2FD5A

The crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
180
structure length
180
Chain Sequence
b'MSDKKTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEAFEQLLGKRRELLGELDPGLSGKERRALAAAFYLSRKHRDAQVDAGCPLPATLAEVARLPEGFREVLSRHVEIMVTSLAESPEETDVALADLVLMIGGLALARALGPGELSDRVLRAAKQAVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator
publication title The crystal structure of a transcriptional regulator from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
total genus 71
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2fd5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2fd5A02
2IAIA 4C3HJ 1LFBA 1ORKA 4EEFG 2M2EA 5IP9J 3S16J 1RPWA 2IEKA 2YU9J 4A3LJ 5J1YA 2E2IJ 4FE7A 2QCOA 1RR7A 4L5EA 1B8IA 2LTPA 1G2HA 2I10A 4IHYA 2UXOA 2UXUA 1TWAJ 4UDSA 2XB5A 2NVTJ 1LE8A 2E1OA 3ZOBA 1JT0A 3GTKJ 3RD3A 3G1OA 1PUFA 1UI5A 3LSJA 4C2MJ 5DS9A 2G7GA 4A3GJ 2D6YA 3HOVJ 1I50J 3BG5A 4D7NA 2WGBA 3SJMA 1ZR4A 4BKXA 4M3GA 3ANPA 2HKUA 1YRNB 3A01B 2VPRA 2XSDC 4M3DA 1EF4A 2O8KA 1UG2A 2JMWA 2GFNA 5FHPA 1VFCA 5FKMA 2YUSA 5C4YA 3DCFA 5DTDA 3IV5A 1I3QJ 2WV1A 5J1RA 5FJ8J 1IRZA 1FEXA 2FX0A 3LJLA 3Q0UA 3LOCA 5C44J 1MSFC 2MGQA 4JX5A 3S14J 1ETXA 3ZQIA 1JJ8C 5E3NA 2PBXA 4C3JJ 3GTOJ 3HBLA 1RESA 3O60A 4XIDA 2LY9A 4FCYA 1O4XA 3S2DJ 3GTLJ 3HOZJ 4W1UA 4XK4A 2L9RA 1ZR2A 5C3EJ 3NNRA 2EQRA 3JRFA 1ITYA 1GV5A 2LFBA 2AHQA 4CYCA 2YS9A 3JRCA 3TP0A 9ANTA 3VOXA 3JRGA 2NP5A 4B4CA 1QPIA 3BG9A 5CXIA 3JRDA 1B72A 1Z77A 2DA1A 1GDTA 5FKNA 3PO2J 3VW1A 1FTTA 4D5FA 3NXCA 1IDYA 1BW6A 3ON4A 2X9DA 4IHXA 4XRSA 3LSRA 2R7ZJ 3VP5A 3PO3J 3HGGA 1TWGJ 4J19A 5FMPA 3RZOJ 4IHWA 2ZCNA 3ON2A 1TWCJ 4M3FA 4JYKA 3TW7A 3IUVA 2L0KA 2QF7A 3B6CA 3FK6A 2ID6A 1RETA 5FLMJ 4DYQA 2JA5J 3S5RA 2DMTA 2FQ4A 5JLWA 1X2MA 4W97A 5FKKA 5IPAA 1HDPA 3HOUJ 3KKDA 4DYCA 2E19A 1R9TJ 3PASA 1VI0A 1ETKA 1WI3A 3AQSA 2LVSA 5K7HA 4JNNA 3S1MJ 4M3BA 3Q0VA 2DMUA 3OOUA 3ZQHA 1QVUA 1QVTA 3COLA 2G0EA 3FK7A 1MBEA 4Y52J 3S15J 3VUQA 3Q3SA 3NPIA 1X2NA 2CUFA 4D7MA 3ZQFA 3JRBA 3A03A 2HXOA 3FKIJ 3Q0WA 3GEUA 1ETWA 3WHCA 5IP7J 2PZ9A 2FD5A 2JA8J 2WUIA 2B63J 2HOTA 3OSFA 2RHAA 2UXHA 3CJDA 3HTIA 1K83J 1K61A 5EEAA 4HNVA 1JKQC 3GBGA 1GUUA 1Y1WJ 1DU6A 4ME9A 1MBFA 3BTCA 4KWAA 5GP9A 2DA4A 3CWRA 5M5YJ 2W48A 4B1RA 2XDNA 4A3CJ 5BNGA 2Y0SN 1NK2P 2ZCXA 4MLOA 3W6VA 3F0CA 2DMQA 2NVXJ 2NVQJ 2JN6A 2N8GA 4D5CA 2XPWA 2CJJA 4IEJA 4A3KJ 3RH2A 1CQTA 5IP6A 1MBKA 5HBUA 4ICHA 5CXGA 4BBSJ 5D19A 5EGOA 4L62A 1XG1A 3G56A 3O8GA 1P7IA 2ECCA 2ZB9A 1UI6A 4QSHA 5F08A 1JJ6C 3WHBA 2FBQA 1XC5A 1IV6A 3GTQJ 1WH5A 4UUTA 3DPJA 3G1MA 4JP0A 3K7AJ 1JUPA 5E3LA 1BW5A 2OERA 2QIBA 2O9LA 3QQAA 2K40A 3BTLA 3HTAA 4IHVA 5M3MJ 2DMNA 2M0CA 1WCMJ 3BRUA 1TWFJ 3V6GA 4MK6A 2EZIA 1AHDP 4GCTA 1U8BA 4JKZA 2UXIA 4LOCA 1FJLA 4UUSA 2Y2ZA 2DN0A 5M3FJ 3H3VK 1ZKGA 5GPAA 2XRLA 3BT9A 3KNWA 3JRAA 3VW0A 5IOZA 5IYDJ 5EYRA 5IYCJ 2DA7A 5FKLA 3HOXJ 1W0UA 3GTGJ 1BA5A 3ZQGA 2CQQA 2JA7J 2M8GX 4X1EA 4X6AJ 2LKXA 1LFUP 4G12A 2RAEA 3LNQA 1JTXA 5EG0B 4MFDA 2YVHA 3ANGA 3BR3A 3MVPA 4ACIA 1VNDA 4MIMA 2PMZN 3KKCA 3G7RA 5DAJA 1U9NA 3KZ9A 3BQYA 4NDLA 3BR5A 3OIOA 1RKWA 1MBJA 3VIBA 1GV2A 2HOAA 3LWJA 1WPKA 4GCLA 5E3OA 3AQTA 5HAWA 3NRGA 2R5YA 2H1KA 1XS9A 3BNIA 1MBHA 2DA2A 2LK2A 3G1LA 3LSGA 5HSZA 2NS8A 2ECBA 4C3IJ 1GT0C 5IOYA 4YZEA 2VUMJ 2V57A 3IH4A 5EDNA 2XGEA 3TW6A 1HLVA 2OI8A 3RZDJ 3VPRA 2COBA 4A3DJ 2G7LA 1APLC 2CUEA 2ID3A 2XPVA 3JREA 3S1QJ 1T56A 3GTMJ 4GFLA 4XICA 3CMYA 1H89C 2LD5A 5AQCA 3MKLA 1B8IB 3RQIA 1ETOA 2XGCA 2NOGA 2ZOZA 1JGGA 1LE8B 1MH4A 4M6VA 2DA6A 1DU0A 2K9NA 1TC3C 3L1PA 3HTHA 3IH2A 3NAUA 2R5ZB 4A3IJ 2GUHA 2CU7A 2HQ5A 1Z0XA 4BBRJ 4A93J 5EFYA 3C2BA 1YRNA 3A01A 1AU7A 3HIMA 3HDDA 2G3BA 1OCPA 1POGA 3E7LA 1ZQ3P 2Y31A 1HOMA 5CW8A 1A6IA 1IC8A 1GVDA 2TCTA 3HB9A 4BXXJ 4NN1A 1SANA 3VVZA 4B3AA 2K9QA 5F0HA 5EZGA 2AO9A 2DTZA 2L7MP 1IJWC 4A69C 1H88C 2DA3A 1IUFA 3NARA 3M3YJ 4Y7NJ 3I4NJ 3MNLA 1IDZA 3QKXA 2JA6J 5K7ZA 2OF7A 2X48A 1MSEC 3BQZA 1IG7A 4NELA 3QBMA 4DZPA 4M3EA 3H0GJ 2XB0X 3QPLA 2GLOA 1A5JA 3JR9A 3HOYJ 5C4JJ 1AKHB 2HXIA 5F0FA 3HTJA 2HOSA 2NVYJ 1B72B 1ETQA 2KDZA 2EZHA 3EGQA 4AC6A 5J3LA 2HYJA 2DG7A 3HGYA 3MN2A 2R92J 3C07A 3HE0A 3S1RJ 4JL3A 3CQZJ 4MFEA 1OFCX 1D5YA 2MW8A 2RASA 4PXIA 3JRIA 2LLKA 3CRJA 4AUXA 1JKOC 3RKQA 3EUPA 4XRSG 1JKPC 3CCYA 1F43A 2F07A 1FIPA 1Q1VA 2L7FP 3VOKA 1F36A 2WB1N 3QPSA 2JJ7A 3HOWJ 3BR2A 2X6OA 3CDLA 3IH3A 2FJ1A 5FKOA 1NK3P 5HODA 1MNMC 3BCGA 2HI3A 2EH3A 2MSYA 2QKOA 3TP3A 4BY7J 2VKEA 3S2HJ 1ZK8A 2O7OA 2CQXA 3K2AA 3TEDA 4I6ZA 2Y30A 1ETVA 2QWTA 1IGNA 2REKA 4FTHA 4GFKA 3BR1A 2DMPA 2Y9YA 1OCTC 3T6NA 2R5ZA 4QIWN 1T33A 3LHQA 1WH7A 1ETYA 1JUMA 2CRGA 1U9OA 5D1RA 1HCRA 3BR0A 3BTJA 5F1JA 1WGXA 1HDDC 2IBDA 2QOPA 2G7SA 5F0CA 4FE4A 2IU5A 5F04A 4HKUA 5FLVA 3VW2A 3PM1A 3JSJA 4RBOA 5GPCA 1U78A 4JX6A 2HYTA 5H9TA 1VF9A 3GZIA 1UHSA 3BG3A 5E3MA 3HM5A 1JKRC 3B6AA 3FISA 3VVYA 2ME6A 3ZQCA 3S17J 3DEWA 4A3MJ 2ME0A 4MXMA 1HF0A 1Y1VJ 4AC0A 3VVXA 3FIWA 2M34A 3PPBA 1SGMA 2O7TA 4A3EJ 5K7FA 2GM4A 4DW6A 2QTQA 4A3FJ 3NI7A 3A02A 2NS7A 3SDGA 2E2JJ 1MBGA 2M9HA 1AKHA 4GCKA 2WAQN 2XGDA 2UXPA 3LSPA 2L7ZA 3GTPJ 2VKVA 3UKGA 1JTYA 5EGOB 2EZLA 4A3BJ 2ZOYA 1JT6A 2NX4A 2W53A 3D1NI 5C4XJ 3HEFA 2K9SA 3S1NJ 2LR8A 4V2FA 1PUFB 2YVEA 4CGRA 5M5WJ 2Q24A 2P81A 1UMQA 3F1BA 3BHQA 1OJLA 3HKZN 5K58A 3V78A 2OPTA 4DZJA 1SFOJ 3BJBA 1NTCA 3GTJJ 3BTIA 3FRQA 1P7JA 2ZCMA 4FISA 1I6HJ 2MG4A 4I76A 1FTZA 2E2HJ 4JX4A 4UUSB 4ABZA 1ENHA 3JRHA 2ELKA 5F27A 5IYBJ 5FGLA 2TRTA 1X58A 4XRMA 3B81A 4DYRA 4V2GA 2GBYA 3BR6A 1W0TA 1TWHJ 2EBIA 5EG0A 1ZGWA 3O8HA 2R93J 2D5VA 2HDDA 3SFIA 5JLXA 4AYBN 1E3OC 3I4MJ 2DA5A 4RDUA 4BY1J 1JUSA 2KT0A 5EZHA 1S7EA 1H8AC 2R0QC 1FIAA 2GENA 4AF5A 3P9TA 4CYCB 1ZTRA 4MO7A 2JK3A 3ZQLA 2XPUA 1QRYA 2DJNA 2JWTA 3OSGA 2LP0A 5EF6A 5J1UA 2EZKA 3M4OJ 2Y9ZA 2H8RA 1BJZA 4QTRA 1BL0A 2R5YB 2DG8A 4A3JJ 5M5XJ 4GFBA 3E7QA 2VI6A 5D18A 4S0HB 1MH3A 2NP3A 1RKTA
chains in the Genus database with same CATH superfamily
3BPXA 4RA2A 3WE3A 5K5RA 1DGRM 1ORKA 3BZ6A 3KEOA 5FLXZ 2L54A 2IGKA 2R7FA 3ASNH 4IQ4A 5L3EA 1X4OA 1TQPA 2MLGA 1NG6A 1P6RA 3QYFA 4I98B 5J1YA 4FE7A 1RR7A 3BP8A 3FXKA 2LTPA 4XMYA 1G2HA 3I71A 2I10A 2MD5A 3MFKA 4UB6C 1FZPB 4E7HA 2L5QA 1OCZH 1TWAJ 2E1OA 3ZGKA 3CMMA 3DPLC 1UI5A 3QU6A 4BHBA 5DS9A 3GFIA 2D6YA 1MMDA 2KMUA 2AS5F 3HOVJ 5GAHJ 3MEXA 2OD5A 2DDBA 2E1NA 2X1DA 4BKXA 3ANPA 5EEGA 2K3PA 2OTLI 3H9JA 2VPRA 3LWFA 1LDDA 4M3DA 1EF4A 5HLIA 2JMWA 1VFCA 3RDIA 2DO7A 2GZWA 3DCFA 1I3QJ 2DPUA 2LF7A 3LJLA 5B5EC 3LOCA 3GMEA 2MGQA 4JX5A 1W7PB 3ZQIA 3DKYA 2EA4A 4MTEA 3HJEA 2PBXA 3KYDB 1SD4A 3O60A 5H2FC 2ZNZA 3PSIA 4CZCA 4HNTA 4G8XA 2HVSA 5CQGA 3H5NA 4WK8F 1ZGJA 3JTHA 2M8EA 1GV5A 2LFBA 4CYCA 2VQGA 2YS9A 1FT9A 4GGGA 2K85A 3JRGA 1P4WA 1Z67A 3N05A 1B9NA 2E1CA 1Z77A 2DA1A 3PO2J 3HIFA 1ZREA 3LA3A 4HYEA 4F93B 1S5LC 3K69A 4ZTFA 4HDUA 2QA4I 1BR4A 3ZMVA 2FEZA 4HF0A 4CICA 4XLCA 3HGGA 3C7JA 4KNYA 4RB0A 2XGXA 1P4AA 3RZOJ 4OOIA 2VJJA 2JVHA 3CUQA 1WSUA 4BE0A 3QYBA 1OYWA 1U0JA 3NQOA 2QF7A 1IN4A 1E3HA 3MCZA 4G6QA 4ANJA 5FLMJ 4DYQA 1H9GA 4RB1A 3F8NA 2AQEA 5EEHA 1O7FA 3LAJA 4IRIA 1X2MA 4W97A 4KIFA 5ICGA 5IPAA 3ZCOA 5D5UB 1B1BA 4BACA 3Q5FA 4HOBA 2WTEA 4LK0F 3VYTB 5IY5H 3PASA 3AQSA 2LVSA 4C9YA 2DOEA 3L09A 1BOAA 3Q0VA 2DMUA 3OOUA 4ZZLA 1MMAA 1X1DA 2NAZA 4KIBA 5J8FA 2IGMA 2PJRA 2Y0MA 4Y52J 3S15J 4U87A 3TGNA 4ZDLA 4D7MA 1TNTA 1EA3A 3FKIJ 3GEUA 1P4XA 6PAXA 2PZ9A 4CUGA 2UXHA 1X3ZB 3WG7H 4BJTA 3OSFA 2RHAA 3CJDA 1FOKA 2UXXA 1JKQC 3LSIA 2OTJI 4RS8A 4ME9A 3EETA 2DA4A 4PUSA 1X1PA 4B1RA 4A3CJ 5BNGA 4QPOA 4AWXB 2ZCXA 2F4MB 1XCBA 2E5NA 2L3DA 3DP7A 2NVXJ 3FKJA 2N8GA 2GXGA 5DM7F 1DGWY 1T08B 2CH0A 2CJJA 5IP6A 2DLLA 2VPLA 5HS8A 5CXGA 2A68F 5EGOA 2ZJRF 4L62A 1XG1A 1KA8A 1LJ9A 2G9WA 3SEQA 2X51A 1Z7LA 3DKWA 3T1BA 2FBQA 3T0YA 1E3PA 2Z33A 3J81Z 2KIMA 3G2BA 1TTYA 2V1UA 5E3LA 2OERA 1AA7A 4ZC3A 1ZGAA 2R7OA 4M74A 2B0LA 1IN6A 2K40A 3BTLA 4OWRB 3F9KA 1W1WE 4IHVA 2M0CA 2STTA 4ITVA 1O3RA 4LMYA 3FDYA 4MK6A 3ZN0A 3L7WA 4JKZA 2IXSA 2W85A 1W5TA 4DBRA 3J80K 4YIIA 3QODA 4UUSA 2VQCA 3MWMA 3CF5F 3FXJA 5M3FJ 1MMNA 3QPHA 4YFKF 1FBSA 5IYDJ 3RCOA 4M6YA 3HOXJ 2VONA 1Z7UA 3ZQGA 2JA7J 1XMAA 4WIBA 4C2MA 5BMZA 1LFUP 5D6FA 4G12A 5F6FA 1BJAA 3GZ5A 3CC7I 1DDNA 3H35A 5EG0B 4MFDA 4ZTJA 1VNDA 2PMZN 2ZJ2A 5DYMA 3BQYA 4E7JA 4XSXF 3OIOA 1RKWA 4KA4A 3ZPLA 1I5ZA 1V5FA 2IA1A 2WBMA 1BR2A 3O6BB 1ON1A 2HR3A 4U0VA 3BNIA 4LG0A 5HSZA 4MGRA 3WTUC 5IOYA 2VUMJ 3TO7A 1BI2A 5DCMA 1J0RA 2XGEA 5EDNA 1HLVA 2BVMA 4BXFA 1YITI 2QUFA 1WWXA 3VPRA 4MHGA 2G7LA 1F1ZA 2DFFA 4ASNA 3PNYA 4DGWB 3S1QJ 3QPTA 4XICA 1T0FC 1H89C 2LD5A 2NRAC 4IVNA 2R7XA 2KL4A 4FASD 1YTYA 3DV8A 1ETOA 2NOGA 5F64A 2ZOZA 5E1XA 1UHMA 1XD7A 3H3ZA 4U7BA 3KFWX 3VEPA 1RIOH 3SZGA 2DAOA 3S2WA 2P7CB 2EB7A 4IQJA 2QKMB 1X4PA 2HPMA 1Z0XA 1FY7A 2G3BA 3E7LA 3LFKA 2W4SA 1A6IA 4L9NA 1YS7A 2EFOA 5ED4A 1IC8A 4EMSA 4NQWB 2KJBA 3HB9A 4XLHA 1SANA 1WZ2A 1DP3A 2K9QA 3K4KA 3R4KA 2DTZA 2HPIA 2O5RA 1NHAA 3B73A 3GFJA 3M3YJ 4Y7NJ 3I4NJ 1HW2A 3FHNA 3BG7A 3D0SA 2JT1A 3QKXA 2LNBA 2JA6J 1T39A 4CXFA 3M7GA 1IG7A 3H92A 4NELA 1ZH5A 4M3EA 4UV9A 2HS5A 3OYGA 3G71I 1SVLA 1PP7U 2XB0X 3HHGA 2VXDA 1AKHB 3HTJA 2HOSA 1R4MB 2NVYJ 1N25A 2AQFA 2KDZA 3S3NA 2V4JC 4MQ9F 3MN2A 4IPAA 4MFEA 1FX7A 4Y3OA 4Y33A 1XSXA 3SFZA 2WC2A 3EUPA 3GEZA 2L9NA 2JPCA 2W25A 2AXLA 3CUQB 3VOKA 2WB1N 2ESHA 3QPSA 3PL8A 4RGUA 3HOWJ 1FMWA 3BR2A 2X6OA 3CDLA 4L9JA 4U7DA 3VODA 2ZCWA 3V42A 5HODA 1MNMC 2FNPA 3F3XA 1D5VA 1D8JA 1Z3XA 2PI0A 4BY7J 3FM3A 1FYKA 3BZKA 3P7NA 2Z2SB 1HKQA 3K2AA 5TISC 3TEDA 1RUNA 2G7HA 1QZZA 1IGNA 4FTHA 4GFKA 1SVMA 2Y9YA 1OCTC 4BQAA 1GLNA 4BHPA 4QIWN 5DDGA 1J09A 2K3FA 1KU9A 3CJRB 2VBYA 2CRGA 2DYSH 5AONA 2PJRB 4YEJA 3ZN1A 2G7SA 4FE4A 1G3SA 2KPMA 4E7SA 3N4MA 1WFXA 1EH8A 3GLXA 3VW2A 3PM1A 3JSJA 1BIBA 2ISZA 4RBOA 1U78A 1AWCA 3Q9SA 2K5CA 1UHSA 