2FD5A

The crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
180
structure length
180
Chain Sequence
MSDKKTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEAFEQLLGKRRELLGELDPGLSGKERRALAAAFYLSRKHRDAQVDAGCPLPATLAEVARLPEGFREVLSRHVEIMVTSLAESPEETDVALADLVLMIGGLALARALGPGELSDRVLRAAKQAVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a transcriptional regulator from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
molecule keywords transcriptional regulator
total genus 71
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2fd5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fd5A02
4I76A 2L7FP 4A3BJ 1ZR4A 3GEUA 4DYCA 1WGXA 3QPLA 4BXXJ 3TW7A 5D1RA 4JX5A 2KDZA 1HLVA 1WH7A 4XIDA 5F04A 3KZ9A 2ID6A 2M9HA 5EGOB 2JA6J 3RD3A 1S7EA 2GM4A 4CYCA 5EZGA 5FKKA 2R5YB 2QOPA 5M3MJ 3BQYA 3MKLA 1ETYA 2L9RA 3BCGA 5F08A 1LE8A 4W1UA 3CWRA 3IUVA 5FJ8J 2LP0A 1SGMA 3ANPA 5CXIA 1X2MA 2E2JJ 2R7ZJ 4DYQA 1ZGWA 1TWHJ 1IRZA 2TCTA 5C4XJ 5FLVA 4GCKA 5EG0B 2COBA 1FIAA 3PPBA 1NTCA 2NS8A 1BJZA 4UUTA 3NNRA 3LSGA 5FKMA 4D5CA 1JJ6C 3OOUA 5E3MA 3GTLJ 2QTQA 4KWAA 1B8IB 1TWFJ 1ZKGA 2O7OA 2DA4A 2DTZA 4DYRA 4QTRA 4XRMA 1ZTRA 3G1LA 1RETA 3IH2A 2JA5J 2UXHA 3BHQA 1FTTA 1Z77A 5HBUA 5F27A 3V6GA 2XGEA 2REKA 3FK6A 5FKOA 2ME6A 2L0KA 3B81A 1K61A 5IOYA 1ETXA 1JT0A 3QKXA 2ECBA 3RZDJ 3HBLA 1HF0A 3A01B 2XB0X 1JTYA 2UXPA 5C3EJ 2DA1A 2ELKA 5EGOA 3FIWA 4M3BA 2M8GX 3RKQA 4A69C 1UMQA 2QCOA 3ZQHA 1MBJA 1UHSA 1A6IA 2M0CA 2FX0A 5F0HA 5JLXA 2QKOA 2NVXJ 2JWTA 1U9NA 1OJLA 3BTLA 4BBSJ 2XPWA 3ZQGA 3VP5A 2ECCA 2XSDC 5E3OA 2P81A 5FGLA 4ME9A 2E19A 2L7ZA 9ANTA 3COLA 2VKEA 3RQIA 4D5FA 2CQXA 3GTMJ 4A3KJ 3PO2J 5E3NA 2MSYA 3TP0A 1I50J 2DA2A 3HIMA 4DW6A 4B4CA 2UXUA 2EBIA 2ME0A 4V2FA 1ORKA 3LNQA 3HE0A 2M2EA 3JRAA 4BKXA 1SANA 1JUMA 3CQZJ 5GP9A 3TEDA 1U9OA 1JKRC 2CRGA 2WAQN 3SJMA 2XGDA 5HAWA 2R5ZB 3M4OJ 4MFDA 3S1QJ 1HOMA 1B8IA 2I10A 3W6VA 1XC5A 4A3IJ 3CRJA 1F43A 3PASA 1HCRA 2HQ5A 4XICA 3I4MJ 2NP3A 1P7JA 2GFNA 5EZHA 2Y0SN 5GPAA 2OERA 3RZOJ 4UUSA 2DMPA 1EF4A 3VPRA 5IYBJ 2CUEA 2NX4A 2VI6A 2N8GA 1OCPA 3BR6A 2OF7A 2Y9ZA 1IGNA 1X2NA 3V78A 3MNLA 2X9DA 5HSZA 4A3DJ 2YU9J 4ABZA 3ZQFA 4M6VA 1AHDP 4NDLA 4C2MJ 2DMQA 3BG9A 1H88C 2MGQA 5FKLA 1F36A 1MBGA 2R93J 3A02A 4CYCB 3GTJJ 5FLMJ 3JRGA 1GT0C 3BNIA 2VKVA 1ZR2A 3HTJA 3HTAA 4FE4A 3AQSA 1BA5A 3VW1A 3BTCA 2LLKA 2DG7A 2X6OA 5IOZA 3F1BA 2ZOZA 1NK2P 1DU0A 2R92J 4I6ZA 1WPKA 5M5WJ 5H9TA 4IHXA 2JK3A 2Y2ZA 2B63J 2R5ZA 2GBYA 4AF5A 3Q3SA 2H8RA 4HNVA 5K7HA 4IEJA 1O4XA 4NN1A 3VIBA 4JNNA 5EDNA 3VVZA 3GTOJ 2OPTA 4GFBA 1T56A 2HI3A 1POGA 3HOYJ 3Q0WA 3GTGJ 2WGBA 3TW6A 1JJ8C 1MBKA 2DA3A 3HTIA 5FKNA 3NI7A 2H1KA 1FEXA 3LOCA 2E1OA 1MBEA 2Y9YA 4A3EJ 3B6AA 3LHQA 1QRYA 5EEAA 1BW6A 4JYKA 1JUPA 2IAIA 2XGCA 3ON4A 2MW8A 2JA8J 1T33A 2DA5A 3G7RA 1RESA 3I4NJ 2EZKA 2VPRA 3SFIA 2EQRA 1YRNA 3S1MJ 1IC8A 3Q0UA 3EGQA 4MIMA 3QPSA 4QSHA 3S5RA 1PUFA 3HGGA 3CCYA 3CMYA 3IV5A 2QIBA 1VNDA 3S15J 1ETVA 3VW0A 1TWCJ 4MK6A 2ZCMA 2LK2A 2DG8A 1X58A 3FK7A 1AU7A 3NPIA 3S14J 3O8HA 4NELA 3L1PA 3JRIA 4UUSB 2LD5A 4UDSA 1OCTC 1ETOA 3HTHA 2WV1A 2O7TA 3HOXJ 2M34A 2ZCNA 3LSJA 2HOAA 4XRSA 2HDDA 1IJWC 2FBQA 4FISA 3ZQCA 3DCFA 4XRSG 4BBRJ 4D7NA 2EH3A 5IPAA 4D7MA 3O8GA 3RH2A 2XPVA 3AQTA 2AO9A 1XS9A 4FTHA 2XDNA 2Y31A 1ETKA 3E7LA 2XPUA 1A5JA 2E2HJ 3WHBA 2RAEA 3BR1A 3S1RJ 4RBOA 5F0CA 1OFCX 2X48A 2QWTA 2R5YA 5J1UA 3HM5A 4M3DA 1MSEC 2G7GA 2V57A 2W48A 2HYJA 1HDPA 4ICHA 4G12A 1XG1A 3ANGA 4IHYA 3QQAA 3IH3A 3NXCA 1I3QJ 1PUFB 4L5EA 2LY9A 4QIWN 1AKHB 5IP7J 3VVXA 3BR0A 3GTPJ 3TP3A 2R0QC 5EG0A 3HB9A 1JGGA 1LFUP 4A3CJ 1R9TJ 4C3IJ 5EYRA 3BG5A 3OSGA 2NVTJ 2HYTA 1LFBA 4Y52J 1IDZA 3VVYA 3T6NA 2G7SA 2ZB9A 3OSFA 4C3HJ 4B1RA 3S1NJ 3KKCA 1JUSA 2UXIA 3IH4A 4M3EA 4X1EA 3ZQIA 4B3AA 4C3JJ 5J1RA 4IHVA 1ZQ3P 2GENA 2G0EA 3HOVJ 3HEFA 5HODA 2W53A 2ZOYA 4EEFG 3FKIJ 2JJ7A 5J3LA 3WHCA 4ACIA 3BJBA 1MH4A 4A3JJ 2CUFA 4RDUA 3LJLA 2NVQJ 5DAJA 1TWAJ 2HXOA 1UG2A 3CJDA 3VUQA 5J1YA 2CJJA 1MBHA 2EZHA 3JRDA 2YVHA 1U8BA 1U78A 1UI5A 2HXIA 2DMTA 3BR3A 3ON2A 3FRQA 2NS7A 2XB5A 3HOUJ 3O60A 3GTKJ 3C07A 5K7FA 1VI0A 3SDGA 4X6AJ 5AQCA 4JL3A 5E3LA 1GV2A 4A3GJ 3BRUA 4J19A 1AKHA 3VOKA 2WUIA 3G56A 4GCTA 4MO7A 3CDLA 1W0UA 1GV5A 2OI8A 1B72A 2FJ1A 5M3FJ 1SFOJ 2IBDA 4AYBN 1FTZA 1H8AC 1MNMC 3GZIA 5IP9J 1YRNB 3BG3A 2PBXA 1K83J 3BTJA 3DPJA 5BNGA 2K9SA 4CGRA 1ZK8A 2O9LA 5IYDJ 3H3VK 1TWGJ 1Y1WJ 4L62A 2JN6A 4YZEA 5DS9A 3KNWA 2D6YA 2D5VA 3VOXA 2CU7A 2DA7A 3D1NI 4HKUA 3HDDA 4AUXA 4GCLA 3F0CA 1MBFA 4LOCA 2DA6A 3M3YJ 3E7QA 1QVTA 5F0FA 3ZQLA 4Y7NJ 5C44J 2L7MP 3GTQJ 1Q1VA 1G2HA 4BY7J 2ZCXA 1JTXA 2PMZN 4FE7A 1IUFA 2K9NA 1QPIA 4A3LJ 2Q24A 3Q0VA 2HKUA 2IEKA 1BW5A 1VFCA 5EF6A 4FCYA 4PXIA 3PM1A 5GPCA 4BY1J 3HOZJ 2CQQA 2JA7J 5C4JJ 1GVDA 1DU6A 3BTIA 5M5XJ 1ITYA 4AC6A 3LWJA 1LE8B 5K7ZA 3G1MA 3NRGA 5D19A 4IHWA 2VUMJ 2LFBA 3P9TA 2F07A 3KKDA 2GUHA 4M3FA 1WCMJ 1I6HJ 3C2BA 2ID3A 2JMWA 2K9QA 1HDDC 5CXGA 1IG7A 4GFLA 1FJLA 2UXOA 2PZ9A 3BQZA 1ETWA 1JKOC 4MFEA 5IP6A 2DMUA 3BT9A 2HOSA 2DN0A 5K58A 1JT6A 4W97A 1Y1VJ 2LVSA 3S2DJ 2YVEA 3EUPA 4A3MJ 1ENHA 4DZPA 1B72B 3S16J 1GUUA 3HGYA 5F1JA 3GBGA 2NVYJ 2HOTA 1IDYA 4JX6A 2XRLA 3UKGA 5FMPA 3JRHA 3JSJA 2LTPA 2DJNA 1FIPA 3JRFA 4AC0A 5DTDA 3ZOBA 4MLOA 3S17J 1BL0A 2EZIA 2RHAA 1H89C 3BR5A 4JP0A 5FHPA 1RKWA 2FD5A 3S2HJ 2Y30A 2G7LA 1JKQC 3DEWA 2AHQA 5D18A 3NAUA 4M3GA 3B6CA 2NOGA 3FISA 5JLWA 1RPWA 4S0HB 2DMNA 1GDTA 2E2IJ 5IYCJ 5M5YJ 1QVUA 3JRBA 3LSPA 1W0TA 3LSRA 1Z0XA 2O8KA 2LR8A 2WB1N 3H0GJ 3JR9A 1NK3P 4GFKA 2FQ4A 1TC3C 3VW2A 2YS9A 1RR7A 3MN2A 5CW8A 4MXMA 4A3FJ 3G1OA 2LKXA 4V2GA 4XK4A 1ETQA 3K7AJ 4DZJA 1VF9A 1RKTA 5C4YA 2TRTA 3OIOA 3JREA 2KT0A 2NP5A 2YUSA 3A01A 4JKZA 2EZLA 4JX4A 3BR2A 1D5YA 2G3BA 2GLOA 3HOWJ 5EFYA 2QF7A 2IU5A 1E3OC 1UI6A 2RASA 3JRCA 3PO3J 3K2AA 2K40A 1IV6A 1MH3A 3HKZN 3A03A 1MSFC 3QBMA 1WH5A 4A93J 1P7IA 1JKPC 1WI3A 3MVPA 1CQTA 1APLC 2MG4A 3NARA
chains in the Genus database with same CATH superfamily
3I3LA 4RM2A 2VQCA 4XQFA 3GEUA 1BIAA 3TO6A 2Q1ZB 3K9TA 2ZXIA 4BDYA 5F04A 1XGMA 3KZ9A 2ID6A 4XLFA 4BYYA 1NG6A 2JA6J 1R49A 1W4MA 3W3CA 5FKKA 4CYCA 3K70C 1MJBA 2QOPA 1I1SA 1P4AA 4AIKA 4BEHA 1YX3A 2DJIA 4DYQA 1TWHJ 4RB3C 1XDUA 4I0BA 5FLVA 5EG0B 5IT9Z 2COBA 3ESWB 1QO0D 2STWA 5D5XB 2HDWA 1UHWA 4RA2A 3I59B 3GZNB 3IAS2 1P6RA 3NNRA 5FKMA 1KQ0A 3CJTB 3OOUA 1JJ6C 3IRQA 1ZKGA 3CJNA 3CF5F 2DA4A 3E5QA 1S72I 2ZJQF 5KVRA 2QVOA 3WE3A 4OIOF 1K4SA 2UXHA 4YG2F 4Y17A 1UHMA 1O3SA 2A07F 4F93B 2JSCA 1EH8A 2ME6A 2RNJA 2QKMB 5FO5A 2PFVA 3HSEA 4PDKA 2ECBA 3U1KA 3WTYC 1JTYA 2UXPA 4LGWA 4MEXF 5JFRA 1TT5B 5EGOA 3RKQA 2L54A 3QAHA 2XSJC 4A69C 3TDUC 3ZQHA 1UHSA 2Z2SB 3MKZA 4ENMA 1PP8F 2CG4A 1OJLA 4UY8I 1MMSA 3ZXSA 1LPQA 4BBSJ 3VP5A 4A5MA 2LRDA 3L7WA 4M9SA 4Y3OA 2IA2A 4Y33A 9ANTA 1J7KA 2VKEA 3RQIA 3CUOA 4OIRF 2V7FA 3TDZC 1U2WA 2LREA 4HW0A 1ZRDA 1BI0A 4HAMA 4PK4A 1I50J 1LB2A 1IXCA 3E0JB 1D5VA 1IW7F 3E3VA 1UZCA 2ME0A 3FM5A 4HPQA 2FXAA 4BKXA 2LKPA 4MQ9F 1KONA 5DEQA 1YO5C 1P4WA 5LGUA 1JKRC 3A0HC 3ZGKA 3SJMA 2ZCWA 1J0RA 4PGHA 3S1QJ 1HOMA 3QU6A 5JVGF 2FJI1 1PYVA 1F4KA 3UR3C 3KP7A 2VJJA 4OAZA 2R7SA 3FMQA 2M30A 4B47A 4HDUA 4U9NA 1Q1HA 4LK0F 2XUBA 1RUOA 2OERA 4UUSA 2DMPA 1EF4A 3P5JA 3VPRA 5IYBJ 5HLTA 1ZRFA 2CUEA 3NQOA 2NX4A 4A5NA 2EIMH 2N8GA 2P4WA 2OF7A 2XRNA 2FBIA 2Y48A 5D6FA 5HSZA 3OYIA 3TQNA 4M6VA 3HJEA 4PUSA 2HS5A 3I4PA 1PUEE 4NDLA 1D8KA 3H3ZA 3BG9A 5TISC 3H9JA 4ZDLA 5FKLA 4ON0A 1MBGA 2R93J 4CYCB 5FLMJ 3D5SC 3NRVA 3DP7A 3HTJA 3S93A 3KZYA 4FE4A 4G7ZF 1BM9A 5KAFC 2M7AA 2V1XA 3BTCA 1YITI 3DKXA 3QP6A 2X6OA 1YX5A 2ZOZA 2MBFA 3KEOA 4I6ZA 1LNWA 5DUKA 2QYOA 1BI2A 1T6SA 1LJ9A 4ASNA 4HNVA 4HF0A 1J2XA 2VONA 1YW9A 2X0LA 4KIGA 3H9QA 2KMUA 2W82A 1DGRM 2FNAA 1T56A 2HI3A 3Q0WA 3GTGJ 2A6HF 2XVCA 2WGBA 1B9NA 3HHGA 4A6DA 2HYFA 4MEYF 4XOTA 1VQKI 2DA3A 1WJ5A 4G7HF 2COMA 2RN7A 5DV5A 3BCBA 1FBUA 2XF7A 2O6GE 4LITA 1S29A 2P6TA 2E1OA 2NXNB 2QQAA 3E6BA 2WY7Q 2HPMA 3S3OA 4E7HA 1W7PD 2HKOA 2CGPA 2LY2A 4CO8A 5HLHA 4WXCA 2IGNA 1ONVA 2PFBA 2XGCA 4HSRA 3QYEA 4XL9A 2EZKA 2MYSA 4AIJA 2IA0A 4HYEA 4B3XA 1LUJB 1YTYA 3QPSA 4QSHA 4ZC3A 3S5RA 3CCYA 1VNDA 2KIFA 3V7CA 3ZMTA 3VW0A 3BJ6A 3L2QA 4MK6A 4Q4ZF 3I9V2 1R5HA 4IRGA 1AU7A 3NPIA 1Z21A 3O8HA 4KMUX 3L1PA 3JRIA 4UDSA 3TGNA 1S5LC 4DBRA 3R61A 1MJAA 2HOEA 3NWTA 5HDKA 1GXPA 1K79A 2FMYA 4C2UA 2AS5F 4HX4A 3QOEA 2FBQA 2R7VA 4XLHA 2GXGA 3BOQA 1P9QC 1TW3A 4HNTA 4UVBA 4D7MA 3AQTA 4OIPF 1RR8C 1U5TC 2DU9A 2KISA 1XS9A 4FTHA 2XDNA 3KIOA 1NG7A 2K3FA 2XAGA 2XPUA 2ZKZA 4Y4RA 4ZYAA 3EPZA 1A5JA 4CICA 3HTSB 1YS6A 4GCVA 4RBOA 4LLGF 2QWTA 1TQIA 4HX8A 5J1UA 5K5QA 1MSEC 1SFKA 4BACA 5K5RA 5LGNA 1IN7A 4LG0A 3CP8A 4CA0A 1SMTA 4JK1X 5JVTA 4S05A 1B4AA 1I3QJ 3MZHA 4L5EA 4XN3A 4E4HA 2QKLB 5EG0A 2R0QC 2PJPA 2Q0OA 1JGGA 1LFUP 3M8FA 2P6SA 2DDAA 3GMEA 2L9VA 2DK8A 4R79A 2W00A 1A6QA 4JOMA 1KZHA 3UNGC 2VPLA 3AG2H 1FNNA 4B1RA 4C3HJ 1DGWY 2FU4A 3KKCA 2IXSA 2GENA 3HOVJ 2VC1A 2ZMEC 2JJ7A 2R7UA 1FP1D 3WHCA 5E1ZB 4ITVA 1MH4A 3FM3A 3LJLA 1WHUA 4RDUA 2OUMA 4B43A 5DAJA 1F9NA 2HQRA 3RI4A 2L9SA 1K6YA 2A68F 4KDPA 3GW2A 1MBHA 3JRDA 2YU3A 3LFUA 4ZJZA 4XNFA 5D8LB 3K2ZA 2XB5A 1YYVA 3L09A 3HOUJ 3GTKJ 1VI0A 5IY5H 3I53A 2BOLA 4X6AJ 2A2FX 1R58A 2VT2A 5B1AH 5JHUA 1Y8RB 4A3GJ 2L9NA 4G8XA 1K78A 1U0JA 2WUIA 5F1RA 4GCTA 4F92B 2DCEA 3AAFA 2OTJI 4C9YA 1YJ9I 3PIPF 1KA8A 3DPTA 2KQRA 2KJCA 1MNMC 2DFHA 4XKCA 5IP9J 2VT3A 3FHZA 3FXMA 1K83J 3BTJA 5LLQA 3LAPA 3SEQA 4A0YA 4KMFA 3DPJA 4BJ5C 3ZRGA 3WGIA 2F48A 4NC7A 5IYDJ 2O9LA 1SVMA 3OV8A 3QWLA 4Q48A 2MA3A 4YZEA 3K4BA 2D5VA 3HXLA 1N25A 3PNTA 3TO9A 2VXDA 3QU3A 3HOTA 2D2WA 4P55A 3FZVA 3E7QA 2QWWA 3VYRB 4HF2A 1ZAOA 4Y7NJ 2HPIA 4F52A 2RREA 1HW1A 4FE7A 3LSIA 1QPIA 4A3LJ 1LDJA 1XPXA 1X1CA 1FBSA 2DDBA 2HEOA 2CUJA 4BY1J 4RMNA 1D0YA 2CQQA 4M74A 2EPFA 4QWQA 3KP2A 1GVDA 2V1NA 2F6CA 2Z99A 1R5GA 5M5XJ 