4GGG A;  1SFO J;  2EIJ H;  5F04 A;  4EQQ A;  3D1N I;  3BG9 A;  4LB6 B;  4MTE A;  4ASN A;  1SFE A;  1B6A A;  3LSR A;  3V7R A;  5EEG A;  4KT5 C;  2JT1 A;  4MFD A;  4P5O A;  1WH5 A;  4L5J A;  1KA8 A;  4L0Z B;  3C2G A;  2VOP A;  3FIW A;  4M74 A;  3CUQ B;  2ID6 A;  3J81 K;  4G7O F;  3LHQ A;  1WSU A;  1LFP A;  2O5R A;  4G9Y A;  4EM0 B;  1BIB A;  3WU0 A;  1K4S A;  2XVC A;  4BAY A;  4XON A;  5LHG A;  3P9T A;  1HBX G;  2OZ6 A;  5JI6 A;  1JTX A;  4A3M J;  5DD8 A;  2KDO A;  2GUH A;  1QZZ A;  1IN5 A;  2BOL A;  2M34 A;  1G4D A;  1BC8 C;  4QPQ A;  3F0C A;  5H6Q A;  3BZ6 A;  3DPJ A;  4WWC A;  2MLK A;  2XF5 A;  4G6D A;  1XCB A;  1MMS A;  2ZJR F;  2EH3 A;  2XAU A;  1UZC A;  2R5Y B;  1DP7 P;  3M8F A;  1LNW A;  5DYM A;  4RAZ A;  1RR8 C;  2M45 A;  1R1U A;  2DOD A;  2L0K A;  1FPQ A;  4YRV A;  3SDB A;  1H9G A;  4DOZ A;  1W0U A;  1FIP A;  2L7Z A;  2LF7 A;  3EUH C;  4U7B A;  4D5F A;  2XAQ A;  2A6E F;  4A3B J;  4BQO A;  2XF7 A;  4O5V A;  5M5X J;  3BY6 A;  3HB9 A;  2BY0 A;  3MNL A;  3RD3 A;  5IYC J;  3DTE A;  6PAX A;  5E1Z B;  1HST A;  5FRO A;  3BQZ A;  1I6H J;  1FIA A;  3D5L A;  2DFH A;  4AWX B;  1ZRF A;  2BXZ A;  2MFZ A;  2RQQ A;  1FWZ A;  4HYE A;  2JN6 A;  2EV0 A;  3AG1 H;  4M6V A;  3HTU A;  4HLY A;  5CQG A;  1TP4 A;  3ZCO A;  1B8I A;  2DTR A;  4BXX J;  5ILV A;  1T6S A;  3H5A A;  1YG2 A;  2XKP A;  5AIQ A;  3UKG A;  4ENM A;  1H0M A;  5HLT A;  4NC8 A;  2EZI A;  4QIW N;  5HLH A;  2V6E A;  3AG4 H;  1ETY A;  3ZXS A;  1MW7 A;  5C4Y A;  3BR1 A;  1XSD A;  1YW9 A;  2ZME B;  3LSG A;  2PZ9 A;  1TWG J;  9ANT A;  2QEX I;  3SDG A;  3GWZ A;  3TOA A;  2YU9 J;  1S9H A;  2QBY B;  3OY9 A;  4R79 A;  2NRA C;  2P0W A;  4PGG A;  2BVM A;  4AC0 A;  2XSD C;  2DW4 A;  2F6C A;  3E5U A;  1T8I A;  4HF0 A;  4BDZ A;  2A6H F;  5EZG A;  3U2R A;  3HHG A;  2VE9 A;  2W85 A;  3B6A A;  4PSW A;  3ON4 A;  4WXC A;  2K5C A;  3CTA A;  3RKW A;  4CH7 A;  4BE2 A;  2DQR A;  1S7O A;  2EIM H;  4XLE A;  4HNU A;  3C18 A;  4KN4 X;  1Y8Q B;  5JHF A;  2HDW A;  4CSW A;  2X6X A;  2MC3 A;  3LAJ A;  2FBI A;  