3WTWC 1JGSA 1GHCA 5L3GA 1LEBA 3HM5A 3FISA 1SC7A 2A3SA 1HF0A 1Y1VJ 3CUQC 3U2RA 4AC0A 1E2XA 5CYVA 2O7TA 2BY2A 2YX7A 3M8EA 3PJRA 2ESNA 2ZXHA 3LL7A 4L0ZB 2QTQA 4XRFA 5ERIA 4I7HA 2XIGA 2ZKZA 1OLTA 3A02A 2EK5A 2FBIA 1Z1DA 2NS7A 3SDGA 1MBGA 5CVIA 2VJ5A 4LLLA 2WAQN 5LHIA 2Z99A 2O61A 3TO9A 1EJ9A 1TBXA 3E5UA 5EGOB 2ZOYA 2W53A 2RDPA 1OCCH 3D1NI 3E6CC 2QENA 4V2FA 3FXMA 1XN7A 4CGRA 1IN7A 1VQKI 2M45A 1IV8A 2VBWA 3K4JA 2CMPA 3E6DA 4HSRA 5CLSA 4ENJA 3OYAA 4KT6A 3BJBA 1NTCA 4LG3A 1HSJA 4XN3A 3BOQA 3DBLB 2MG4A 2EV6A 4I76A 2OA4A 2E2HJ 4C2UA 1Z91A 4UUSB 4ABZA 3K70D 4HPQA 5IYBJ 5FGLA 1DQUA 4R79A 4IHTA 4IRVA 2M1BA 3HKZA 2GOMA 4V2GA 1W0TA 2BBYA 2EBIA 3KP5A 5FRNA 4G9YA 2EV5A 3C18A 2LG4A 1K78A 2DFIA 3SFIA 1E3OC 3KCCA 4PDKA 2FNAA 1VQ8I 1REPC 5FD5A 4BY1J 1JUSA 2KT0A 5EZHA 2FOWA 2BYVE 2RREA 1S7EA 3HRUA 4LK1F 4DQ2A 2GENA 4AF5A 4M9XA 4KMFA 5E8GA 5ILVA 2NS0A 2QSFX 2VL8A 2K27A 3ZMDA 4CYDA 2UXNA 2XASA 2LP0A 2W1OA 4I0AA 1QZEA 3MQ0A 4GXOA 4RAGA 2DG8A 2WAFA 5E8IA 1YYVA 4LG0B 5D18A 2FA5A 1FPQA 3NWTA 2NP3A 2E60A 4HA8A 3OYBA 4C3HJ 1H9TA 1VQLI 3CJTB 2O0YA 4OAYA 4EEFG 1XCVA 2FBKA 1LFPA 2M2EA 3WE2A 2BW3A 1RPWA 5LEKA 1SFUA 2WAEA 2E2IJ 5D6EA 2JRMA 3W2WA 1B8IA 1TW3A 2HQAA 1DPUA 2MABA 1T95A 3RKWA 4XLNF 2UXUA 3AFHA 4BQOA 1JT0A 1QHHD 2ELHA 3OYDA 4N4OB 3RD3A 3F6OA 3DTIA 1VTNC 1PUFA 4KMUX 1STZA 2YU3A 2M4GA 2B3WA 3GCMA 2M87A 4IOAF 1L3LA 3G4SI 2IS6A 1I50J 3WTSC 4D7NA 2WGBA 3W2AA 3SJMA 3WTTC 1PDNC 1ZR4A 4I02A 4B8XA 4YIFA 2GAUA 3CCRI 2D2WA 2GA2A 3DU6A 3EPZA 3OS2A 2V1XA 3TOBA 4ZDPA 4S04A 1UG2A 4CH7A 5FHPA 1MZBA 4LFUA 1FOYA 2BY1A 2D1HA 2WV1A 3KX2A 3M07A 2LDUA 5J1RA 2W7NA 3BZCA 2RQPA 3Q0UA 4KICA 4P9UA 1MSFC 3ESWB 4FT8A 3HOTA 3CZ6A 3S14J 1ETXA 3MKYB 1ZLKA 4C3JJ 3GTOJ 4XN0A 4XIDA 1FNNA 2XHKA 3E0JB 1O4XA 3R0JA 3HOZJ 4W1UA 2H6BA 1ZR2A 3NNRA 4F52A 3HG9A 2TDXA 1MW7A 2KZGA 3TDUC 3KLOA 5TRDA 3VOXA 1D0YA 3K4LA 3WGHA 2KP6A 4B4CA 5FB2A 1MJBA 1X3UA 5FKNA 2HEOA 2QGUA 2W84A 1IDYA 1BW6A 2H8WA 2VLAA 2X9DA 1U3EM 4EV0A 2I5UA 2GIZA 2R7ZJ 3OOPA 3VP5A 3REOA 2EPFA 1TP4A 1TWGJ 3KYCB 1D8KA 4LJZF 1XMXA 3C1DA 4BH9A 3V8JA 4IHWA 2Q1ZB 3EDPA 2ZCNA 2HZDA 1ON2A 2ACJA 3ON2A 2FSWA 2KRHA 4JYKA 4HNUA 3TW7A 3HRMA 1YFHA 3F22A 3FK6A 1R71A 4Q4ZF 2WA0A 3S5RA 2MH9A 1K4SA 4R8HA 3D5LA 5ILUA 5FFZA 1Y39A 1BR1A 4HX8A 2Q2EA 3V7SA 1HA8A 3RJPA 4MNUA 3KKDA 2CUZA 4DYCA 2Z1DA 1LPQA 2H09A 5DD8A 3S8PA 3I64A 2XAQA 4JOMA 1J75A 1MDMB 1W5CC 4OIRF 3ZQHA 1H0MA 2E1MB 3FK7A 3MMYB 4HLXA 2M7BA 3I0TA 5D5WB 1YJNI 2CUFA 3BWGA 5CQEA 3ZQFA 3JRBA 1X3WB 2FJI1 3TOAA 4X0GA 3Q0WA 3HTSB 2EINH 2XAGA 2JA8J 3CP2A 2WUIA 2B63J 2HOTA 4Y15A 3L2UA 4PFPA 2DK5A 4XR6A 5EEAA 1S7OA 3ECHA 4G7HF 1MBFA 1RC9A 1CF7A 5M5YJ 2W48A 2ADUA 4E7IA 1IRXA 1K6YA 2XDNA 2PN6A 3E5QA 3W6VA 2DMQA 3I9V2 4J01A 2XPWA 4KT5C 4IEJA 3RH2A 4A3KJ 3MZHA 4NB5A 1XGOA 5HBUA 3F72A 4EJWA 1BC7C 4P5OA 2MC3A 3G3ZA 5D19A 2O8XA 1VQMI 4AU7A 1FSHA 2P5LC 3O8GA 1P7IA 3U9GA 4QSHA 1JJ6C 2ZFWA 5J4VA 2CQKA 1XC5A 3BROA 4UUTA 3OYMA 2K4JA 2E1MC 2I8DA 3HRSA 4JP0A 2A5YB 2QIBA 2O9LA 4CHUA 3QQAA 2AXTC 3OMYA 1WCMJ 3WG9A 1TWFJ 2RQQA 1V5EA 2EIKH 4MEYF 2EZIA 4BAYA 1QU3A 1O7LA 2UUZA 3BY6A 3EYYA 3K1NA 5J4YA 3T8TA 1SMYF 1R6RA 2JUGA 4NNJA 3RYPA 1TQIA 1P2FA 4Y17A 1BI1A 3H3VK 2A05A 3WTZA 4JQFA 3BT9A 2FBHA 3RKXA 5IOZA 5E17F 2OAZA 1W0UA 1IF1A 1VQ9I 1WHUA 1MJ9A 5KAIC 5FROA 4X6AJ 3M8FA 2CSOA 2LKXA 3ERMA 1SAUA 1ZLJA 2F48A 1MJAA 2BZTA 3FXOA 3LSMA 2EA2A 4AD9A 4ACIA 2YVHA 3GYHX 3KZ9A 3K4BA 3WU0A 4G94A 1KQ9A 1MBJA 2LSOA 2IS2A 1UELB 3K4MA 3ZR8X 2KDOA 3BJAA 1UZCA 2OCCH 4KIGA 3HRTA 1FYMA 4GCLA 4BXUA 2RGVA 3AQTA 1MMGA 1SEUA 5DD4A 3SZPA 3QRFF 2FMLA 2LK2A 2ECBA 3CESA 1QGPA 1LVAA 5H20A 4EM1A 2VOOA 4Z6YA 3IKVA 2OI8A 4YG2F 4RM2A 4A3DJ 4QLCU 2CUEA 2ID3A 2KKOA 2BW3B 4ENKA 4GFLA 1HC8A 4Q48A 2HQNA 3MKLA 1B8IB 3ML6A 3RQIA 3IRRA 2PEXA 2ZMEA 1D1CA 3H3UA 3I53A 3JSOA 4HZFA 1JGGA 3GWZA 3TL4X 1U6GA 3FF5A 2IGOA 3ZP5A 1ZRFA 2K9NA 5A2QK 3IRQA 2JSPA 4M9ZA 1XMKA 1F9NA 4E7KA 2E71A 4NUBA 2R5ZB 4A3IJ 2GUHA 2CU7A 2L4AA 3IP4B 3OS0A 1YRNA 3P9IA 1G8XA 1AU7A 2BXYA 2COMA 1Y0UA 1POGA 1WQ2A 3K2ZA 1ZQ3P 4UUVA 5CW8A 2K02A 2TCTA 4BXXJ 1MGTA 4PFOA 5HNFA 5EZGA 3WTXC 2L7MP 4LB6B 1H88C 1IUFA 1Y56A 2M4KA 5GADJ 3NRVA 4I0BA 2GWRA 2EFNA 3QYEA 1AOYA 3M1EA 5IT9K 1IDZA 2IT0A 5K7ZA 3UR3C 1MSEC 2WY8Q 3BQZA 1A6QA 2VN2A 4HQMA 2YVXA 4UHTA 2R3SA 4HBLA 3L9FA 3VB2A 4YIRX 3WTVC 3FWEA 2JRTA 2X4HA 3QPLA 3CCMI 2LYCA 2GLOA 3JR9A 1A5JA 4PSWA 3HOYJ 3OYIA 2HXIA 4IRGA 5F0FA 1FC3A 1FYLA 1R1TA 1VQ4I 1S9HA 4D9JA 2WV0A 5AIPA 2RC4A 3R60A 2R92J 3HE0A 2P5VA 3CQZJ 3RKYA 2CQNA 1S29A 4CSWA 1D5YA 2RASA 2IJLA 3CRJA 5H6RA 2E5ZA 1ACIA 4XRSG 1JKPC 1B9MA 3KP7A 1FIPA 4DOZA 1F36A 1SD7A 1BM9A 5E20A 3IH3A 5LLQA 3EUAA 2Q8KA 3L2WA 4CA0A 1KU7A 3F23A 3BCBA 4GRIA 1TT5B 2A5WA 1HKTA 5GTHC 2VKEA 3S2HJ 4IF4A 5B1BH 4I6ZA 2X1CA 4OU0A 2CW8A 2VBXA 1FOXA 1JXSA 4ETSA 2IRFG 2PBIA 3AAFA 3T6NA 3DTKA 3DPTA 3DLAA 5K5QA 3DWLE 1K6OA 1RRJA 1JUMA 1U9OA 1ZG1A 4KDPA 1ZELA 2K9LA 1DUXC 2FXAA 4HG2A 2XUBA 3TQNA 3CMAI 1I39A 4U88A 3GF2A 4RAYA 2B7EA 5FLVA 1YW9A 3AG4H 5ILSA 3KP3A 1WJBA 3F8FA 4JX6A 2HYTA 3P9CA 3DEUA 2XF6A 4KFCA 3FXRA 4IOCF 3B6AA 1X19A 3S17J 4AVPA 3DXJF 3FIWA 2M34A 1M1EB 1YS6A 4L18B 1OPCA 2L02A 5ICCA 1HW5A 4BJ6C 1QHGA 2KRCA 2RKHA 1N77A 4DIQA 1XGMA 5FGMA 2PJPA 3PIPF 3EYIA 4XL9A 2WWYA 2OQGA 5LEJA 4XKCA 3FXUA 5B1AH 4GCKA 4M6XA 2XGDA 2EFWA 3LSPA 3GTPJ 3CMEI 3UKGA 1JTYA 2FOKA 2RNGA 2EZLA 3IWFA 4A3BJ 1JT6A 1RNLA 2MC4A 2ZSIB 2P5KA 3WTYC 2LR8A 4CCJA 4A5MA 3W6JB 1OISA 5HVQC 1Z6TA 3F8MA 1F4KA 1QA6A 1FWZA 2EFQA 3HKZN 3PIOF 4I99C 3FZVA 4XQFA 4XONA 3GW2A 3GTJJ 3S3OA 3BTIA 5L3CA 2NNNA 3R61A 3T8RA 4FETA 4LIUA 4EJOA 4FISA 3GUDA 3VYUB 2KQRA 2QQ8A 1BN5A 1K7AA 2DTRA 3X2QH 2LREA 1XDUA 2TRTA 4KN7X 2KHMA 2QSHX 2XKPA 4BYYA 4ENMA 4DYRA 4M72A 3SHFA 2CFXA 1PP8F 3BDDA 4RMNA 1XGSA 3O8HA 5KCMA 4BHCA 2HDDA 4P96A 5CVUA 2BOLA 3HSRA 5H6QA 4RGRA 2IS4A 5JR3A 3HOSA 2OCEA 3EQLF 2GIVA 2P6SA 2VIXA 2VB6A 3P9TA 4CYCB 1I1GA 4HSTA 1QRYA 2OZUA 2DJNA 2LBFA 5EF6A 5J1UA 1W7PD 2O3FA 1FBUA 2CS3A 3K4NA 2VQHA 2H8RA 4A3JJ 1QPMA 5M5XJ 4AYBA 3E7QA 2VI6A 1VZ0A 1R5ID 1ZRDA 2QM3A 1ZAOA 1S6LA 1N75A 2JQ7A 1R5HA 4MQVA 4HF1A 2NVUB 3SEZA 5IP9J 3RI4A 4UV8A 3S16J 2RVCA 3C3WA 2YU9J 2QCOA 4L5EA 3OYHA 3P5JA 1UHWA 2VE8A 3VDXA 2QSGX 3JAMZ 2BHZA 3CUOA 4IHYA 4UDSA 2OU2A 4XSZF 2ZMEB 3T5XA 1YIOA 4PJJA 3ZOBA 4DNCA 3RSNA 4E6KG 3IL2A 2BXZA 4C2MJ 4IKFA 2K4BA 3BJ6A 1T2KA 3HHHA 2L9VA 2G7GA 3DBRB 3ELKA 3H36A 1T8IA 4K2EA 3QOPA 1B59A 2BY0A 2V9PA 3BG5A 3J81K 4RB3C 1N78A 3NEUA 4ZJZA 5DM6F 5B3SH 1YRNB 4C30A 2WY7Q 3NWSA 1MNDA 3SWHA 5FKMA 4NC6A 5LRRA 2YUSA 2ISYA 1BIAA 5CVJA 4EVIA 3I56I 3O3KA 4PSXA 1RR8C 1SFKA 1IRZA 1FEXA 2FX0A 2DPDA 2MH2A 5DEQA 3R0AA 1HQCA 1HBXG 4ZYGA 1BI3A 2V1NA 3PFIA 2LF8A 3PFYA 1RESA 2XKOA 4AM3A 1B4AA 3HTUA 2HYFA 3L00A 4PJ0C 1YW7A 4ZYAA 4FCYA 2V7FA 3S2DJ 2LRDA 2E34A 4BEHA 4AIDA 2L9RA 4N9HA 3HXLA 2EQRA 3PUFA 2JSCA 2VJ4A 3JRFA 1ITYA 2QVOA 2AHQA 1V55H 3TP0A 2RN7A 1X1BA 2ZMEC 4H0EA 2DT5A 2B9SA 3BG9A 3LFUA 1HKSA 1DPRA 4GO1A 1GDTA 4D5FA 3SQNA 3GO5A 3O2PE 4B44A 4XRSA 4RGSA 3L2QA 1G3YA 3W6KB 4BGDA 5LFAA 2DJIA 4J19A 5FMPA 3OL3A 4E70A 2CYYA 2QEXI 5BQTA 3BJOA 1TWCJ 2BE5F 2VKDA 3ABMH 4M3FA 2A6EF 3IUVA 3J7AO 3RTRA 3DEEA 3B6CA 2L2OA 1RETA 3ASOH 1Y6IA 3OYCA 2ZBKA 2BGCA 1FP1D 2FQ4A 1IO2A 4ZYDA 5KAFC 1XSDA 2R7UA 5FKKA 1Y8QB 3MZYA 2V6EA 1U8RA 2V1DA 2OV7A 5JFRA 4OD5A 3JCUC 4FQGA 2DOFA 2OBPA 5CVRA 4HF2A 2A69F 3HSFA 3LMMA 2A2FX 2UWMA 1WI3A 1U5TA 5K7HA 4M3BA 2KLOA 1IRFA 4NHJA 1IXSB 1T6SA 3E5XA 4G7ZF 5FRMA 3WODF 2G0EA 1MBEA 3E6MA 3VUQA 5GTIC 3Q3SA 3M1CA 1A31A 4IXAA 3KP6A 2DK8A 2X6WA 3A03A 1R36A 4ZH4F 2HXOA 3VYRB 1ETWA 1WRJA 3I59A 1KQ8A 2CW0F 1WJFA 2VT3A 3H5AA 4B09A 3BCAA 1IRGA 1W7PA 1K83J 5KNLA 5HOOA 2F6CA 1RZ4A 3GBGA 5HDKA 1GUUA 4HDVA 1Y1WJ 3DF8A 1ZG3A 1DU6A 3QWLA 4KWAA 1PVEA 3CWRA 2HWVA 1SFEA 1QQIA 4Y4RA 1IW7F 2V79A 3V4GA 3VSKA 1NK2P 4MLOA 3F0CA 5DCMB 4XNFA 2QQAA 2JN6A 2VKHA 5TGTA 4E7LA 3VTIA 2HDWA 3CF2A 2K7LA 4JBAA 2Y48A 1R1UA 1CQTA 5CVVA 2A61A 4ICHA 2DT7B 4BE2A 1Z3YA 2BEOA 4BBSJ 3OIPA 1YW8A 2F5VA 1FSEA 3IWZA 2ZB9A 1UI6A 2CFOA 3WHBA 3ABUA 2Y0SA 2NOJB 4Y13A 4YRVA 1WH5A 3OR2C 3DPJA 3G1MA 3RYRA 4UVBA 4IX7A 1NG7A 3K7AJ 4LGWA 3JSPA 5J47A 4LIVA 4RAZA 3VWBA 2VT2A 3CTAA 2W82A 5J40A 4BNCA 3BRUA 3LAPA 3V6GA 1Z21A 4BL0B 1KGSA 5BOXA 1U8BA 2ZXWH 3P9KA 3CO7C 4C2TA 2DI3A 2UZKA 1YLFA 2NXNB 2LMDA 3KP2A 2XRLA 3KNWA 3JRAA 3VW0A 5EYRA 5IYCJ 2DA7A 5FKLA 1BA5A 4HX4A 4X1EA 2RAEA 3LNQA 3V8KA 4II3A 2FE3A 2ZXJA 3MVPA 3ANGA 4MIMA 3KKCA 4E4HA 3TBIA 5DAJA 4G6DA 4OINF 4NDLA 4D1QA 2Z5UA 1GXQA 1WJ5A 2IP2A 3BR5A 2QQ9A 4N0BA 1W36D 1XX5A 2PG4A 3U21A 1ULYA 5E18F 1GV2A 1XB4A 2HOAA 3LQQA 1TL8A 3LWJA 1SFXA 4A2UA 2H1KA 4RM3A 3PNVA 1MBHA 2DA2A 3G1LA 3LSGA 1R23A 1WJEA 2NS8A 2MBFA 4WXDA 2BV6A 4YZEA 2LY1A 2V57A 2P4WA 1G6NA 1LVKA 4AVZA 3TW6A 2HNHA 5CJ9A 4U9LA 1D0XA 1APLC 5KK1A 4U0YA 3JREA 5D4SA 4AIKA 4BE1A 3GTMJ 3CMYA 1K79A 5AQCA 3CCJI 3OYEA 3JW4A 2NNYA 2CG4A 5A2QZ 2XGCA 4BJ5C 1EH7A 1WJCA 2HFHA 5BPDA 3M9AA 1DU0A 4BUPA 2XVCA 1I6XA 5D4RA 2VC1A 2HVRA 1Z9CA 4KUMA 1KYWA 2D1VA 1ONVA 4LLGF 1K4TA 4ESFA 3QAHA 2VOPA 4XLEA 4O5VA 3A01A 3IAS2 3HIMA 3GLLA 2RNJA 4I09A 2J5OA 3QU3A 3ABLH 4M73A 4NN1A 3VVZA 1WI9A 4MTDA 2EFPA 5IT9Z 2DFEA 1IJWC 1OMIA 2HKOA 5J8CA 2DA3A 3ABTA 1B6AA 2L7KA 3OYKA 3TKYA 1GVJA 3U1KA 4F92B 5HLHA 2OF7A 4MXMA 4XORA 2GXBA 1X1AA 4BEHB 4A5NA 1TZLA 3H0GJ 4M9SA 3LQRA 5DCFA 4RAFA 5JHFA 1TT0A 2R7TA 3F8CA 1D0ZA 4E7ZA 2HGCA 2X6YA 5C4JJ 3ZQ7A 1J9IA 1ETQA 2IGNA 2EZHA 3DTEA 3EGQA 2IA2A 4WF2A 5J3LA 2HYJA 3AG3H 4WX9A 1YI2I 2W57A 2DG7A 1J7KA 4HAMA 1XGNA 3S1RJ 3CCEI 2JUCA 2M3AA 5BPIA 1DP7P 1JKOC 3RKQA 4UB8C 2FRHA 2XAJA 2F07A 3EUKL 1Q1VA 3PUBA 4J00A 2L7FP 3HC7A 5K1YA 3J80Z 5F1RA 4CCLA 2HTJA 1W5SA 2VC0A 5FKOA 3K0LA 2VBZA 3CDIA 1ZARA 2HU9A 1ZYRF 2HQRA 4ZYEA 2HI3A 