2BYVE 3DV8A 1X1DA 1LE8B 5K7ZA 5EEHA 2JUCA 2IJLA 4AM3A 4IHWA 3LAJA 2MH2A 1U5TB 3HIFA 1FOWA 4M3FA 1WCMJ 3U9GA 2DXIA 3GF2A 1W7PB 1PDNC 4ANJA 1YOVB 1V3FA 2K27A 5CXGA 4CHUA 5BS6A 4HNUA 2LDUA 4LD5A 1FJLA 2UXOA 2PZ9A 2DOFA 3BQZA 1ETWA 2EWNA 2K85A 2WB1A 4E7ZA 3MKYB 2IRFG 2HOSA 2DN0A 3CDHA 1EA3A 4U0VA 3S2DJ 2R7XA 3MCZA 4DZPA 1B72B 2ESNA 3S16J 1IDYA 2DPUA 2KJBA 3KP6A 4QLCU 1Y39A 3UKGA 1HC8A 3R4KA 5FMPA 4ZYDA 3SQNA 5FD5A 2K3PA 4AC0A 1Z7LA 5EJCA 5DTDA 3ZOBA 1O7FA 3KLNA 4EM1A 1W5SA 4D1QA 1I39A 4JP0A 3CJQB 2RNGA 2CW7A 2P0WA 1OR7C 3CCJI 1IXRC 4U7BA 3NAUA 4BHCA 5J8FA 1GXQA 1S7AA 1KU3A 2M8EA 3B6CA 4ESJA 3FISA 5JLWA 2F2EA 4S0HB 2QLZA 4HG2A 2P7CB 1JGSA 2DMNA 1PJRA 5GTIC 3SZGA 1QBJA 2E71A 5IYCJ 2BY2A 4CCKA 2EFOA 1K78B 2KRCA 2G7HA 2JPBA 2Z5UA 3OS1A 5CVIA 5HDNA 4G7OF 1D1AA 2K5CA 3HZJA 3W6KB 2ZY9A 3HRMA 4XM3A 1FSEA 4LLLA 3VW2A 3IAM2 1IO2A 3PSIA 2CUZA 4XKVA 3CP2A 2D45A 3J81Z 3MMYB 2PJRB 2QSHX 1ETQA 3U1DA 1SAXA 1VF9A 2TRTA 3OOPA 4OOIA 3GEZA 2M4KA 5FFZA 2ZBKA 1UG0A 2L4AA 4JKZA 2EZLA 1ACIA 2HR3A 3AG1H 1WJEA 2G7UA 1UI6A 4EVIA 3O2PE 4O5VA 4FHTA 4L9JA 5JI6A 2XROA 1IV6A 3QBMA 1J75A 5FRNA 4A93J 1DPUA 2L7KA 3HTUA 2VQLA 4I76A 4B8XA 2L7FP 3OYMA 1KU9A 1R5ID 4CCOA 3W2WA 4E7KA 3TW7A 4BXXJ 4JX5A 1ZLJA 5DM7F 4E7SA 2KDZA 1HLVA 4LG0B 1WH7A 4CH7A 1FY7A 1X1BA 2V9KA 1VTNC 3RD3A 1S7EA 2GM4A 2R5YB 1LDKB 1USSA 3MKLA 4KN4X 1ETYA 2L9RA 1VQ7I 5LGTA 4LK1F 5FJ8J 4IHSA 3KYDB 3PFYA 2XV4S 3QOPA 1X2MA 2E2JJ 2R7ZJ 1ZGWA 1IRZA 5E79C 3C2HA 2XIGA 5KNLA 3OR1C 2VOOA 1QZZA 1FIAA 1S9HA 1NTCA 4FASD 4Q5SF 2DOEA 5HOOA 3E97A 3T8TA 1BN5A 1X4OA 3GZ5A 2MABA 5E3MA 3S2WA 2QTQA 2JRTA 1TWFJ 2IA1A 2O7OA 3KEQA 4DYRA 3MQ0A 4XRMA 1ZTRA 1WVRA 2PX9A 2WAEA 3QYBA 5TJJA 3T8RA 3H92A 4E70A 2FQ3A 3V6GA 2XGEA 3F8BA 2REKA 1BR1A 3FK6A 5AIQA 5FKOA 2L0KA 3B81A 3QKXA 2UUZA 3HBLA 3RKWA 1HF0A 2YPRA 3ABKH 3T5XA 1FZPB 2XB0X 2ZFWA 5C3EJ 1D1BA 2VB6A 3GFJA 4EJOA 1MNDA 2DYSH 3FIWA 2M8GX 4M3BA 5BPDA 3PNYA 4ETSA 1SD5A 5LBQA 3CCVI 1XDSA 2R7FA 2M0CA 2FX0A 5F0HA 3IRRA 1H9TA 2QKOA 2NVXJ 2XPWA 2XSDC 3PUFA 5FGLA 1LVAA 1TL8A 3OIPA 2E19A 2L7ZA 3COLA 1OYIA 1QU3A 4R8HA 4UVCA 2CQXA 3GTMJ 3KYLA 5E3NA 1R00A 5H6RA 4DW6A 2EBIA 1NH3A 4V2FA 3CCRI 2KLOA 1ORKA 3LNQA 1UB9A 2M2EA 4UV9A 1MDMB 4D9JA 6PAXA 3K1NA 3RYPA 3HE0A 1SANA 1JUMA 3DLLF 3TEDA 2CRGA 3RSNA 1VQ8I 5HAWA 2MD5A 5EEGA 2AXTC 5DDGA 1VQPI 1B8IA 2I10A 2CMPA 3W6VA 1XC5A 5J47A 3CRJA 3BG7A 1LEBA 4MNUA 1HCRA 2HQ5A 4XICA 2NP3A 5ICGA 1GHCA 3DBRB 1TQMA 1YW8A 3LMMA 3PFIA 4BXFA 4HLYA 5D5UB 1YI2I 5D4SA 1ZG5A 1WFXA 2O61A 3H3UA 4OD5A 1R7JA 2W84A 4ENKA 4LFUA 1OCPA 2Y9ZA 1XMKA 1IXSB 1X2NA 5LD2C 3CCLI 4A3DJ 4XSZF 5LRRA 3ZQFA 1G3YA 3K4MA 1AHDP 1UFMA 4GGGA 3Q5FA 1H88C 1MMGA 3GTJJ 2LOOA 2XKOA 2KPMA 2JSPA 2LLKA 3F8NA 5CKTA 3FXJA 3ASNH 5L3FA 2R92J 3I55I 5A2QK 4KISA 2X51A 3HG9A 1VQNI 3H0DA 1XX5A 1BC8C 2ZXWH 2JK3A 3Q3SA 2H8RA 1S3JA 4IEJA 1O4XA 4HV5A 2ETHA 3VIBA 4EMSA 4JNNA 1Z05A 1B9MA 1FYLA 5TGTA 5FROA 1REPC 3KLOA 1HW5A 3OL3A 3A1YA 1R22A 2Y69H 2HKXA 1POGA 3FXOA 3K4NA 3HOYJ 4M6YA 4BHBA 1YJWI 2HGCA 3ABLH 4ZZDA 5B5EC 5HVQC 5DD8A 1NHAA 2K4BA 5ICEA 2F4IA 3L2UA 5J40A 2VASA 2VXZA 2FSWA 2ISYA 2Y9YA 5E20A 1RRJA 2FNPA 1E3HA 4LIUA 2IAIA 2NYXA 2WTEA 1BR4A 1BIBA 3HRUA 2GIZA 1T38A 4N9HA 2JA8J 1RESA 1TNTA 1YRNA 1AA7A 3WU1B 2EQRA 2E7XA 2NOJB 1PP7U 3F6VA 3Q0UA 2Q2EA 3EGQA 1IN6A 3OYEA 1A31A 1WZ2A 4CSWA 3HSRA 1PUFA 2VBWA 2Y0MA 4ZYEA 1R1UA 3CMYA 1L3LA 3S15J 5E8IA 5GAHJ 3CD6I 4F91B 1RNLA 1TP4A 3SEZA 2ZCMA 1E17A 2CQKA 3S14J 1QA6A 2GIVA 1FWZA 4NELA 3CCEI 4S04A 4KT5C 1OCTC 1ETOA 1AOYA 4LJZF 5FRMA 2WV1A 2W24A 3J7AO 3CESA 2O7TA 4EGZA 2ZCNA 1W5TA 3LSJA 2H6CA 2HDDA 4OWRB 4FISA 4D7NA 1R23A 5CVJA 3O8GA 3BG6A 1O3TA 2YSRA 3LSKA 4L9VA 2M1BA 3ZMUA 2VKDA 2DO7A 4NHJA 4MGRA 4OINF 2JQ7A 5LRSA 4I99C 3WHBA 2E2HJ 2PMUA 3S1RJ 3BR1A 3DBLB 3IP4B 5F0CA 2OCEA 2R5YA 3I64A 4M3DA 3KP5A 2KFDA 2TDXA 2XF6A 2BZTA 3RPQA 1QPMA 2CV1A 4M71A 3ANGA 4U87A 3NXCA 2BE5F 2VIXA 4QIWN 1AKHB 3BR0A 2VE8A 2Z9OA 3GCMA 3Q9VA 5IT9K 1D0ZA 2PG4A 3OSGA 3E6DA 1TQPA 2HYTA 5DCMB 3K70D 2DFIA 3L2WA 2LH9A 3S1NJ 3NWSA 2UXIA 3FBNB 3LL7A 2J5OA 4PZJA 2LYCA 2LG4A 4OD4A 3TOAA 3BZKA 5J1RA 2W53A 4KICA 5LEKA 3OYNA 3ECOA 2ZO4A 1YHQI 4BXUA 4HLXA 3FKIJ 3IUOA 2M0MA 4ACIA 3BJBA 3AL0B 2KIUA 4A3JJ 2CUFA 1OPCA 3RQ4A 2HVSA 3CJDA 3VUQA 4IQJA 3LSMA 2CJJA 2UV1A 3LSHA 1RZ4A 1U78A 1F1ZA 2C6YA 2QGUA 5GTHC 4KYWA 3PQKA 3ON2A 4BHPA 1D8JA 3SXYA 1R36A 2X85A 3IKTA 3C07A 3O60A 4CUGA 3DF8A 3GXOA 3K1MA 2I8DA 4RGUA 2XC7A 3OYBA 4LLNA 3KZZA 3VOKA 2EA2A 4MO7A 1T8IA 1W0UA 1GV5A 2CQNA 1B72A 2FJ1A 5M3FJ 3WTZA 3VODA 1YRNB 4RB1A 2PBXA 2DYRH 2K9SA 2QQ9A 3QP5A 1FOYA 1TNSA 4XLEA 3OYKA 4IVNA 4BE0A 4C2TA 2OAZA 4XN0A 2JN6A 3K6GA 2D6YA 1V55H 3VOXA 2CU7A 2XAUA 4L9TA 4IO9F 3SFZA 4AUXA 4GCLA 3M3YJ 2MFZA 5F0FA 1ZARA 2ZMEA 5C44J 3GTQJ 1Q1VA 2XHKA 2ZCXA 2PMZN 1IAWA 3CLOA 3OL4A 3Q0VA 4HEA2 4Q47A 3F22A 2IEKA 1BW5A 1MZBA 2WA0A 3K69A 3PIOF 1G3SA 1VFCA 2UWMA 4FCYA 1U6GA 1Y0UA 1ZHFA 1KU2A 2F5DA 3OR2C 5HS8A 3HOZJ 4I98B 4IQ4A 3MFKA 1T39A 5C4JJ 2ZFUA 1OCZH 2IGMA 3ONQA 4BEHB 3AG3H 2DFEA 2KRFA 2ZJRF 2EFPA 1HA8A 5D19A 4ZTJA 3R60A 3DTEA 2BEOA 3N05A 2F07A 2WAQA 3J80K 2FMLA 2A69F 1T98A 2MC3A 2QBYB 2X1EA 2I5UA 4NQWA 4BJTA 3O6BB 2JMWA 3V42A 2K9QA 3CZ6A 1HDDC 1OKRA 4XLPF 4F3QA 3CCUI 1Z9CA 1WSUA 3LQQA 1YE9A 1YS7A 2QA4I 2D1HA 1ZH5A 2K9MA 3KFWX 3BT9A 5K58A 1Y1VJ 4ENJA 3EUPA 4B09A 5H2FC 2K9LA 1YG2A 1GUUA 3CUQA 4GDFA 2NVYJ 3L2VA 4JX6A 4YEJA 1HKQA 2OJED 4DOZA 3JSJA 2E5ZA 3WGHA 3ZR8X 4U7DA 1FIPA 4QPQA 1XTAA 5D8KB 2ACJA 4MLOA 4IHTA 1XD7A 2HYGD 1G3TA 1IZ1A 1YJNI 2EZIA 2RHAA 1H89C 3BR5A 2R7TA 1RKWA 2M4GA 3S2HJ 2Y30A 2G7LA 2DLLA 5HS9A 2IGKA 3GYHX 2XAFA 2AQEA 4M3GA 3HKZA 2NOGA 3K10A 1OQYA 4NBQA 3AL0C 2KDOA 3HSFA 4OU0A 5AONA 2E2IJ 4FT8A 5M5YJ 1QVUA 3C7JA 3JRBA 3LSPA 3ZMSA 4L0ZB 4II2A 3ZQQA 3CMAI 1HKTA 3F8FA 2YX7A 2V79A 1OMIA 3SHFA 5LHHA 2LR8A 2WB1N 3ZN1A 3JR9A 3VDXA 2UXNA 4DJAA 4AD9A 2YS9A 1RR7A 1SFEA 3MN2A 4M9XA 4A0ZA 1K4TA 3G1OA 1HW2A 4XLCA 1JI8A 4XK4A 3K7AJ 4EJUA 2A3SA 5C4YA 1YQAA 3OIOA 3F6OA 3JREA 2YUSA 4JX4A 3BR2A 5BPIA 2IU5A 1BBYA 1FOXA 4IPAA 2CO5A 1VQOI 2VBXA 1W7PA 4FETA 3PO3J 3ZCOA 2O03A 4H4KC 2K40A 4PJJA 1MH3A 2DOAA 1MSFC 1WH5A 4MQVA 1O3RA 1FOKA 3C3WA 2EIKH 2CSOA 2IT0A 1X19A 3MVPA 2LMDA 3TL4X 3HHHA 1ZR4A 4DYCA 1WGXA 3PUBA 2F5EA 3VYTB 3HRSA 1H9GA 2D1VA 5HS7A 5HDGA 2QEXI 4XIDA 2M9HA 2XAJA 3WTTC 5EGOB 5E18F 5M3MJ 3GVAA 3BQYA 4PJNA 3L2RA 2IPQX 3F8MA 2DFFA 3IUVA 2LP0A 1SGMA 5CXIA 1O3QA 2QQBA 4KIBA 4KIFA 2HTJA 2PLYA 4I02A 5C4XJ 4GCKA 1LEAA 3I71A 4K2EA 1ULYA 2NS8A 1BJZA 3GLXA 2CFXA 4HQEA 1XSVA 5BOXA 1JE8A 3CCQI 3LSGA 3AG4H 1SVOA 4D5CA 3OS0A 4PSWA 4KWAA 3DU6A 1B8IB 5DUIA 2NS0A 4QPOA 3GWZA 2DTZA 2EA4A 3VYUB 2FF4A 3OS2A 4ESBA 3EYIA 3G1LA 1YIJI 1RETA 3IH2A 1TBXA 1P4XA 1Z77A 1QZEA 5F27A 5ICCA 3WGGA 4RAZA 3VEPA 4HBLA 2WC2A 1K61A 1Z3YA 4UVAA 2KIQA 2IS2A 3RZDJ 3G73A 3I56I 2RC4A 3PL8A 4DIQA 4ESFA 1RI7A 4CCNA 2X6WA 4P9UA 1UMQA 4XR6A 2QZ8A 1STZA 1A6IA 1ZYRF 2M45A 5JLXA 2CH0A 2JWTA 1U9NA 3BTLA 2KL4A 2RV8A 3KETA 1YFHA 3B73A 2IVMA 3ZQGA 5L3EA 2ECCA 2DW4A 3GZ6A 1R4MB 4DQ2A 1ON2A 3IHUA 4D5FA 2A6EF 1TTYA 2W4SA 4EJWA 1F5TA 4KFCA 2PQ8A 4ZTFA 3TP0A 2DA2A 1V5FA 5KCMA 3OYDA 1OCRH 3HIMA 5DCFA 2F5CA 4B4CA 3V8JA 2ELJA 2XKPA 2H09A 4YRVA 3AFHA 3H36A 5E17F 1JHFA 2PEXA 3FBIB 1U9OA 2WAQN 3DPLC 3HYIA 2V1DA 2XGDA 1SMYF 3M4OJ 4MFDA 5DD4A 3E6MA 3EUAA 2Z33A 4IX7A 1A35A 2H27A 2EK5A 4A3IJ 1F43A 3PASA 3I4MJ 5CQGA 1P7JA 5IT3A 3KX2A 2GFNA 4E7IA 2Y0SN 3HC7A 3RZOJ 1FYMA 2B9SA 2E1MC 4A2UA 3CUQB 4UUVA 2PBIA 2VI6A 3G3ZA 2CW8A 3IKVA 3LFKA 4AVPA 3CF2A 1ZELA 1BOBA 2BV6A 2YU9J 4ABZA 2UXXA 4B44A 5D4RA 2BHYA 2L5QA 4RGSA 3DQVC 3D5RC 4C2MJ 2Z1DA 1FLIA 2DMQA 3BWGA 2ZJ2A 2MGQA 3AKZA 2RGVA 1R1VA 1DQUA 1GT0C 2VKVA 3HTAA 3AQSA 2P5LC 2XASA 1BA5A 3IC7A 3VW1A 1MMDA 5E1XA 3D0SA 2E35A 3M07A 5IOZA 3F1BA 3FXLA 1VQ5I 1DU0A 3L00A 1WPKA 1GLNA 5M5WJ 5H9TA 4YELA 2EV5A 2Y2ZA 4HSTA 3WE2A 2GBYA 4KUMA 4AF5A 4HQMA 5K7HA 2HFHA 4UB6C 2E34A 1BI3A 4I09A 3C18A 5TRDA 4LB6B 5EDNA 3GTOJ 2OPTA 2V9VA 3M9AA 2BXZA 2ICWG 2IS1A 1HXDA 1QZYA 4HOBA 3LA7A 4OMZA 1JJ8C 3KP4A 4F7ZA 1R1TA 4RAGA 5FKNA 3NI7A 3LA2A 3CO6C 3E6CC 2H1KA 1FEXA 2VLAA 1DP7P 4XLAA 2BW3B 1WJAA 2XAHA 5AIPA 1MBEA 3DLAA 3P7NA 3DXJF 3DBHB 4A3EJ 3B6AA 2RVCA 4G9YA 1QRYA 1Z3XA 2BBYA 4N4OB 5CLSA 4C2MA 3CCSI 1BW6A 1SEUA 3VWBA 1JUPA 1Z67A 2KRHA 2W25A 1SAUA 2MW8A 1QGPA 1T33A 3G7RA 3JCUC 2FOWA 5LHGA 3I4NJ 2BVMA 3SFIA 4HRIA 3W2VA 2PN6A 4IRIA 3JW4A 2F4MB 3EUHA 2QIBA 1TWCJ 3ZPLA 2O0YA 2XAQA 1VQLI 2DG8A 1X58A 3FK7A 1IRGA 2R4GA 2ZNYA 5JHFA 3F23A 4BNCA 3CCMI 4DGWB 3HTHA 3FXKA 3GUDA 3HOXJ 3K4LA 4EV0A 4BE2A 1R6RA 4UXNA 1IJWC 2Y75A 1FMWA 4GO1A 5F6FA 1HSTA 3DCFA 4BBRJ 4AIHA 3ECHA 2B7EA 2J5PA 2XPVA 1VZ0A 2O3FA 2AO9A 1XCBA 2R7QA 4PFOA 2Y31A 4BQQA 1B59A 3RTRA 3OYAA 3E7LA 4WXDA 1I6XA 5B3SH 3S32A 3FF5A 2VODA 4KNYA 3HUGB 3L2CA 2LBFA 1OFCX 2JPCA 1HSJA 1S7OA 2X48A 3HM5A 2KZGA 1Y6IA 3BPXA 1V5GA 4BGDA 4IF4A 2WAFA 4E7LA 1HDPA 2Z3YA 4CGZA 3W2AA 3QQAA 1JHHA 1EV7A 3VVXA 3WTWC 5IP7J 2RDPA 2DT7B 2OQGA 3TMOA 5FB2A 3TP3A 3KCCA 4CZCA 4O6JA 3DEUA 2R7OA 4EM2A 4A3CJ 2E1MB 4C3IJ 4PGGA 5EYRA 3BG5A 2NVTJ 3ULQB 2UZKA 4Y52J 3VVYA 3CMEI 3T6NA 1MKMA 3OSFA 3VSKA 3CC7I 1JUSA 2DAOA 2GA1A 3BLYA 4X1EA 1S8NA 4YFXF 3ZMZA 5JR3A 3ZQIA 4B3AA 3MKWB 4IHVA 2ZMEB 2ZOYA 3HEFA 5HODA 4UNOA 2BY1A 3FMSA 4M9ZA 4ZYGA 5J3LA 3ERMA 2FE3A 3U2RA 4BQAA 1B1BA 2HQNA 3MZYA 1XMXA 5H20A 4EJTA 3LWFA 2HXOA 3RPUD 2HWVA 4B48A 1UG2A 1G4DA 1WQ2A 2B3WA 2ZXHA 5J1YA 3DTIA 1U3EM 2EZHA 3JSPA 3GFIA 1O7LA 1XB4A 2YVHA 1FYKA 1U8BA 4G6DA 4AYBA 4AU7A 3CO7C 4J00A 3FRQA 5K7FA 1X3UA 1SFXA 3SDGA 4P5OA 5AQCA 4JL3A 5E3LA 2V4JC 3M8EA 2JT1A 2WWYA 4C30A 2DBBA 4J19A 4IKFA 3CC4I 2EILH 4NC6A 1EH6A 1TZLA 3G56A 3CDLA 3MAJA 2VJ4A 2OI8A 1X4PA 2Y0SA 2GZWA 2CWEA 4LMYA 1SFOJ 3TBIA 4AYBN 