5C44 J;  1E17 A;  2ZCX A;  2RN7 A;  2DA5 A;  3EUH A;  1ZQ3 P;  4UNO A;  3MMY B;  1FZP B;  5EJC A;  1RI7 A;  3QOP A;  4YEL A;  1SD5 A;  2JRM A;  4Z2Y A;  2X4H A;  3S5R A;  2AO9 A;  2LKP A;  3WG9 A;  3S2D J;  3VIB A;  3GEU A;  1HQC A;  3HOW J;  2ELJ A;  1HKT A;  3H0D A;  4II3 A;  4AID A;  4RM3 A;  1X4P A;  2K40 A;  2HOA A;  3A2K A;  3PSI A;  2M1B A;  3EET A;  3NEU A;  5EG0 B;  1TZL A;  4FE4 A;  5K7Z A;  3CF5 F;  1LDD A;  1VFC A;  1A35 A;  3TO6 A;  3ABU A;  5L3G A;  3BJ6 A;  3LSH A;  2FMY A;  2Y0S A;  5CQE A;  2VB6 A;  1H88 C;  1ZRC A;  2CS3 A;  1IAW A;  2K9S A;  3F21 A;  2J5O A;  1QU3 A;  2FUG 2;  3EUP A;  3OOU A;  1FJL A;  3IAS 2;  5HOO A;  1JUP A;  2JA7 J;  2QKO A;  2X0L A;  2IBD A;  3G2B A;  2G7L A;  1VQ9 I;  1PYV A;  4HZF A;  3NAU A;  3L2R A;  5JR3 A;  3ZMV A;  3BDD A;  5D8K B;  4U87 A;  2O9L A;  2BY1 A;  2WAD A;  1O3T A;  1DQU A;  3W6K B;  5B66 C;  2DPU A;  1FOW A;  1W7P B;  2DFE A;  4OU0 A;  4IQJ A;  2KIF A;  1OFC X;  1WVR A;  2H6C A;  5FKL A;  4AIH A;  1RIO H;  3BHQ A;  1L3L A;  3DBL B;  1I5Z A;  3TW7 A;  2X1C A;  1KZH A;  4PJL A;  4DGW B;  3GVA A;  4CGR A;  4BHP A;  4XKW A;  4MEY F;  1WJB A;  3VVX A;  1FYK A;  1MNE A;  3FXJ A;  4I0B A;  4BJ6 C;  3DLL F;  4GFK A;  2F5C A;  2A5W A;  4KIB A;  2V57 A;  5D8L B;  3JRG A;  3S93 A;  5E1W A;  1XDS A;  3U1D A;  4NC6 A;  3ZQI A;  4YII A;  1JKP C;  3OS0 A;  1FEX A;  2UXH A;  4OAZ A;  2XAG A;  1KQ9 A;  3I71 A;  5KAF C;  3HXL A;  1E3H A;  2NP3 A;  3RKX A;  5D4S A;  3QPL A;  5FFZ A;  4F3Q A;  3HTI A;  3LA7 A;  1U8R A;  1ORK A;  2RAS A;  4ESF A;  3IUO A;  3IH3 A;  4PCQ A;  5CKT A;  3F8N A;  3ISP A;  2VKD A;  4BQN A;  1VF9 A;  4CDG A;  1PUF A;  4NBQ A;  2BHY A;  2MGQ A;  2JTV A;  2JA5 J;  3VUQ A;  2R7F A;  1LEB A;  1IRZ A;  1BW6 A;  2E2I J;  4GDF A;  4G7H F;  2PMZ A;  4M3G A;  3QOE A;  3B02 A;  1R7J A;  4MK6 A;  5J1U A;  2CUE A;  2EFQ A;  3ZQ7 A;  3HOS A;  3P9K A;  3MAJ A;  3WTY C;  2BVL A;  2UXU A;  3TDZ C;  3K4J A;  4BJT A;  2DOF A;  1ZG3 A;  2TRT A;  3GBG A;  2ADU A;  3RYR A;  2Z9O A;  