2MSYA 3CCSI 1WVRA 3TP3A 5K5OA 2MD0A 1ZG5A 1O3TA 2O7OA 3CP8A 2ELJA 5HLGA 2Y30A 1QNTA 4A0ZA 3SZTA 1D3YA 3GXOA 2QWTA 4S05A 2VASA 1S8NA 5D8KB 1U5TB 3LHQA 1ETYA 1VQNI 2E7XA 4QPQA 5LD2C 3BTJA 1PUEE 1WGXA 2BY3A 1K78B 1HCRA 4OIQF 2M7AA 4NQWA 1L0OC 2H94A 3VFZA 5H9TA 3I59B 5TJJA 1VF9A 2OJED 5CKTA 2QYOA 3GZIA 3BG3A 3BPVA 4FHTA 1MNEA 5E3MA 3ZQQA 2O6GE 2QKLB 1JKRC 1JHHA 3AG2H 2ME6A 3H1CA 4ZYHA 3HUGA 4ZDOA 3DEWA 2ME0A 4ESBA 4AIJA 1G3TA 4RLQA 4BU2A 1JI8A 2PLYA 3KIOA 1YE9A 3QP6A 4A0XA 3DBHB 3OYFA 3RIRA 1SGMA 3PPBA 2OQRA 1KYZA 4A3EJ 4BS9A 2RV8A 4XLPF 2GM4A 1O3SA 4DW6A 2ZJQF 2H1LA 4A3FJ 2XC7A 3TMOA 2EIMH 2CV1A 2ZNYA 4CZZA 3NI7A 2E2JJ 3ECOA 2VJIA 4GCVA 3ONQA 1J59A 1V54H 2F4OB 1AKHA 5FFXA 3AG1H 4CO8A 4HQEA 3CCLI 2HVQA 2QLZA 3FM5A 4F91B 3HEFA 2K9SA 5C4XJ 1U5TC 1PUFB 2YVEA 2E36A 1WKMA 2Q24A 1XPXA 1UMQA 1OJLA 1FP2A 5K58A 3E97A 5LGUA 3V78A 2OPTA 2JZYA 2VXZA 3FRQA 3OWTA 1P7JA 3IHUA 3WU2C 3WU1B 4EM0B 1FTZA 4JX4A 1UCRA 1ENHA 2ELKA 2YX4A 1U2WA 4PJNA 4ZZDA 3BLYA 3BR6A 2JA2A 4OAZA 1ZGWA 1OR7A 2R93J 3K1PA 2FF4A 2Q0OA 1J5YA 2D5VA 4AYBN 4HRIA 4I2OA 3I4MJ 4RDUA 1USTA 2F5DA 4F7ZA 1VQ7I 3I54A 1FIAA 2KRFA 2JK3A 3C2HA 4L5JA 5E1ZB 3ZQLA 2JWTA 2HTSA 2KIQA 2R4GA 2DOAA 2E35A 2M30A 2MLKA 3HZJA 1IXCA 3KEQA 3M4OJ 2Y9ZA 2KFDA 2CV0A 4WWCA 4AIHA 3EUHA 4GFBA 2NYXA 2OZ6A 1MH3A 1O57A 2IAIA 3V7CA 1VQ5I 1EV7A 1LFBA 1S72I 1BBYA 3A4CA 3UNGC 2OUMA 2IEKA 3H9GA 4A3LJ 3COAC 3L2RA 1IN5A 3NS4A 2R7VA 2PQ8A 5FLXK 5HS7A 3LSHA 2UXOA 2VE9A 4Z2YA 2ZXIA 3FBIB 3H0DA 4OIOF 2XB5A 2NVTJ 1LE8A 4G7OF 5LGTA 2XF7A 3GTKJ 3G1OA 2Q2EB 1TLHB 3LSJA 4CCOA 2XAFA 4A3GJ 3SXYA 3A1YA 4A6EA 1UFMA 4OMZA 1Z05A 2ZO4A 2CUJA 5HDNA 3OYNA 4M3GA 3KEYA 1NH3A 2HKUA 3A01B 2XSDC 1IUYA 3FMRA 2O8KA 2LH9A 2GFNA 1W4MA 3ZRGA 2DYRH 5DV5A 3G6EI 1O3QA 5C4YA 3ZXSA 3IV5A 5DTDA 2X6XA 4PK4A 5FJ8J 1OCOH 5DUKA 5C44J 5KVRA 4PZJA 5HLTA 1JJ8C 4UY8I 5E3NA 1SVOA 4IJAA 3ISPA 3HBLA 1LDKB 2CWEA 2LOOA 2CW7A 4L9VA 2HOEA 1CF7B 2LY9A 1BOBA 3DQVC 2A6HF 3GTLJ 2W00A 4XK4A 4R1HA 5C3EJ 3S32A 1D1AA 1R5GA 1R49A 3JRCA 9ANTA 1I1SA 4V19K 2NP5A 5E79C 1QPIA 3IAM2 5CXIA 4LD5A 2DQRA 3JRDA 4XLAA 1B72A 3K70C 1EH6A 1XDSA 1R4NB 3FHZA 1FTTA 3VW1A 4O3MA 3NXCA 3ON4A 4IHXA 2EJRA 3ZMUA 2YSRA 1JHFA 3LSRA 4XBFA 1WJAA 3PO3J 3FBNB 3OIQA 1OYIA 2ICWG 4BQQA 2PFVA 1TW2A 2XF5A 4NBQA 4HLYA 5BS6A 3RQ4A 2R7SA 4RB2C 2L9SA 4XOTA 3AL0B 3IC7A 2GA1A 3S3MA 2L0KA 3WGGA 2ID6A 4XKVA 2JA5J 2DCEA 1HW1A 3GVAA 2DMTA 5JLWA 1S3JA 2XAHA 4RGXA 3OR1C 1KQ0A 4L9TA 2V6CA 1HDPA 4NC7A 3TO6A 4L0YB 4P55A 2E7WA 4EJVA 4CGZA 3HOUJ 1VQOI 3K9TA 3LSKA 4O6JA 2E19A 1YHQI 3CJQB 4F55A 1R9TJ 1VI0A 1ETKA 3AKZA 1BI0A 4JNNA 4IRHA 4EM2A 1SAXA 3S1MJ 2FMYA 1ODDA 2Y69H 1QVUA 3D5RC 1QVTA 2EILH 3LA7A 3COLA 4QWQA 3VOEA 3K1MA 3NPIA 1MKMA 1X2NA 3HPHA 3S93A 3K8PC 2XDVA 4ENNA 2LC2A 3E3VA 1R7JA 3HPGA 4RLFA 3WHCA 5IP7J 2FD5A 5D5XB 3HTIA 4GDFA 5IT3A 3DPUA 3LA2A 1K61A 5EJCA 3TDZC 4HNVA 1G59A 3FXLA 3QP5A 3BTCA 4A6DA 3AL0C 1HSTA 2DQLA 3FX3A 5GP9A 3RPQA 3CCUI 3HUGB 2Y0SN 3VYSB 1A35A 2XV4S 3SYTA 4TV7A 4I01A 4JK1X 5JVGF 2QBYA 2MA3A 4D5CA 2NVQJ 4KISA 2HKXA 3CJNA 2JPBA 2V26A 4HV6A 4OIPF 1T98A 1MBKA 2ZC2A 1Z6RA 2XRNA 3N97A 4GYIA 3KYLA 3SDBA 1FOWA 3WGIA 2GXAA 4MEXF 1J2XA 3G56A 2O03A 2ECCA 2Z16A 3MAJA 2FU4A 5F08A 1KONA 5B66C 1IV6A 2IW5A 2OC6A 3GTQJ 4HEA2 2LKSA 2DXIA 4B3XA 2CV2A 1JUPA 1BW5A 1UJ8A 3HTAA 1TNSA 5M3MJ 2DMNA 2LY2A 3GFMA 2FUG2 3KZIC 1I3AA 3DKXA 2R7WA 3U1DA 1W36C 1F5TA 1PYVA 2KIFA 1AHDP 4GCTA 3GX4X 2UXIA 1WJDA 1R1VA 4LOCA 1T38A 3VSLA 1FJLA 2XSJC 2Y2ZA 4CCMA 3IKTA 2DN0A 3RPUD 1ZKGA 5GPAA 5JHUA 2DODA 5LHGA 4KJZA 3JTGA 1FLIA 2QWWA 3CC4I 2P7VB 2Z9OA 1Y0NA 1VQ6I 2XAUA 3GTGJ 1MDMA 2P0WA 2CQQA 2F5CA 1C0WA 2M8GX 3A0BC 2YR2A 1JTXA 5DUIA 5GAEJ 4EJUA 2HDCA 2DBBA 3BR3A 3A2KA 2A07F 3G7RA 1U9NA 1G3WA 2IVMA 2WADA 4EATA 3OV8A 4M71A 2ZFUA 3VIBA 3F8BA 3CCVI 2DFHA 4PGHA 1LDJA 5LHHA 1WPKA 5E3OA 5HAWA 1R22A 3NRGA 2R5YA 3KZZA 1XS9A 1YJWI 1RI7A 4B48A 1GT0C 4C3IJ 1RUOA 5FO5A 1IN8A 2PMZA 2B1EA 3IH4A 3CC2I 4XKWA 3RZDJ 5L3BA 4YFXF 5KHDA 2HZTA 4ESJA 1OYYA 2COBA 2JTVA 1UG0A 3PNTA 4EQQA 1ZRCA 2XPVA 2X85A 4H4KC 2EWNA 1T56A 3G73A 4EJTA 1GXPA 4XM3A 5ICFA 2GOXB 1MD0A 2UV1A 4P9FA 2STWA 2W24A 3ABKH 2EIJH 4U9NA 1USSA 1YQAA 2M5WA 2ZSHB 1MH4A 4II2A 4M6VA 5LGNA 1LE8B 2DA6A 3MKZA 2VODA 1D1BA 4HV5A 2DW4A 4DVYP 1OR7C 1LKXA 1TC3C 2YPRA 4XKBA 3L1PA 3HTHA 3IH2A 4DJAA 3K4CA 4A12A 3NAUA 5E1WA 2KJCA 2HQ5A 3BC8A 4BBRJ 4A93J 1OKRA 1YG2A 3C2BA 3M8JA 4YFNF 1A36A 3HDDA 5EFYA 4PJLA 3KZYA 2L01A 3PQKA 1OCPA 5HDGA 1HOMA 1IAWA 2Y31A 3KPHA 2H27A 1GVDA 1S7AA 5FD6A 3V7RA 1IZ1A 4B3AA 2J5PA 4UVAA 2ETHA 1SD5A 4PGGA 5F0HA 1LEAA 3D5SC 2AO9A 3EUHC 3F21A 1CGPA 4A69C 2L4MA 2ZJPF 3NARA 2KZVA 3I4PA 3QOEA 3BG6A 2R7QA 3I58A 2K9MA 4XOPA 3MNLA 4HX7A 1YX5A 2X48A 1ZHFA 4UNOA 5CPRB 2PMUA 1UB9A 4BDZA 1YX3A 3K10A 4BDYA 4HW0A 3QBMA 5HS9A 4DZPA 5LRSA 3CD6I 2CO5A 4IZZA 3DLLF 3OYJA 5L3DA 2BVLA 2CGPA 3CCQI 1B72B 3DFGA 4UXNA 4OMYA 4Q47A 4B47A 4KITB 2CQ7A 4WXCA 4CCKA 4AC6A 3HGYA 3I3LA 3C07A 4JL3A 3W2VA 4WXHA 1OFCX 1YOVB 2X0LA 1P9QC 2IS1A 2MW8A 4PXIA 3JRIA 2LLKA 4AUXA 5LBQA 1V5GA 2F5FA 3CCYA 1F43A 1LUJB 1KU3A 3OL4A 2Z3YA 4EGYA 2QQBA 2JJ7A 1EKEA 3R6SA 1G4DA 3W3CA 1NK3P 4IL6C 2FJ1A 3KETA 4LLNA 1TQMA 1R00A 1OQYA 3ERED 1LB2A 3PSFA 2G7UA 3Q9VA 3ROUA 2EH3A 3BCGA 2QKOA 1R58A 2D45A 2ZY9A 3H9QA 4DBQA 3RPUA 1ZK8A 1ZN2A 2VQLA 2CQXA 1ETVA 3CLOA 3C2GA 4PCQA 3JAMK 3J7AY 3KP4A 4EGZA 2H6CA 2Y75A 1BC8C 2REKA 3PQJA 3BR1A 2DMPA 1QZYA 3V8LA 2WB1A 1MIJA 4BQNA 2R5ZA 5D8LB 2F5EA 1T33A 2PMHA 1XSVA 1WH7A 4UVCA 3HL2A 2KISA 2P8TA 4OD4A 5D1RA 4KN4X 5JI6A 3BR0A 5F1JA 1KZHA 4L5IA 4FX4A 2IBDA 1HDDC 2QOPA 3F6VA 3CDHA 5F0CA 2IU5A 3KLNA 5F04A 3L2VA 3LSTA 4KYWA 4HKUA 3A0HC 4U0WA 4CDGA 4IHSA 1XTAA 2HYGD 3OY9A 5GPCA 2R7DA 5JVTA 4IO9F 2LBFB 3ZMTA 5HNHA 3GZ6A 3VVYA 4XLFA 3E1SA 3ZQCA 4A3MJ 1E17A 3H5RA 3VVXA 1MMSA 5D5VB 3I5UA 1V4RA 1LQ1A 3B02A 1VQPI 2FQ3A 4NC8A 5K7FA 1E0EA 4G6TB 2QBYB 1YJ9I 2IA0A 2DU9A 3GFLA 2M9HA 2X1EA 2GQQA 2R7RA 4A0YA 2UXPA 4B43A 1LNWA 2L7ZA 2VKVA 2K86A 3L2CA 1V3FA 4LITA 3MZ8A 2LKPA 2NX4A 1YIJI 3KE2A 3S1NJ 1SMTA 3ULQB 5L3FA 5AIQA 3J7YJ 3I55I 5M5WJ 2C6YA 2P81A 3F1BA 3BHQA 1FBQA 2M0MA 2F4IA 1A04A 1IXRC 4F3QA 1QO0D 3ZMSA 4N4NB 3FXQA 3CO6C 4DZJA 1SFOJ 2WAQA 1YO5C 1KU2A 1Y8RB 1P92A 3HSEA 5GAGJ 4ON0A 4FX0A 2ZCMA 1I6HJ 2F2EA 2P6TA 4D0PA 1T0FA 3OYLA 4LB5A 2KIUA 1JE8A 2V9VA 2A6TA 2V9KA 3OS1A 3ZMZA 2QZ8A 3JRHA 2MFZA 2EV0A 1QBJA 5F27A 1X1CA 5ICEA 1OCRH 1X58A 4XRMA 3B81A 2BHYA 2IPQX 2GBYA 2JVGA 3IUOA 4YELA 1TWHJ 2PFBA 5EG0A 3DU5A 3FMQA 3E6BA 3HYIA 5JLXA 4Q5SF 1I27A 4N9IA 1PJRA 3MKWB 1SD6A 2DA5A 3GZNB 1HXDA 1ERDA 5J6XA 3FMSA 2DDAA 2MYSA 1H8AC 2PX9A 2R0QC 4PJMA 1ZTRA 4MO7A 2XPUA 4WCGA 1Q1HA 2DT6A 3J7ZI 3OSGA 1UAAA 3K6GA 2EZKA 3CLQA 1BJZA 4QTRA 4CCNA 2XROA 2R5YB 1FMVA 4GYGA 3MD2A 1BL0A 4P1WA 4S0HB 1RKTA
chains in the Genus database with same CATH topology
2IAIA 4C3HJ 1LFBA 1ORKA 4EEFG 2M2EA 5IP9J 3S16J 1RPWA 2IEKA 2YU9J 4A3LJ 5J1YA 2E2IJ 4FE7A 2QCOA 1RR7A 4L5EA 1B8IA 2LTPA 1G2HA 2I10A 4IHYA 2UXOA 2UXUA 1TWAJ 4UDSA 2XB5A 2NVTJ 1LE8A 2E1OA 3ZOBA 1JT0A 3GTKJ 3RD3A 3G1OA 1PUFA 1UI5A 3LSJA 4C2MJ 5DS9A 2G7GA 4A3GJ 2D6YA 3HOVJ 1I50J 3BG5A 4D7NA 2WGBA 3SJMA 1ZR4A 4BKXA 4M3GA 3ANPA 2HKUA 1YRNB 3A01B 2VPRA 2XSDC 4M3DA 1EF4A 2O8KA 1UG2A 2JMWA 2GFNA 5FHPA 1VFCA 5FKMA 2YUSA 5C4YA 3DCFA 5DTDA 3IV5A 1I3QJ 2WV1A 5J1RA 5FJ8J 1IRZA 1FEXA 2FX0A 3LJLA 3Q0UA 3LOCA 5C44J 1MSFC 2MGQA 4JX5A 3S14J 1ETXA 3ZQIA 1JJ8C 5E3NA 2PBXA 4C3JJ 3GTOJ 3HBLA 1RESA 3O60A 4XIDA 2LY9A 4FCYA 1O4XA 3S2DJ 3GTLJ 3HOZJ 4W1UA 4XK4A 2L9RA 1ZR2A 5C3EJ 3NNRA 2EQRA 3JRFA 1ITYA 1GV5A 2LFBA 2AHQA 4CYCA 2YS9A 3JRCA 3TP0A 9ANTA 3VOXA 3JRGA 2NP5A 4B4CA 1QPIA 3BG9A 5CXIA 3JRDA 1B72A 1Z77A 2DA1A 1GDTA 5FKNA 3PO2J 3VW1A 1FTTA 4D5FA 3NXCA 1IDYA 1BW6A 3ON4A 2X9DA 4IHXA 4XRSA 3LSRA 2R7ZJ 3VP5A 3PO3J 3HGGA 1TWGJ 4J19A 5FMPA 3RZOJ 4IHWA 2ZCNA 3ON2A 1TWCJ 4M3FA 4JYKA 3TW7A 3IUVA 2L0KA 2QF7A 3B6CA 3FK6A 2ID6A 1RETA 5FLMJ 4DYQA 2JA5J 3S5RA 2DMTA 2FQ4A 5JLWA 1X2MA 4W97A 5FKKA 5IPAA 1HDPA 3HOUJ 3KKDA 4DYCA 2E19A 1R9TJ 3PASA 1VI0A 1ETKA 1WI3A 3AQSA 2LVSA 5K7HA 4JNNA 3S1MJ 4M3BA 3Q0VA 2DMUA 3OOUA 3ZQHA 1QVUA 1QVTA 3COLA 2G0EA 3FK7A 1MBEA 4Y52J 3S15J 3VUQA 3Q3SA 3NPIA 1X2NA 2CUFA 4D7MA 3ZQFA 3JRBA 3A03A 2HXOA 3FKIJ 3Q0WA 3GEUA 1ETWA 3WHCA 5IP7J 2PZ9A 2FD5A 2JA8J 2WUIA 2B63J 2HOTA 3OSFA 2RHAA 2UXHA 3CJDA 3HTIA 1K83J 1K61A 5EEAA 4HNVA 1JKQC 3GBGA 1GUUA 1Y1WJ 1DU6A 4ME9A 1MBFA 3BTCA 4KWAA 5GP9A 2DA4A 3CWRA 5M5YJ 2W48A 4B1RA 2XDNA 4A3CJ 5BNGA 2Y0SN 1NK2P 2ZCXA 4MLOA 3W6VA 3F0CA 2DMQA 2NVXJ 2NVQJ 2JN6A 2N8GA 4D5CA 2XPWA 2CJJA 4IEJA 4A3KJ 3RH2A 1CQTA 5IP6A 1MBKA 5HBUA 4ICHA 5CXGA 4BBSJ 5D19A 5EGOA 4L62A 1XG1A 3G56A 3O8GA 1P7IA 2ECCA 2ZB9A 1UI6A 4QSHA 5F08A 1JJ6C 3WHBA 2FBQA 1XC5A 1IV6A 3GTQJ 1WH5A 4UUTA 3DPJA 3G1MA 4JP0A 3K7AJ 1JUPA 5E3LA 1BW5A 2OERA 2QIBA 2O9LA 3QQAA 2K40A 3BTLA 3HTAA 4IHVA 5M3MJ 2DMNA 2M0CA 1WCMJ 3BRUA 1TWFJ 3V6GA 4MK6A 2EZIA 1AHDP 4GCTA 1U8BA 4JKZA 2UXIA 4LOCA 1FJLA 4UUSA 2Y2ZA 2DN0A 5M3FJ 3H3VK 1ZKGA 5GPAA 2XRLA 3BT9A 3KNWA 3JRAA 3VW0A 5IOZA 5IYDJ 5EYRA 5IYCJ 2DA7A 5FKLA 3HOXJ 1W0UA 3GTGJ 1BA5A 3ZQGA 2CQQA 2JA7J 2M8GX 4X1EA 4X6AJ 2LKXA 1LFUP 4G12A 2RAEA 3LNQA 1JTXA 5EG0B 4MFDA 2YVHA 3ANGA 3BR3A 3MVPA 4ACIA 1VNDA 4MIMA 2PMZN 3KKCA 3G7RA 5DAJA 1U9NA 3KZ9A 3BQYA 4NDLA 3BR5A 3OIOA 1RKWA 1MBJA 3VIBA 1GV2A 2HOAA 3LWJA 1WPKA 4GCLA 5E3OA 3AQTA 5HAWA 3NRGA 2R5YA 2H1KA 1XS9A 3BNIA 1MBHA 2DA2A 2LK2A 3G1LA 3LSGA 5HSZA 2NS8A 2ECBA 4C3IJ 1GT0C 5IOYA 4YZEA 2VUMJ 2V57A 3IH4A 5EDNA 2XGEA 3TW6A 1HLVA 2OI8A 3RZDJ 3VPRA 2COBA 4A3DJ 2G7LA 1APLC 2CUEA 2ID3A 2XPVA 3JREA 3S1QJ 1T56A 3GTMJ 4GFLA 4XICA 3CMYA 1H89C 2LD5A 5AQCA 3MKLA 1B8IB 3RQIA 1ETOA 2XGCA 2NOGA 2ZOZA 1JGGA 1LE8B 1MH4A 4M6VA 2DA6A 1DU0A 2K9NA 