1IUYA 1H8AC 4XORA 1I3AA 3WTVC 3G2BA 1BI1A 3GZIA 3BG3A 3B02A 4MHGA 3QYFA 3VOEA 4ZDPA 4PJLA 3LSTA 1XSDA 1JXSA 5BNGA 1MIJA 1ZK8A 4P96A 5CVVA 5FGMA 5KAIC 3H3VK 4JBAA 1VQ9I 1W1WE 1KYWA 1TWGJ 2PMHA 2X4HA 3WODF 5D5WB 2EFNA 5DS9A 2CYYA 3CUQC 2K02A 3D1NI 2CV2A 3HDDA 2A5YB 3JTGA 3F0CA 4XOPA 1MBFA 4HV6A 2P5KA 2A6TA 2P8TA 1V54H 2JZYA 3WTSC 2L7MP 1FX7A 3V8LA 3FKJA 4EQQA 2OC6A 3PSFA 3SWHA 5FD6A 4Z6YA 4P9FA 4M6XA 4PJ0C 1XGNA 4D0PA 2ISZA 5EF6A 2GQQA 4PXIA 2F5FA 1MJ9A 3QPHA 4XSXF 5GPCA 5FLXZ 2L3DA 4Y15A 1J5YA 3SDBA 3Q9SA 3BTIA 3LWJA 1LVKA 3OYJA 3DFGA 5GAGJ 2LFBA 2K7LA 1YIOA 1TW2A 2GWRA 3RDIA 2LKSA 4KITB 4WX9A 1C0WA 3PJRA 4RGRA 1ODDA 4XONA 3RYRA 4YFNF 1ZG1A 3NEUA 1IG7A 4GFLA 2PMZA 2LC2A 2HZTA 5FFXA 3MZ8A 1JKOC 1GVJA 4RB2C 2KKOA 2L02A 3A0BC 2LVSA 3IWZA 5ERIA 3M7GA 4CZZA 3J7ZI 3HGYA 5F1JA 2HOTA 4U0YA 3S8PA 2M87A 5L3CA 4JQFA 2XRLA 2QQ8A 2R7DA 2DJNA 3FWEA 4G6TB 3M1CA 1XSXA 2Q8KA 3JRFA 2VE9A 1G6NA 1KYZA 1G3WA 3V7RA 1Z6RA 3WTUC 2VN2A 4YFKF 4I01A 3ABUA 1KGSA 4O3MA 4YIIA 5L3GA 1ZLKA 2FD5A 3RJPA 3HRTA 4EGYA 3ABTA 1JKQC 5D18A 1WJDA 3V4GA 2YVXA 4EJVA 3F3XA 2H6BA 1W36C 3OYCA 3S3MA 2OCCH 1RPWA 5J8CA 3KE2A 2PJRA 1I27A 4KN7X 4RLQA 2NAZA 2WV0A 1UCRA 1OCOH 1U5TA 2JA2A 2P5VA 2ZSIB 4J01A 4N0BA 1W0TA 1ZN2A 2GXAA 1Z1DA 4RS8A 3GFMA 1E3PA 4U88A 1Z0XA 3RIRA 4WWCA 2BHZA 3H0GJ 1NK3P 4GFKA 4WCGA 4BE1A 2QBYA 3CJRB 4RAYA 4DBQA 5H6QA 4MXMA 5DM6F 4A3FJ 2LKXA 5FLXK 4V2GA 2VQGA 4PJMA 4DZJA 1RKTA 4U9LA 3NS4A 1UELB 5ED4A 2KT0A 2EFWA 1IN8A 3KPHA 1IV8A 5EFYA 4BUPA 2QF7A 4OIQF 3WU0A 4ZDOA 1N77A 2V6CA 3JRCA 5LEJA 3K2AA 1LQ1A 3HKZN 1N75A 1O57A 3DWLE 1WWXA 2NRAC 1P7IA 4ZZLA 1JKPC 4MTEA 4MTDA 1CQTA 1K7AA 2OBPA 3NARA 1L0OC 2K4JA 3OIQA 1T08B 4A3BJ 3J80Z 3GLLA 3QPLA 4FQGA 3TKYA 3H5AA 3KYCB 5D5VB 5D1RA 1ZREA 1MMNA 2VKHA 2HTSA 3H5RA 3DKYA 3FXUA 1FC3A 3KP3A 5EZGA 3ZMDA 2BVLA 4XBFA 3P9KA 5CJ9A 3BCGA 5F08A 1LE8A 4W1UA 3CWRA 3ANPA 1OYWA 1SD4A 4GYIA 1KQ9A 2TCTA 1XGSA 2B0LA 3K4JA 2QSFX 3ASOH 4OMYA 4HDVA 1KU7A 3I58A 4Y13A 3PPBA 3F9KA 2HZDA 5BQTA 3DKWA 1WRJA 4L5IA 4UUTA 4AWXB 1H0MA 1QHHD 1OYYA 2X1CA 3IL2A 2V9PA 2EJRA 3I5UA 3GTLJ 3JTHA 2CFOA 2X6XA 3GFLA 4PFPA 3OYFA 4E6KG 4QTRA 2LY1A 4IXAA 4X0GA 3S3NA 1DPRA 3DU5A 1R71A 2JA5J 3TOBA 3BHQA 2IW5A 3BPVA 4L18B 1FTTA 4IOAF 4CCJA 2H8WA 5HBUA 4DVYP 1G8XA 3BJOA 2VOPA 1MMAA 4N9IA 3GX4X 5IOYA 1ETXA 1JT0A 3F8CA 2W85A 3A01B 2QM3A 2DA1A 3OY9A 2ESHA 1BJAA 2HU9A 2ELKA 4XKWA 4N4NB 2OZUA 2QCOA 2YR2A 1CF7A 1MBJA 1XN7A 3VTIA 3JAMK 5HLIA 1WJBA 2E7WA 1X1AA 3R0AA 1Z7UA 3ZN0A 1MDMA 2P7VB 4XKBA 3EYYA 2FUG2 4NNJA 2P81A 5E3OA 1K6OA 4ME9A 1MW7A 2F5VA 2OV7A 3HPGA 4A3KJ 3PO2J 1B6AA 3I54A 2MSYA 1DDNA 2UXUA 2HDCA 1E0EA 1OCCH 4A12A 3JRAA 4II3A 1RIOH 3C2GA 4GXOA 3CQZJ 5GP9A 1D0XA 2IS6A 3MWMA 1R4NB 2R5ZB 5ILVA 2M3AA 3CDIA 1DUXC 1T0FA 1XMAA 3MEXA 2QSGX 2CW0F 4A0XA 3BP8A 2V1UA 4FX4A 4GYGA 3QPTA 1SC7A 3BZCA 3FXRA 2GOMA 5EZHA 4BL0B 3OYHA 2FA5A 5GPAA 1T2KA 2NNYA 1CGPA 1LFPA 2GOXB 2A05A 2OU2A 4L5JA 4NUBA 2JRMA 4G94A 1T95A 2HVQA 4WXHA 3BR6A 2R7RA 1IGNA 3V78A 2ADUA 3MNLA 2X9DA 3RKXA 4OAYA 1EJ9A 1J59A 4IL6C 3T0YA 1W36D 3ISPA 5A2QZ 2RKHA 1F36A 1X3ZB 2AQFA 3A02A 4I0AA 4YIRX 3JRGA 3BNIA 2FRHA 3EUHC 2GAUA 4AVZA 1ZR2A 4BDZA 2XGXA 1IRFA 1ZGAA 1M1EB 3U21A 1WI9A 1WKMA 2VJ5A 4L0YB 2DG7A 1MNEA 3R6SA 3FXQA 1X1PA 1NK2P 3EETA 1I5ZA 3E5UA 3REOA 1UJ8A 3OYGA 5ICFA 4IHXA 2B63J 2R5ZA 1SD6A 1YLFA 3N97A 5CYVA 4NN1A 2VL8A 3CC2I 2E5NA 4CYDA 3CMMA 2H94A 3VVZA 1S6LA 5J4YA 4GFBA 3QRFF 4AIDA 1J9IA 2DQLA 3TW6A 4BH9A 3ZP5A 3CLQA 1EH7A 1MBKA 3EQLF 4BQNA 3CTAA 2L01A 4F55A 3HTIA 2EV6A 2VC0A 4RAFA 5ILSA 4IRHA 1A36A 3OWTA 4Z2YA 4RM3A 4TV7A 4IRVA 4XMYA 3LOCA 1RUNA 3BJAA 3LHQA 3ZMVA 1N78A 2CS3A 5EEAA 4BAYA 4ENNA 2FEZA 4JYKA 2KHMA 2A5WA 3ON4A 4WK8F 2VQHA 3H9GA 2DA5A 3TO7A 1HBXG 2VPRA 3S1MJ 1IC8A 2F4OB 4MIMA 3L9FA 3F21A 3K8PC 4M73A 1DP3A 3H35A 2XF5A 3HGGA 3IV5A 2BY0A 5GADJ 3DEEA 3RKYA 2EB7A 4BJ6C 1ETVA 2ZSHB 3BDDA 3K4CA 4RB0A 3E1SA 5J4VA 2LK2A 3ELKA 3P9IA 3ZQ7A 2DPDA 2M7BA 1PVEA 1A04A 1YW7A 4UUSB 2LD5A 3K4KA 4V19K 3WU2C 2E1CA 2GXBA 5CVRA 5J6XA 2L4MA 5ILUA 2Q2EB 2K86A 2M34A 2VBZA 4A6EA 1U8RA 2JVGA 1E2XA 2HOAA 2BY3A 4PSXA 4XRSA 3W6JB 4CDGA 3ZQCA 4XRSG 1HQCA 1XGOA 2EH3A 5IPAA 2QENA 1XCVA 2XDVA 3M8JA 4ZYHA 1FP2A 3BROA 2Z16A 3BY6A 3BCAA 3RH2A 2YX4A 3OYLA 3E5XA 1ETKA 2MC4A 3G6EI 1V5EA 4R1HA 3P9CA 2RAEA 3RCOA 4BU2A 2G7GA 3DTKA 2V57A 1QQIA 4FX0A 1G59A 3J7AY 2W48A 2V6EA 2HYJA 3H5NA 4ICHA 4G12A 3V7SA 1Z91A 1XG1A 2W1OA 2HNHA 4H0EA 4IHYA 3IH3A 4U0WA 4NQWB 1PUFB 1ERDA 2LY9A 1P2FA 1IN4A 3GTPJ 2FBKA 2BW3A 2IP2A 2DT6A 2DT5A 2IGOA 3HB9A 1ZRCA 2EFQA 1FSHA 1R9TJ 3PQJA 3DPUA 2MLGA 3JAMZ 1LFBA 1IDZA 3WG7H 2BXYA 3G71I 2G7SA 2ZB9A 1SVLA 3QODA 2M5WA 3SYTA 2WBMA 3IH4A 4M3EA 2STTA 4P1WA 3A4CA 4I7HA 4C3JJ 1QHGA 1ZQ3P 2G0EA 3ERED 2X6YA 3V8KA 4EEFG 4IZZA 1ON1A 2DI3A 4YIFA 2FOKA 4M72A 5K1YA 3VSLA 3BC8A 2CV0A 2NVQJ 2JVHA 1TWAJ 2IS4A 5BMZA 2DODA 2OZ6A 3K1PA 1Y0NA 2MLKA 2R3SA 5HNFA 4HX7A 5E8GA 3D5LA 3FX3A 1RC9A 4LB5A 3FHNA 1UI5A 2HXIA 2DMTA 3BR3A 2WY8Q 2NS7A 2HQAA 5B1BH 2W7NA 5HLGA 1OLTA 5K5OA 1X3WB 4RLFA 2E1NA 2RQPA 4RGXA 1GV2A 3HUGA 2VJIA 3BRUA 4NC8A 3EUKL 1AKHA 1FT9A 5CPRB 3J81K 1MD0A 2O8XA 1HKSA 1ZGJA 2IBDA 3LQRA 4EATA 1FTZA 4HF1A 1SD7A 3FDYA 2E60A 2ELHA 3FMRA 4CGRA 5KHDA 2DTRA 3VYSB 1Y1WJ 2EINH 4L62A 2FBHA 3WTXC 1WJFA 1VQ4I 3KNWA 4PCQA 2DA7A 4I2OA 4HKUA 2LF8A 1T0FC 4LOCA 2DA6A 4CCLA 1QVTA 2LBFB 3COAC 1VQ6I 1LKXA 1BOAA 2EIJH 3ZQLA 3HPHA 5HNHA 4GRIA 2V26A 5F64A 3SZPA 5GAEJ 3SZTA 1AWCA 1G2HA 4BY7J 3BZ6A 1JTXA 3F72A 2R7WA 1P92A 1IUFA 2K9NA 2Q24A 4BQOA 1OR7A 2HKUA 1Z6TA 3HL2A 1LDDA 4L9NA 1I1GA 3PM1A 3G4SI 3M1EA 4UB8C 1IF1A 2JA7J 2DK5A 4LIVA 1SFUA 1DU6A 4E7JA 1KQ8A 1ITYA 4AC6A 3T1BA 2B1EA 3K0LA 3G1MA 3NRGA 1BR2A 4WIBA 2VUMJ 3ML6A 3P9TA 3KKDA 1J09A 2GUHA 2ZNZA 3X2QH 1FPQA 5B66C 2EV0A 1I6HJ 3C2BA 2ID3A 4UV8A 5L3DA 2W57A 2ZJPF 3LA3A 3R0JA 1Y8QB 4IJAA 2BGCA 4MFEA 5IP6A 2DMUA 2G9WA 5DCMA 2H1LA 1JT6A 4W97A 2YVEA 2JUGA 4A3MJ 1ENHA 1W5CC 3ABMH 4KA4A 1D1CA 2OQRA 3EDPA 3GBGA 5E1WA 5KK1A 3RPUA 3ROUA 2OD5A 3JRHA 2LTPA 1QNTA 4CXFA 2KP6A 2E36A 3S17J 4DNCA 3OMYA 2CQ7A 5CQEA 4LG3A 3MD2A 1BL0A 4NB5A 1UAAA 2WADA 3VFZA 3O3KA 1MGTA 3PNVA 1USTA 4EM0B 5FHPA 3DEWA 2AHQA 4ZH4F 3IWFA 1VQMI 2HVRA 5LHIA 1ZG3A 2X1DA 2AXLA 3VB2A 4G6QA 2ZXJA 2MD0A 2A61A 2NVUB 1GDTA 2GA2A 4WF2A 3I0TA 2OA4A 1IRXA 3WG9A 1FMVA 4IOCF 2QUFA 2NNNA 1TLHB 3JSOA 4KJZA 4XLNF 1WJCA 3C1DA 2RQQA 2OTLI 3LSRA 4KT6A 2O5RA 3KZIC 1BC7C 1EKEA 1IN5A 2O8KA 3J7YJ 1V4RA 3N4MA 2FQ4A 1OISA 2LSOA 1TC3C 5CW8A 2KZVA 1CF7B 3GO5A 4XRFA 5CVUA 1FBQA 5LFAA 1Y56A 2JTVA 2ZC2A 2LNBA 3H1CA 3KEYA 5L3BA 5D6EA 1TT0A 2VBYA 2NP5A 3A01A 1D5YA 4HA8A 2G3BA 2GLOA 2DQRA 3I59A 3HOWJ 1D3YA 1E3OC 5DYMA 4BS9A 2RASA 2KIMA 3A2KA 3A03A 4CCMA 2L2OA 2MH9A 2LF7A 4HZFA 1WI3A 2PI0A 3HOSA 1APLC 4UHTA 2MG4A
chains in the Genus database with same CATH topology
4I76A 2L7FP 4A3BJ 1ZR4A 3GEUA 4DYCA 1WGXA 3QPLA 4BXXJ 3TW7A 5D1RA 4JX5A 2KDZA 1HLVA 1WH7A 4XIDA 5F04A 3KZ9A 2ID6A 2M9HA 5EGOB 2JA6J 3RD3A 1S7EA 2GM4A 4CYCA 5EZGA 5FKKA 2R5YB 2QOPA 5M3MJ 3BQYA 3MKLA 1ETYA 2L9RA 3BCGA 5F08A 1LE8A 4W1UA 3CWRA 3IUVA 5FJ8J 2LP0A 1SGMA 3ANPA 5CXIA 1X2MA 2E2JJ 2R7ZJ 4DYQA 1ZGWA 1TWHJ 1IRZA 2TCTA 5C4XJ 5FLVA 4GCKA 5EG0B 2COBA 1FIAA 3PPBA 1NTCA 2NS8A 1BJZA 4UUTA 3NNRA 3LSGA 5FKMA 4D5CA 1JJ6C 3OOUA 5E3MA 3GTLJ 2QTQA 4KWAA 1B8IB 1TWFJ 1ZKGA 2O7OA 2DA4A 2DTZA 4DYRA 4QTRA 4XRMA 1ZTRA 3G1LA 1RETA 3IH2A 2JA5J 2UXHA 3BHQA 1FTTA 1Z77A 5HBUA 5F27A 3V6GA 2XGEA 2REKA 3FK6A 5FKOA 2ME6A 2L0KA 3B81A 1K61A 5IOYA 1ETXA 1JT0A 3QKXA 2ECBA 3RZDJ 3HBLA 1HF0A 3A01B 2XB0X 1JTYA 2UXPA 5C3EJ 2DA1A 2ELKA 5EGOA 3FIWA 4M3BA 2M8GX 3RKQA 4A69C 1UMQA 2QCOA 3ZQHA 1MBJA 1UHSA 1A6IA 2M0CA 2FX0A 5F0HA 5JLXA 2QKOA 2NVXJ 2JWTA 1U9NA 1OJLA 3BTLA 4BBSJ 2XPWA 3ZQGA 3VP5A 2ECCA 2XSDC 5E3OA 2P81A 5FGLA 4ME9A 2E19A 2L7ZA 9ANTA 3COLA 2VKEA 3RQIA 4D5FA 2CQXA 3GTMJ 4A3KJ 3PO2J 5E3NA 2MSYA 3TP0A 1I50J 2DA2A 3HIMA 4DW6A 4B4CA 2UXUA 2EBIA 2ME0A 4V2FA 1ORKA 3LNQA 3HE0A 2M2EA 3JRAA 4BKXA 1SANA 1JUMA 3CQZJ 5GP9A 3TEDA 1U9OA 1JKRC 2CRGA 2WAQN 3SJMA 2XGDA 5HAWA 2R5ZB 3M4OJ 4MFDA 3S1QJ 1HOMA 1B8IA 2I10A 3W6VA 1XC5A 4A3IJ 3CRJA 1F43A 3PASA 1HCRA 2HQ5A 4XICA 3I4MJ 2NP3A 1P7JA 2GFNA 5EZHA 2Y0SN 5GPAA 2OERA 3RZOJ 4UUSA 2DMPA 1EF4A 3VPRA 5IYBJ 2CUEA 2NX4A 2VI6A 2N8GA 1OCPA 3BR6A 2OF7A 2Y9ZA 1IGNA 1X2NA 3V78A 3MNLA 2X9DA 5HSZA 4A3DJ 2YU9J 4ABZA 3ZQFA 4M6VA 1AHDP 4NDLA 4C2MJ 2DMQA 3BG9A 1H88C 2MGQA 5FKLA 1F36A 1MBGA 2R93J 3A02A 4CYCB 3GTJJ 5FLMJ 3JRGA 1GT0C 3BNIA 2VKVA 1ZR2A 3HTJA 3HTAA 4FE4A 3AQSA 1BA5A 3VW1A 3BTCA 2LLKA 2DG7A 2X6OA 5IOZA 3F1BA 2ZOZA 1NK2P 1DU0A 2R92J 4I6ZA 1WPKA 5M5WJ 5H9TA 4IHXA 2JK3A 2Y2ZA 2B63J 2R5ZA 2GBYA 4AF5A 3Q3SA 2H8RA 4HNVA 5K7HA 4IEJA 1O4XA 4NN1A 3VIBA 4JNNA 5EDNA 3VVZA 3GTOJ 2OPTA 4GFBA 1T56A 2HI3A 1POGA 3HOYJ 3Q0WA 3GTGJ 2WGBA 3TW6A 1JJ8C 1MBKA 2DA3A 3HTIA 5FKNA 3NI7A 2H1KA 1FEXA 3LOCA 2E1OA 1MBEA 2Y9YA 4A3EJ 3B6AA 3LHQA 1QRYA 5EEAA 1BW6A 4JYKA 1JUPA 2IAIA 2XGCA 3ON4A 2MW8A 2JA8J 1T33A 2DA5A 3G7RA 1RESA 3I4NJ 2EZKA 2VPRA 3SFIA 2EQRA 1YRNA 3S1MJ 1IC8A 3Q0UA 3EGQA 4MIMA 3QPSA 4QSHA 3S5RA 1PUFA 3HGGA 3CCYA 3CMYA 3IV5A 2QIBA 1VNDA 3S15J 1ETVA 3VW0A 1TWCJ 4MK6A 2ZCMA 2LK2A 2DG8A 1X58A 3FK7A 1AU7A 3NPIA 3S14J 3O8HA 4NELA 3L1PA 3JRIA 4UUSB 2LD5A 4UDSA 1OCTC 1ETOA 3HTHA 2WV1A 2O7TA 3HOXJ 2M34A 2ZCNA 3LSJA 2HOAA 4XRSA 2HDDA 1IJWC 2FBQA 4FISA 3ZQCA 3DCFA 4XRSG 4BBRJ 4D7NA 2EH3A 5IPAA 4D7MA 3O8GA 3RH2A 2XPVA 3AQTA 2AO9A 1XS9A 4FTHA 2XDNA 2Y31A 1ETKA 3E7LA 2XPUA 1A5JA 2E2HJ 3WHBA 2RAEA 3BR1A 3S1RJ 4RBOA 5F0CA 1OFCX 2X48A 2QWTA 2R5YA 5J1UA 3HM5A 4M3DA 1MSEC 2G7GA 2V57A 2W48A 2HYJA 1HDPA 4ICHA 4G12A 1XG1A 3ANGA 4IHYA 3QQAA 3IH3A 3NXCA 1I3QJ 1PUFB 4L5EA 2LY9A 4QIWN 1AKHB 5IP7J 3VVXA 3BR0A 3GTPJ 3TP3A 2R0QC 5EG0A 3HB9A 1JGGA 1LFUP 4A3CJ 1R9TJ 4C3IJ 5EYRA 3BG5A 3OSGA 2NVTJ 2HYTA 1LFBA 4Y52J 1IDZA 3VVYA 3T6NA 2G7SA 2ZB9A 3OSFA 4C3HJ 4B1RA 3S1NJ 3KKCA 1JUSA 2UXIA 3IH4A 4M3EA 4X1EA 3ZQIA 4B3AA 4C3JJ 5J1RA 4IHVA 1ZQ3P 2GENA 2G0EA 3HOVJ 3HEFA 5HODA 2W53A 2ZOYA 4EEFG 3FKIJ 2JJ7A 5J3LA 3WHCA 4ACIA 3BJBA 1MH4A 4A3JJ 2CUFA 4RDUA 3LJLA 2NVQJ 5DAJA 1TWAJ 2HXOA 1UG2A 3CJDA 3VUQA 5J1YA 2CJJA 1MBHA 2EZHA 3JRDA 2YVHA 1U8BA 1U78A 1UI5A 2HXIA 2DMTA 3BR3A 3ON2A 3FRQA 2NS7A 2XB5A 3HOUJ 3O60A 3GTKJ 3C07A 5K7FA 1VI0A 3SDGA 4X6AJ 5AQCA 4JL3A 5E3LA 1GV2A 4A3GJ 3BRUA 4J19A 1AKHA 3VOKA 2WUIA 3G56A 4GCTA 4MO7A 3CDLA 1W0UA 1GV5A 2OI8A 1B72A 2FJ1A 5M3FJ 1SFOJ 2IBDA 4AYBN 1FTZA 1H8AC 1MNMC 3GZIA 5IP9J 1YRNB 3BG3A 2PBXA 1K83J 3BTJA 3DPJA 5BNGA 2K9SA 4CGRA 1ZK8A 2O9LA 5IYDJ 3H3VK 1TWGJ 1Y1WJ 4L62A 2JN6A 4YZEA 5DS9A 3KNWA 2D6YA 2D5VA 3VOXA 2CU7A 2DA7A 3D1NI 4HKUA 3HDDA 4AUXA 4GCLA 3F0CA 1MBFA 4LOCA 2DA6A 3M3YJ 3E7QA 1QVTA 5F0FA 3ZQLA 4Y7NJ 5C44J 2L7MP 3GTQJ 1Q1VA 1G2HA 4BY7J 2ZCXA 1JTXA 2PMZN 4FE7A 1IUFA 2K9NA 1QPIA 4A3LJ 2Q24A 3Q0VA 2HKUA 2IEKA 1BW5A 1VFCA 5EF6A 4FCYA 4PXIA 3PM1A 5GPCA 4BY1J 3HOZJ 2CQQA 2JA7J 5C4JJ 1GVDA 1DU6A 3BTIA 5M5XJ 1ITYA 4AC6A 3LWJA 1LE8B 5K7ZA 3G1MA 3NRGA 5D19A 4IHWA 2VUMJ 2LFBA 3P9TA 2F07A 3KKDA 2GUHA 4M3FA 1WCMJ 1I6HJ 3C2BA 2ID3A 2JMWA 2K9QA 1HDDC 5CXGA 1IG7A 4GFLA 1FJLA 2UXOA 2PZ9A 3BQZA 1ETWA 1JKOC 4MFEA 5IP6A 2DMUA 3BT9A 2HOSA 2DN0A 5K58A 1JT6A 4W97A 1Y1VJ 2LVSA 3S2DJ 2YVEA 3EUPA 4A3MJ 1ENHA 4DZPA 1B72B 3S16J 1GUUA 3HGYA 5F1JA 3GBGA 2NVYJ 2HOTA 1IDYA 4JX6A 2XRLA 3UKGA 5FMPA 3JRHA 3JSJA 2LTPA 2DJNA 1FIPA 3JRFA 4AC0A 5DTDA 3ZOBA 4MLOA 3S17J 1BL0A 2EZIA 2RHAA 1H89C 3BR5A 4JP0A 5FHPA 1RKWA 2FD5A 3S2HJ 2Y30A 2G7LA 1JKQC 3DEWA 2AHQA 5D18A 3NAUA 4M3GA 3B6CA 2NOGA 3FISA 5JLWA 1RPWA 4S0HB 2DMNA 1GDTA 2E2IJ 5IYCJ 5M5YJ 1QVUA 3JRBA 3LSPA 1W0TA 3LSRA 1Z0XA 2O8KA 2LR8A 2WB1N 3H0GJ 3JR9A 1NK3P 4GFKA 2FQ4A 1TC3C 3VW2A 2YS9A 1RR7A 3MN2A 5CW8A 4MXMA 4A3FJ 3G1OA 2LKXA 4V2GA 4XK4A 1ETQA 3K7AJ 4DZJA 1VF9A 1RKTA 5C4YA 2TRTA 3OIOA 3JREA 2KT0A 2NP5A 2YUSA 3A01A 4JKZA 2EZLA 4JX4A 3BR2A 1D5YA 2G3BA 2GLOA 3HOWJ 5EFYA 2QF7A 2IU5A 1E3OC 1UI6A 2RASA 3JRCA 3PO3J 3K2AA 2K40A 1IV6A 1MH3A 3HKZN 3A03A 1MSFC 3QBMA 1WH5A 4A93J 1P7IA 1JKPC 1WI3A 3MVPA 1CQTA 1APLC 2MG4A 3NARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I76 A;  2L7F P;  4A3B J;  1ZR4 A;  3GEU A;  4DYC A;  1WGX A;  3QPL A;  4BXX J;  3TW7 A;  5D1R A;  4JX5 A;  2KDZ A;  1HLV A;  1WH7 A;  4XID A;  5F04 A;  3KZ9 A;  2ID6 A;  2M9H A;  5EGO B;  2JA6 J;  3RD3 A;  1S7E A;  2GM4 A;  4CYC A;  5EZG A;  5FKK A;  2R5Y B;  2QOP A;  5M3M J;  3BQY A;  3MKL A;  1ETY A;  2L9R A;  3BCG A;  5F08 A;  1LE8 A;  4W1U A;  3CWR A;  3IUV A;  5FJ8 J;  2LP0 A;  1SGM A;  3ANP A;  5CXI A;  1X2M A;  2E2J J;  2R7Z J;  4DYQ A;  1ZGW A;  1TWH J;  1IRZ A;  2TCT A;  5C4X J;  5FLV A;  4GCK A;  5EG0 B;  2COB A;  1FIA A;  3PPB A;  1NTC A;  2NS8 A;  1BJZ A;  4UUT A;  3NNR A;  3LSG A;  5FKM A;  4D5C A;  1JJ6 C;  3OOU A;  5E3M A;  3GTL J;  2QTQ A;  4KWA A;  1B8I B;  1TWF J;  1ZKG A;  2O7O A;  2DA4 A;  2DTZ A;  4DYR A;  4QTR A;  4XRM A;  1ZTR A;  3G1L A;  1RET A;  3IH2 A;  2JA5 J;  2UXH A;  3BHQ A;  1FTT A;  1Z77 A;  5HBU A;  5F27 A;  3V6G A;  2XGE A;  2REK A;  3FK6 A;  5FKO A;  2ME6 A;  2L0K A;  3B81 A;  1K61 A;  5IOY A;  1ETX A;  1JT0 A;  3QKX A;  2ECB A;  3RZD J;  3HBL A;  1HF0 A;  3A01 B;  2XB0 X;  1JTY A;  2UXP A;  5C3E J;  2DA1 A;  2ELK A;  5EGO A;  3FIW A;  4M3B A;  2M8G X;  3RKQ A;  4A69 C;  1UMQ A;  2QCO A;  3ZQH A;  1MBJ A;  1UHS A;  1A6I A;  2M0C A;  2FX0 A;  5F0H A;  5JLX A;  2QKO A;  2NVX J;  2JWT A;  1U9N A;  1OJL A;  3BTL A;  4BBS J;  2XPW A;  3ZQG A;  3VP5 A;  2ECC A;  2XSD C;  5E3O A;  2P81 A;  5FGL A;  4ME9 A;  2E19 A;  2L7Z A;  9ANT A;  3COL A;  2VKE A;  3RQI A;  4D5F A;  2CQX A;  3GTM J;  4A3K J;  3PO2 J;  5E3N A;  2MSY A;  3TP0 A;  1I50 J;  2DA2 A;  3HIM A;  4DW6 A;  4B4C A;  2UXU A;  2EBI A;  2ME0 A;  4V2F A;  1ORK A;  3LNQ A;  3HE0 A;  2M2E A;  3JRA A;  4BKX A;  1SAN A;  1JUM A;  3CQZ J;  5GP9 A;  3TED A;  1U9O A;  1JKR C;  2CRG A;  2WAQ N;  3SJM A;  2XGD A;  5HAW A;  2R5Z B;  3M4O J;  4MFD A;  3S1Q J;  1HOM A;  1B8I A;  2I10 A;  3W6V A;  1XC5 A;  4A3I J;  3CRJ A;  1F43 A;  3PAS A;  1HCR A;  2HQ5 A;  4XIC A;  3I4M J;  2NP3 A;  1P7J A;  2GFN A;  5EZH A;  2Y0S N;  5GPA A;  2OER A;  3RZO J;  4UUS A;  2DMP A;  1EF4 A;  3VPR A;  5IYB J;  2CUE A;  2NX4 A;  2VI6 A;  2N8G A;  1OCP A;  3BR6 A;  2OF7 A;  2Y9Z A;  1IGN A;  1X2N A;  3V78 A;  3MNL A;  2X9D A;  5HSZ A;  4A3D J;  2YU9 J;  4ABZ A;  3ZQF A;  4M6V A;  1AHD P;  4NDL A;  4C2M J;  2DMQ A;  3BG9 A;  1H88 C;  2MGQ A;  5FKL A;  1F36 A;  1MBG A;  2R93 J;  3A02 A;  4CYC B;  3GTJ J;  5FLM J;  3JRG A;  1GT0 C;  3BNI A;  2VKV A;  1ZR2 A;  3HTJ A;  3HTA A;  4FE4 A;  3AQS A;  1BA5 A;  3VW1 A;  3BTC A;  2LLK A;  2DG7 A;  2X6O A;  5IOZ A;  3F1B A;  2ZOZ A;  1NK2 P;  1DU0 A;  2R92 J;  4I6Z A;  1WPK A;  5M5W J;  5H9T A;  4IHX A;  2JK3 A;  2Y2Z A;  2B63 J;  2R5Z A;  2GBY A;  4AF5 A;  3Q3S A;  2H8R A;  4HNV A;  5K7H A;  4IEJ A;  1O4X A;  4NN1 A;  3VIB A;  4JNN A;  5EDN A;  3VVZ A;  3GTO J;  2OPT A;  4GFB A;  1T56 A;  2HI3 A;  1POG A;  3HOY J;  3Q0W A;  3GTG J;  2WGB A;  3TW6 A;  1JJ8 C;  1MBK A;  2DA3 A;  3HTI A;  5FKN A;  3NI7 A;  2H1K A;  1FEX A;  3LOC A;  2E1O A;  1MBE A;  2Y9Y A;  4A3E J;  3B6A A;  3LHQ A;  1QRY A;  5EEA A;  1BW6 A;  4JYK A;  1JUP A;  2IAI A;  2XGC A;  3ON4 A;  2MW8 A;  2JA8 J;  1T33 A;  2DA5 A;  3G7R A;  1RES A;  3I4N J;  2EZK A;  2VPR A;  3SFI A;  2EQR A;  1YRN A;  3S1M J;  1IC8 A;  3Q0U A;  3EGQ A;  4MIM A;  3QPS A;  4QSH A;  3S5R A;  1PUF A;  3HGG A;  3CCY A;  3CMY A;  3IV5 A;  2QIB A;  1VND A;  3S15 J;  1ETV A;  3VW0 A;  1TWC J;  4MK6 A;  2ZCM A;  2LK2 A;  2DG8 A;  1X58 A;  3FK7 A;  1AU7 A;  3NPI A;  3S14 J;  3O8H A;  4NEL A;  3L1P A;  3JRI A;  4UUS B;  2LD5 A;  4UDS A;  1OCT C;  1ETO A;  3HTH A;  2WV1 A;  2O7T A;  3HOX J;  2M34 A;  2ZCN A;  3LSJ A;  2HOA A;  4XRS A;  2HDD A;  1IJW C;  2FBQ A;  4FIS A;  3ZQC A;  3DCF A;  4XRS G;  4BBR J;  4D7N A;  2EH3 A;  5IPA A;  4D7M A;  3O8G A;  3RH2 A;  2XPV A;  3AQT A;  2AO9 A;  1XS9 A;  4FTH A;  2XDN A;  2Y31 A;  1ETK A;  3E7L A;  2XPU A;  1A5J A;  2E2H J;  3WHB A;  2RAE A;  3BR1 A;  3S1R J;  4RBO A;  5F0C A;  1OFC X;  2X48 A;  2QWT A;  2R5Y A;  5J1U A;  3HM5 A;  4M3D A;  1MSE C;  2G7G A;  2V57 A;  2W48 A;  2HYJ A;  1HDP A;  4ICH A;  4G12 A;  1XG1 A;  3ANG A;  4IHY A;  3QQA A;  3IH3 A;  3NXC A;  1I3Q J;  1PUF B;  4L5E A;  2LY9 A;  4QIW N;  1AKH B;  5IP7 J;  3VVX A;  3BR0 A;  3GTP J;  3TP3 A;  2R0Q C;  5EG0 A;  3HB9 A;  1JGG A;  1LFU P;  4A3C J;  1R9T J;  4C3I J;  5EYR A;  3BG5 A;  3OSG A;  2NVT J;  2HYT A;  1LFB A;  4Y52 J;  1IDZ A;  3VVY A;  3T6N A;  2G7S A;  2ZB9 A;  3OSF A;  4C3H J;  4B1R A;  3S1N J;  3KKC A;  1JUS A;  2UXI A;  3IH4 A;  4M3E A;  4X1E A;  3ZQI A;  4B3A A;  4C3J J;  5J1R A;  4IHV A;  1ZQ3 P;  2GEN A;  2G0E A;  3HOV J;  3HEF A;  5HOD A;  2W53 A;  2ZOY A;  4EEF G;  3FKI J;  2JJ7 A;  5J3L A;  3WHC A;  4ACI A;  3BJB A;  1MH4 A;  4A3J J;  2CUF A;  4RDU A;  3LJL A;  2NVQ J;  5DAJ A;  1TWA J;  2HXO A;  1UG2 A;  3CJD A;  3VUQ A;  5J1Y A;  2CJJ A;  1MBH A;  2EZH A;  3JRD A;  2YVH A;  1U8B A;  1U78 A;  1UI5 A;  2HXI A;  2DMT A;  3BR3 A;  3ON2 A;  3FRQ A;  2NS7 A;  2XB5 A;  3HOU J;  3O60 A;  3GTK J;  3C07 A;  5K7F A;  1VI0 A;  3SDG A;  4X6A J;  5AQC A;  4JL3 A;  5E3L A;  1GV2 A;  4A3G J;  3BRU A;  4J19 A;  1AKH A;  3VOK A;  2WUI A;  3G56 A;  4GCT A;  4MO7 A;  3CDL A;  1W0U A;  1GV5 A;  2OI8 A;  1B72 A;  2FJ1 A;  5M3F J;  1SFO J;  2IBD A;  4AYB N;  1FTZ A;  1H8A C;  1MNM C;  3GZI A;  5IP9 J;  1YRN B;  3BG3 A;  2PBX A;  1K83 J;  3BTJ A;  3DPJ A;  5BNG A;  2K9S A;  4CGR A;  1ZK8 A;  2O9L A;  5IYD J;  3H3V K;  1TWG J;  1Y1W J;  4L62 A;  2JN6 A;  4YZE A;  5DS9 A;  3KNW A;  2D6Y A;  2D5V A;  3VOX A;  2CU7 A;  2DA7 A;  3D1N I;  4HKU A;  3HDD A;  4AUX A;  4GCL A;  3F0C A;  1MBF A;  4LOC A;  2DA6 A;  3M3Y J;  3E7Q A;  1QVT A;  5F0F A;  3ZQL A;  4Y7N J;  5C44 J;  2L7M P;  3GTQ J;  1Q1V A;  1G2H A;  4BY7 J;  2ZCX A;  1JTX A;  2PMZ N;  4FE7 A;  1IUF A;  2K9N A;  1QPI A;  4A3L J;  2Q24 A;  3Q0V A;  2HKU A;  2IEK A;  1BW5 A;  1VFC A;  5EF6 A;  4FCY A;  4PXI A;  3PM1 A;  5GPC A;  4BY1 J;  3HOZ J;  2CQQ A;  2JA7 J;  5C4J J;  1GVD A;  1DU6 A;  3BTI A;  5M5X J;  1ITY A;  4AC6 A;  3LWJ A;  1LE8 B;  5K7Z A;  3G1M A;  3NRG A;  5D19 A;  4IHW A;  2VUM J;  2LFB A;  3P9T A;  2F07 A;  3KKD A;  2GUH A;  4M3F A;  1WCM J;  1I6H J;  3C2B A;  2ID3 A;  2JMW A;  2K9Q A;  1HDD C;  5CXG A;  1IG7 A;  4GFL A;  1FJL A;  2UXO A;  2PZ9 A;  3BQZ A;  1ETW A;  1JKO C;  4MFE A;  5IP6 A;  2DMU A;  3BT9 A;  2HOS A;  2DN0 A;  5K58 A;  1JT6 A;  4W97 A;  1Y1V J;  2LVS A;  3S2D J;  2YVE A;  3EUP A;  4A3M J;  1ENH A;  4DZP A;  1B72 B;  3S16 J;  1GUU A;  3HGY A;  5F1J A;  3GBG A;  2NVY J;  2HOT A;  1IDY A;  4JX6 A;  2XRL A;  3UKG A;  5FMP A;  3JRH A;  3JSJ A;  2LTP A;  2DJN A;  1FIP A;  3JRF A;  4AC0 A;  5DTD A;  3ZOB A;  4MLO A;  3S17 J;  1BL0 A;  2EZI A;  2RHA A;  1H89 C;  3BR5 A;  4JP0 A;  5FHP A;  1RKW A;  2FD5 A;  3S2H J;  2Y30 A;  2G7L A;  1JKQ C;  3DEW A;  2AHQ A;  5D18 A;  3NAU A;  4M3G A;  3B6C A;  2NOG A;  3FIS A;  5JLW A;  1RPW A;  4S0H B;  2DMN A;  1GDT A;  2E2I J;  5IYC J;  5M5Y J;  1QVU A;  3JRB A;  3LSP A;  1W0T A;  3LSR A;  1Z0X A;  2O8K A;  2LR8 A;  2WB1 N;  3H0G J;  3JR9 A;  1NK3 P;  4GFK A;  2FQ4 A;  1TC3 C;  3VW2 A;  2YS9 A;  1RR7 A;  3MN2 A;  5CW8 A;  4MXM A;  4A3F J;  3G1O A;  2LKX A;  4V2G A;  4XK4 A;  1ETQ A;  3K7A J;  4DZJ A;  1VF9 A;  1RKT A;  5C4Y A;  2TRT A;  3OIO A;  3JRE A;  2KT0 A;  2NP5 A;  2YUS A;  3A01 A;  4JKZ A;  2EZL A;  4JX4 A;  3BR2 A;  1D5Y A;  2G3B A;  2GLO A;  3HOW J;  5EFY A;  2QF7 A;  2IU5 A;  1E3O C;  1UI6 A;  2RAS A;  3JRC A;  3PO3 J;  3K2A A;  2K40 A;  1IV6 A;  1MH3 A;  3HKZ N;  3A03 A;  1MSF C;  3QBM A;  1WH5 A;  4A93 J;  1P7I A;  1JKP C;  1WI3 A;  3MVP A;  1CQT A;  1APL C;  2MG4 A;  3NAR A; 