2GZW A;  3SFZ A;  1WI9 A;  5LGT A;  2DOA A;  3AG2 H;  4N9I A;  4NHJ A;  3KLN A;  5CVJ A;  4NB5 A;  2L4M A;  2R7D A;  3WTU C;  2D1H A;  3NRV A;  5D19 A;  3IRQ A;  2FEZ A;  1XG1 A;  4A6D A;  1O7F A;  1WRJ A;  3CMY A;  2QGU A;  3B6C A;  1Y6I A;  2K4J A;  1Z7L A;  1EA3 A;  1APL C;  2MA3 A;  2QF7 A;  2RQP A;  3KP6 A;  1BN5 A;  2L7F P;  4QPO A;  2LLK A;  4A3I J;  4JL3 A;  2E34 A;  1JUS A;  1K6Y A;  3HSR A;  3OOP A;  4A3D J;  3ECH A;  3QU3 A;  3D0S A;  1G8X A;  3HGG A;  1XPX A;  3OIQ A;  5JHU A;  1NG7 A;  3A01 A;  1UFM A;  2QOP A;  4HQE A;  5ILU A;  1JGS A;  3I0T A;  2F5D A;  4P9F A;  4IQ4 A;  3D5S C;  2K9L A;  4YFN F;  2LRD A;  4HQM A;  1IO2 A;  4BH9 A;  4XLP F;  4RLF A;  1RKW A;  3LA3 A;  4JYK A;  2TCT A;  2R0Q C;  2HGC A;  2JVH A;  4GCK A;  2BEO A;  3Q0W A;  1U6G A;  2X1E A;  4PUS A;  4NUB A;  1DPU A;  3ZQQ A;  3Q0U A;  2VJI A;  1BI1 A;  3RQI A;  1QZY A;  4RB0 A;  4R8H A;  1BI2 A;  4IRG A;  4F92 B;  5LGU A;  4LLL A;  2LBF B;  4EM2 A;  5CW8 A;  2D5V A;  1AKH A;  2KPM A;  2JPB A;  2L2O A;  1QVU A;  1IW7 F;  3CJN A;  3S15 J;  4HKU A;  1Q1H A;  3VVY A;  2CQ7 A;  3FRQ A;  2RGV A;  3I55 I;  2P6S A;  4OIO F;  4X0G A;  2STT A;  1QO0 D;  3CWR A;  2DU9 A;  3B73 A;  1V4R A;  4D5C A;  4F55 A;  2GBY A;  2DK8 A;  4KIS A;  2ZXH A;  4IVN A;  4XQF A;  4WCG A;  4LMY A;  3HTS B;  2IT0 A;  3GFL A;  3ERM A;  1T38 A;  1P4A A;  4RA2 A;  2M30 A;  3BR3 A;  2FML A;  3QOD A;  3MKY B;  3HOZ J;  5AQC A;  4ZZD A;  2W7N A;  2QYO A;  2R7U A;  3JSJ A;  2F5V A;  3BZC A;  3N4M A;  3OYI A;  2V1N A;  3ONQ A;  3JRD A;  2P7C B;  4JKZ A;  1VND A;  2GA2 A;  1I27 A;  3GF2 A;  4PXI A;  4AIJ A;  3CO6 C;  4A3K J;  2DA4 A;  2Q1Z B;  3NWS A;  1VQO I;  1RR7 A;  3A02 A;  2ELH A;  2HZT A;  3QYF A;  2VOD A;  1WKM A;  5D18 A;  2VXZ A;  1REP C;  4XOR A;  4PDK A;  4JP0 A;  2VIX A;  1HW2 A;  1Y56 A;  2VJ4 A;  4Q47 A;  5K7F A;  1S72 I;  4U7D A;  1RUN A;  2PBX A;  3IHU A;  3OYM A;  2QKL B;  5J4V A;  2VXD A;  4ICH A;  5EEA A;  1GT0 C;  1DDN A;  5IPA A;  1MMA A;  2KP6 A;  4W97 A;  1FYL A;  4ENN