1TC3C 3L1PA 3HTHA 3IH2A 3NAUA 2R5ZB 4A3IJ 2GUHA 2CU7A 2HQ5A 1Z0XA 4BBRJ 4A93J 5EFYA 3C2BA 1YRNA 3A01A 1AU7A 3HIMA 3HDDA 2G3BA 1OCPA 1POGA 3E7LA 1ZQ3P 2Y31A 1HOMA 5CW8A 1A6IA 1IC8A 1GVDA 2TCTA 3HB9A 4BXXJ 4NN1A 1SANA 3VVZA 4B3AA 2K9QA 5F0HA 5EZGA 2AO9A 2DTZA 2L7MP 1IJWC 4A69C 1H88C 2DA3A 1IUFA 3NARA 3M3YJ 4Y7NJ 3I4NJ 3MNLA 1IDZA 3QKXA 2JA6J 5K7ZA 2OF7A 2X48A 1MSEC 3BQZA 1IG7A 4NELA 3QBMA 4DZPA 4M3EA 3H0GJ 2XB0X 3QPLA 2GLOA 1A5JA 3JR9A 3HOYJ 5C4JJ 1AKHB 2HXIA 5F0FA 3HTJA 2HOSA 2NVYJ 1B72B 1ETQA 2KDZA 2EZHA 3EGQA 4AC6A 5J3LA 2HYJA 2DG7A 3HGYA 3MN2A 2R92J 3C07A 3HE0A 3S1RJ 4JL3A 3CQZJ 4MFEA 1OFCX 1D5YA 2MW8A 2RASA 4PXIA 3JRIA 2LLKA 3CRJA 4AUXA 1JKOC 3RKQA 3EUPA 4XRSG 1JKPC 3CCYA 1F43A 2F07A 1FIPA 1Q1VA 2L7FP 3VOKA 1F36A 2WB1N 3QPSA 2JJ7A 3HOWJ 3BR2A 2X6OA 3CDLA 3IH3A 2FJ1A 5FKOA 1NK3P 5HODA 1MNMC 3BCGA 2HI3A 2EH3A 2MSYA 2QKOA 3TP3A 4BY7J 2VKEA 3S2HJ 1ZK8A 2O7OA 2CQXA 3K2AA 3TEDA 4I6ZA 2Y30A 1ETVA 2QWTA 1IGNA 2REKA 4FTHA 4GFKA 3BR1A 2DMPA 2Y9YA 1OCTC 3T6NA 2R5ZA 4QIWN 1T33A 3LHQA 1WH7A 1ETYA 1JUMA 2CRGA 1U9OA 5D1RA 1HCRA 3BR0A 3BTJA 5F1JA 1WGXA 1HDDC 2IBDA 2QOPA 2G7SA 5F0CA 4FE4A 2IU5A 5F04A 4HKUA 5FLVA 3VW2A 3PM1A 3JSJA 4RBOA 5GPCA 1U78A 4JX6A 2HYTA 5H9TA 1VF9A 3GZIA 1UHSA 3BG3A 5E3MA 3HM5A 1JKRC 3B6AA 3FISA 3VVYA 2ME6A 3ZQCA 3S17J 3DEWA 4A3MJ 2ME0A 4MXMA 1HF0A 1Y1VJ 4AC0A 3VVXA 3FIWA 2M34A 3PPBA 1SGMA 2O7TA 4A3EJ 5K7FA 2GM4A 4DW6A 2QTQA 4A3FJ 3NI7A 3A02A 2NS7A 3SDGA 2E2JJ 1MBGA 2M9HA 1AKHA 4GCKA 2WAQN 2XGDA 2UXPA 3LSPA 2L7ZA 3GTPJ 2VKVA 3UKGA 1JTYA 5EGOB 2EZLA 4A3BJ 2ZOYA 1JT6A 2NX4A 2W53A 3D1NI 5C4XJ 3HEFA 2K9SA 3S1NJ 2LR8A 4V2FA 1PUFB 2YVEA 4CGRA 5M5WJ 2Q24A 2P81A 1UMQA 3F1BA 3BHQA 1OJLA 3HKZN 5K58A 3V78A 2OPTA 4DZJA 1SFOJ 3BJBA 1NTCA 3GTJJ 3BTIA 3FRQA 1P7JA 2ZCMA 4FISA 1I6HJ 2MG4A 4I76A 1FTZA 2E2HJ 4JX4A 4UUSB 4ABZA 1ENHA 3JRHA 2ELKA 5F27A 5IYBJ 5FGLA 2TRTA 1X58A 4XRMA 3B81A 4DYRA 4V2GA 2GBYA 3BR6A 1W0TA 1TWHJ 2EBIA 5EG0A 1ZGWA 3O8HA 2R93J 2D5VA 2HDDA 3SFIA 5JLXA 4AYBN 1E3OC 3I4MJ 2DA5A 4RDUA 4BY1J 1JUSA 2KT0A 5EZHA 1S7EA 1H8AC 2R0QC 1FIAA 2GENA 4AF5A 3P9TA 4CYCB 1ZTRA 4MO7A 2JK3A 3ZQLA 2XPUA 1QRYA 2DJNA 2JWTA 3OSGA 2LP0A 5EF6A 5J1UA 2EZKA 3M4OJ 2Y9ZA 2H8RA 1BJZA 4QTRA 1BL0A 2R5YB 2DG8A 4A3JJ 5M5XJ 4GFBA 3E7QA 2VI6A 5D18A 4S0HB 1MH3A 2NP3A 1RKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAI A;  4C3H J;  1LFB A;  1ORK A;  4EEF G;  2M2E A;  5IP9 J;  3S16 J;  1RPW A;  2IEK A;  2YU9 J;  4A3L J;  5J1Y A;  2E2I J;  4FE7 A;  2QCO A;  1RR7 A;  4L5E A;  1B8I A;  2LTP A;  1G2H A;  2I10 A;  4IHY A;  2UXO A;  2UXU A;  1TWA J;  4UDS A;  2XB5 A;  2NVT J;  1LE8 A;  2E1O A;  3ZOB A;  1JT0 A;  3GTK J;  3RD3 A;  3G1O A;  1PUF A;  1UI5 A;  3LSJ A;  4C2M J;  5DS9 A;  2G7G A;  4A3G J;  2D6Y A;  3HOV J;  1I50 J;  3BG5 A;  4D7N A;  2WGB A;  3SJM A;  1ZR4 A;  4BKX A;  4M3G A;  3ANP A;  2HKU A;  1YRN B;  3A01 B;  2VPR A;  2XSD C;  4M3D A;  1EF4 A;  2O8K A;  1UG2 A;  2JMW A;  2GFN A;  5FHP A;  1VFC A;  5FKM A;  2YUS A;  5C4Y A;  3DCF A;  5DTD A;  3IV5 A;  1I3Q J;  2WV1 A;  5J1R A;  5FJ8 J;  1IRZ A;  1FEX A;  2FX0 A;  3LJL A;  3Q0U A;  3LOC A;  5C44 J;  1MSF C;  2MGQ A;  4JX5 A;  3S14 J;  1ETX A;  3ZQI A;  1JJ8 C;  5E3N A;  2PBX A;  4C3J J;  3GTO J;  3HBL A;  1RES A;  3O60 A;  4XID A;  2LY9 A;  4FCY A;  1O4X A;  3S2D J;  3GTL J;  3HOZ J;  4W1U A;  4XK4 A;  2L9R A;  1ZR2 A;  5C3E J;  3NNR A;  2EQR A;  3JRF A;  1ITY A;  1GV5 A;  2LFB A;  2AHQ A;  4CYC A;  2YS9 A;  3JRC A;  3TP0 A;  9ANT A;  3VOX A;  3JRG A;  2NP5 A;  4B4C A;  1QPI A;  3BG9 A;  5CXI A;  3JRD A;  1B72 A;  1Z77 A;  2DA1 A;  1GDT A;  5FKN A;  3PO2 J;  3VW1 A;  1FTT A;  4D5F A;  3NXC A;  1IDY A;  1BW6 A;  3ON4 A;  2X9D A;  4IHX A;  4XRS A;  3LSR A;  2R7Z J;  3VP5 A;  3PO3 J;  3HGG A;  1TWG J;  4J19 A;  5FMP A;  3RZO J;  4IHW A;  2ZCN A;  3ON2 A;  1TWC J;  4M3F A;  4JYK A;  3TW7 A;  3IUV A;  2L0K A;  2QF7 A;  3B6C A;  3FK6 A;  2ID6 A;  1RET A;  5FLM J;  4DYQ A;  2JA5 J;  3S5R A;  2DMT A;  2FQ4 A;  5JLW A;  1X2M A;  4W97 A;  5FKK A;  5IPA A;  1HDP A;  3HOU J;  3KKD A;  4DYC A;  2E19 A;  1R9T J;  3PAS A;  1VI0 A;  1ETK A;  1WI3 A;  3AQS A;  2LVS A;  5K7H A;  4JNN A;  3S1M J;  4M3B A;  3Q0V A;  2DMU A;  3OOU A;  3ZQH A;  1QVU A;  1QVT A;  3COL A;  2G0E A;  3FK7 A;  1MBE A;  4Y52 J;  3S15 J;  3VUQ A;  3Q3S A;  3NPI A;  1X2N A;  2CUF A;  4D7M A;  3ZQF A;  3JRB A;  3A03 A;  2HXO A;  3FKI J;  3Q0W A;  3GEU A;  1ETW A;  3WHC A;  5IP7 J;  2PZ9 A;  2FD5 A;  2JA8 J;  2WUI A;  2B63 J;  2HOT A;  3OSF A;  2RHA A;  2UXH A;  3CJD A;  3HTI A;  1K83 J;  1K61 A;  5EEA A;  4HNV A;  1JKQ C;  3GBG A;  1GUU A;  1Y1W J;  1DU6 A;  4ME9 A;  1MBF A;  3BTC A;  4KWA A;  5GP9 A;  2DA4 A;  3CWR A;  5M5Y J;  2W48 A;  4B1R A;  2XDN A;  4A3C J;  5BNG A;  2Y0S N;  1NK2 P;  2ZCX A;  4MLO A;  3W6V A;  3F0C A;  2DMQ A;  2NVX J;  2NVQ J;  2JN6 A;  2N8G A;  4D5C A;  2XPW A;  2CJJ A;  4IEJ A;  4A3K J;  3RH2 A;  1CQT A;  5IP6 A;  1MBK A;  5HBU A;  4ICH A;  5CXG A;  4BBS J;  5D19 A;  5EGO A;  4L62 A;  1XG1 A;  3G56 A;  3O8G A;  1P7I A;  2ECC A;  2ZB9 A;  1UI6 A;  4QSH A;  5F08 A;  1JJ6 C;  3WHB A;  2FBQ A;  1XC5 A;  1IV6 A;  3GTQ J;  1WH5 A;  4UUT A;  3DPJ A;  3G1M A;  4JP0 A;  3K7A J;  1JUP A;  5E3L A;  1BW5 A;  2OER A;  2QIB A;  2O9L A;  3QQA A;  2K40 A;  3BTL A;  3HTA A;  4IHV A;  5M3M J;  2DMN A;  2M0C A;  1WCM J;  3BRU A;  1TWF J;  3V6G A;  4MK6 A;  2EZI A;  1AHD P;  4GCT A;  1U8B A;  4JKZ A;  2UXI A;  4LOC A;  1FJL A;  4UUS A;  2Y2Z A;  2DN0 A;  5M3F J;  3H3V K;  1ZKG A;  5GPA A;  2XRL A;  3BT9 A;  3KNW A;  3JRA A;  3VW0 A;  5IOZ A;  5IYD J;  5EYR A;  5IYC J;  2DA7 A;  5FKL A;  3HOX J;  1W0U A;  3GTG J;  1BA5 A;  3ZQG A;  2CQQ A;  2JA7 J;  2M8G X;  4X1E A;  4X6A J;  2LKX A;  1LFU P;  4G12 A;  2RAE A;  3LNQ A;  1JTX A;  5EG0 B;  4MFD A;  2YVH A;  3ANG A;  3BR3 A;  3MVP A;  4ACI A;  1VND A;  4MIM A;  2PMZ N;  3KKC A;  3G7R A;  5DAJ A;  1U9N A;  3KZ9 A;  3BQY A;  4NDL A;  3BR5 A;  3OIO A;  1RKW A;  1MBJ A;  3VIB A;  1GV2 A;  2HOA A;  3LWJ A;  1WPK A;  4GCL A;  5E3O A;  3AQT A;  5HAW A;  3NRG A;  2R5Y A;  2H1K A;  1XS9 A;  3BNI A;  1MBH A;  2DA2 A;  2LK2 A;  3G1L A;  3LSG A;  5HSZ A;  2NS8 A;  2ECB A;  4C3I J;  1GT0 C;  5IOY A;  4YZE A;  2VUM J;  2V57 A;  3IH4 A;  5EDN A;  2XGE A;  3TW6 A;  1HLV A;  2OI8 A;  3RZD J;  3VPR A;  2COB A;  4A3D J;  2G7L A;  1APL C;  2CUE A;  2ID3 A;  2XPV A;  3JRE A;  3S1Q J;  1T56 A;  3GTM J;  4GFL A;  4XIC A;  3CMY A;  1H89 C;  2LD5 A;  5AQC A;  3MKL A;  1B8I B;  3RQI A;  1ETO A;  2XGC A;  2NOG A;  2ZOZ A;  1JGG A;  1LE8 B;  1MH4 A;  4M6V A;  2DA6 A;  1DU0 A;  2K9N A;  1TC3 C;  3L1P A;  3HTH A;  3IH2 A;  3NAU A;  2R5Z B;  4A3I J;  2GUH A;  2CU7 A;  2HQ5 A;  1Z0X A;  4BBR J;  4A93 J;  5EFY A;  3C2B A;  1YRN A;  3A01 A;  1AU7 A;  3HIM A;  3HDD A;  2G3B A;  1OCP A;  1POG A;  3E7L A;  1ZQ3 P;  2Y31 A;  1HOM A;  5CW8 A;  1A6I A;  1IC8 A;  1GVD A;  2TCT A;  3HB9 A;  4BXX J;  4NN1 A;  1SAN A;  3VVZ A;  4B3A A;  2K9Q A;  5F0H A;  5EZG A;  2AO9 A;  2DTZ A;  2L7M P;  1IJW C;  4A69 C;  1H88 C;  2DA3 A;  1IUF A;  3NAR A;  3M3Y J;  4Y7N J;  3I4N J;  3MNL A;  1IDZ A;  3QKX A;  2JA6 J;  5K7Z A;  2OF7 A;  2X48 A;  1MSE C;  3BQZ A;  1IG7 A;  4NEL A;  3QBM A;  4DZP A;  4M3E A;  3H0G J;  2XB0 X;  3QPL A;  2GLO A;  1A5J A;  3JR9 A;  3HOY J;  5C4J J;  1AKH B;  2HXI A;  5F0F A;  3HTJ A;  2HOS A;  2NVY J;  1B72 B;  1ETQ A;  2KDZ A;  2EZH A;  3EGQ A;  4AC6 A;  5J3L A;  2HYJ A;  2DG7 A;  3HGY A;  3MN2 A;  2R92 J;  3C07 A;  3HE0 A;  3S1R J;  4JL3 A;  3CQZ J;  4MFE A;  1OFC X;  1D5Y A;  2MW8 A;  2RAS A;  4PXI A;  3JRI A;  2LLK A;  3CRJ A;  4AUX A;  1JKO C;  3RKQ A;  3EUP A;  4XRS G;  1JKP C;  3CCY A;  1F43 A;  2F07 A;  1FIP A;  1Q1V A;  2L7F P;  3VOK A;  1F36 A;  2WB1 N;  3QPS A;  2JJ7 A;  3HOW J;  3BR2 A;  2X6O A;  3CDL A;  3IH3 A;  2FJ1 A;  5FKO A;  1NK3 P;  5HOD A;  1MNM C;  3BCG A;  2HI3 A;  2EH3 A;  2MSY A;  2QKO A;  3TP3 A;  4BY7 J;  2VKE A;  3S2H J;  1ZK8 A;  2O7O A;  2CQX A;  3K2A A;  3TED A;  4I6Z A;  2Y30 A;  1ETV A;  2QWT A;  1IGN A;  2REK A;  4FTH A;  4GFK A;  3BR1 A;  2DMP A;  2Y9Y A;  1OCT C;  3T6N A;  2R5Z A;  4QIW N;  1T33 A;  3LHQ A;  1WH7 A;  1ETY A;  1JUM A;  2CRG A;  1U9O A;  5D1R A;  1HCR A;  3BR0 A;  3BTJ A;  5F1J A;  1WGX A;  1HDD C;  2IBD A;  2QOP A;  2G7S A;  5F0C A;  4FE4 A;  2IU5 A;  5F04 A;  4HKU A;  5FLV A;  3VW2 A;  3PM1 A;  3JSJ A;  4RBO A;  5GPC A;  1U78 A;  4JX6 A;  2HYT A;  5H9T A;  1VF9 A;  3GZI A;  1UHS A;  3BG3 A;  5E3M A;  3HM5 A;  1JKR C;  3B6A A;  3FIS A;  3VVY A;  2ME6 A;  3ZQC A;  3S17 J;  3DEW A;  4A3M J;  2ME0 A;  4MXM A;  1HF0 A;  1Y1V J;  4AC0 A;  3VVX A;  3FIW A;  2M34 A;  3PPB A;  1SGM A;  2O7T A;  4A3E J;  5K7F A;  2GM4 A;  4DW6 A;  2QTQ A;  4A3F J;  3NI7 A;  3A02 A;  2NS7 A;  3SDG A;  2E2J J;  1MBG A;  2M9H A;  1AKH A;  4GCK A;  2WAQ N;  2XGD A;  2UXP A;  3LSP A;  2L7Z A;  3GTP J;  2VKV A;  3UKG A;  1JTY A;  5EGO B;  2EZL A;  4A3B J;  2ZOY A;  1JT6 A;  2NX4 A;  2W53 A;  3D1N I;  5C4X J;  3HEF A;  2K9S A;  3S1N J;  2LR8 A;  4V2F A;  1PUF B;  2YVE A;  4CGR A;  5M5W J;  2Q24 A;  2P81 A;  1UMQ A;  3F1B A;  3BHQ A;  1OJL A;  3HKZ N;  5K58 A;  3V78 A;  2OPT A;  4DZJ A;  1SFO J;  3BJB A;  1NTC A;  3GTJ J;  3BTI A;  3FRQ A;  1P7J A;  2ZCM A;  4FIS A;  1I6H J;  2MG4 A;  4I76 A;  1FTZ A;  2E2H J;  4JX4 A;  4UUS B;  4ABZ A;  1ENH A;  3JRH A;  2ELK A;  5F27 A;  5IYB J;  5FGL A;  2TRT A;  1X58 A;  4XRM A;  3B81 A;  4DYR A;  4V2G A;  2GBY A;  3BR6 A;  1W0T A;  1TWH J;  2EBI A;  5EG0 A;  1ZGW A;  3O8H A;  2R93 J;  2D5V A;  2HDD A;  3SFI A;  5JLX A;  4AYB N;  1E3O C;  3I4M J;  2DA5 A;  4RDU A;  4BY1 J;  1JUS A;  2KT0 A;  5EZH A;  1S7E A;  1H8A C;  2R0Q C;  1FIA A;  2GEN A;  4AF5 A;  3P9T A;  4CYC B;  1ZTR A;  4MO7 A;  2JK3 A;  3ZQL A;  2XPU A;  1QRY A;  2DJN A;  2JWT A;  3OSG A;  2LP0 A;  5EF6 A;  5J1U A;  2EZK A;  3M4O J;  2Y9Z A;  2H8R A;  1BJZ A;  4QTR A;  1BL0 A;  2R5Y B;  2DG8 A;  4A3J J;  5M5X J;  4GFB A;  3E7Q A;  2VI6 A;  5D18 A;  4S0H B;  1MH3 A;  2NP3 A;  1RKT A; 