#chains in the Genus database with same CATH topology
 3I3L A;  4RM2 A;  2VQC A;  4XQF A;  3GEU A;  1BIA A;  3TO6 A;  2Q1Z B;  3K9T A;  2ZXI A;  4BDY A;  5F04 A;  1XGM A;  3KZ9 A;  2ID6 A;  4XLF A;  4BYY A;  1NG6 A;  2JA6 J;  1R49 A;  1W4M A;  3W3C A;  5FKK A;  4CYC A;  3K70 C;  1MJB A;  2QOP A;  1I1S A;  1P4A A;  4AIK A;  4BEH A;  1YX3 A;  2DJI A;  4DYQ A;  1TWH J;  4RB3 C;  1XDU A;  4I0B A;  5FLV A;  5EG0 B;  5IT9 Z;  2COB A;  3ESW B;  1QO0 D;  2STW A;  5D5X B;  2HDW A;  1UHW A;  4RA2 A;  3I59 B;  3GZN B;  3IAS 2;  1P6R A;  3NNR A;  5FKM A;  1KQ0 A;  3CJT B;  3OOU A;  1JJ6 C;  3IRQ A;  1ZKG A;  3CJN A;  3CF5 F;  2DA4 A;  3E5Q A;  1S72 I;  2ZJQ F;  5KVR A;  2QVO A;  3WE3 A;  4OIO F;  1K4S A;  2UXH A;  4YG2 F;  4Y17 A;  1UHM A;  1O3S A;  2A07 F;  4F93 B;  2JSC A;  1EH8 A;  2ME6 A;  2RNJ A;  2QKM B;  5FO5 A;  2PFV A;  3HSE A;  4PDK A;  2ECB A;  3U1K A;  3WTY C;  1JTY A;  2UXP A;  4LGW A;  4MEX F;  5JFR A;  1TT5 B;  5EGO A;  3RKQ A;  2L54 A;  3QAH A;  2XSJ C;  4A69 C;  3TDU C;  3ZQH A;  1UHS A;  2Z2S B;  3MKZ A;  4ENM A;  1PP8 F;  2CG4 A;  1OJL A;  4UY8 I;  1MMS A;  3ZXS A;  1LPQ A;  4BBS J;  3VP5 A;  4A5M A;  2LRD A;  3L7W A;  4M9S A;  4Y3O A;  2IA2 A;  4Y33 A;  9ANT A;  1J7K A;  2VKE A;  3RQI A;  3CUO A;  4OIR F;  2V7F A;  3TDZ C;  1U2W A;  2LRE A;  4HW0 A;  1ZRD A;  1BI0 A;  4HAM A;  4PK4 A;  1I50 J;  1LB2 A;  1IXC A;  3E0J B;  1D5V A;  1IW7 F;  3E3V A;  1UZC A;  2ME0 A;  3FM5 A;  4HPQ A;  2FXA A;  4BKX A;  2LKP A;  4MQ9 F;  1KON A;  5DEQ A;  1YO5 C;  1P4W A;  5LGU A;  1JKR C;  3A0H C;  3ZGK A;  3SJM A;  2ZCW A;  1J0R A;  4PGH A;  3S1Q J;  1HOM A;  3QU6 A;  5JVG F;  2FJI 1;  1PYV A;  1F4K A;  3UR3 C;  3KP7 A;  2VJJ A;  4OAZ A;  2R7S A;  3FMQ A;  2M30 A;  4B47 A;  4HDU A;  4U9N A;  1Q1H A;  4LK0 F;  2XUB A;  1RUO A;  2OER A;  4UUS A;  2DMP A;  1EF4 A;  3P5J A;  3VPR A;  5IYB J;  5HLT A;  1ZRF A;  2CUE A;  3NQO A;  2NX4 A;  4A5N A;  2EIM H;  2N8G A;  2P4W A;  2OF7 A;  2XRN A;  2FBI A;  2Y48 A;  5D6F A;  5HSZ A;  3OYI A;  3TQN A;  4M6V A;  3HJE A;  4PUS A;  2HS5 A;  3I4P A;  1PUE E;  4NDL A;  1D8K A;  3H3Z A;  3BG9 A;  5TIS C;  3H9J A;  4ZDL A;  5FKL A;  4ON0 A;  1MBG A;  2R93 J;  4CYC B;  5FLM J;  3D5S C;  3NRV A;  3DP7 A;  3HTJ A;  3S93 A;  3KZY A;  4FE4 A;  4G7Z F;  1BM9 A;  5KAF C;  2M7A A;  2V1X A;  3BTC A;  1YIT I;  3DKX A;  3QP6 A;  2X6O A;  1YX5 A;  2ZOZ A;  2MBF A;  3KEO A;  4I6Z A;  1LNW A;  5DUK A;  2QYO A;  1BI2 A;  1T6S A;  1LJ9 A;  4ASN A;  4HNV A;  4HF0 A;  1J2X A;  2VON A;  1YW9 A;  2X0L A;  4KIG A;  3H9Q A;  2KMU A;  2W82 A;  1DGR M;  2FNA A;  1T56 A;  2HI3 A;  3Q0W A;  3GTG J;  2A6H F;  2XVC A;  2WGB A;  1B9N A;  3HHG A;  4A6D A;  2HYF A;  4MEY F;  4XOT A;  1VQK I;  2DA3 A;  1WJ5 A;  4G7H F;  2COM A;  2RN7 A;  5DV5 A;  3BCB A;  1FBU A;  2XF7 A;  2O6G E;  4LIT A;  1S29 A;  2P6T A;  2E1O A;  2NXN B;  2QQA A;  3E6B A;  2WY7 Q;  2HPM A;  3S3O A;  4E7H A;  1W7P D;  2HKO A;  2CGP A;  2LY2 A;  4CO8 A;  5HLH A;  4WXC A;  2IGN A;  1ONV A;  2PFB A;  2XGC A;  4HSR A;  3QYE A;  4XL9 A;  2EZK A;  2MYS A;  4AIJ A;  2IA0 A;  4HYE A;  4B3X A;  1LUJ B;  1YTY A;  3QPS A;  4QSH A;  4ZC3 A;  3S5R A;  3CCY A;  1VND A;  2KIF A;  3V7C A;  3ZMT A;  3VW0 A;  3BJ6 A;  3L2Q A;  4MK6 A;  4Q4Z F;  3I9V 2;  1R5H A;  4IRG A;  1AU7 A;  3NPI A;  1Z21 A;  3O8H A;  4KMU X;  3L1P A;  3JRI A;  4UDS A;  3TGN A;  1S5L C;  4DBR A;  3R61 A;  1MJA A;  2HOE A;  3NWT A;  5HDK A;  1GXP A;  1K79 A;  2FMY A;  4C2U A;  2AS5 F;  4HX4 A;  3QOE A;  2FBQ A;  2R7V A;  4XLH A;  2GXG A;  3BOQ A;  1P9Q C;  1TW3 A;  4HNT A;  4UVB A;  4D7M A;  3AQT A;  4OIP F;  1RR8 C;  1U5T C;  2DU9 A;  2KIS A;  1XS9 A;  4FTH A;  2XDN A;  3KIO A;  1NG7 A;  2K3F A;  2XAG A;  2XPU A;  2ZKZ A;  4Y4R A;  4ZYA A;  3EPZ A;  1A5J A;  4CIC A;  3HTS B;  1YS6 A;  4GCV A;  4RBO A;  4LLG F;  2QWT A;  1TQI A;  4HX8 A;  5J1U A;  5K5Q A;  1MSE C;  1SFK A;  4BAC A;  5K5R A;  5LGN A;  1IN7 A;  4LG0 A;  3CP8 A;  4CA0 A;  1SMT A;  4JK1 X;  5JVT A;  4S05 A;  1B4A A;  1I3Q J;  3MZH A;  4L5E A;  4XN3 A;  4E4H A;  2QKL B;  5EG0 A;  2R0Q C;  2PJP A;  2Q0O A;  1JGG A;  1LFU P;  3M8F A;  2P6S A;  2DDA A;  3GME A;  2L9V A;  2DK8 A;  4R79 A;  2W00 A;  1A6Q A;  4JOM A;  1KZH A;  3UNG C;  2VPL A;  3AG2 H;  1FNN A;  4B1R A;  4C3H J;  1DGW Y;  2FU4 A;  3KKC A;  2IXS A;  2GEN A;  3HOV J;  2VC1 A;  2ZME C;  2JJ7 A;  2R7U A;  1FP1 D;  3WHC A;  5E1Z B;  4ITV A;  1MH4 A;  3FM3 A;  3LJL A;  1WHU A;  4RDU A;  2OUM A;  4B43 A;  5DAJ A;  1F9N A;  2HQR A;  3RI4 A;  2L9S A;  1K6Y A;  2A68 F;  4KDP A;  3GW2 A;  1MBH A;  3JRD A;  2YU3 A;  3LFU A;  4ZJZ A;  4XNF A;  5D8L B;  3K2Z A;  2XB5 A;  1YYV A;  3L09 A;  3HOU J;  3GTK J;  1VI0 A;  5IY5 H;  3I53 A;  2BOL A;  4X6A J;  2A2F X;  1R58 A;  2VT2 A;  5B1A H;  5JHU A;  1Y8R B;  4A3G J;  2L9N A;  4G8X A;  1K78 A;  1U0J A;  2WUI A;  5F1R A;  4GCT A;  4F92 B;  2DCE A;  3AAF A;  2OTJ I;  4C9Y A;  1YJ9 I;  3PIP F;  1KA8 A;  3DPT A;  2KQR A;  2KJC A;  1MNM C;  2DFH A;  4XKC A;  5IP9 J;  2VT3 A;  3FHZ A;  3FXM A;  1K83 J;  3BTJ A;  5LLQ A;  3LAP A;  3SEQ A;  4A0Y A;  4KMF A;  3DPJ A;  4BJ5 C;  3ZRG A;  3WGI A;  2F48 A;  4NC7 A;  5IYD J;  2O9L A;  1SVM A;  3OV8 A;  3QWL A;  4Q48 A;  2MA3 A;  4YZE A;  3K4B A;  2D5V A;  3HXL A;  1N25 A;  3PNT A;  3TO9 A;  2VXD A;  3QU3 A;  3HOT A;  2D2W A;  4P55 A;  3FZV A;  3E7Q A;  2QWW A;  3VYR B;  4HF2 A;  1ZAO A;  4Y7N J;  2HPI A;  4F52 A;  2RRE A;  1HW1 A;  4FE7 A;  3LSI A;  1QPI A;  4A3L J;  1LDJ A;  1XPX A;  1X1C A;  1FBS A;  2DDB A;  2HEO A;  2CUJ A;  4BY1 J;  4RMN A;  1D0Y A;  2CQQ A;  4M74 A;  2EPF A;  4QWQ A;  3KP2 A;  1GVD A;  2V1N A;  2F6C A;  2Z99 A;  1R5G A;  5M5X J;  2BYV E;  3DV8 A;  1X1D A;  1LE8 B;  5K7Z A;  5EEH A;  2JUC A;  2IJL A;  4AM3 A;  4IHW A;  3LAJ A;  2MH2 A;  1U5T B;  3HIF A;  1FOW A;  4M3F A;  1WCM J;  3U9G A;  2DXI A;  3GF2 A;  1W7P B;  1PDN C;  4ANJ A;  1YOV B;  1V3F A;  2K27 A;  5CXG A;  4CHU A;  5BS6 A;  4HNU A;  2LDU A;  4LD5 A;  1FJL A;  2UXO A;  2PZ9 A;  2DOF A;  3BQZ A;  1ETW A;  2EWN A;  2K85 A;  2WB1 A;  4E7Z A;  3MKY B;  2IRF G;  2HOS A;  2DN0 A;  3CDH A;  1EA3 A;  4U0V A;  3S2D J;  2R7X A;  3MCZ A;  4DZP A;  1B72 B;  2ESN A;  3S16 J;  1IDY A;  2DPU A;  2KJB A;  3KP6 A;  4QLC U;  1Y39 A;  3UKG A;  1HC8 A;  3R4K A;  5FMP A;  4ZYD A;  3SQN A;  5FD5 A;  2K3P A;  4AC0 A;  1Z7L A;  5EJC A;  5DTD A;  3ZOB A;  1O7F A;  3KLN A;  4EM1 A;  1W5S A;  4D1Q A;  1I39 A;  4JP0 A;  3CJQ B;  2RNG A;  2CW7 A;  2P0W A;  1OR7 C;  3CCJ I;  1IXR C;  4U7B A;  3NAU A;  4BHC A;  5J8F A;  1GXQ A;  1S7A A;  1KU3 A;  2M8E A;  3B6C A;  4ESJ A;  3FIS A;  5JLW A;  2F2E A;  4S0H B;  2QLZ A;  4HG2 A;  2P7C B;  1JGS A;  2DMN A;  1PJR A;  5GTI C;  3SZG A;  1QBJ A;  2E71 A;  5IYC J;  2BY2 A;  4CCK A;  2EFO A;  1K78 B;  2KRC A;  2G7H A;  2JPB A;  2Z5U A;  3OS1 A;  5CVI A;  5HDN A;  4G7O F;  1D1A A;  2K5C A;  3HZJ A;  3W6K B;  2ZY9 A;  3HRM A;  4XM3 A;  1FSE A;  4LLL A;  3VW2 A;  3IAM 2;  1IO2 A;  3PSI A;  2CUZ A;  4XKV A;  3CP2 A;  2D45 A;  3J81 Z;  3MMY B;  2PJR B;  2QSH X;  1ETQ A;  3U1D A;  1SAX A;  1VF9 A;  2TRT A;  3OOP A;  4OOI A;  3GEZ A;  2M4K A;  5FFZ A;  2ZBK A;  1UG0 A;  2L4A A;  4JKZ A;  2EZL A;  1ACI A;  2HR3 A;  3AG1 H;  1WJE A;  2G7U A;  1UI6 A;  4EVI A;  3O2P E;  4O5V A;  4FHT A;  4L9J A;  5JI6 A;  2XRO A;  1IV6 A;  3QBM A;  1J75 A;  5FRN A;  4A93 J;  1DPU A;  2L7K A;  3HTU A;  2VQL A;  4I76 A;  4B8X A;  2L7F P;  3OYM A;  1KU9 A;  1R5I D;  4CCO A;  3W2W A;  4E7K A;  3TW7 A;  4BXX J;  4JX5 A;  1ZLJ A;  5DM7 F;  4E7S A;  2KDZ A;  1HLV A;  4LG0 B;  1WH7 A;  4CH7 A;  1FY7 A;  1X1B A;  2V9K A;  1VTN C;  3RD3 A;  1S7E A;  2GM4 A;  2R5Y B;  1LDK B;  1USS A;  3MKL A;  4KN4 X;  1ETY A;  2L9R A;  1VQ7 I;  5LGT A;  4LK1 F;  5FJ8 J;  4IHS A;  3KYD B;  3PFY A;  2XV4 S;  3QOP A;  1X2M A;  2E2J J;  2R7Z J;  1ZGW A;  1IRZ A;  5E79 C;  3C2H A;  2XIG A;  5KNL A;  3OR1 C;  2VOO A;  1QZZ A;  1FIA A;  1S9H A;  1NTC A;  4FAS D;  4Q5S F;  2DOE A;  5HOO A;  3E97 A;  3T8T A;  1BN5 A;  1X4O A;  3GZ5 A;  2MAB A;  5E3M A;  3S2W A;  2QTQ A;  2JRT A;  1TWF J;  2IA1 A;  2O7O A;  3KEQ A;  4DYR A;  3MQ0 A;  4XRM A;  1ZTR A;  1WVR A;  2PX9 A;  2WAE A;  3QYB A;  5TJJ A;  3T8R A;  3H92 A;  4E70 A;  2FQ3 A;  3V6G A;  2XGE A;  3F8B A;  2REK A;  1BR1 A;  3FK6 A;  5AIQ A;  5FKO A;  2L0K A;  3B81 A;  3QKX A;  2UUZ A;  3HBL A;  3RKW A;  1HF0 A;  2YPR A;  3ABK H;  3T5X A;  1FZP B;  2XB0 X;  2ZFW A;  5C3E J;  1D1B A;  2VB6 A;  3GFJ A;  4EJO A;  1MND A;  2DYS H;  3FIW A;  2M8G X;  4M3B A;  5BPD A;  3PNY A;  4ETS A;  1SD5 A;  5LBQ A;  3CCV I;  1XDS A;  2R7F A;  2M0C A;  2FX0 A;  5F0H A;  3IRR A;  1H9T A;  2QKO A;  2NVX J;  2XPW A;  2XSD C;  3PUF A;  5FGL A;  1LVA A;  1TL8 A;  3OIP A;  2E19 A;  2L7Z A;  3COL A;  1OYI A;  1QU3 A;  4R8H A;  4UVC A;  2CQX A;  3GTM J;  3KYL A;  5E3N A;  1R00 A;  5H6R A;  4DW6 A;  2EBI A;  1NH3 A;  4V2F A;  3CCR I;  2KLO A;  1ORK A;  3LNQ A;  1UB9 A;  2M2E A;  4UV9 A;  1MDM B;  4D9J A;  6PAX A;  3K1N A;  3RYP A;  3HE0 A;  1SAN A;  1JUM A;  3DLL F;  3TED A;  2CRG A;  3RSN A;  1VQ8 I;  5HAW A;  2MD5 A;  5EEG A;  