A;  3DTI A;  2VKV A;  2X51 A;  1OCP A;  5D6E A;  3BTJ A;  3N97 A;  2UUZ A;  2WY8 Q;  4FAS D;  4PK4 A;  4FX4 A;  1JE8 A;  4RBO A;  3E6B A;  1HKQ A;  4E7K A;  2XRL A;  2A61 A;  4XKC A;  3HHH A;  1HKS A;  1SD4 A;  1W5T A;  3CCR I;  3FXK A;  4MQ9 F;  5BQT A;  2E7W A;  1XGM A;  3COA C;  3BLY A;  3CP2 A;  3JRI A;  4IHT A;  4CA0 A;  1BOA A;  5FHP A;  3HRM A;  1K7A A;  1BJZ A;  5LD2 C;  4I01 A;  4YEJ A;  5GAE J;  2RHA A;  3K10 A;  2KRH A;  2YX4 A;  4BJ5 C;  4A3J J;  2EZL A;  1I1S A;  2XRO A;  1YS6 A;  2EB7 A;  4M9S A;  2FJ1 A;  3A0H C;  1YIT I;  2E19 A;  4MFE A;  1ONV A;  2K4B A;  4MXM A;  4MLO A;  3CCQ I;  1MND A;  2MW8 A;  1IGN A;  1HF0 A;  4XLA A;  2QWT A;  3HG9 A;  5H20 A;  5AIP A;  3SQN A;  3CCL I;  3ANP A;  3PFI A;  1M1E B;  1CF7 A;  3QPT A;  2Y0M A;  3CCV I;  3F6O A;  2Q2E B;  5C4X J;  3W2W A;  3O3K A;  1JTY A;  2VAS A;  2HDC A;  4M72 A;  1SD7 A;  2VE8 A;  4UV9 A;  2IEK A;  5KK1 A;  4XN3 A;  3BRO A;  1R9T J;  1R49 A;  4KMU X;  1BC7 C;  2M9H A;  1ZGW A;  3BCB A;  1GHC A;  1K78 B;  2CYY A;  1J9I A;  2A68 F;  2ZNZ A;  4W1U A;  5DEQ A;  3CCE I;  1MBE A;  3PSF A;  3J7Z I;  4IO9 F;  1JI8 A;  3K4L A;  1D8K A;  2TDX A;  2V1U A;  2WB1 N;  5F1J A;  3R0A A;  3OSG A;  1WWX A;  2XPW A;  5CXG A;  2VN2 A;  5J47 A;  1LE8 B;  2CQK A;  5GPA A;  1R00 A;  2DPD A;  4ZC3 A;  2PFV A;  4AVP A;  1B59 A;  1KON A;  2FF4 A;  2Z3Y A;  1U3E M;  4FIS A;  1YTY A;  4C2U A;  2JA6 J;  4J19 A;  2BHZ A;  1B4A A;  1TT0 A;  3VYU B;  1WJA A;  2IA2 A;  2X9D A;  2ZXW H;  5E18 F;  3KLO A;  1Z05 A;  2LSO A;  1D1B A;  1ZLJ A;  3WTS C;  3AFH A;  3S3M A;  4OIP F;  4X6A J;  4UVC A;  2L3D A;  3TBI A;  4WX9 A;  4PJ0 C;  4C30 A;  1JT0 A;  2FNP A;  4LFU A;  3FXL A;  2HQ5 A;  2MBF A;  2W82 A;  1JKQ C;  5K7H A;  2JK3 A;  2EZH A;  1RET A;  5FGL A;  2E1M B;  1R5H A;  3JSP A;  5LEJ A;  4D7N A;  4CZC A;  3OYG A;  1D8J A;  1E3P A;  3M1C A;  5KCM A;  5F0F A;  1D5Y A;  1ZHF A;  4B09 A;  5DM6 F;  4HW0 A;  3PM1 A;  1YW8 A;  2WV1 A;  3QQA A;  1IXC A;  3DPU A;  1XGS A;  4C2T A;  2XGX A;  4ENJ A;  4ZTJ A;  3RDI A;  2VT3 A;  3GTP J;  1Z3Y A;  2EA4 A;  5D5V B;  3RQ4 A;  2CU7 A;  4UY8 I;  3JRC A;  1LFB A;  3J7Y J;  1BM9 A;  5LRS A;  2PI0 A;  5EF6 A;  4OD4 A;  2FOW A;  1FBS A;  3FXO A;  1UHS A;  1SVO A;  3GYH X;  3BR5 A;  1ETW A;  3FMR A;  2E1O A;  3O8H A;  3S3O A;  1SAU A;  3I4P A;  1XGN A;  2IA1 A;  3I64 A;  2D1V A;  3ASN H;  4ZH4 F;  3JRH A;  3AKZ A;  4C3I J;  1YIO A; 
#chains in the Genus database with same CATH homology
 3G56 A;  4JX4 A;  4C3H J;  2DMN A;  1W0U A;  1FIP A;  4B3A A;  2L7Z A;  3OSF A;  4JX5 A;  4D5F A;  4KWA A;  4A3B J;  5M5X J;  2AHQ A;  3HB9 A;  5FLV A;  2OPT A;  4D7M A;  4BY7 J;  1IUF A;  1K61 A;  3MNL A;  1HOM A;  3RD3 A;  5IYC J;  2NS8 A;  2JA8 J;  2HKU A;  3WHC A;  1P7I A;  1I6H J;  3BQZ A;  1FIA A;  5IP9 J;  3JR9 A;  4C3J J;  5EGO B;  5M3M J;  3FK6 A;  5HOD A;  1GV5 A;  3NNR A;  2JN6 A;  4M6V A;  1GDT A;  1QVT A;  3V6G A;  1B8I A;  2E2J J;  3NPI A;  5DAJ A;  2P81 A;  3GTO J;  2QIB A;  3GTG J;  3S1Q J;  2ID3 A;  4BXX J;  5JLX A;  2G7S A;  3UKG A;  4L62 A;  3M3Y J;  1UG2 A;  2EZI A;  1JT6 A;  4QIW N;  1WGX A;  2QTQ A;  2HOT A;  2Y30 A;  3K2A A;  3RKQ A;  1ETY A;  2LD5 A;  5C4Y A;  3BR1 A;  1RKT A;  2YUS A;  3ANG A;  3LSG A;  3E7L A;  2PZ9 A;  1TWG J;  3SFI A;  9ANT A;  3NXC A;  5FKM A;  3SDG A;  3MKL A;  2YU9 J;  2NX4 A;  3F1B A;  4DW6 A;  3V78 A;  1TWH J;  2IU5 A;  4GCT A;  4AC0 A;  2XSD C;  4M3F A;  4DZJ A;  1LE8 A;  1RPW A;  1QRY A;  3H0G J;  3VW1 A;  5EZG A;  5HBU A;  2R5Z B;  2GFN A;  3RZO J;  3B6A A;  1PUF B;  3BG3 A;  3ON4 A;  5C3E J;  1DU0 A;  2F07 A;  1TWF J;  2X6O A;  1AU7 A;  1ZTR A;  2R93 J;  1I50 J;  3RZD J;  2XPU A;  5C44 J;  2ZCX A;  2DN0 A;  2DA5 A;  1ZQ3 P;  3TW6 A;  3FKI J;  1WH7 A;  1H89 C;  2HOS A;  4ABZ A;  1GV2 A;  1FTZ A;  1NTC A;  3QPS A;  3S5R A;  2JJ7 A;  2AO9 A;  4XRM A;  3S2D J;  1B72 A;  3COL A;  3VIB A;  3GEU A;  2O7T A;  1MBJ A;  3HOW J;  5FKN A;  3GTM J;  2EQR A;  3BNI A;  3NAR A;  1IV6 A;  2K40 A;  2ME0 A;  2HOA A;  4UUS A;  1X2N A;  3CRJ A;  5EG0 B;  2UXP A;  5K7Z