#chains in the Genus database with same CATH topology
 3BPX A;  4RA2 A;  3WE3 A;  5K5R A;  1DGR M;  1ORK A;  3BZ6 A;  3KEO A;  5FLX Z;  2L54 A;  2IGK A;  2R7F A;  3ASN H;  4IQ4 A;  5L3E A;  1X4O A;  1TQP A;  2MLG A;  1NG6 A;  1P6R A;  3QYF A;  4I98 B;  5J1Y A;  4FE7 A;  1RR7 A;  3BP8 A;  3FXK A;  2LTP A;  4XMY A;  1G2H A;  3I71 A;  2I10 A;  2MD5 A;  3MFK A;  4UB6 C;  1FZP B;  4E7H A;  2L5Q A;  1OCZ H;  1TWA J;  2E1O A;  3ZGK A;  3CMM A;  3DPL C;  1UI5 A;  3QU6 A;  4BHB A;  5DS9 A;  3GFI A;  2D6Y A;  1MMD A;  2KMU A;  2AS5 F;  3HOV J;  5GAH J;  3MEX A;  2OD5 A;  2DDB A;  2E1N A;  2X1D A;  4BKX A;  3ANP A;  5EEG A;  2K3P A;  2OTL I;  3H9J A;  2VPR A;  3LWF A;  1LDD A;  4M3D A;  1EF4 A;  5HLI A;  2JMW A;  1VFC A;  3RDI A;  2DO7 A;  2GZW A;  3DCF A;  1I3Q J;  2DPU A;  2LF7 A;  3LJL A;  5B5E C;  3LOC A;  3GME A;  2MGQ A;  4JX5 A;  1W7P B;  3ZQI A;  3DKY A;  2EA4 A;  4MTE A;  3HJE A;  2PBX A;  3KYD B;  1SD4 A;  3O60 A;  5H2F C;  2ZNZ A;  3PSI A;  4CZC A;  4HNT A;  4G8X A;  2HVS A;  5CQG A;  3H5N A;  4WK8 F;  1ZGJ A;  3JTH A;  2M8E A;  1GV5 A;  2LFB A;  4CYC A;  2VQG A;  2YS9 A;  1FT9 A;  4GGG A;  2K85 A;  3JRG A;  1P4W A;  1Z67 A;  3N05 A;  1B9N A;  2E1C A;  1Z77 A;  2DA1 A;  3PO2 J;  3HIF A;  1ZRE A;  3LA3 A;  4HYE A;  4F93 B;  1S5L C;  3K69 A;  4ZTF A;  4HDU A;  2QA4 I;  1BR4 A;  3ZMV A;  2FEZ A;  4HF0 A;  4CIC A;  4XLC A;  3HGG A;  3C7J A;  4KNY A;  4RB0 A;  2XGX A;  1P4A A;  3RZO J;  4OOI A;  2VJJ A;  2JVH A;  3CUQ A;  1WSU A;  4BE0 A;  3QYB A;  1OYW A;  1U0J A;  3NQO A;  2QF7 A;  1IN4 A;  1E3H A;  3MCZ A;  4G6Q A;  4ANJ A;  5FLM J;  4DYQ A;  1H9G A;  4RB1 A;  3F8N A;  2AQE A;  5EEH A;  1O7F A;  3LAJ A;  4IRI A;  1X2M A;  4W97 A;  4KIF A;  5ICG A;  5IPA A;  3ZCO A;  5D5U B;  1B1B A;  4BAC A;  3Q5F A;  4HOB A;  2WTE A;  4LK0 F;  3VYT B;  5IY5 H;  3PAS A;  3AQS A;  2LVS A;  4C9Y A;  2DOE A;  3L09 A;  1BOA A;  3Q0V A;  2DMU A;  3OOU A;  4ZZL A;  1MMA A;  1X1D A;  2NAZ A;  4KIB A;  5J8F A;  2IGM A;  2PJR A;  2Y0M A;  4Y52 J;  3S15 J;  4U87 A;  3TGN A;  4ZDL A;  4D7M A;  1TNT A;  1EA3 A;  3FKI J;  3GEU A;  1P4X A;  6PAX A;  2PZ9 A;  4CUG A;  2UXH A;  1X3Z B;  3WG7 H;  4BJT A;  3OSF A;  2RHA A;  3CJD A;  1FOK A;  2UXX A;  1JKQ C;  3LSI A;  2OTJ I;  4RS8 A;  4ME9 A;  3EET A;  2DA4 A;  4PUS A;  1X1P A;  4B1R A;  4A3C J;  5BNG A;  4QPO A;  4AWX B;  2ZCX A;  2F4M B;  1XCB A;  2E5N A;  2L3D A;  3DP7 A;  2NVX J;  3FKJ A;  2N8G A;  2GXG A;  5DM7 F;  1DGW Y;  1T08 B;  2CH0 A;  2CJJ A;  5IP6 A;  2DLL A;  2VPL A;  5HS8 A;  5CXG A;  2A68 F;  5EGO A;  2ZJR F;  4L62 A;  1XG1 A;  1KA8 A;  1LJ9 A;  2G9W A;  3SEQ A;  2X51 A;  1Z7L A;  3DKW A;  3T1B A;  2FBQ A;  3T0Y A;  1E3P A;  2Z33 A;  3J81 Z;  2KIM A;  3G2B A;  1TTY A;  2V1U A;  5E3L A;  2OER A;  1AA7 A;  4ZC3 A;  1ZGA A;  2R7O A;  4M74 A;  2B0L A;  1IN6 A;  2K40 A;  3BTL A;  4OWR B;  3F9K A;  1W1W E;  4IHV A;  2M0C A;  2STT A;  4ITV A;  1O3R A;  4LMY A;  3FDY A;  4MK6 A;  3ZN0 A;  3L7W A;  4JKZ A;  2IXS A;  2W85 A;  1W5T A;  4DBR A;  3J80 K;  4YII A;  3QOD A;  4UUS A;  2VQC A;  3MWM A;  3CF5 F;  3FXJ A;  5M3F J;  1MMN A;  3QPH A;  4YFK F;  1FBS A;  5IYD J;  3RCO A;  4M6Y A;  3HOX J;  2VON A;  1Z7U A;  3ZQG A;  2JA7 J;  1XMA A;  4WIB A;  4C2M A;  5BMZ A;  1LFU P;  5D6F A;  4G12 A;  5F6F A;  1BJA A;  3GZ5 A;  3CC7 I;  1DDN A;  3H35 A;  5EG0 B;  4MFD A;  4ZTJ A;  1VND A;  2PMZ N;  2ZJ2 A;  5DYM A;  3BQY A;  4E7J A;  4XSX F;  3OIO A;  1RKW A;  4KA4 A;  3ZPL A;  1I5Z A;  1V5F A;  2IA1 A;  2WBM A;  1BR2 A;  3O6B B;  1ON1 A;  2HR3 A;  4U0V A;  3BNI A;  4LG0 A;  5HSZ A;  4MGR A;  3WTU C;  5IOY A;  2VUM J;  3TO7 A;  1BI2 A;  5DCM A;  1J0R A;  2XGE A;  5EDN A;  1HLV A;  2BVM A;  4BXF A;  1YIT I;  2QUF A;  1WWX A;  3VPR A;  4MHG A;  2G7L A;  1F1Z A;  2DFF A;  4ASN A;  3PNY A;  4DGW B;  3S1Q J;  3QPT A;  4XIC A;  1T0F C;  1H89 C;  2LD5 A;  2NRA C;  4IVN A;  2R7X A;  2KL4 A;  4FAS D;  1YTY A;  3DV8 A;  1ETO A;  2NOG A;  5F64 A;  2ZOZ A;  5E1X A;  1UHM A;  1XD7 A;  3H3Z A;  4U7B A;  3KFW X;  3VEP A;  1RIO H;  3SZG A;  2DAO A;  3S2W A;  2P7C B;  2EB7 A;  4IQJ A;  2QKM B;  1X4P A;  2HPM A;  1Z0X A;  1FY7 A;  2G3B A;  3E7L A;  3LFK A;  2W4S A;  1A6I A;  4L9N A;  1YS7 A;  2EFO A;  5ED4 A;  1IC8 A;  4EMS A;  4NQW B;  2KJB A;  3HB9 A;  4XLH A;  1SAN A;  1WZ2 A;  1DP3 A;  2K9Q A;  3K4K A;  3R4K A;  2DTZ A;  2HPI A;  2O5R A;  1NHA A;  3B73 A;  3GFJ A;  3M3Y J;  4Y7N J;  3I4N J;  1HW2 A;  3FHN A;  3BG7 A;  3D0S A;  2JT1 A;  3QKX A;  2LNB A;  2JA6 J;  1T39 A;  4CXF A;  3M7G A;  1IG7 A;  3H92 A;  4NEL A;  1ZH5 A;  4M3E A;  4UV9 A;  2HS5 A;  3OYG A;  3G71 I;  1SVL A;  1PP7 U;  2XB0 X;  3HHG A;  2VXD A;  1AKH B;  3HTJ A;  2HOS A;  1R4M B;  2NVY J;  1N25 A;  2AQF A;  2KDZ A;  3S3N A;  2V4J C;  4MQ9 F;  3MN2 A;  4IPA A;  4MFE A;  1FX7 A;  4Y3O A;  4Y33 A;  1XSX A;  3SFZ A;  2WC2 A;  3EUP A;  3GEZ A;  2L9N A;  2JPC A;  2W25 A;  2AXL A;  3CUQ B;  3VOK A;  2WB1 N;  2ESH A;  3QPS A;  3PL8 A;  4RGU A;  3HOW J;  1FMW A;  3BR2 A;  2X6O A;  3CDL A;  4L9J A;  4U7D A;  3VOD A;  2ZCW A;  3V42 A;  5HOD A;  1MNM C;  2FNP A;  3F3X A;  1D5V A;  1D8J A;  1Z3X A;  2PI0 A;  4BY7 J;  3FM3 A;  1FYK A;  3BZK A;  3P7N A;  2Z2S B;  1HKQ A;  3K2A A;  5TIS C;  3TED A;  1RUN A;  2G7H A;  1QZZ A;  1IGN A;  4FTH A;  4GFK A;  1SVM A;  2Y9Y A;  1OCT C;  4BQA A;  1GLN A;  4BHP A;  4QIW N;  5DDG A;  1J09 A;  2K3F A;  1KU9 A;  3CJR B;  2VBY A;  2CRG A;  2DYS H;  5AON A;  2PJR B;  4YEJ A;  3ZN1 A;  2G7S A;  4FE4 A;  1G3S A;  2KPM A;  4E7S A;  3N4M A;  1WFX A;  1EH8 A;  3GLX A;  3VW2 A;  3PM1 A;  3JSJ A;  1BIB A;  2ISZ A;  4RBO A;  1U78 A;  1AWC A;  3Q9S A;  2K5C A;  1UHS A;  3WTW C;  1JGS A;  1GHC A;  5L3G A;  1LEB A;  3HM5 A;  3FIS A;  1SC7 A;  2A3S A;  1HF0 A;  1Y1V J;  3CUQ C;  3U2R A;  4AC0 A;  1E2X A;  5CYV A;  2O7T A;  2BY2 A;  2YX7 A;  3M8E A;  3PJR A;  2ESN A;  2ZXH A;  3LL7 A;  4L0Z B;  2QTQ A;  4XRF A;  5ERI A;  4I7H A;  2XIG A;  2ZKZ A;  1OLT A;  3A02 A;  2EK5 A;  2FBI A;  1Z1D A;  2NS7 A;  3SDG A;  1MBG A;  5CVI A;  2VJ5 A;  4LLL A;  2WAQ N;  5LHI A;  2Z99 A;  2O61 A;  3TO9 A;  1EJ9 A;  1TBX A;  3E5U A;  5EGO B;  2ZOY A;  2W53 A;  2RDP A;  1OCC H;  3D1N I;  3E6C C;  2QEN A;  4V2F A;  3FXM A;  1XN7 A;  4CGR A;  1IN7 A;  1VQK I;  2M45 A;  1IV8 A;  2VBW A;  3K4J A;  2CMP A;  3E6D A;  4HSR A;  5CLS A;  4ENJ A;  3OYA A;  4KT6 A;  3BJB A;  1NTC A;  4LG3 A;  1HSJ A;  4XN3 A;  3BOQ A;  3DBL B;  2MG4 A;  2EV6 A;  4I76 A;  2OA4 A;  2E2H J;  4C2U A;  1Z91 A;  4UUS B;  4ABZ A;  3K70 D;  4HPQ A;  5IYB J;  5FGL A;  1DQU A;  4R79 A;  4IHT A;  4IRV A;  2M1B A;  3HKZ A;  2GOM A;  4V2G A;  1W0T A;  2BBY A;  2EBI A;  3KP5 A;  5FRN A;  4G9Y A;  2EV5 A;  3C18 A;  2LG4 A;  1K78 A;  2DFI A;  3SFI A;  1E3O C;  3KCC A;  4PDK A;  2FNA A;  1VQ8 I;  1REP C;  5FD5 A;  4BY1 J;  1JUS A;  2KT0 A;  5EZH A;  2FOW A;  2BYV E;  2RRE A;  1S7E A;  3HRU A;  4LK1 F;  4DQ2 A;  2GEN A;  4AF5 A;  4M9X A;  4KMF A;  5E8G A;  5ILV A;  2NS0 A;  2QSF X;  2VL8 A;  2K27 A;  3ZMD A;  4CYD A;  2UXN A;  2XAS A;  2LP0 A;  2W1O A;  4I0A A;  1QZE A;  3MQ0 A;  4GXO A;  4RAG A;  2DG8 A;  2WAF A;  5E8I A;  1YYV A;  4LG0 B;  5D18 A;  2FA5 A;  1FPQ A;  3NWT A;  2NP3 A;  2E60 A;  4HA8 A;  3OYB A;  4C3H J;  1H9T A;  1VQL I;  3CJT B;  2O0Y A;  4OAY A;  4EEF G;  1XCV A;  2FBK A;  1LFP A;  2M2E A;  3WE2 A;  2BW3 A;  1RPW A;  5LEK A;  1SFU A;  2WAE A;  2E2I J;  5D6E A;  2JRM A;  3W2W A;  1B8I A;  1TW3 A;  2HQA A;  1DPU A;  2MAB A;  1T95 A;  3RKW A;  4XLN F;  2UXU A;  3AFH A;  4BQO A;  1JT0 A;  1QHH D;  2ELH A;  3OYD A;  4N4O B;  3RD3 A;  3F6O A;  3DTI A;  1VTN C;  1PUF A;  4KMU X;  1STZ A;  2YU3 A;  2M4G A;  2B3W A;  3GCM A;  2M87 A;  4IOA F;  1L3L A;  3G4S I;  2IS6 A;  1I50 J;  3WTS C;  4D7N A;  2WGB A;  3W2A A;  3SJM A;  3WTT C;  1PDN C;  1ZR4 A;  4I02 A;  4B8X A;  4YIF A;  2GAU A;  3CCR I;  2D2W A;  2GA2 A;  3DU6 A;  3EPZ A;  3OS2 A;  2V1X A;  3TOB A;  4ZDP A;  4S04 A;  1UG2 A;  4CH7 A;  5FHP A;  1MZB A;  4LFU A;  1FOY A;  2BY1 A;  2D1H A;  2WV1 A;  3KX2 A;  3M07 A;  2LDU A;  5J1R A;  2W7N A;  3BZC A;  2RQP A;  3Q0U A;  4KIC A;  4P9U A;  1MSF C;  3ESW B;  4FT8 A;  3HOT A;  3CZ6 A;  3S14 J;  1ETX A;  3MKY B;  1ZLK A;  4C3J J;  3GTO J;  4XN0 A;  4XID A;  1FNN A;  2XHK A;  3E0J B;  1O4X A;  3R0J A;  3HOZ J;  4W1U A;  2H6B A;  1ZR2 A;  3NNR A;  4F52 A;  3HG9 A;  2TDX A;  1MW7 A;  2KZG A;  3TDU C;  3KLO A;  5TRD A;  3VOX A;  1D0Y A;  3K4L A;  3WGH A;  2KP6 A;  4B4C A;  5FB2 A;  1MJB A;  1X3U A;  5FKN A;  2HEO A;  2QGU A;  2W84 A;  1IDY A;  1BW6 A;  2H8W A;  2VLA A;  2X9D A;  1U3E M;  4EV0 A;  2I5U A;  2GIZ A;  2R7Z J;  3OOP A;  3VP5 A;  3REO A;  2EPF A;  1TP4 A;  1TWG J;  3KYC B;  1D8K A;  4LJZ F;  1XMX A;  3C1D A;  4BH9 A;  3V8J A;  4IHW A;  2Q1Z B;  3EDP A;  2ZCN A;  2HZD A;  1ON2 A;  2ACJ A;  3ON2 A;  2FSW A;  2KRH A;  4JYK A;  4HNU A;  3TW7 A;  3HRM A;  1YFH A;  3F22 A;  3FK6 A;  1R71 A;  4Q4Z F;  2WA0 A;  3S5R A;  2MH9 A;  1K4S A;  4R8H A;  3D5L A;  5ILU A;  5FFZ A;  1Y39 A;  1BR1 A;  4HX8 A;  2Q2E A;  3V7S A;  1HA8 A;  3RJP A;  4MNU A;  3KKD A;  2CUZ A;  4DYC A;  