2AXT C;  5DDG A;  1VQP I;  1B8I A;  2I10 A;  2CMP A;  3W6V A;  1XC5 A;  5J47 A;  3CRJ A;  3BG7 A;  1LEB A;  4MNU A;  1HCR A;  2HQ5 A;  4XIC A;  2NP3 A;  5ICG A;  1GHC A;  3DBR B;  1TQM A;  1YW8 A;  3LMM A;  3PFI A;  4BXF A;  4HLY A;  5D5U B;  1YI2 I;  5D4S A;  1ZG5 A;  1WFX A;  2O61 A;  3H3U A;  4OD5 A;  1R7J A;  2W84 A;  4ENK A;  4LFU A;  1OCP A;  2Y9Z A;  1XMK A;  1IXS B;  1X2N A;  5LD2 C;  3CCL I;  4A3D J;  4XSZ F;  5LRR A;  3ZQF A;  1G3Y A;  3K4M A;  1AHD P;  1UFM A;  4GGG A;  3Q5F A;  1H88 C;  1MMG A;  3GTJ J;  2LOO A;  2XKO A;  2KPM A;  2JSP A;  2LLK A;  3F8N A;  5CKT A;  3FXJ A;  3ASN H;  5L3F A;  2R92 J;  3I55 I;  5A2Q K;  4KIS A;  2X51 A;  3HG9 A;  1VQN I;  3H0D A;  1XX5 A;  1BC8 C;  2ZXW H;  2JK3 A;  3Q3S A;  2H8R A;  1S3J A;  4IEJ A;  1O4X A;  4HV5 A;  2ETH A;  3VIB A;  4EMS A;  4JNN A;  1Z05 A;  1B9M A;  1FYL A;  5TGT A;  5FRO A;  1REP C;  3KLO A;  1HW5 A;  3OL3 A;  3A1Y A;  1R22 A;  2Y69 H;  2HKX A;  1POG A;  3FXO A;  3K4N A;  3HOY J;  4M6Y A;  4BHB A;  1YJW I;  2HGC A;  3ABL H;  4ZZD A;  5B5E C;  5HVQ C;  5DD8 A;  1NHA A;  2K4B A;  5ICE A;  2F4I A;  3L2U A;  5J40 A;  2VAS A;  2VXZ A;  2FSW A;  2ISY A;  2Y9Y A;  5E20 A;  1RRJ A;  2FNP A;  1E3H A;  4LIU A;  2IAI A;  2NYX A;  2WTE A;  1BR4 A;  1BIB A;  3HRU A;  2GIZ A;  1T38 A;  4N9H A;  2JA8 J;  1RES A;  1TNT A;  1YRN A;  1AA7 A;  3WU1 B;  2EQR A;  2E7X A;  2NOJ B;  1PP7 U;  3F6V A;  3Q0U A;  2Q2E A;  3EGQ A;  1IN6 A;  3OYE A;  1A31 A;  1WZ2 A;  4CSW A;  3HSR A;  1PUF A;  2VBW A;  2Y0M A;  4ZYE A;  1R1U A;  3CMY A;  1L3L A;  3S15 J;  5E8I A;  5GAH J;  3CD6 I;  4F91 B;  1RNL A;  1TP4 A;  3SEZ A;  2ZCM A;  1E17 A;  2CQK A;  3S14 J;  1QA6 A;  2GIV A;  1FWZ A;  4NEL A;  3CCE I;  4S04 A;  4KT5 C;  1OCT C;  1ETO A;  1AOY A;  4LJZ F;  5FRM A;  2WV1 A;  2W24 A;  3J7A O;  3CES A;  2O7T A;  4EGZ A;  2ZCN A;  1W5T A;  3LSJ A;  2H6C A;  2HDD A;  4OWR B;  4FIS A;  4D7N A;  1R23 A;  5CVJ A;  3O8G A;  3BG6 A;  1O3T A;  2YSR A;  3LSK A;  4L9V A;  2M1B A;  3ZMU A;  2VKD A;  2DO7 A;  4NHJ A;  4MGR A;  4OIN F;  2JQ7 A;  5LRS A;  4I99 C;  3WHB A;  2E2H J;  2PMU A;  3S1R J;  3BR1 A;  3DBL B;  3IP4 B;  5F0C A;  2OCE A;  2R5Y A;  3I64 A;  4M3D A;  3KP5 A;  2KFD A;  2TDX A;  2XF6 A;  2BZT A;  3RPQ A;  1QPM A;  2CV1 A;  4M71 A;  3ANG A;  4U87 A;  3NXC A;  2BE5 F;  2VIX A;  4QIW N;  1AKH B;  3BR0 A;  2VE8 A;  2Z9O A;  3GCM A;  3Q9V A;  5IT9 K;  1D0Z A;  2PG4 A;  3OSG A;  3E6D A;  1TQP A;  2HYT A;  5DCM B;  3K70 D;  2DFI A;  3L2W A;  2LH9 A;  3S1N J;  3NWS A;  2UXI A;  3FBN B;  3LL7 A;  2J5O A;  4PZJ A;  2LYC A;  2LG4 A;  4OD4 A;  3TOA A;  3BZK A;  5J1R A;  2W53 A;  4KIC A;  5LEK A;  3OYN A;  3ECO A;  2ZO4 A;  1YHQ I;  4BXU A;  4HLX A;  3FKI J;  3IUO A;  2M0M A;  4ACI A;  3BJB A;  3AL0 B;  2KIU A;  4A3J J;  2CUF A;  1OPC A;  3RQ4 A;  2HVS A;  3CJD A;  3VUQ A;  4IQJ A;  3LSM A;  2CJJ A;  2UV1 A;  3LSH A;  1RZ4 A;  1U78 A;  1F1Z A;  2C6Y A;  2QGU A;  5GTH C;  4KYW A;  3PQK A;  3ON2 A;  4BHP A;  1D8J A;  3SXY A;  1R36 A;  2X85 A;  3IKT A;  3C07 A;  3O60 A;  4CUG A;  3DF8 A;  3GXO A;  3K1M A;  2I8D A;  4RGU A;  2XC7 A;  3OYB A;  4LLN A;  3KZZ A;  3VOK A;  2EA2 A;  4MO7 A;  1T8I A;  1W0U A;  1GV5 A;  2CQN A;  1B72 A;  2FJ1 A;  5M3F J;  3WTZ A;  3VOD A;  1YRN B;  4RB1 A;  2PBX A;  2DYR H;  2K9S A;  2QQ9 A;  3QP5 A;  1FOY A;  1TNS A;  4XLE A;  3OYK A;  4IVN A;  4BE0 A;  4C2T A;  2OAZ A;  4XN0 A;  2JN6 A;  3K6G A;  2D6Y A;  1V55 H;  3VOX A;  2CU7 A;  2XAU A;  4L9T A;  4IO9 F;  3SFZ A;  4AUX A;  4GCL A;  3M3Y J;  2MFZ A;  5F0F A;  1ZAR A;  2ZME A;  5C44 J;  3GTQ J;  1Q1V A;  2XHK A;  2ZCX A;  2PMZ N;  1IAW A;  3CLO A;  3OL4 A;  3Q0V A;  4HEA 2;  4Q47 A;  3F22 A;  2IEK A;  1BW5 A;  1MZB A;  2WA0 A;  3K69 A;  3PIO F;  1G3S A;  1VFC A;  2UWM A;  4FCY A;  1U6G A;  1Y0U A;  1ZHF A;  1KU2 A;  2F5D A;  3OR2 C;  5HS8 A;  3HOZ J;  4I98 B;  4IQ4 A;  3MFK A;  1T39 A;  5C4J J;  2ZFU A;  1OCZ H;  2IGM A;  3ONQ A;  4BEH B;  3AG3 H;  2DFE A;  2KRF A;  2ZJR F;  2EFP A;  1HA8 A;  5D19 A;  4ZTJ A;  3R60 A;  3DTE A;  2BEO A;  3N05 A;  2F07 A;  2WAQ A;  3J80 K;  2FML A;  2A69 F;  1T98 A;  2MC3 A;  2QBY B;  2X1E A;  2I5U A;  4NQW A;  4BJT A;  3O6B B;  2JMW A;  3V42 A;  2K9Q A;  3CZ6 A;  1HDD C;  1OKR A;  4XLP F;  4F3Q A;  3CCU I;  1Z9C A;  1WSU A;  3LQQ A;  1YE9 A;  1YS7 A;  2QA4 I;  2D1H A;  1ZH5 A;  2K9M A;  3KFW X;  3BT9 A;  5K58 A;  1Y1V J;  4ENJ A;  3EUP A;  4B09 A;  5H2F C;  2K9L A;  1YG2 A;  1GUU A;  3CUQ A;  4GDF A;  2NVY J;  3L2V A;  4JX6 A;  4YEJ A;  1HKQ A;  2OJE D;  4DOZ A;  3JSJ A;  2E5Z A;  3WGH A;  3ZR8 X;  4U7D A;  1FIP A;  4QPQ A;  1XTA A;  5D8K B;  2ACJ A;  4MLO A;  4IHT A;  1XD7 A;  2HYG D;  1G3T A;  1IZ1 A;  1YJN I;  2EZI A;  2RHA A;  1H89 C;  3BR5 A;  2R7T A;  1RKW A;  2M4G A;  3S2H J;  2Y30 A;  2G7L A;  2DLL A;  5HS9 A;  2IGK A;  3GYH X;  2XAF A;  2AQE A;  4M3G A;  3HKZ A;  2NOG A;  3K10 A;  1OQY A;  4NBQ A;  3AL0 C;  2KDO A;  3HSF A;  4OU0 A;  5AON A;  2E2I J;  4FT8 A;  5M5Y J;  1QVU A;  3C7J A;  3JRB A;  3LSP A;  3ZMS A;  4L0Z B;  4II2 A;  3ZQQ A;  3CMA I;  1HKT A;  3F8F A;  2YX7 A;  2V79 A;  1OMI A;  3SHF A;  5LHH A;  2LR8 A;  2WB1 N;  3ZN1 A;  3JR9 A;  3VDX A;  2UXN A;  4DJA A;  4AD9 A;  2YS9 A;  1RR7 A;  1SFE A;  3MN2 A;  4M9X A;  4A0Z A;  1K4T A;  3G1O A;  1HW2 A;  4XLC A;  1JI8 A;  4XK4 A;  3K7A J;  4EJU A;  2A3S A;  5C4Y A;  1YQA A;  3OIO A;  3F6O A;  3JRE A;  2YUS A;  4JX4 A;  3BR2 A;  5BPI A;  2IU5 A;  1BBY A;  1FOX A;  4IPA A;  2CO5 A;  1VQO I;  2VBX A;  1W7P A;  4FET A;  3PO3 J;  3ZCO A;  2O03 A;  4H4K C;  2K40 A;  4PJJ A;  1MH3 A;  2DOA A;  1MSF C;  1WH5 A;  4MQV A;  1O3R A;  1FOK A;  3C3W A;  2EIK H;  2CSO A;  2IT0 A;  1X19 A;  3MVP A;  2LMD A;  3TL4 X;  3HHH A;  1ZR4 A;  4DYC A;  1WGX A;  3PUB A;  2F5E A;  3VYT B;  3HRS A;  1H9G A;  2D1V A;  5HS7 A;  5HDG A;  2QEX I;  4XID A;  2M9H A;  2XAJ A;  3WTT C;  5EGO B;  5E18 F;  5M3M J;  3GVA A;  3BQY A;  4PJN A;  3L2R A;  2IPQ X;  3F8M A;  2DFF A;  3IUV A;  2LP0 A;  1SGM A;  5CXI A;  1O3Q A;  2QQB A;  4KIB A;  4KIF A;  2HTJ A;  2PLY A;  4I02 A;  5C4X J;  4GCK A;  1LEA A;  3I71 A;  4K2E A;  1ULY A;  2NS8 A;  1BJZ A;  3GLX A;  2CFX A;  4HQE A;  1XSV A;  5BOX A;  1JE8 A;  3CCQ I;  3LSG A;  3AG4 H;  1SVO A;  4D5C A;  3OS0 A;  4PSW A;  4KWA A;  3DU6 A;  1B8I B;  5DUI A;  2NS0 A;  4QPO A;  3GWZ A;  2DTZ A;  2EA4 A;  3VYU B;  2FF4 A;  3OS2 A;  4ESB A;  3EYI A;  3G1L A;  1YIJ I;  1RET A;  3IH2 A;  1TBX A;  1P4X A;  1Z77 A;  1QZE A;  5F27 A;  5ICC A;  3WGG A;  4RAZ A;  3VEP A;  4HBL A;  2WC2 A;  1K61 A;  1Z3Y A;  4UVA A;  2KIQ A;  2IS2 A;  3RZD J;  3G73 A;  3I56 I;  2RC4 A;  3PL8 A;  4DIQ A;  4ESF A;  1RI7 A;  4CCN A;  2X6W A;  4P9U A;  1UMQ A;  4XR6 A;  2QZ8 A;  1STZ A;  1A6I A;  1ZYR F;  2M45 A;  5JLX A;  2CH0 A;  2JWT A;  1U9N A;  3BTL A;  2KL4 A;  2RV8 A;  3KET A;  1YFH A;  3B73 A;  2IVM A;  3ZQG A;  5L3E A;  2ECC A;  2DW4 A;  3GZ6 A;  1R4M B;  4DQ2 A;  1ON2 A;  3IHU A;  4D5F A;  2A6E F;  1TTY A;  2W4S A;  4EJW A;  1F5T A;  4KFC A;  2PQ8 A;  4ZTF A;  3TP0 A;  2DA2 A;  1V5F A;  5KCM A;  3OYD A;  1OCR H;  3HIM A;  5DCF A;  2F5C A;  4B4C A;  3V8J A;  2ELJ A;  2XKP A;  2H09 A;  4YRV A;  3AFH A;  3H36 A;  5E17 F;  1JHF A;  2PEX A;  3FBI B;  1U9O A;  2WAQ N;  3DPL C;  3HYI A;  2V1D A;  2XGD A;  1SMY F;  3M4O J;  4MFD A;  5DD4 A;  3E6M A;  3EUA A;  2Z33 A;  4IX7 A;  1A35 A;  2H27 A;  2EK5 A;  4A3I J;  1F43 A;  3PAS A;  3I4M J;  5CQG A;  1P7J A;  5IT3 A;  3KX2 A;  2GFN A;  4E7I A;  2Y0S N;  3HC7 A;  3RZO J;  1FYM A;  2B9S A;  2E1M C;  4A2U A;  3CUQ B;  4UUV A;  2PBI A;  2VI6 A;  3G3Z A;  2CW8 A;  3IKV A;  3LFK A;  4AVP A;  3CF2 A;  1ZEL A;  1BOB A;  2BV6 A;  2YU9 J;  4ABZ A;  2UXX A;  4B44 A;  5D4R A;  2BHY A;  2L5Q A;  4RGS A;  3DQV C;  3D5R C;  4C2M J;  2Z1D A;  1FLI A;  2DMQ A;  3BWG A;  2ZJ2 A;  2MGQ A;  3AKZ A;  2RGV A;  1R1V A;  1DQU A;  1GT0 C;  2VKV A;  3HTA A;  3AQS A;  2P5L C;  2XAS A;  1BA5 A;  3IC7 A;  3VW1 A;  1MMD A;  5E1X A;  3D0S A;  2E35 A;  3M07 A;  5IOZ A;  3F1B A;  3FXL A;  1VQ5 I;  1DU0 A;  3L00 A;  1WPK A;  1GLN A;  5M5W J;  5H9T A;  4YEL A;  2EV5 A;  2Y2Z A;  4HST A;  3WE2 A;  2GBY A;  4KUM A;  4AF5 A;  4HQM A;  5K7H A;  2HFH A;  4UB6 C;  2E34 A;  1BI3 A;  4I09 A;  3C18 A;  5TRD A;  4LB6 B;  5EDN A;  3GTO J;  2OPT A;  2V9V A;  3M9A A;  2BXZ A;  2ICW G;  2IS1 A;  1HXD A;  1QZY A;  4HOB A;  3LA7 A;  4OMZ A;  1JJ8 C;  3KP4 A;  4F7Z A;  1R1T A;  4RAG A;  5FKN A;  3NI7 A;  3LA2 A;  3CO6 C;  3E6C C;  2H1K A;  1FEX A;  2VLA A;  1DP7 P;  4XLA A;  2BW3 B;  1WJA A;  2XAH A;  5AIP A;  1MBE A;  3DLA A;  3P7N A;  3DXJ F;  3DBH B;  4A3E J;  3B6A A;  2RVC A;  4G9Y A;  1QRY A;  1Z3X A;  2BBY A;  4N4O B;  5CLS A;  4C2M A;  3CCS I;  1BW6 A;  1SEU A;  3VWB A;  1JUP A;  1Z67 A;  2KRH A;  2W25 A;  1SAU A;  2MW8 A;  1QGP A;  1T33 A;  3G7R A;  3JCU C;  2FOW A;  5LHG A;  3I4N J;  2BVM A;  3SFI A;  4HRI A;  3W2V A;  2PN6 A;  4IRI A;  3JW4 A;  2F4M B;  3EUH A;  2QIB A;  1TWC J;  3ZPL A;  2O0Y A;  2XAQ A;  1VQL I;  2DG8 A;  1X58 A;  3FK7 A;  1IRG A;  2R4G A;  2ZNY A;  5JHF A;  3F23 A;  4BNC A;  3CCM I;  4DGW B;  3HTH A;  3FXK A;  3GUD A;  3HOX J;  3K4L A;  4EV0 A;  4BE2 A;  1R6R A;  4UXN A;  1IJW C;  2Y75 A;  1FMW A;  4GO1 A;  5F6F A;  1HST A;  3DCF A;  4BBR J;  4AIH A;  3ECH A;  2B7E A;  2J5P A;  2XPV A;  1VZ0 A;  2O3F A;  2AO9 A;  1XCB A;  2R7Q A;  4PFO A;  2Y31 A;  4BQQ A;  1B59 A;  3RTR A;  3OYA A;  3E7L A;  4WXD A;  1I6X A;  5B3S H;  3S32 A;  3FF5 A;  2VOD A;  4KNY A;  3HUG B;  3L2C A;  2LBF A;  1OFC X;  2JPC A;  1HSJ A;  