A;  4FE4 A;  1VFC A;  3MVP A;  3HTH A;  2HDD A;  3A03 A;  1TWA J;  3VOX A;  1H88 C;  2K9S A;  2UXI A;  2D6Y A;  4GFL A;  1ZR4 A;  2DJN A;  2DA2 A;  2OER A;  3VP5 A;  2XDN A;  3EUP A;  3OOU A;  4Y52 J;  1FJL A;  2XB0 X;  3HGY A;  5CXI A;  1JUP A;  2R92 J;  2R5Y A;  2JA7 J;  2QKO A;  4B4C A;  1JUM A;  4M3B A;  5BNG A;  2IBD A;  2G7L A;  5M3F J;  2X48 A;  3TP3 A;  3ZQG A;  2LVS A;  2L7M P;  3HKZ N;  1POG A;  3NAU A;  2DMT A;  5EZH A;  4A3F J;  1YRN B;  3ON2 A;  5EYR A;  5IP6 A;  3OIO A;  2ZOY A;  2O9L A;  3B81 A;  1NK3 P;  3HOU J;  2VKE A;  3GTK J;  1OFC X;  5FKL A;  3AQT A;  3BHQ A;  5EDN A;  1UI5 A;  3TW7 A;  3KZ9 A;  5D1R A;  5EGO A;  1U9O A;  1UI6 A;  1FTT A;  4CGR A;  1AKH B;  3VVX A;  4XRS A;  4QSH A;  2DTZ A;  4GFK A;  3CCY A;  3HOY J;  4XIC A;  2V57 A;  2CUF A;  3JRG A;  2H8R A;  3MN2 A;  5JLW A;  3ZQI A;  1HCR A;  1BW5 A;  1JKP C;  1FEX A;  2UXH A;  5H9T A;  2QCO A;  2RAE A;  1ETK A;  1JGG A;  3S14 J;  3GTL J;  4UUT A;  2NP3 A;  3NI7 A;  1ZK8 A;  3K7A J;  1NK2 P;  3QPL A;  3E7Q A;  3HTI A;  4NN1 A;  3QKX A;  3I4M J;  1ORK A;  2Y0S N;  3ZOB A;  4IHW A;  3HEF A;  2RAS A;  4BY1 J;  3IH3 A;  2OF7 A;  1ETQ A;  1VF9 A;  4I6Z A;  4BBS J;  1PUF A;  2G3B A;  2MG4 A;  5E3O A;  2MGQ A;  2JA5 J;  3VUQ A;  1IRZ A;  3H3V K;  4A3L J;  1BW6 A;  2E2I J;  5F0H A;  2Q24 A;  3FK7 A;  2M2E A;  1JJ6 C;  3JRE A;  2Y2Z A;  4M3G A;  1A5J A;  4MK6 A;  4X1E A;  5J1U A;  5HSZ A;  2CUE A;  5GPC A;  4DYC A;  2Y9Y A;  3VPR A;  3BJB A;  3GTJ J;  1HLV A;  5K58 A;  4Y7N J;  5IYB J;  2EZK A;  2UXU A;  1W0T A;  1Q1V A;  2TRT A;  3GBG A;  2NS7 A;  4V2F A;  3PO2 J;  2NOG A;  1CQT A;  1U9N A;  1MSF C;  2Y9Z A;  3G1L A;  3C07 A;  3C2B A;  1ETO A;  2NVX J;  1EF4 A;  2ZCN A;  1X2M A;  2MSY A;  5D19 A;  3T6N A;  3ZQH A;  1F43 A;  4MO7 A;  3O8G A;  3KKD A;  1XG1 A;  3G1M A;  3CMY A;  1ZR2 A;  3B6C A;  1OJL A;  1AHD P;  2R7Z J;  3S17 J;  4AUX A;  1APL C;  2QF7 A;  4IHY A;  2L7F P;  3BT9 A;  2LLK A;  2Y31 A;  2FX0 A;  2M8G X;  4A3I J;  2K9Q A;  4BKX A;  4ME9 A;  4LOC