2Z1D A;  1LPQ A;  2H09 A;  5DD8 A;  3S8P A;  3I64 A;  2XAQ A;  4JOM A;  1J75 A;  1MDM B;  1W5C C;  4OIR F;  3ZQH A;  1H0M A;  2E1M B;  3FK7 A;  3MMY B;  4HLX A;  2M7B A;  3I0T A;  5D5W B;  1YJN I;  2CUF A;  3BWG A;  5CQE A;  3ZQF A;  3JRB A;  1X3W B;  2FJI 1;  3TOA A;  4X0G A;  3Q0W A;  3HTS B;  2EIN H;  2XAG A;  2JA8 J;  3CP2 A;  2WUI A;  2B63 J;  2HOT A;  4Y15 A;  3L2U A;  4PFP A;  2DK5 A;  4XR6 A;  5EEA A;  1S7O A;  3ECH A;  4G7H F;  1MBF A;  1RC9 A;  1CF7 A;  5M5Y J;  2W48 A;  2ADU A;  4E7I A;  1IRX A;  1K6Y A;  2XDN A;  2PN6 A;  3E5Q A;  3W6V A;  2DMQ A;  3I9V 2;  4J01 A;  2XPW A;  4KT5 C;  4IEJ A;  3RH2 A;  4A3K J;  3MZH A;  4NB5 A;  1XGO A;  5HBU A;  3F72 A;  4EJW A;  1BC7 C;  4P5O A;  2MC3 A;  3G3Z A;  5D19 A;  2O8X A;  1VQM I;  4AU7 A;  1FSH A;  2P5L C;  3O8G A;  1P7I A;  3U9G A;  4QSH A;  1JJ6 C;  2ZFW A;  5J4V A;  2CQK A;  1XC5 A;  3BRO A;  4UUT A;  3OYM A;  2K4J A;  2E1M C;  2I8D A;  3HRS A;  4JP0 A;  2A5Y B;  2QIB A;  2O9L A;  4CHU A;  3QQA A;  2AXT C;  3OMY A;  1WCM J;  3WG9 A;  1TWF J;  2RQQ A;  1V5E A;  2EIK H;  4MEY F;  2EZI A;  4BAY A;  1QU3 A;  1O7L A;  2UUZ A;  3BY6 A;  3EYY A;  3K1N A;  5J4Y A;  3T8T A;  1SMY F;  1R6R A;  2JUG A;  4NNJ A;  3RYP A;  1TQI A;  1P2F A;  4Y17 A;  1BI1 A;  3H3V K;  2A05 A;  3WTZ A;  4JQF A;  3BT9 A;  2FBH A;  3RKX A;  5IOZ A;  5E17 F;  2OAZ A;  1W0U A;  1IF1 A;  1VQ9 I;  1WHU A;  1MJ9 A;  5KAI C;  5FRO A;  4X6A J;  3M8F A;  2CSO A;  2LKX A;  3ERM A;  1SAU A;  1ZLJ A;  2F48 A;  1MJA A;  2BZT A;  3FXO A;  3LSM A;  2EA2 A;  4AD9 A;  4ACI A;  2YVH A;  3GYH X;  3KZ9 A;  3K4B A;  3WU0 A;  4G94 A;  1KQ9 A;  1MBJ A;  2LSO A;  2IS2 A;  1UEL B;  3K4M A;  3ZR8 X;  2KDO A;  3BJA A;  1UZC A;  2OCC H;  4KIG A;  3HRT A;  1FYM A;  4GCL A;  4BXU A;  2RGV A;  3AQT A;  1MMG A;  1SEU A;  5DD4 A;  3SZP A;  3QRF F;  2FML A;  2LK2 A;  2ECB A;  3CES A;  1QGP A;  1LVA A;  5H20 A;  4EM1 A;  2VOO A;  4Z6Y A;  3IKV A;  2OI8 A;  4YG2 F;  4RM2 A;  4A3D J;  4QLC U;  2CUE A;  2ID3 A;  2KKO A;  2BW3 B;  4ENK A;  4GFL A;  1HC8 A;  4Q48 A;  2HQN A;  3MKL A;  1B8I B;  3ML6 A;  3RQI A;  3IRR A;  2PEX A;  2ZME A;  1D1C A;  3H3U A;  3I53 A;  3JSO A;  4HZF A;  1JGG A;  3GWZ A;  3TL4 X;  1U6G A;  3FF5 A;  2IGO A;  3ZP5 A;  1ZRF A;  2K9N A;  5A2Q K;  3IRQ A;  2JSP A;  4M9Z A;  1XMK A;  1F9N A;  4E7K A;  2E71 A;  4NUB A;  2R5Z B;  4A3I J;  2GUH A;  2CU7 A;  2L4A A;  3IP4 B;  3OS0 A;  1YRN A;  3P9I A;  1G8X A;  1AU7 A;  2BXY A;  2COM A;  1Y0U A;  1POG A;  1WQ2 A;  3K2Z A;  1ZQ3 P;  4UUV A;  5CW8 A;  2K02 A;  2TCT A;  4BXX J;  1MGT A;  4PFO A;  5HNF A;  5EZG A;  3WTX C;  2L7M P;  4LB6 B;  1H88 C;  1IUF A;  1Y56 A;  2M4K A;  5GAD J;  3NRV A;  4I0B A;  2GWR A;  2EFN A;  3QYE A;  1AOY A;  3M1E A;  5IT9 K;  1IDZ A;  2IT0 A;  5K7Z A;  3UR3 C;  1MSE C;  2WY8 Q;  3BQZ A;  1A6Q A;  2VN2 A;  4HQM A;  2YVX A;  4UHT A;  2R3S A;  4HBL A;  3L9F A;  3VB2 A;  4YIR X;  3WTV C;  3FWE A;  2JRT A;  2X4H A;  3QPL A;  3CCM I;  2LYC A;  2GLO A;  3JR9 A;  1A5J A;  4PSW A;  3HOY J;  3OYI A;  2HXI A;  4IRG A;  5F0F A;  1FC3 A;  1FYL A;  1R1T A;  1VQ4 I;  1S9H A;  4D9J A;  2WV0 A;  5AIP A;  2RC4 A;  3R60 A;  2R92 J;  3HE0 A;  2P5V A;  3CQZ J;  3RKY A;  2CQN A;  1S29 A;  4CSW A;  1D5Y A;  2RAS A;  2IJL A;  3CRJ A;  5H6R A;  2E5Z A;  1ACI A;  4XRS G;  1JKP C;  1B9M A;  3KP7 A;  1FIP A;  4DOZ A;  1F36 A;  1SD7 A;  1BM9 A;  5E20 A;  3IH3 A;  5LLQ A;  3EUA A;  2Q8K A;  3L2W A;  4CA0 A;  1KU7 A;  3F23 A;  3BCB A;  4GRI A;  1TT5 B;  2A5W A;  1HKT A;  5GTH C;  2VKE A;  3S2H J;  4IF4 A;  5B1B H;  4I6Z A;  2X1C A;  4OU0 A;  2CW8 A;  2VBX A;  1FOX A;  1JXS A;  4ETS A;  2IRF G;  2PBI A;  3AAF A;  3T6N A;  3DTK A;  3DPT A;  3DLA A;  5K5Q A;  3DWL E;  1K6O A;  1RRJ A;  1JUM A;  1U9O A;  1ZG1 A;  4KDP A;  1ZEL A;  2K9L A;  1DUX C;  2FXA A;  4HG2 A;  2XUB A;  3TQN A;  3CMA I;  1I39 A;  4U88 A;  3GF2 A;  4RAY A;  2B7E A;  5FLV A;  1YW9 A;  3AG4 H;  5ILS A;  3KP3 A;  1WJB A;  3F8F A;  4JX6 A;  2HYT A;  3P9C A;  3DEU A;  2XF6 A;  4KFC A;  3FXR A;  4IOC F;  3B6A A;  1X19 A;  3S17 J;  4AVP A;  3DXJ F;  3FIW A;  2M34 A;  1M1E B;  1YS6 A;  4L18 B;  1OPC A;  2L02 A;  5ICC A;  1HW5 A;  4BJ6 C;  1QHG A;  2KRC A;  2RKH A;  1N77 A;  4DIQ A;  1XGM A;  5FGM A;  2PJP A;  3PIP F;  3EYI A;  4XL9 A;  2WWY A;  2OQG A;  5LEJ A;  4XKC A;  3FXU A;  5B1A H;  4GCK A;  4M6X A;  2XGD A;  2EFW A;  3LSP A;  3GTP J;  3CME I;  3UKG A;  1JTY A;  2FOK A;  2RNG A;  2EZL A;  3IWF A;  4A3B J;  1JT6 A;  1RNL A;  2MC4 A;  2ZSI B;  2P5K A;  3WTY C;  2LR8 A;  4CCJ A;  4A5M A;  3W6J B;  1OIS A;  5HVQ C;  1Z6T A;  3F8M A;  1F4K A;  1QA6 A;  1FWZ A;  2EFQ A;  3HKZ N;  3PIO F;  4I99 C;  3FZV A;  4XQF A;  4XON A;  3GW2 A;  3GTJ J;  3S3O A;  3BTI A;  5L3C A;  2NNN A;  3R61 A;  3T8R A;  4FET A;  4LIU A;  4EJO A;  4FIS A;  3GUD A;  3VYU B;  2KQR A;  2QQ8 A;  1BN5 A;  1K7A A;  2DTR A;  3X2Q H;  2LRE A;  1XDU A;  2TRT A;  4KN7 X;  2KHM A;  2QSH X;  2XKP A;  4BYY A;  4ENM A;  4DYR A;  4M72 A;  3SHF A;  2CFX A;  1PP8 F;  3BDD A;  4RMN A;  1XGS A;  3O8H A;  5KCM A;  4BHC A;  2HDD A;  4P96 A;  5CVU A;  2BOL A;  3HSR A;  5H6Q A;  4RGR A;  2IS4 A;  5JR3 A;  3HOS A;  2OCE A;  3EQL F;  2GIV A;  2P6S A;  2VIX A;  2VB6 A;  3P9T A;  4CYC B;  1I1G A;  4HST A;  1QRY A;  2OZU A;  2DJN A;  2LBF A;  5EF6 A;  5J1U A;  1W7P D;  2O3F A;  1FBU A;  2CS3 A;  3K4N A;  2VQH A;  2H8R A;  4A3J J;  1QPM A;  5M5X J;  4AYB A;  3E7Q A;  2VI6 A;  1VZ0 A;  1R5I D;  1ZRD A;  2QM3 A;  1ZAO A;  1S6L A;  1N75 A;  2JQ7 A;  1R5H A;  4MQV A;  4HF1 A;  2NVU B;  3SEZ A;  5IP9 J;  3RI4 A;  4UV8 A;  3S16 J;  2RVC A;  3C3W A;  2YU9 J;  2QCO A;  4L5E A;  3OYH A;  3P5J A;  1UHW A;  2VE8 A;  3VDX A;  2QSG X;  3JAM Z;  2BHZ A;  3CUO A;  4IHY A;  4UDS A;  2OU2 A;  4XSZ F;  2ZME B;  3T5X A;  1YIO A;  4PJJ A;  3ZOB A;  4DNC A;  3RSN A;  4E6K G;  3IL2 A;  2BXZ A;  4C2M J;  4IKF A;  2K4B A;  3BJ6 A;  1T2K A;  3HHH A;  2L9V A;  2G7G A;  3DBR B;  3ELK A;  3H36 A;  1T8I A;  4K2E A;  3QOP A;  1B59 A;  2BY0 A;  2V9P A;  3BG5 A;  3J81 K;  4RB3 C;  1N78 A;  3NEU A;  4ZJZ A;  5DM6 F;  5B3S H;  1YRN B;  4C30 A;  2WY7 Q;  3NWS A;  1MND A;  3SWH A;  5FKM A;  4NC6 A;  5LRR A;  2YUS A;  2ISY A;  1BIA A;  5CVJ A;  4EVI A;  3I56 I;  3O3K A;  4PSX A;  1RR8 C;  1SFK A;  1IRZ A;  1FEX A;  2FX0 A;  2DPD A;  2MH2 A;  5DEQ A;  3R0A A;  1HQC A;  1HBX G;  4ZYG A;  1BI3 A;  2V1N A;  3PFI A;  2LF8 A;  3PFY A;  1RES A;  2XKO A;  4AM3 A;  1B4A A;  3HTU A;  2HYF A;  3L00 A;  4PJ0 C;  1YW7 A;  4ZYA A;  4FCY A;  2V7F A;  3S2D J;  2LRD A;  2E34 A;  4BEH A;  4AID A;  2L9R A;  4N9H A;  3HXL A;  2EQR A;  3PUF A;  2JSC A;  2VJ4 A;  3JRF A;  1ITY A;  2QVO A;  2AHQ A;  1V55 H;  3TP0 A;  2RN7 A;  1X1B A;  2ZME C;  4H0E A;  2DT5 A;  2B9S A;  3BG9 A;  3LFU A;  1HKS A;  1DPR A;  4GO1 A;  1GDT A;  4D5F A;  3SQN A;  3GO5 A;  3O2P E;  4B44 A;  4XRS A;  4RGS A;  3L2Q A;  1G3Y A;  3W6K B;  4BGD A;  5LFA A;  2DJI A;  4J19 A;  5FMP A;  3OL3 A;  4E70 A;  2CYY A;  2QEX I;  5BQT A;  3BJO A;  1TWC J;  2BE5 F;  2VKD A;  3ABM H;  4M3F A;  2A6E F;  3IUV A;  3J7A O;  3RTR A;  3DEE A;  3B6C A;  2L2O A;  1RET A;  3ASO H;  1Y6I A;  3OYC A;  2ZBK A;  2BGC A;  1FP1 D;  2FQ4 A;  1IO2 A;  4ZYD A;  5KAF C;  1XSD A;  2R7U A;  5FKK A;  1Y8Q B;  3MZY A;  2V6E A;  1U8R A;  2V1D A;  2OV7 A;  5JFR A;  4OD5 A;  3JCU C;  4FQG A;  2DOF A;  2OBP A;  5CVR A;  4HF2 A;  2A69 F;  3HSF A;  3LMM A;  2A2F X;  2UWM A;  1WI3 A;  1U5T A;  5K7H A;  4M3B A;  2KLO A;  1IRF A;  4NHJ A;  1IXS B;  1T6S A;  3E5X A;  4G7Z F;  5FRM A;  3WOD F;  2G0E A;  1MBE A;  3E6M A;  3VUQ A;  5GTI C;  3Q3S A;  3M1C A;  1A31 A;  4IXA A;  3KP6 A;  2DK8 A;  2X6W A;  3A03 A;  1R36 A;  4ZH4 F;  2HXO A;  3VYR B;  1ETW A;  1WRJ A;  3I59 A;  1KQ8 A;  2CW0 F;  1WJF A;  2VT3 A;  3H5A A;  4B09 A;  3BCA A;  1IRG A;  1W7P A;  1K83 J;  5KNL A;  5HOO A;  2F6C A;  1RZ4 A;  3GBG A;  5HDK A;  1GUU A;  4HDV A;  1Y1W J;  3DF8 A;  1ZG3 A;  1DU6 A;  3QWL A;  4KWA A;  1PVE A;  3CWR A;  2HWV A;  1SFE A;  1QQI A;  4Y4R A;  1IW7 F;  2V79 A;  3V4G A;  3VSK A;  1NK2 P;  4MLO A;  3F0C A;  5DCM B;  4XNF A;  2QQA A;  2JN6 A;  2VKH A;  5TGT A;  4E7L A;  3VTI A;  2HDW A;  3CF2 A;  2K7L A;  4JBA A;  2Y48 A;  1R1U A;  1CQT A;  5CVV A;  2A61 A;  4ICH A;  2DT7 B;  4BE2 A;  1Z3Y A;  2BEO A;  4BBS J;  3OIP A;  1YW8 A;  2F5V A;  1FSE A;  3IWZ A;  2ZB9 A;  1UI6 A;  2CFO A;  3WHB A;  3ABU A;  2Y0S A;  2NOJ B;  4Y13 A;  4YRV A;  1WH5 A;  3OR2 C;  3DPJ A;  3G1M A;  3RYR A;  4UVB A;  4IX7 A;  1NG7 A;  3K7A J;  4LGW A;  3JSP A;  5J47 A;  4LIV A;  4RAZ A;  3VWB A;  2VT2 A;  3CTA A;  2W82 A;  5J40 A;  4BNC A;  3BRU A;  3LAP A;  3V6G A;  1Z21 A;  4BL0 B;  1KGS A;  5BOX A;  1U8B A;  2ZXW H;  3P9K A;  3CO7 C;  4C2T A;  2DI3 A;  2UZK A;  1YLF A;  2NXN B;  2LMD A;  3KP2 A;  2XRL A;  3KNW A;  3JRA A;  3VW0 A;  5EYR A;  5IYC J;  2DA7 A;  5FKL A;  1BA5 A;  4HX4 A;  4X1E A;  2RAE A;  3LNQ A;  3V8K A;  4II3 A;  2FE3 A;  2ZXJ A;  3MVP A;  3ANG A;  4MIM A;  3KKC A;  4E4H A;  3TBI A;  5DAJ A;  4G6D A;  4OIN F;  4NDL A;  4D1Q A;  2Z5U A;  1GXQ A;  1WJ5 A;  2IP2 A;  3BR5 A;  2QQ9 A;  4N0B A;  1W36 D;  1XX5 A;  2PG4 A;  3U21 A;  1ULY A;  5E18 F;  1GV2 A;  1XB4 A;  2HOA A;  3LQQ A;  1TL8 A;  3LWJ A;  1SFX A;  4A2U A;  2H1K A;  4RM3 A;  3PNV A;  1MBH A;  2DA2 A;  3G1L A;  3LSG A;  1R23 A;  1WJE A;  2NS8 A;  2MBF A;  4WXD A;  2BV6 A;  4YZE A;  2LY1 A;  2V57 A;  2P4W A;  1G6N A;  1LVK A;  4AVZ A;  3TW6 A;  2HNH A;  5CJ9 A;  4U9L A;  1D0X A;  1APL C;  5KK1 A;  4U0Y A;  3JRE A;  5D4S A;  4AIK A;  4BE1 A;  