1S7O A;  2X48 A;  3HM5 A;  2KZG A;  1Y6I A;  3BPX A;  1V5G A;  4BGD A;  4IF4 A;  2WAF A;  4E7L A;  1HDP A;  2Z3Y A;  4CGZ A;  3W2A A;  3QQA A;  1JHH A;  1EV7 A;  3VVX A;  3WTW C;  5IP7 J;  2RDP A;  2DT7 B;  2OQG A;  3TMO A;  5FB2 A;  3TP3 A;  3KCC A;  4CZC A;  4O6J A;  3DEU A;  2R7O A;  4EM2 A;  4A3C J;  2E1M B;  4C3I J;  4PGG A;  5EYR A;  3BG5 A;  2NVT J;  3ULQ B;  2UZK A;  4Y52 J;  3VVY A;  3CME I;  3T6N A;  1MKM A;  3OSF A;  3VSK A;  3CC7 I;  1JUS A;  2DAO A;  2GA1 A;  3BLY A;  4X1E A;  1S8N A;  4YFX F;  3ZMZ A;  5JR3 A;  3ZQI A;  4B3A A;  3MKW B;  4IHV A;  2ZME B;  2ZOY A;  3HEF A;  5HOD A;  4UNO A;  2BY1 A;  3FMS A;  4M9Z A;  4ZYG A;  5J3L A;  3ERM A;  2FE3 A;  3U2R A;  4BQA A;  1B1B A;  2HQN A;  3MZY A;  1XMX A;  5H20 A;  4EJT A;  3LWF A;  2HXO A;  3RPU D;  2HWV A;  4B48 A;  1UG2 A;  1G4D A;  1WQ2 A;  2B3W A;  2ZXH A;  5J1Y A;  3DTI A;  1U3E M;  2EZH A;  3JSP A;  3GFI A;  1O7L A;  1XB4 A;  2YVH A;  1FYK A;  1U8B A;  4G6D A;  4AYB A;  4AU7 A;  3CO7 C;  4J00 A;  3FRQ A;  5K7F A;  1X3U A;  1SFX A;  3SDG A;  4P5O A;  5AQC A;  4JL3 A;  5E3L A;  2V4J C;  3M8E A;  2JT1 A;  2WWY A;  4C30 A;  2DBB A;  4J19 A;  4IKF A;  3CC4 I;  2EIL H;  4NC6 A;  1EH6 A;  1TZL A;  3G56 A;  3CDL A;  3MAJ A;  2VJ4 A;  2OI8 A;  1X4P A;  2Y0S A;  2GZW A;  2CWE A;  4LMY A;  1SFO J;  3TBI A;  4AYB N;  1IUY A;  1H8A C;  4XOR A;  1I3A A;  3WTV C;  3G2B A;  1BI1 A;  3GZI A;  3BG3 A;  3B02 A;  4MHG A;  3QYF A;  3VOE A;  4ZDP A;  4PJL A;  3LST A;  1XSD A;  1JXS A;  5BNG A;  1MIJ A;  1ZK8 A;  4P96 A;  5CVV A;  5FGM A;  5KAI C;  3H3V K;  4JBA A;  1VQ9 I;  1W1W E;  1KYW A;  1TWG J;  2PMH A;  2X4H A;  3WOD F;  5D5W B;  2EFN A;  5DS9 A;  2CYY A;  3CUQ C;  2K02 A;  3D1N I;  2CV2 A;  3HDD A;  2A5Y B;  3JTG A;  3F0C A;  4XOP A;  1MBF A;  4HV6 A;  2P5K A;  2A6T A;  2P8T A;  1V54 H;  2JZY A;  3WTS C;  2L7M P;  1FX7 A;  3V8L A;  3FKJ A;  4EQQ A;  2OC6 A;  3PSF A;  3SWH A;  5FD6 A;  4Z6Y A;  4P9F A;  4M6X A;  4PJ0 C;  1XGN A;  4D0P A;  2ISZ A;  5EF6 A;  2GQQ A;  4PXI A;  2F5F A;  1MJ9 A;  3QPH A;  4XSX F;  5GPC A;  5FLX Z;  2L3D A;  4Y15 A;  1J5Y A;  3SDB A;  3Q9S A;  3BTI A;  3LWJ A;  1LVK A;  3OYJ A;  3DFG A;  5GAG J;  2LFB A;  2K7L A;  1YIO A;  1TW2 A;  2GWR A;  3RDI A;  2LKS A;  4KIT B;  4WX9 A;  1C0W A;  3PJR A;  4RGR A;  1ODD A;  4XON A;  3RYR A;  4YFN F;  1ZG1 A;  3NEU A;  1IG7 A;  4GFL A;  2PMZ A;  2LC2 A;  2HZT A;  5FFX A;  3MZ8 A;  1JKO C;  1GVJ A;  4RB2 C;  2KKO A;  2L02 A;  3A0B C;  2LVS A;  3IWZ A;  5ERI A;  3M7G A;  4CZZ A;  3J7Z I;  3HGY A;  5F1J A;  2HOT A;  4U0Y A;  3S8P A;  2M87 A;  5L3C A;  4JQF A;  2XRL A;  2QQ8 A;  2R7D A;  2DJN A;  3FWE A;  4G6T B;  3M1C A;  1XSX A;  2Q8K A;  3JRF A;  2VE9 A;  1G6N A;  1KYZ A;  1G3W A;  3V7R A;  1Z6R A;  3WTU C;  2VN2 A;  4YFK F;  4I01 A;  3ABU A;  1KGS A;  4O3M A;  4YII A;  5L3G A;  1ZLK A;  2FD5 A;  3RJP A;  3HRT A;  4EGY A;  3ABT A;  1JKQ C;  5D18 A;  1WJD A;  3V4G A;  2YVX A;  4EJV A;  3F3X A;  2H6B A;  1W36 C;  3OYC A;  3S3M A;  2OCC H;  1RPW A;  5J8C A;  3KE2 A;  2PJR A;  1I27 A;  4KN7 X;  4RLQ A;  2NAZ A;  2WV0 A;  1UCR A;  1OCO H;  1U5T A;  2JA2 A;  2P5V A;  2ZSI B;  4J01 A;  4N0B A;  1W0T A;  1ZN2 A;  2GXA A;  1Z1D A;  4RS8 A;  3GFM A;  1E3P A;  4U88 A;  1Z0X A;  3RIR A;  4WWC A;  2BHZ A;  3H0G J;  1NK3 P;  4GFK A;  4WCG A;  4BE1 A;  2QBY A;  3CJR B;  4RAY A;  4DBQ A;  5H6Q A;  4MXM A;  5DM6 F;  4A3F J;  2LKX A;  5FLX K;  4V2G A;  2VQG A;  4PJM A;  4DZJ A;  1RKT A;  4U9L A;  3NS4 A;  1UEL B;  5ED4 A;  2KT0 A;  2EFW A;  1IN8 A;  3KPH A;  1IV8 A;  5EFY A;  4BUP A;  2QF7 A;  4OIQ F;  3WU0 A;  4ZDO A;  1N77 A;  2V6C A;  3JRC A;  5LEJ A;  3K2A A;  1LQ1 A;  3HKZ N;  1N75 A;  1O57 A;  3DWL E;  1WWX A;  2NRA C;  1P7I A;  4ZZL A;  1JKP C;  4MTE A;  4MTD A;  1CQT A;  1K7A A;  2OBP A;  3NAR A;  1L0O C;  2K4J A;  3OIQ A;  1T08 B;  4A3B J;  3J80 Z;  3GLL A;  3QPL A;  4FQG A;  3TKY A;  3H5A A;  3KYC B;  5D5V B;  5D1R A;  1ZRE A;  1MMN A;  2VKH A;  2HTS A;  3H5R A;  3DKY A;  3FXU A;  1FC3 A;  3KP3 A;  5EZG A;  3ZMD A;  2BVL A;  4XBF A;  3P9K A;  5CJ9 A;  3BCG A;  5F08 A;  1LE8 A;  4W1U A;  3CWR A;  3ANP A;  1OYW A;  1SD4 A;  4GYI A;  1KQ9 A;  2TCT A;  1XGS A;  2B0L A;  3K4J A;  2QSF X;  3ASO H;  4OMY A;  4HDV A;  1KU7 A;  3I58 A;  4Y13 A;  3PPB A;  3F9K A;  2HZD A;  5BQT A;  3DKW A;  1WRJ A;  4L5I A;  4UUT A;  4AWX B;  1H0M A;  1QHH D;  1OYY A;  2X1C A;  3IL2 A;  2V9P A;  2EJR A;  3I5U A;  3GTL J;  3JTH A;  2CFO A;  2X6X A;  3GFL A;  4PFP A;  3OYF A;  4E6K G;  4QTR A;  2LY1 A;  4IXA A;  4X0G A;  3S3N A;  1DPR A;  3DU5 A;  1R71 A;  2JA5 J;  3TOB A;  3BHQ A;  2IW5 A;  3BPV A;  4L18 B;  1FTT A;  4IOA F;  4CCJ A;  2H8W A;  5HBU A;  4DVY P;  1G8X A;  3BJO A;  2VOP A;  1MMA A;  4N9I A;  3GX4 X;  5IOY A;  1ETX A;  1JT0 A;  3F8C A;  2W85 A;  3A01 B;  2QM3 A;  2DA1 A;  3OY9 A;  2ESH A;  1BJA A;  2HU9 A;  2ELK A;  4XKW A;  4N4N B;  2OZU A;  2QCO A;  2YR2 A;  1CF7 A;  1MBJ A;  1XN7 A;  3VTI A;  3JAM K;  5HLI A;  1WJB A;  2E7W A;  1X1A A;  3R0A A;  1Z7U A;  3ZN0 A;  1MDM A;  2P7V B;  4XKB A;  3EYY A;  2FUG 2;  4NNJ A;  2P81 A;  5E3O A;  1K6O A;  4ME9 A;  1MW7 A;  2F5V A;  2OV7 A;  3HPG A;  4A3K J;  3PO2 J;  1B6A A;  3I54 A;  2MSY A;  1DDN A;  2UXU A;  2HDC A;  1E0E A;  1OCC H;  4A12 A;  3JRA A;  4II3 A;  1RIO H;  3C2G A;  4GXO A;  3CQZ J;  5GP9 A;  1D0X A;  2IS6 A;  3MWM A;  1R4N B;  2R5Z B;  5ILV A;  2M3A A;  3CDI A;  1DUX C;  1T0F A;  1XMA A;  3MEX A;  2QSG X;  2CW0 F;  4A0X A;  3BP8 A;  2V1U A;  4FX4 A;  4GYG A;  3QPT A;  1SC7 A;  3BZC A;  3FXR A;  2GOM A;  5EZH A;  4BL0 B;  3OYH A;  2FA5 A;  5GPA A;  1T2K A;  2NNY A;  1CGP A;  1LFP A;  2GOX B;  2A05 A;  2OU2 A;  4L5J A;  4NUB A;  2JRM A;  4G94 A;  1T95 A;  2HVQ A;  4WXH A;  3BR6 A;  2R7R A;  1IGN A;  3V78 A;  2ADU A;  3MNL A;  2X9D A;  3RKX A;  4OAY A;  1EJ9 A;  1J59 A;  4IL6 C;  3T0Y A;  1W36 D;  3ISP A;  5A2Q Z;  2RKH A;  1F36 A;  1X3Z B;  2AQF A;  3A02 A;  4I0A A;  4YIR X;  3JRG A;  3BNI A;  2FRH A;  3EUH C;  2GAU A;  4AVZ A;  1ZR2 A;  4BDZ A;  2XGX A;  1IRF A;  1ZGA A;  1M1E B;  3U21 A;  1WI9 A;  1WKM A;  2VJ5 A;  4L0Y B;  2DG7 A;  1MNE A;  3R6S A;  3FXQ A;  1X1P A;  1NK2 P;  3EET A;  1I5Z A;  3E5U A;  3REO A;  1UJ8 A;  3OYG A;  5ICF A;  4IHX A;  2B63 J;  2R5Z A;  1SD6 A;  1YLF A;  3N97 A;  5CYV A;  4NN1 A;  2VL8 A;  3CC2 I;  2E5N A;  4CYD A;  3CMM A;  2H94 A;  3VVZ A;  1S6L A;  5J4Y A;  4GFB A;  3QRF F;  4AID A;  1J9I A;  2DQL A;  3TW6 A;  4BH9 A;  3ZP5 A;  3CLQ A;  1EH7 A;  1MBK A;  3EQL F;  4BQN A;  3CTA A;  2L01 A;  4F55 A;  3HTI A;  2EV6 A;  2VC0 A;  4RAF A;  5ILS A;  4IRH A;  1A36 A;  3OWT A;  4Z2Y A;  4RM3 A;  4TV7 A;  4IRV A;  4XMY A;  3LOC A;  1RUN A;  3BJA A;  3LHQ A;  3ZMV A;  1N78 A;  2CS3 A;  5EEA A;  4BAY A;  4ENN A;  2FEZ A;  4JYK A;  2KHM A;  2A5W A;  3ON4 A;  4WK8 F;  2VQH A;  3H9G A;  2DA5 A;  3TO7 A;  1HBX G;  2VPR A;  3S1M J;  1IC8 A;  2F4O B;  4MIM A;  3L9F A;  3F21 A;  3K8P C;  4M73 A;  1DP3 A;  3H35 A;  2XF5 A;  3HGG A;  3IV5 A;  2BY0 A;  5GAD J;  3DEE A;  3RKY A;  2EB7 A;  4BJ6 C;  1ETV A;  2ZSH B;  3BDD A;  3K4C A;  4RB0 A;  3E1S A;  5J4V A;  2LK2 A;  3ELK A;  3P9I A;  3ZQ7 A;  2DPD A;  2M7B A;  1PVE A;  1A04 A;  1YW7 A;  4UUS B;  2LD5 A;  3K4K A;  4V19 K;  3WU2 C;  2E1C A;  2GXB A;  5CVR A;  5J6X A;  2L4M A;  5ILU A;  2Q2E B;  2K86 A;  2M34 A;  2VBZ A;  4A6E A;  1U8R A;  2JVG A;  1E2X A;  2HOA A;  2BY3 A;  4PSX A;  4XRS A;  3W6J B;  4CDG A;  3ZQC A;  4XRS G;  1HQC A;  1XGO A;  2EH3 A;  5IPA A;  2QEN A;  1XCV A;  2XDV A;  3M8J A;  4ZYH A;  1FP2 A;  3BRO A;  2Z16 A;  3BY6 A;  3BCA A;  3RH2 A;  2YX4 A;  3OYL A;  3E5X A;  1ETK A;  2MC4 A;  3G6E I;  1V5E A;  4R1H A;  3P9C A;  2RAE A;  3RCO A;  4BU2 A;  2G7G A;  3DTK A;  2V57 A;  1QQI A;  4FX0 A;  1G59 A;  3J7A Y;  2W48 A;  2V6E A;  2HYJ A;  3H5N A;  4ICH A;  4G12 A;  3V7S A;  1Z91 A;  1XG1 A;  2W1O A;  2HNH A;  4H0E A;  4IHY A;  3IH3 A;  4U0W A;  4NQW B;  1PUF B;  1ERD A;  2LY9 A;  1P2F A;  1IN4 A;  3GTP J;  2FBK A;  2BW3 A;  2IP2 A;  2DT6 A;  2DT5 A;  2IGO A;  3HB9 A;  1ZRC A;  2EFQ A;  1FSH A;  1R9T J;  3PQJ A;  3DPU A;  2MLG A;  3JAM Z;  1LFB A;  1IDZ A;  3WG7 H;  2BXY A;  3G71 I;  2G7S A;  2ZB9 A;  1SVL A;  3QOD A;  2M5W A;  3SYT A;  2WBM A;  3IH4 A;  4M3E A;  2STT A;  4P1W A;  3A4C A;  4I7H A;  4C3J J;  1QHG A;  1ZQ3 P;  2G0E A;  3ERE D;  2X6Y A;  3V8K A;  4EEF G;  4IZZ A;  1ON1 A;  2DI3 A;  4YIF A;  2FOK A;  4M72 A;  5K1Y A;  3VSL A;  3BC8 A;  2CV0 A;  2NVQ J;  2JVH A;  1TWA J;  2IS4 A;  5BMZ A;  2DOD A;  2OZ6 A;  3K1P A;  1Y0N A;  2MLK A;  2R3S A;  5HNF A;  4HX7 A;  5E8G A;  3D5L A;  3FX3 A;  1RC9 A;  4LB5 A;  3FHN A;  1UI5 A;  2HXI A;  2DMT A;  3BR3 A;  2WY8 Q;  2NS7 A;  2HQA A;  5B1B H;  2W7N A;  5HLG A;  1OLT A;  5K5O A;  1X3W B;  4RLF A;  2E1N A;  2RQP A;  4RGX A;  1GV2 A;  3HUG A;  2VJI A;  3BRU A;  4NC8 A;  3EUK L;  1AKH A;  1FT9 A;  5CPR B;  3J81 K;  1MD0 A;  2O8X A;  1HKS A;  1ZGJ A;  2IBD A;  3LQR A;  4EAT A;  1FTZ A;  4HF1 A;  1SD7 A;  3FDY A;  2E60 A;  2ELH A;  3FMR A;  4CGR A;  5KHD A;  2DTR A;  3VYS B;  1Y1W J;  2EIN H;  4L62 A;  2FBH A;  3WTX C;  1WJF A;  1VQ4 I;  3KNW A;  4PCQ A;  2DA7 A;  4I2O A;  4HKU A;  2LF8 A;  1T0F C;  4LOC A;  2DA6 A;  4CCL A;  1QVT A;  2LBF B;  3COA C;  1VQ6 I;  1LKX A;  1BOA A;  2EIJ H;  3ZQL A;  3HPH A;  5HNH A;  4GRI A;  2V26 A;  5F64 A;  3SZP A;  5GAE J;  3SZT A;  1AWC A;  1G2H A;  4BY7 J;  3BZ6 A;  1JTX A;  3F72 A;  2R7W A;  1P92 A;  1IUF A;  2K9N A;  2Q24 A;  4BQO A;  1OR7 A;  2HKU A;  1Z6T A;  3HL2 A;  1LDD A;  4L9N A;  