A;  4JL3 A;  1JUS A;  4GFB A;  4JX6 A;  4A3D J;  2DA3 A;  1JKR C;  5FKK A;  2XB5 A;  2GEN A;  1T56 A;  3VW2 A;  3HGG A;  2WAQ N;  1HDD C;  1XC5 A;  5IP7 J;  3BR2 A;  3BG5 A;  5DS9 A;  3A01 A;  1MBG A;  2QOP A;  2NVQ J;  1YRN A;  3GZI A;  4A69 C;  1RKW A;  1IG7 A;  4JYK A;  3GTQ J;  1MBH A;  2TCT A;  2R0Q C;  2VUM J;  4GCK A;  3LWJ A;  3HTJ A;  3Q0W A;  4DYQ A;  1MBF A;  3RH2 A;  5FLM J;  4IEJ A;  2O7O A;  3Q0U A;  5E3L A;  1E3O C;  2REK A;  3BCG A;  4G12 A;  3QBM A;  3RQI A;  4FCY A;  2HI3 A;  3S1R J;  2LTP A;  3Q0V A;  2PMZ N;  3JRA A;  1GVD A;  4AYB N;  5CW8 A;  3FIS A;  2D5V A;  3ZQL A;  1AKH A;  2NVT J;  4JNN A;  1QVU A;  4HKU A;  3W6V A;  3S15 J;  2K9N A;  3VVY A;  4L5E A;  2NVY J;  2XPV A;  1S7E A;  3FRQ A;  5E3M A;  2DMQ A;  5IOY A;  2KDZ A;  4GCL A;  2I10 A;  4IHX A;  3CWR A;  3S1N J;  1JKO C;  4D5C A;  3BTL A;  1TC3 C;  2GBY A;  2CQX A;  2G7G A;  1XS9 A;  1HDP A;  2G0E A;  3BQY A;  3LSJ A;  5GP9 A;  3BR3 A;  3HOZ J;  1T33 A;  3IH2 A;  5AQC A;  3LNQ A;  2LKX A;  3JSJ A;  2B63 J;  4JKZ A;  3JRD A;  3JRF A;  3Q3S A;  1VND A;  2LFB A;  3HE0 A;  4PXI A;  2DA7 A;  5F27 A;  5DTD A;  4A3K J;  2DA4 A;  1BL0 A;  1RR7 A;  3A02 A;  3CQZ J;  1G2H A;  3PPB A;  3I4N J;  1MNM C;  2HYJ A;  4V2G A;  3VOK A;  3LJL A;  2LR8 A;  2OI8 A;  1U8B A;  3VVZ A;  4AC6 A;  1A6I A;  5D18 A;  2UXO A;  1WCM J;  2DA1 A;  4DZP A;  1LFU P;  4JP0 A;  3TED A;  2XGD A;  5K7F A;  4M3E A;  2FBQ A;  3BR0 A;  1MH4 A;  2PBX A;  2YVE A;  1I3Q J;  2NP5 A;  1SGM A;  2O8K A;  4ICH A;  5EEA A;  2FQ4 A;  2R5Z A;  1GT0 C;  1WI3 A;  5IPA A;  1IC8 A;  4W97 A;  1QPI A;  4A3G J;  2HYT A;  2VKV A;  4CYC B;  2EBI A;  1OCP A;  3LOC A;  2KT0 A;  4XK4 A;  3BTJ A;  4A93 J;  1ITY A;  3BTC A;  3G1O A;  2WUI A;  1K83 J;  1X58 A;  3TP0 A;  4RBO A;  1OCT C;  2VI6 A;  2DA6 A;  2XRL A;  5M5Y J;  4QTR A;  2CJJ A;  3L1P A;  3ZQC A;  3SJM A;  1JJ8 C;  3PAS A;  3AQS A;  4XRS G;  1MH3 A;  3JRI A;  2COB A;  5FHP A;  2LY9 A;  3HTA A;  1BJZ A;  5FJ8 J;  2JWT A;  4A3E J;  2M0C A;  2LK2 A;  3O60 