3GTM J;  3CMY A;  1K79 A;  5AQC A;  3CCJ I;  3OYE A;  3JW4 A;  2NNY A;  2CG4 A;  5A2Q Z;  2XGC A;  4BJ5 C;  1EH7 A;  1WJC A;  2HFH A;  5BPD A;  3M9A A;  1DU0 A;  4BUP A;  2XVC A;  1I6X A;  5D4R A;  2VC1 A;  2HVR A;  1Z9C A;  4KUM A;  1KYW A;  2D1V A;  1ONV A;  4LLG F;  1K4T A;  4ESF A;  3QAH A;  2VOP A;  4XLE A;  4O5V A;  3A01 A;  3IAS 2;  3HIM A;  3GLL A;  2RNJ A;  4I09 A;  2J5O A;  3QU3 A;  3ABL H;  4M73 A;  4NN1 A;  3VVZ A;  1WI9 A;  4MTD A;  2EFP A;  5IT9 Z;  2DFE A;  1IJW C;  1OMI A;  2HKO A;  5J8C A;  2DA3 A;  3ABT A;  1B6A A;  2L7K A;  3OYK A;  3TKY A;  1GVJ A;  3U1K A;  4F92 B;  5HLH A;  2OF7 A;  4MXM A;  4XOR A;  2GXB A;  1X1A A;  4BEH B;  4A5N A;  1TZL A;  3H0G J;  4M9S A;  3LQR A;  5DCF A;  4RAF A;  5JHF A;  1TT0 A;  2R7T A;  3F8C A;  1D0Z A;  4E7Z A;  2HGC A;  2X6Y A;  5C4J J;  3ZQ7 A;  1J9I A;  1ETQ A;  2IGN A;  2EZH A;  3DTE A;  3EGQ A;  2IA2 A;  4WF2 A;  5J3L A;  2HYJ A;  3AG3 H;  4WX9 A;  1YI2 I;  2W57 A;  2DG7 A;  1J7K A;  4HAM A;  1XGN A;  3S1R J;  3CCE I;  2JUC A;  2M3A A;  5BPI A;  1DP7 P;  1JKO C;  3RKQ A;  4UB8 C;  2FRH A;  2XAJ A;  2F07 A;  3EUK L;  1Q1V A;  3PUB A;  4J00 A;  2L7F P;  3HC7 A;  5K1Y A;  3J80 Z;  5F1R A;  4CCL A;  2HTJ A;  1W5S A;  2VC0 A;  5FKO A;  3K0L A;  2VBZ A;  3CDI A;  1ZAR A;  2HU9 A;  1ZYR F;  2HQR A;  4ZYE A;  2HI3 A;  2MSY A;  3CCS I;  1WVR A;  3TP3 A;  5K5O A;  2MD0 A;  1ZG5 A;  1O3T A;  2O7O A;  3CP8 A;  2ELJ A;  5HLG A;  2Y30 A;  1QNT A;  4A0Z A;  3SZT A;  1D3Y A;  3GXO A;  2QWT A;  4S05 A;  2VAS A;  1S8N A;  5D8K B;  1U5T B;  3LHQ A;  1ETY A;  1VQN I;  2E7X A;  4QPQ A;  5LD2 C;  3BTJ A;  1PUE E;  1WGX A;  2BY3 A;  1K78 B;  1HCR A;  4OIQ F;  2M7A A;  4NQW A;  1L0O C;  2H94 A;  3VFZ A;  5H9T A;  3I59 B;  5TJJ A;  1VF9 A;  2OJE D;  5CKT A;  2QYO A;  3GZI A;  3BG3 A;  3BPV A;  4FHT A;  1MNE A;  5E3M A;  3ZQQ A;  2O6G E;  2QKL B;  1JKR C;  1JHH A;  3AG2 H;  2ME6 A;  3H1C A;  4ZYH A;  3HUG A;  4ZDO A;  3DEW A;  2ME0 A;  4ESB A;  4AIJ A;  1G3T A;  4RLQ A;  4BU2 A;  1JI8 A;  2PLY A;  3KIO A;  1YE9 A;  3QP6 A;  4A0X A;  3DBH B;  3OYF A;  3RIR A;  1SGM A;  3PPB A;  2OQR A;  1KYZ A;  4A3E J;  4BS9 A;  2RV8 A;  4XLP F;  2GM4 A;  1O3S A;  4DW6 A;  2ZJQ F;  2H1L A;  4A3F J;  2XC7 A;  3TMO A;  2EIM H;  2CV1 A;  2ZNY A;  4CZZ A;  3NI7 A;  2E2J J;  3ECO A;  2VJI A;  4GCV A;  3ONQ A;  1J59 A;  1V54 H;  2F4O B;  1AKH A;  5FFX A;  3AG1 H;  4CO8 A;  4HQE A;  3CCL I;  2HVQ A;  2QLZ A;  3FM5 A;  4F91 B;  3HEF A;  2K9S A;  5C4X J;  1U5T C;  1PUF B;  2YVE A;  2E36 A;  1WKM A;  2Q24 A;  1XPX A;  1UMQ A;  1OJL A;  1FP2 A;  5K58 A;  3E97 A;  5LGU A;  3V78 A;  2OPT A;  2JZY A;  2VXZ A;  3FRQ A;  3OWT A;  1P7J A;  3IHU A;  3WU2 C;  3WU1 B;  4EM0 B;  1FTZ A;  4JX4 A;  1UCR A;  1ENH A;  2ELK A;  2YX4 A;  1U2W A;  4PJN A;  4ZZD A;  3BLY A;  3BR6 A;  2JA2 A;  4OAZ A;  1ZGW A;  1OR7 A;  2R93 J;  3K1P A;  2FF4 A;  2Q0O A;  1J5Y A;  2D5V A;  4AYB N;  4HRI A;  4I2O A;  3I4M J;  4RDU A;  1UST A;  2F5D A;  4F7Z A;  1VQ7 I;  3I54 A;  1FIA A;  2KRF A;  2JK3 A;  3C2H A;  4L5J A;  5E1Z B;  3ZQL A;  2JWT A;  2HTS A;  2KIQ A;  2R4G A;  2DOA A;  2E35 A;  2M30 A;  2MLK A;  3HZJ A;  1IXC A;  3KEQ A;  3M4O J;  2Y9Z A;  2KFD A;  2CV0 A;  4WWC A;  4AIH A;  3EUH A;  4GFB A;  2NYX A;  2OZ6 A;  1MH3 A;  1O57 A;  2IAI A;  3V7C A;  1VQ5 I;  1EV7 A;  1LFB A;  1S72 I;  1BBY A;  3A4C A;  3UNG C;  2OUM A;  2IEK A;  3H9G A;  4A3L J;  3COA C;  3L2R A;  1IN5 A;  3NS4 A;  2R7V A;  2PQ8 A;  5FLX K;  5HS7 A;  3LSH A;  2UXO A;  2VE9 A;  4Z2Y A;  2ZXI A;  3FBI B;  3H0D A;  4OIO F;  2XB5 A;  2NVT J;  1LE8 A;  4G7O F;  5LGT A;  2XF7 A;  3GTK J;  3G1O A;  2Q2E B;  1TLH B;  3LSJ A;  4CCO A;  2XAF A;  4A3G J;  3SXY A;  3A1Y A;  4A6E A;  1UFM A;  4OMZ A;  1Z05 A;  2ZO4 A;  2CUJ A;  5HDN A;  3OYN A;  4M3G A;  3KEY A;  1NH3 A;  2HKU A;  3A01 B;  2XSD C;  1IUY A;  3FMR A;  2O8K A;  2LH9 A;  2GFN A;  1W4M A;  3ZRG A;  2DYR H;  5DV5 A;  3G6E I;  1O3Q A;  5C4Y A;  3ZXS A;  3IV5 A;  5DTD A;  2X6X A;  4PK4 A;  5FJ8 J;  1OCO H;  5DUK A;  5C44 J;  5KVR A;  4PZJ A;  5HLT A;  1JJ8 C;  4UY8 I;  5E3N A;  1SVO A;  4IJA A;  3ISP A;  3HBL A;  1LDK B;  2CWE A;  2LOO A;  2CW7 A;  4L9V A;  2HOE A;  1CF7 B;  2LY9 A;  1BOB A;  3DQV C;  2A6H F;  3GTL J;  2W00 A;  4XK4 A;  4R1H A;  5C3E J;  3S32 A;  1D1A A;  1R5G A;  1R49 A;  3JRC A;  9ANT A;  1I1S A;  4V19 K;  2NP5 A;  5E79 C;  1QPI A;  3IAM 2;  5CXI A;  4LD5 A;  2DQR A;  3JRD A;  4XLA A;  1B72 A;  3K70 C;  1EH6 A;  1XDS A;  1R4N B;  3FHZ A;  1FTT A;  3VW1 A;  4O3M A;  3NXC A;  3ON4 A;  4IHX A;  2EJR A;  3ZMU A;  2YSR A;  1JHF A;  3LSR A;  4XBF A;  1WJA A;  3PO3 J;  3FBN B;  3OIQ A;  1OYI A;  2ICW G;  4BQQ A;  2PFV A;  1TW2 A;  2XF5 A;  4NBQ A;  4HLY A;  5BS6 A;  3RQ4 A;  2R7S A;  4RB2 C;  2L9S A;  4XOT A;  3AL0 B;  3IC7 A;  2GA1 A;  3S3M A;  2L0K A;  3WGG A;  2ID6 A;  4XKV A;  2JA5 J;  2DCE A;  1HW1 A;  3GVA A;  2DMT A;  5JLW A;  1S3J A;  2XAH A;  4RGX A;  3OR1 C;  1KQ0 A;  4L9T A;  2V6C A;  1HDP A;  4NC7 A;  3TO6 A;  4L0Y B;  4P55 A;  2E7W A;  4EJV A;  4CGZ A;  3HOU J;  1VQO I;  3K9T A;  3LSK A;  4O6J A;  2E19 A;  1YHQ I;  3CJQ B;  4F55 A;  1R9T J;  1VI0 A;  1ETK A;  3AKZ A;  1BI0 A;  4JNN A;  4IRH A;  4EM2 A;  1SAX A;  3S1M J;  2FMY A;  1ODD A;  2Y69 H;  1QVU A;  3D5R C;  1QVT A;  2EIL H;  3LA7 A;  3COL A;  4QWQ A;  3VOE A;  3K1M A;  3NPI A;  1MKM A;  1X2N A;  3HPH A;  3S93 A;  3K8P C;  2XDV A;  4ENN A;  2LC2 A;  3E3V A;  1R7J A;  3HPG A;  4RLF A;  3WHC A;  5IP7 J;  2FD5 A;  5D5X B;  3HTI A;  4GDF A;  5IT3 A;  3DPU A;  3LA2 A;  1K61 A;  5EJC A;  3TDZ C;  4HNV A;  1G59 A;  3FXL A;  3QP5 A;  3BTC A;  4A6D A;  3AL0 C;  1HST A;  2DQL A;  3FX3 A;  5GP9 A;  3RPQ A;  3CCU I;  3HUG B;  2Y0S N;  3VYS B;  1A35 A;  2XV4 S;  3SYT A;  4TV7 A;  4I01 A;  4JK1 X;  5JVG F;  2QBY A;  2MA3 A;  4D5C A;  2NVQ J;  4KIS A;  2HKX A;  3CJN A;  2JPB A;  2V26 A;  4HV6 A;  4OIP F;  1T98 A;  1MBK A;  2ZC2 A;  1Z6R A;  2XRN A;  3N97 A;  4GYI A;  3KYL A;  3SDB A;  1FOW A;  3WGI A;  2GXA A;  4MEX F;  1J2X A;  3G56 A;  2O03 A;  2ECC A;  2Z16 A;  3MAJ A;  2FU4 A;  5F08 A;  1KON A;  5B66 C;  1IV6 A;  2IW5 A;  2OC6 A;  3GTQ J;  4HEA 2;  2LKS A;  2DXI A;  4B3X A;  2CV2 A;  1JUP A;  1BW5 A;  1UJ8 A;  3HTA A;  1TNS A;  5M3M J;  2DMN A;  2LY2 A;  3GFM A;  2FUG 2;  3KZI C;  1I3A A;  3DKX A;  2R7W A;  3U1D A;  1W36 C;  1F5T A;  1PYV A;  2KIF A;  1AHD P;  4GCT A;  3GX4 X;  2UXI A;  1WJD A;  1R1V A;  4LOC A;  1T38 A;  3VSL A;  1FJL A;  2XSJ C;  2Y2Z A;  4CCM A;  3IKT A;  2DN0 A;  3RPU D;  1ZKG A;  5GPA A;  5JHU A;  2DOD A;  5LHG A;  4KJZ A;  3JTG A;  1FLI A;  2QWW A;  3CC4 I;  2P7V B;  2Z9O A;  1Y0N A;  1VQ6 I;  2XAU A;  3GTG J;  1MDM A;  2P0W A;  2CQQ A;  2F5C A;  1C0W A;  2M8G X;  3A0B C;  2YR2 A;  1JTX A;  5DUI A;  5GAE J;  4EJU A;  2HDC A;  2DBB A;  3BR3 A;  3A2K A;  2A07 F;  3G7R A;  1U9N A;  1G3W A;  2IVM A;  2WAD A;  4EAT A;  3OV8 A;  4M71 A;  2ZFU A;  3VIB A;  3F8B A;  3CCV I;  2DFH A;  4PGH A;  1LDJ A;  5LHH A;  1WPK A;  5E3O A;  5HAW A;  1R22 A;  3NRG A;  2R5Y A;  3KZZ A;  1XS9 A;  1YJW I;  1RI7 A;  4B48 A;  1GT0 C;  4C3I J;  1RUO A;  5FO5 A;  1IN8 A;  2PMZ A;  2B1E A;  3IH4 A;  3CC2 I;  4XKW A;  3RZD J;  5L3B A;  4YFX F;  5KHD A;  2HZT A;  4ESJ A;  1OYY A;  2COB A;  2JTV A;  1UG0 A;  3PNT A;  4EQQ A;  1ZRC A;  2XPV A;  2X85 A;  4H4K C;  2EWN A;  1T56 A;  3G73 A;  4EJT A;  1GXP A;  4XM3 A;  5ICF A;  2GOX B;  1MD0 A;  2UV1 A;  4P9F A;  2STW A;  2W24 A;  3ABK H;  2EIJ H;  4U9N A;  1USS A;  1YQA A;  2M5W A;  2ZSH B;  1MH4 A;  4II2 A;  4M6V A;  5LGN A;  1LE8 B;  2DA6 A;  3MKZ A;  2VOD A;  1D1B A;  4HV5 A;  2DW4 A;  4DVY P;  1OR7 C;  1LKX A;  1TC3 C;  2YPR A;  4XKB A;  3L1P A;  3HTH A;  3IH2 A;  4DJA A;  3K4C A;  4A12 A;  3NAU A;  5E1W A;  2KJC A;  2HQ5 A;  3BC8 A;  4BBR J;  4A93 J;  1OKR A;  1YG2 A;  3C2B A;  3M8J A;  4YFN F;  1A36 A;  3HDD A;  5EFY A;  4PJL A;  3KZY A;  2L01 A;  3PQK A;  1OCP A;  5HDG A;  1HOM A;  1IAW A;  2Y31 A;  3KPH A;  2H27 A;  1GVD A;  1S7A A;  5FD6 A;  3V7R A;  1IZ1 A;  4B3A A;  2J5P A;  4UVA A;  2ETH A;  1SD5 A;  4PGG A;  5F0H A;  1LEA A;  3D5S C;  2AO9 A;  3EUH C;  3F21 A;  1CGP A;  4A69 C;  2L4M A;  2ZJP F;  3NAR A;  2KZV A;  3I4P A;  3QOE A;  3BG6 A;  2R7Q A;  3I58 A;  2K9M A;  4XOP A;  3MNL A;  4HX7 A;  1YX5 A;  2X48 A;  1ZHF A;  4UNO A;  5CPR B;  2PMU A;  1UB9 A;  4BDZ A;  1YX3 A;  3K10 A;  4BDY A;  4HW0 A;  3QBM A;  5HS9 A;  4DZP A;  5LRS A;  3CD6 I;  2CO5 A;  4IZZ A;  3DLL F;  3OYJ A;  5L3D A;  2BVL A;  2CGP A;  3CCQ I;  1B72 B;  3DFG A;  4UXN A;  4OMY A;  4Q47 A;  4B47 A;  4KIT B;  2CQ7 A;  4WXC A;  4CCK A;  4AC6 A;  3HGY A;  3I3L A;  3C07 A;  4JL3 A;  3W2V A;  4WXH A;  1OFC X;  1YOV B;  2X0L A;  1P9Q C;  2IS1 A;  2MW8 A;  4PXI A;  3JRI A;  2LLK A;  4AUX A;  5LBQ A;  1V5G A;  2F5F A;  3CCY A;  1F43 A;  1LUJ B;  1KU3 A;  3OL4 A;  2Z3Y A;  4EGY A;  2QQB A;  2JJ7 A;  1EKE A;  3R6S A;  1G4D A;  3W3C A;  1NK3 P;  4IL6 C;  2FJ1 A;  3KET A;  4LLN A;  1TQM A;  1R00 A;  1OQY A;  3ERE D;  1LB2 A;  3PSF A;  2G7U A;  3Q9V A;  3ROU A;  2EH3 A;  3BCG A;  2QKO A;  1R58 A;  2D45 A;  2ZY9 A;  3H9Q A;  4DBQ A;  3RPU A;  1ZK8 A;  1ZN2 A;  2VQL A;  2CQX A;  1ETV A;  3CLO A;  3C2G A;  4PCQ A;  3JAM K;  3J7A Y;  3KP4 A;  4EGZ A;  2H6C A;  2Y75 A;  1BC8 C;  2REK A;  3PQJ A;  3BR1 A;  2DMP A;  1QZY A;  3V8L A;  2WB1 A;  1MIJ A;  4BQN A;  2R5Z A;  5D8L B;  2F5E A;  1T33 A;  2PMH A;  1XSV A;  1WH7 A;  4UVC A;  3HL2 A;  2KIS A;  2P8T A;  4OD4 A;  5D1R A;  4KN4 X;  5JI6 A;  3BR0 A;  5F1J A;  1KZH A;  4L5I A;  4FX4 