1I1G A;  3PM1 A;  3G4S I;  3M1E A;  4UB8 C;  1IF1 A;  2JA7 J;  2DK5 A;  4LIV A;  1SFU A;  1DU6 A;  4E7J A;  1KQ8 A;  1ITY A;  4AC6 A;  3T1B A;  2B1E A;  3K0L A;  3G1M A;  3NRG A;  1BR2 A;  4WIB A;  2VUM J;  3ML6 A;  3P9T A;  3KKD A;  1J09 A;  2GUH A;  2ZNZ A;  3X2Q H;  1FPQ A;  5B66 C;  2EV0 A;  1I6H J;  3C2B A;  2ID3 A;  4UV8 A;  5L3D A;  2W57 A;  2ZJP F;  3LA3 A;  3R0J A;  1Y8Q B;  4IJA A;  2BGC A;  4MFE A;  5IP6 A;  2DMU A;  2G9W A;  5DCM A;  2H1L A;  1JT6 A;  4W97 A;  2YVE A;  2JUG A;  4A3M J;  1ENH A;  1W5C C;  3ABM H;  4KA4 A;  1D1C A;  2OQR A;  3EDP A;  3GBG A;  5E1W A;  5KK1 A;  3RPU A;  3ROU A;  2OD5 A;  3JRH A;  2LTP A;  1QNT A;  4CXF A;  2KP6 A;  2E36 A;  3S17 J;  4DNC A;  3OMY A;  2CQ7 A;  5CQE A;  4LG3 A;  3MD2 A;  1BL0 A;  4NB5 A;  1UAA A;  2WAD A;  3VFZ A;  3O3K A;  1MGT A;  3PNV A;  1UST A;  4EM0 B;  5FHP A;  3DEW A;  2AHQ A;  4ZH4 F;  3IWF A;  1VQM I;  2HVR A;  5LHI A;  1ZG3 A;  2X1D A;  2AXL A;  3VB2 A;  4G6Q A;  2ZXJ A;  2MD0 A;  2A61 A;  2NVU B;  1GDT A;  2GA2 A;  4WF2 A;  3I0T A;  2OA4 A;  1IRX A;  3WG9 A;  1FMV A;  4IOC F;  2QUF A;  2NNN A;  1TLH B;  3JSO A;  4KJZ A;  4XLN F;  1WJC A;  3C1D A;  2RQQ A;  2OTL I;  3LSR A;  4KT6 A;  2O5R A;  3KZI C;  1BC7 C;  1EKE A;  1IN5 A;  2O8K A;  3J7Y J;  1V4R A;  3N4M A;  2FQ4 A;  1OIS A;  2LSO A;  1TC3 C;  5CW8 A;  2KZV A;  1CF7 B;  3GO5 A;  4XRF A;  5CVU A;  1FBQ A;  5LFA A;  1Y56 A;  2JTV A;  2ZC2 A;  2LNB A;  3H1C A;  3KEY A;  5L3B A;  5D6E A;  1TT0 A;  2VBY A;  2NP5 A;  3A01 A;  1D5Y A;  4HA8 A;  2G3B A;  2GLO A;  2DQR A;  3I59 A;  3HOW J;  1D3Y A;  1E3O C;  5DYM A;  4BS9 A;  2RAS A;  2KIM A;  3A2K A;  3A03 A;  4CCM A;  2L2O A;  2MH9 A;  2LF7 A;  4HZF A;  1WI3 A;  2PI0 A;  3HOS A;  1APL C;  4UHT A;  2MG4 A; 
#chains in the Genus database with same CATH homology
 4I76 A;  2L7F P;  4A3B J;  1ZR4 A;  3GEU A;  4DYC A;  1WGX A;  3QPL A;  4BXX J;  3TW7 A;  5D1R A;  4JX5 A;  2KDZ A;  1HLV A;  1WH7 A;  4XID A;  5F04 A;  3KZ9 A;  2ID6 A;  2M9H A;  5EGO B;  2JA6 J;  3RD3 A;  1S7E A;  2GM4 A;  4CYC A;  5EZG A;  5FKK A;  2R5Y B;  2QOP A;  5M3M J;  3BQY A;  3MKL A;  1ETY A;  2L9R A;  3BCG A;  5F08 A;  1LE8 A;  4W1U A;  3CWR A;  3IUV A;  5FJ8 J;  2LP0 A;  1SGM A;  3ANP A;  5CXI A;  1X2M A;  2E2J J;  2R7Z J;  4DYQ A;  1ZGW A;  1TWH J;  1IRZ A;  2TCT A;  5C4X J;  5FLV A;  4GCK A;  5EG0 B;  2COB A;  1FIA A;  3PPB A;  1NTC A;  2NS8 A;  1BJZ A;  4UUT A;  3NNR A;  3LSG A;  5FKM A;  4D5C A;  1JJ6 C;  3OOU A;  5E3M A;  3GTL J;  2QTQ A;  4KWA A;  1B8I B;  1TWF J;  1ZKG A;  2O7O A;  2DA4 A;  2DTZ A;  4DYR A;  4QTR A;  4XRM A;  1ZTR A;  3G1L A;  1RET A;  3IH2 A;  2JA5 J;  2UXH A;  3BHQ A;  1FTT A;  1Z77 A;  5HBU A;  5F27 A;  3V6G A;  2XGE A;  2REK A;  3FK6 A;  5FKO A;  2ME6 A;  2L0K A;  3B81 A;  1K61 A;  5IOY A;  1ETX A;  1JT0 A;  3QKX A;  2ECB A;  3RZD J;  3HBL A;  1HF0 A;  3A01 B;  2XB0 X;  1JTY A;  2UXP A;  5C3E J;  2DA1 A;  2ELK A;  5EGO A;  3FIW A;  4M3B A;  2M8G X;  3RKQ A;  4A69 C;  1UMQ A;  2QCO A;  3ZQH A;  1MBJ A;  1UHS A;  1A6I A;  2M0C A;  2FX0 A;  5F0H A;  5JLX A;  2QKO A;  2NVX J;  2JWT A;  1U9N A;  1OJL A;  3BTL A;  4BBS J;  2XPW A;  3ZQG A;  3VP5 A;  2ECC A;  2XSD C;  5E3O A;  2P81 A;  5FGL A;  4ME9 A;  2E19 A;  2L7Z A;  9ANT A;  3COL A;  2VKE A;  3RQI A;  4D5F A;  2CQX A;  3GTM J;  4A3K J;  3PO2 J;  5E3N A;  2MSY A;  3TP0 A;  1I50 J;  2DA2 A;  3HIM A;  4DW6 A;  4B4C A;  2UXU A;  2EBI A;  2ME0 A;  4V2F A;  1ORK A;  3LNQ A;  3HE0 A;  2M2E A;  3JRA A;  4BKX A;  1SAN A;  1JUM A;  3CQZ J;  5GP9 A;  3TED A;  1U9O A;  1JKR C;  2CRG A;  2WAQ N;  3SJM A;  2XGD A;  5HAW A;  2R5Z B;  3M4O J;  4MFD A;  3S1Q J;  1HOM A;  1B8I A;  2I10 A;  3W6V A;  1XC5 A;  4A3I J;  3CRJ A;  1F43 A;  3PAS A;  1HCR A;  2HQ5 A;  4XIC A;  3I4M J;  2NP3 A;  1P7J A;  2GFN A;  5EZH A;  2Y0S N;  5GPA A;  2OER A;  3RZO J;  4UUS A;  2DMP A;  1EF4 A;  3VPR A;  5IYB J;  2CUE A;  2NX4 A;  2VI6 A;  2N8G A;  1OCP A;  3BR6 A;  2OF7 A;  2Y9Z A;  1IGN A;  1X2N A;  3V78 A;  3MNL A;  2X9D A;  5HSZ A;  4A3D J;  2YU9 J;  4ABZ A;  3ZQF A;  4M6V A;  1AHD P;  4NDL A;  4C2M J;  2DMQ A;  3BG9 A;  1H88 C;  2MGQ A;  5FKL A;  1F36 A;  1MBG A;  2R93 J;  3A02 A;  4CYC B;  3GTJ J;  5FLM J;  3JRG A;  1GT0 C;  3BNI A;  2VKV A;  1ZR2 A;  3HTJ A;  3HTA A;  4FE4 A;  3AQS A;  1BA5 A;  3VW1 A;  3BTC A;  2LLK A;  2DG7 A;  2X6O A;  5IOZ A;  3F1B A;  2ZOZ A;  1NK2 P;  1DU0 A;  2R92 J;  4I6Z A;  1WPK A;  5M5W J;  5H9T A;  4IHX A;  2JK3 A;  2Y2Z A;  2B63 J;  2R5Z A;  2GBY A;  4AF5 A;  3Q3S A;  2H8R A;  4HNV A;  5K7H A;  4IEJ A;  1O4X A;  4NN1 A;  3VIB A;  4JNN A;  5EDN A;  3VVZ A;  3GTO J;  2OPT A;  4GFB A;  1T56 A;  2HI3 A;  1POG A;  3HOY J;  3Q0W A;  3GTG J;  2WGB A;  3TW6 A;  1JJ8 C;  1MBK A;  2DA3 A;  3HTI A;  5FKN A;  3NI7 A;  2H1K A;  1FEX A;  3LOC A;  2E1O A;  1MBE A;  2Y9Y A;  4A3E J;  3B6A A;  3LHQ A;  1QRY A;  5EEA A;  1BW6 A;  4JYK A;  1JUP A;  2IAI A;  2XGC A;  3ON4 A;  2MW8 A;  2JA8 J;  1T33 A;  2DA5 A;  3G7R A;  1RES A;  3I4N J;  2EZK A;  2VPR A;  3SFI A;  2EQR A;  1YRN A;  3S1M J;  1IC8 A;  3Q0U A;  3EGQ A;  4MIM A;  3QPS A;  4QSH A;  3S5R A;  1PUF A;  3HGG A;  3CCY A;  3CMY A;  3IV5 A;  2QIB A;  1VND A;  3S15 J;  1ETV A;  3VW0 A;  1TWC J;  4MK6 A;  2ZCM A;  2LK2 A;  2DG8 A;  1X58 A;  3FK7 A;  1AU7 A;  3NPI A;  3S14 J;  3O8H A;  4NEL A;  3L1P A;  3JRI A;  4UUS B;  2LD5 A;  4UDS A;  1OCT C;  1ETO A;  3HTH A;  2WV1 A;  2O7T A;  3HOX J;  2M34 A;  2ZCN A;  3LSJ A;  2HOA A;  4XRS A;  2HDD A;  1IJW C;  2FBQ A;  4FIS A;  3ZQC A;  3DCF A;  4XRS G;  4BBR J;  4D7N A;  2EH3 A;  5IPA A;  4D7M A;  3O8G A;  3RH2 A;  2XPV A;  3AQT A;  2AO9 A;  1XS9 A;  4FTH A;  2XDN A;  2Y31 A;  1ETK A;  3E7L A;  2XPU A;  1A5J A;  2E2H J;  3WHB A;  2RAE A;  3BR1 A;  3S1R J;  4RBO A;  5F0C A;  1OFC X;  2X48 A;  2QWT A;  2R5Y A;  5J1U A;  3HM5 A;  4M3D A;  1MSE C;  2G7G A;  2V57 A;  2W48 A;  2HYJ A;  1HDP A;  4ICH A;  4G12 A;  1XG1 A;  3ANG A;  4IHY A;  3QQA A;  3IH3 A;  3NXC A;  1I3Q J;  1PUF B;  4L5E A;  2LY9 A;  4QIW N;  1AKH B;  5IP7 J;  3VVX A;  3BR0 A;  3GTP J;  3TP3 A;  2R0Q C;  5EG0 A;  3HB9 A;  1JGG A;  1LFU P;  4A3C J;  1R9T J;  4C3I J;  5EYR A;  3BG5 A;  3OSG A;  2NVT J;  2HYT A;  1LFB A;  4Y52 J;  1IDZ A;  3VVY A;  3T6N A;  2G7S A;  2ZB9 A;  3OSF A;  4C3H J;  4B1R A;  3S1N J;  3KKC A;  1JUS A;  2UXI A;  3IH4 A;  4M3E A;  4X1E A;  3ZQI A;  4B3A A;  4C3J J;  5J1R A;  4IHV A;  1ZQ3 P;  2GEN A;  2G0E A;  3HOV J;  3HEF A;  5HOD A;  2W53 A;  2ZOY A;  4EEF G;  3FKI J;  2JJ7 A;  5J3L A;  3WHC A;  4ACI A;  3BJB A;  1MH4 A;  4A3J J;  2CUF A;  4RDU A;  3LJL A;  2NVQ J;  5DAJ A;  1TWA J;  2HXO A;  1UG2 A;  3CJD A;  3VUQ A;  5J1Y A;  2CJJ A;  1MBH A;  2EZH A;  3JRD A;  2YVH A;  1U8B A;  1U78 A;  1UI5 A;  2HXI A;  2DMT A;  3BR3 A;  3ON2 A;  3FRQ A;  2NS7 A;  2XB5 A;  3HOU J;  3O60 A;  3GTK J;  3C07 A;  5K7F A;  1VI0 A;  3SDG A;  4X6A J;  5AQC A;  4JL3 A;  5E3L A;  1GV2 A;  4A3G J;  3BRU A;  4J19 A;  1AKH A;  3VOK A;  2WUI A;  3G56 A;  4GCT A;  4MO7 A;  3CDL A;  1W0U A;  1GV5 A;  2OI8 A;  1B72 A;  2FJ1 A;  5M3F J;  1SFO J;  2IBD A;  4AYB N;  1FTZ A;  1H8A C;  1MNM C;  3GZI A;  5IP9 J;  1YRN B;  3BG3 A;  2PBX A;  1K83 J;  3BTJ A;  3DPJ A;  5BNG A;  2K9S A;  4CGR A;  1ZK8 A;  2O9L A;  5IYD J;  3H3V K;  1TWG J;  1Y1W J;  4L62 A;  2JN6 A;  4YZE A;  5DS9 A;  3KNW A;  2D6Y A;  2D5V A;  3VOX A;  2CU7 A;  2DA7 A;  3D1N I;  4HKU A;  3HDD A;  4AUX A;  4GCL A;  3F0C A;  1MBF A;  4LOC A;  2DA6 A;  3M3Y J;  3E7Q A;  1QVT A;  5F0F A;  3ZQL A;  4Y7N J;  5C44 J;  2L7M P;  3GTQ J;  1Q1V A;  1G2H A;  4BY7 J;  2ZCX A;  1JTX A;  2PMZ N;  4FE7 A;  1IUF A;  2K9N A;  1QPI A;  4A3L J;  2Q24 A;  3Q0V A;  2HKU A;  2IEK A;  1BW5 A;  1VFC A;  5EF6 A;  4FCY A;  4PXI A;  3PM1 A;  5GPC A;  4BY1 J;  3HOZ J;  2CQQ A;  2JA7 J;  5C4J J;  1GVD A;  1DU6 A;  3BTI A;  5M5X J;  1ITY A;  4AC6 A;  3LWJ A;  1LE8 B;  5K7Z A;  3G1M A;  3NRG A;  5D19 A;  4IHW A;  2VUM J;  2LFB A;  3P9T A;  2F07 A;  3KKD A;  2GUH A;  4M3F A;  1WCM J;  1I6H J;  3C2B A;  2ID3 A;  2JMW A;  2K9Q A;  1HDD C;  5CXG A;  1IG7 A;  4GFL A;  1FJL A;  2UXO A;  2PZ9 A;  3BQZ A;  1ETW A;  1JKO C;  4MFE A;  5IP6 A;  2DMU A;  3BT9 A;  2HOS A;  2DN0 A;  5K58 A;  1JT6 A;  4W97 A;  1Y1V J;  2LVS A;  3S2D J;  2YVE A;  3EUP A;  4A3M J;  1ENH A;  4DZP A;  1B72 B;  3S16 J;  1GUU A;  3HGY A;  5F1J A;  3GBG A;  2NVY J;  2HOT A;  1IDY A;  4JX6 A;  2XRL A;  3UKG A;  5FMP A;  3JRH A;  3JSJ A;  2LTP A;  2DJN A;  1FIP A;  3JRF A;  4AC0 A;  5DTD A;  3ZOB A;  4MLO A;  3S17 J;  1BL0 A;  2EZI A;  2RHA A;  1H89 C;  3BR5 A;  4JP0 A;  5FHP A;  1RKW A;  2FD5 A;  3S2H J;  2Y30 A;  2G7L A;  1JKQ C;  3DEW A;  2AHQ A;  5D18 A;  3NAU A;  4M3G A;  3B6C A;  2NOG A;  3FIS A;  5JLW A;  1RPW A;  4S0H B;  2DMN A;  1GDT A;  2E2I J;  5IYC J;  5M5Y J;  1QVU A;  3JRB A;  3LSP A;  1W0T A;  3LSR A;  1Z0X A;  2O8K A;  2LR8 A;  2WB1 N;  3H0G J;  3JR9 A;  1NK3 P;  4GFK A;  2FQ4 A;  1TC3 C;  3VW2 A;  2YS9 A;  1RR7 A;  3MN2 A;  5CW8 A;  4MXM A;  4A3F J;  3G1O A;  2LKX A;  4V2G A;  4XK4 A;  1ETQ A;  3K7A J;  4DZJ A;  1VF9 A;  1RKT A;  5C4Y A;  2TRT A;  3OIO A;  3JRE A;  2KT0 A;  2NP5 A;  2YUS A;  3A01 A;  4JKZ A;  2EZL A;  4JX4 A;  3BR2 A;  1D5Y A;  2G3B A;  2GLO A;  3HOW J;  5EFY A;  2QF7 A;  2IU5 A;  1E3O C;  1UI6 A;  2RAS A;  3JRC A;  3PO3 J;  3K2A A;  2K40 A;  1IV6 A;  1MH3 A;  3HKZ N;  3A03 A;  1MSF C;  3QBM A;  1WH5 A;  4A93 J;  1P7I A;  1JKP C;  1WI3 A;  3MVP A;  1CQT A;  1APL C;  2MG4 A;  3NAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...