A;  2YS9 A;  1Z77 A;  2RHA A;  5J3L A;  5EFY A;  2ELK A;  2HXO A;  4A3J J;  2EZL A;  4M3D A;  2DMU A;  4BBR J;  5IYD J;  5EG0 A;  2GM4 A;  1ENH A;  1ETV A;  2W53 A;  2FJ1 A;  3HIM A;  2E19 A;  1VI0 A;  4MFE A;  1GUU A;  1RES A;  4MXM A;  4MLO A;  3S16 J;  1H8A C;  5J1Y A;  2MW8 A;  5J1R A;  1U78 A;  1HF0 A;  1IGN A;  2WGB A;  2QWT A;  3EGQ A;  4NEL A;  4C2M J;  2ECB A;  3ANP A;  1IJW C;  3DEW A;  4YZE A;  1B8I B;  5C4X J;  4MIM A;  4AF5 A;  3HBL A;  1JTY A;  2ZCM A;  2E2H J;  2IEK A;  1R9T J;  2XGE A;  5IOZ A;  2VPR A;  1TWC J;  2M9H A;  1ZGW A;  1MSE C;  2DG7 A;  3IH4 A;  3PO3 J;  4ACI A;  1SAN A;  2DMP A;  1IDZ A;  4A3C J;  1MBK A;  4W1U A;  4XID A;  5HAW A;  1MBE A;  4S0H B;  4I76 A;  4UDS A;  2WB1 N;  5F1J A;  3OSG A;  5FKO A;  3IUV A;  2XPW A;  2H1K A;  5CXG A;  1Y1V J;  1LE8 B;  1UMQ A;  2ZOZ A;  3VW0 A;  5GPA A;  1ZKG A;  2FD5 A;  2N8G A;  1DU6 A;  4HNV A;  4IHV A;  5F0C A;  3HM5 A;  4FTH A;  3CDL A;  4FIS A;  1P7J A;  3WHB A;  4J19 A;  2XGC A;  2JA6 J;  2GLO A;  2IAI A;  1Z0X A;  2X9D A;  2DG8 A;  3HOX J;  5C4J J;  2W48 A;  2ZB9 A;  3JRB A;  4X6A J;  3LSP A;  4EEF G;  1WPK A;  1SFO J;  3ZQF A;  3G7R A;  5F04 A;  1JT0 A;  3D1N I;  3BG9 A;  2HQ5 A;  3DCF A;  3LSR A;  5M5W J;  1JKQ C;  5K7H A;  5FMP A;  2JK3 A;  2EZH A;  1RET A;  1B72 B;  3HDD A;  5FGL A;  4MFD A;  1WH5 A;  3IV5 A;  3S2H J;  4D7N A;  3FIW A;  2YVH A;  5F08 A;  2ID6 A;  3CJD A;  3LHQ A;  3A01 B;  3KKC A;  4FE7 A;  5F0F A;  2CQQ A;  1D5Y A;  4UUS B;  4NDL A;  3PM1 A;  3P9T A;  2WV1 A;  3QQA A;  2ECC A;  1JTX A;  4A3M J;  4RDU A;  4B1R A;  2GUH A;  4DYR A;  2LP0 A;  2M34 A;  1Y1W J;  3GTP J;  1ETX A;  3BR6 A;  3F0C A;  5E3N A;  4CYC A;  1O4X A;  2ME6 A;  2CU7 A;  3DPJ A;  3JRC A;  1LFB A;  3S1M J;  5EF6 A;  3HOV J;  3BRU A;  1UHS A;  1BA5 A;  3BR5 A;  1IDY A;  1ETW A;  2EH3 A;  3BTI A;  3NRG A;  2E1O A;  3O8H A;  2R5Y B;  2HXI A;  3M4O J;  3KNW A;  2L9R A;  3JRH A;  2JMW A;  1F36 A;  2L0K A;  2CRG A;  4C3I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...