A;  2IBD A;  1HDD C;  2QOP A;  3F6V A;  3CDH A;  5F0C A;  2IU5 A;  3KLN A;  5F04 A;  3L2V A;  3LST A;  4KYW A;  4HKU A;  3A0H C;  4U0W A;  4CDG A;  4IHS A;  1XTA A;  2HYG D;  3OY9 A;  5GPC A;  2R7D A;  5JVT A;  4IO9 F;  2LBF B;  3ZMT A;  5HNH A;  3GZ6 A;  3VVY A;  4XLF A;  3E1S A;  3ZQC A;  4A3M J;  1E17 A;  3H5R A;  3VVX A;  1MMS A;  5D5V B;  3I5U A;  1V4R A;  1LQ1 A;  3B02 A;  1VQP I;  2FQ3 A;  4NC8 A;  5K7F A;  1E0E A;  4G6T B;  2QBY B;  1YJ9 I;  2IA0 A;  2DU9 A;  3GFL A;  2M9H A;  2X1E A;  2GQQ A;  2R7R A;  4A0Y A;  2UXP A;  4B43 A;  1LNW A;  2L7Z A;  2VKV A;  2K86 A;  3L2C A;  1V3F A;  4LIT A;  3MZ8 A;  2LKP A;  2NX4 A;  1YIJ I;  3KE2 A;  3S1N J;  1SMT A;  3ULQ B;  5L3F A;  5AIQ A;  3J7Y J;  3I55 I;  5M5W J;  2C6Y A;  2P81 A;  3F1B A;  3BHQ A;  1FBQ A;  2M0M A;  2F4I A;  1A04 A;  1IXR C;  4F3Q A;  1QO0 D;  3ZMS A;  4N4N B;  3FXQ A;  3CO6 C;  4DZJ A;  1SFO J;  2WAQ A;  1YO5 C;  1KU2 A;  1Y8R B;  1P92 A;  3HSE A;  5GAG J;  4ON0 A;  4FX0 A;  2ZCM A;  1I6H J;  2F2E A;  2P6T A;  4D0P A;  1T0F A;  3OYL A;  4LB5 A;  2KIU A;  1JE8 A;  2V9V A;  2A6T A;  2V9K A;  3OS1 A;  3ZMZ A;  2QZ8 A;  3JRH A;  2MFZ A;  2EV0 A;  1QBJ A;  5F27 A;  1X1C A;  5ICE A;  1OCR H;  1X58 A;  4XRM A;  3B81 A;  2BHY A;  2IPQ X;  2GBY A;  2JVG A;  3IUO A;  4YEL A;  1TWH J;  2PFB A;  5EG0 A;  3DU5 A;  3FMQ A;  3E6B A;  3HYI A;  5JLX A;  4Q5S F;  1I27 A;  4N9I A;  1PJR A;  3MKW B;  1SD6 A;  2DA5 A;  3GZN B;  1HXD A;  1ERD A;  5J6X A;  3FMS A;  2DDA A;  2MYS A;  1H8A C;  2PX9 A;  2R0Q C;  4PJM A;  1ZTR A;  4MO7 A;  2XPU A;  4WCG A;  1Q1H A;  2DT6 A;  3J7Z I;  3OSG A;  1UAA A;  3K6G A;  2EZK A;  3CLQ A;  1BJZ A;  4QTR A;  4CCN A;  2XRO A;  2R5Y B;  1FMV A;  4GYG A;  3MD2 A;  1BL0 A;  4P1W A;  4S0H B;  1RKT A; 
#chains in the Genus database with same CATH homology
 2IAI A;  4C3H J;  1LFB A;  1ORK A;  4EEF G;  2M2E A;  5IP9 J;  3S16 J;  1RPW A;  2IEK A;  2YU9 J;  4A3L J;  5J1Y A;  2E2I J;  4FE7 A;  2QCO A;  1RR7 A;  4L5E A;  1B8I A;  2LTP A;  1G2H A;  2I10 A;  4IHY A;  2UXO A;  2UXU A;  1TWA J;  4UDS A;  2XB5 A;  2NVT J;  1LE8 A;  2E1O A;  3ZOB A;  1JT0 A;  3GTK J;  3RD3 A;  3G1O A;  1PUF A;  1UI5 A;  3LSJ A;  4C2M J;  5DS9 A;  2G7G A;  4A3G J;  2D6Y A;  3HOV J;  1I50 J;  3BG5 A;  4D7N A;  2WGB A;  3SJM A;  1ZR4 A;  4BKX A;  4M3G A;  3ANP A;  2HKU A;  1YRN B;  3A01 B;  2VPR A;  2XSD C;  4M3D A;  1EF4 A;  2O8K A;  1UG2 A;  2JMW A;  2GFN A;  5FHP A;  1VFC A;  5FKM A;  2YUS A;  5C4Y A;  3DCF A;  5DTD A;  3IV5 A;  1I3Q J;  2WV1 A;  5J1R A;  5FJ8 J;  1IRZ A;  1FEX A;  2FX0 A;  3LJL A;  3Q0U A;  3LOC A;  5C44 J;  1MSF C;  2MGQ A;  4JX5 A;  3S14 J;  1ETX A;  3ZQI A;  1JJ8 C;  5E3N A;  2PBX A;  4C3J J;  3GTO J;  3HBL A;  1RES A;  3O60 A;  4XID A;  2LY9 A;  4FCY A;  1O4X A;  3S2D J;  3GTL J;  3HOZ J;  4W1U A;  4XK4 A;  2L9R A;  1ZR2 A;  5C3E J;  3NNR A;  2EQR A;  3JRF A;  1ITY A;  1GV5 A;  2LFB A;  2AHQ A;  4CYC A;  2YS9 A;  3JRC A;  3TP0 A;  9ANT A;  3VOX A;  3JRG A;  2NP5 A;  4B4C A;  1QPI A;  3BG9 A;  5CXI A;  3JRD A;  1B72 A;  1Z77 A;  2DA1 A;  1GDT A;  5FKN A;  3PO2 J;  3VW1 A;  1FTT A;  4D5F A;  3NXC A;  1IDY A;  1BW6 A;  3ON4 A;  2X9D A;  4IHX A;  4XRS A;  3LSR A;  2R7Z J;  3VP5 A;  3PO3 J;  3HGG A;  1TWG J;  4J19 A;  5FMP A;  3RZO J;  4IHW A;  2ZCN A;  3ON2 A;  1TWC J;  4M3F A;  4JYK A;  3TW7 A;  3IUV A;  2L0K A;  2QF7 A;  3B6C A;  3FK6 A;  2ID6 A;  1RET A;  5FLM J;  4DYQ A;  2JA5 J;  3S5R A;  2DMT A;  2FQ4 A;  5JLW A;  1X2M A;  4W97 A;  5FKK A;  5IPA A;  1HDP A;  3HOU J;  3KKD A;  4DYC A;  2E19 A;  1R9T J;  3PAS A;  1VI0 A;  1ETK A;  1WI3 A;  3AQS A;  2LVS A;  5K7H A;  4JNN A;  3S1M J;  4M3B A;  3Q0V A;  2DMU A;  3OOU A;  3ZQH A;  1QVU A;  1QVT A;  3COL A;  2G0E A;  3FK7 A;  1MBE A;  4Y52 J;  3S15 J;  3VUQ A;  3Q3S A;  3NPI A;  1X2N A;  2CUF A;  4D7M A;  3ZQF A;  3JRB A;  3A03 A;  2HXO A;  3FKI J;  3Q0W A;  3GEU A;  1ETW A;  3WHC A;  5IP7 J;  2PZ9 A;  2FD5 A;  2JA8 J;  2WUI A;  2B63 J;  2HOT A;  3OSF A;  2RHA A;  2UXH A;  3CJD A;  3HTI A;  1K83 J;  1K61 A;  5EEA A;  4HNV A;  1JKQ C;  3GBG A;  1GUU A;  1Y1W J;  1DU6 A;  4ME9 A;  1MBF A;  3BTC A;  4KWA A;  5GP9 A;  2DA4 A;  3CWR A;  5M5Y J;  2W48 A;  4B1R A;  2XDN A;  4A3C J;  5BNG A;  2Y0S N;  1NK2 P;  2ZCX A;  4MLO A;  3W6V A;  3F0C A;  2DMQ A;  2NVX J;  2NVQ J;  2JN6 A;  2N8G A;  4D5C A;  2XPW A;  2CJJ A;  4IEJ A;  4A3K J;  3RH2 A;  1CQT A;  5IP6 A;  1MBK A;  5HBU A;  4ICH A;  5CXG A;  4BBS J;  5D19 A;  5EGO A;  4L62 A;  1XG1 A;  3G56 A;  3O8G A;  1P7I A;  2ECC A;  2ZB9 A;  1UI6 A;  4QSH A;  5F08 A;  1JJ6 C;  3WHB A;  2FBQ A;  1XC5 A;  1IV6 A;  3GTQ J;  1WH5 A;  4UUT A;  3DPJ A;  3G1M A;  4JP0 A;  3K7A J;  1JUP A;  5E3L A;  1BW5 A;  2OER A;  2QIB A;  2O9L A;  3QQA A;  2K40 A;  3BTL A;  3HTA A;  4IHV A;  5M3M J;  2DMN A;  2M0C A;  1WCM J;  3BRU A;  1TWF J;  3V6G A;  4MK6 A;  2EZI A;  1AHD P;  4GCT A;  1U8B A;  4JKZ A;  2UXI A;  4LOC A;  1FJL A;  4UUS A;  2Y2Z A;  2DN0 A;  5M3F J;  3H3V K;  1ZKG A;  5GPA A;  2XRL A;  3BT9 A;  3KNW A;  3JRA A;  3VW0 A;  5IOZ A;  5IYD J;  5EYR A;  5IYC J;  2DA7 A;  5FKL A;  3HOX J;  1W0U A;  3GTG J;  1BA5 A;  3ZQG A;  2CQQ A;  2JA7 J;  2M8G X;  4X1E A;  4X6A J;  2LKX A;  1LFU P;  4G12 A;  2RAE A;  3LNQ A;  1JTX A;  5EG0 B;  4MFD A;  2YVH A;  3ANG A;  3BR3 A;  3MVP A;  4ACI A;  1VND A;  4MIM A;  2PMZ N;  3KKC A;  3G7R A;  5DAJ A;  1U9N A;  3KZ9 A;  3BQY A;  4NDL A;  3BR5 A;  3OIO A;  1RKW A;  1MBJ A;  3VIB A;  1GV2 A;  2HOA A;  3LWJ A;  1WPK A;  4GCL A;  5E3O A;  3AQT A;  5HAW A;  3NRG A;  2R5Y A;  2H1K A;  1XS9 A;  3BNI A;  1MBH A;  2DA2 A;  2LK2 A;  3G1L A;  3LSG A;  5HSZ A;  2NS8 A;  2ECB A;  4C3I J;  1GT0 C;  5IOY A;  4YZE A;  2VUM J;  2V57 A;  3IH4 A;  5EDN A;  2XGE A;  3TW6 A;  1HLV A;  2OI8 A;  3RZD J;  3VPR A;  2COB A;  4A3D J;  2G7L A;  1APL C;  2CUE A;  2ID3 A;  2XPV A;  3JRE A;  3S1Q J;  1T56 A;  3GTM J;  4GFL A;  4XIC A;  3CMY A;  1H89 C;  2LD5 A;  5AQC A;  3MKL A;  1B8I B;  3RQI A;  1ETO A;  2XGC A;  2NOG A;  2ZOZ A;  1JGG A;  1LE8 B;  1MH4 A;  4M6V A;  2DA6 A;  1DU0 A;  2K9N A;  1TC3 C;  3L1P A;  3HTH A;  3IH2 A;  3NAU A;  2R5Z B;  4A3I J;  2GUH A;  2CU7 A;  2HQ5 A;  1Z0X A;  4BBR J;  4A93 J;  5EFY A;  3C2B A;  1YRN A;  3A01 A;  1AU7 A;  3HIM A;  3HDD A;  2G3B A;  1OCP A;  1POG A;  3E7L A;  1ZQ3 P;  2Y31 A;  1HOM A;  5CW8 A;  1A6I A;  1IC8 A;  1GVD A;  2TCT A;  3HB9 A;  4BXX J;  4NN1 A;  1SAN A;  3VVZ A;  4B3A A;  2K9Q A;  5F0H A;  5EZG A;  2AO9 A;  2DTZ A;  2L7M P;  1IJW C;  4A69 C;  1H88 C;  2DA3 A;  1IUF A;  3NAR A;  3M3Y J;  4Y7N J;  3I4N J;  3MNL A;  1IDZ A;  3QKX A;  2JA6 J;  5K7Z A;  2OF7 A;  2X48 A;  1MSE C;  3BQZ A;  1IG7 A;  4NEL A;  3QBM A;  4DZP A;  4M3E A;  3H0G J;  2XB0 X;  3QPL A;  2GLO A;  1A5J A;  3JR9 A;  3HOY J;  5C4J J;  1AKH B;  2HXI A;  5F0F A;  3HTJ A;  2HOS A;  2NVY J;  1B72 B;  1ETQ A;  2KDZ A;  2EZH A;  3EGQ A;  4AC6 A;  5J3L A;  2HYJ A;  2DG7 A;  3HGY A;  3MN2 A;  2R92 J;  3C07 A;  3HE0 A;  3S1R J;  4JL3 A;  3CQZ J;  4MFE A;  1OFC X;  1D5Y A;  2MW8 A;  2RAS A;  4PXI A;  3JRI A;  2LLK A;  3CRJ A;  4AUX A;  1JKO C;  3RKQ A;  3EUP A;  4XRS G;  1JKP C;  3CCY A;  1F43 A;  2F07 A;  1FIP A;  1Q1V A;  2L7F P;  3VOK A;  1F36 A;  2WB1 N;  3QPS A;  2JJ7 A;  3HOW J;  3BR2 A;  2X6O A;  3CDL A;  3IH3 A;  2FJ1 A;  5FKO A;  1NK3 P;  5HOD A;  1MNM C;  3BCG A;  2HI3 A;  2EH3 A;  2MSY A;  2QKO A;  3TP3 A;  4BY7 J;  2VKE A;  3S2H J;  1ZK8 A;  2O7O A;  2CQX A;  3K2A A;  3TED A;  4I6Z A;  2Y30 A;  1ETV A;  2QWT A;  1IGN A;  2REK A;  4FTH A;  4GFK A;  3BR1 A;  2DMP A;  2Y9Y A;  1OCT C;  3T6N A;  2R5Z A;  4QIW N;  1T33 A;  3LHQ A;  1WH7 A;  1ETY A;  1JUM A;  2CRG A;  1U9O A;  5D1R A;  1HCR A;  3BR0 A;  3BTJ A;  5F1J A;  1WGX A;  1HDD C;  2IBD A;  2QOP A;  2G7S A;  5F0C A;  4FE4 A;  2IU5 A;  5F04 A;  4HKU A;  5FLV A;  3VW2 A;  3PM1 A;  3JSJ A;  4RBO A;  5GPC A;  1U78 A;  4JX6 A;  2HYT A;  5H9T A;  1VF9 A;  3GZI A;  1UHS A;  3BG3 A;  5E3M A;  3HM5 A;  1JKR C;  3B6A A;  3FIS A;  3VVY A;  2ME6 A;  3ZQC A;  3S17 J;  3DEW A;  4A3M J;  2ME0 A;  4MXM A;  1HF0 A;  1Y1V J;  4AC0 A;  3VVX A;  3FIW A;  2M34 A;  3PPB A;  1SGM A;  2O7T A;  4A3E J;  5K7F A;  2GM4 A;  4DW6 A;  2QTQ A;  4A3F J;  3NI7 A;  3A02 A;  2NS7 A;  3SDG A;  2E2J J;  1MBG A;  2M9H A;  1AKH A;  4GCK A;  2WAQ N;  2XGD A;  2UXP A;  3LSP A;  2L7Z A;  3GTP J;  2VKV A;  3UKG A;  1JTY A;  5EGO B;  2EZL A;  4A3B J;  2ZOY A;  1JT6 A;  2NX4 A;  2W53 A;  3D1N I;  5C4X J;  3HEF A;  2K9S A;  3S1N J;  2LR8 A;  4V2F A;  1PUF B;  2YVE A;  4CGR A;  5M5W J;  2Q24 A;  2P81 A;  1UMQ A;  3F1B A;  3BHQ A;  1OJL A;  3HKZ N;  5K58 A;  3V78 A;  2OPT A;  4DZJ A;  1SFO J;  3BJB A;  1NTC A;  3GTJ J;  3BTI A;  3FRQ A;  1P7J A;  2ZCM A;  4FIS A;  1I6H J;  2MG4 A;  4I76 A;  1FTZ A;  2E2H J;  4JX4 A;  4UUS B;  4ABZ A;  1ENH A;  3JRH A;  2ELK A;  5F27 A;  5IYB J;  5FGL A;  2TRT A;  1X58 A;  4XRM A;  3B81 A;  4DYR A;  4V2G A;  2GBY A;  3BR6 A;  1W0T A;  1TWH J;  2EBI A;  5EG0 A;  1ZGW A;  3O8H A;  2R93 J;  2D5V A;  2HDD A;  3SFI A;  5JLX A;  4AYB N;  1E3O C;  3I4M J;  2DA5 A;  4RDU A;  4BY1 J;  1JUS A;  2KT0 A;  5EZH A;  1S7E A;  1H8A C;  2R0Q C;  1FIA A;  2GEN A;  4AF5 A;  3P9T A;  4CYC B;  1ZTR A;  4MO7 A;  2JK3 A;  3ZQL A;  2XPU A;  1QRY A;  2DJN A;  2JWT A;  3OSG A;  2LP0 A;  5EF6 A;  5J1U A;  2EZK A;  3M4O J;  2Y9Z A;  2H8R A;  1BJZ A;  4QTR A;  1BL0 A;  2R5Y B;  2DG8 A;  4A3J J;  5M5X J;  4GFB A;  3E7Q A;  2VI6 A;  5D18 A;  4S0H B;  1MH3 A;  2NP3 A;  1RKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...