2FDGA

Crystal structure of alkb in complex with fe(ii), succinate, and methylated trinucleotide t-mea-t
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
199
structure length
199
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase/dna
molecule keywords 5'-D(P*TP*(MA7)P*T)-3'
total genus 49
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdgA00
4QKBA 3BIEA 3H8OA 4ZS3A 2FDHA 3I49A 2FDGA 4NIDA 4NIGA 2FDJA 3BI3A 2FDKA 4CXYA 5F8PA 2IUWA 3KHBA 4NROA 3I2OA 3O1SA 4NRMA 4MG2A 3BUCA 4IE4A 3O1MA 3RZLA 3RZKA 3O1TA 3LFMA 3BU0A 3RZJA 3BTZA 4ZS2A 4NIIA 3T4VA 4NRPA 4QKDA 3KHCA 4IE7A 4MGTA 4CXWA 4QKFA 4NRQA 3T3YA 3RZGA 3O1RA 4O61A 4NIHA 4NPMA 4CXXA 4O7XA 5DABA 3O1OA 3BTYA 3T4HB 3BTXA 3H8XA 3BKZA 3RZHA 3S57A 4QKNA 4OCTA 2FD8A 4JHTA 3I3QA 3O1VA 4NJ4A 4NPLA 2FDIA 4IE6A 3O1UA 4RFRB 2FDFA 3I3MA 4IE0A 4QHOA 4IE5A 4IDZA 3RZMA 3H8RA 4ZHNA 3S5AA 3O1PA
chains in the Genus database with same CATH superfamily
1D4M2 3AYAA 3Q8CA 1SPPA 2ZJCA 2QDRA 4GMP1 4P5HA 4JRLA 2Q0AA 3UKTA 3SHRA 4ZKTB 2ET7A 2VM9A 4FXKB 4GXLA 3ZPOA 4BQXA 5F5CA 1JYVA 4OMDA 3AKQA 4Y5Z0 5DAWA 5LA1A 2HWF1 1HRV2 2JDMA 5DG2A 1CJDA 1UYPA 4R4ZA 1KFUL 2AREA 3SISA 1PZ7A 1X33A 2B45X 2HWF3 3MIEA 2R073 2WR9A 2X05A 1AR93 3PVBB 1BLZA 4LO6B 1BEV2 1FT9A 4FXGB 3TEWA 3H8XA 5FZAA 3FLPA 4FTBA 3DPRB 3J7LA 1VBE3 3DUIA 4HT1T 5F6KA 3VZOA 4CCEA 3G6JB 1AVBA 1MQTB 2VCBA 1Q3EA 1POV3 3IT8A 2R0HA 1CZVA 1PVC1 5LW9A 2R1BA 4NIGA 2DYCA 1MPXA 1PVC3 4FPGA 5B2GB 2D5FA 1PIV3 4E4HA 4M01A 2DWRA 3NKTA 1HX6A 3WNOA 2PLV2 5FKCA 4DRRA 3POWA 5K0UA 3WLUA 4MADA 5FXVA 3T3YA 3K2OA 4QXHA 4BXSV 1JHJA 2ZACA 2F4LA 2Q1FA 2MEV3 1OA3A 2O14A 3UYJA 1RUG2 5CG8A 1EP0A 4NJ4A 1RHI1 2ZGRA 4UF0A 2D44A 1I6XA 5K7PA 3WG4A 2XLGA 4LNVA 4Y20B 4L0PA 3W58A 4BMEA 1AYN3 2JDUA 4XCAA 1WMXA 3K4DA 1NXMA 3ZPYA 1ND2C 1C4RA 1JU4A 2QZ2A 3JZVA 3GM8A 5IVJA 5IFPA 4QKDA 4BU2A 2D93A 2ZX0A 5C6CA 4XJWA 2UY8A 4E27A 5FYTA 4AEDA 1X50A 3FL7A 1VBD3 2OYZA 1ND2B 1UN1A 3T2OA 5K0UC 2DURA 3KCXA 5LY2A 3PMSA 3GZUC 4W4ZA 4XQ4A 4XBLA 1VB4A 5LWBA 4XOGA 5F3CA 1JYIA 4KBZA 1BBT1 4IDZA 1HRV3 2BTVC 2RM23 2VOKA 2WQ4A 4PDWC 4UFIA 3HNBM 4CU7A 1ZZ8A 1AUYA 1IQAA 1MS3A 2EIGA 1T2XA 1W8WA 4E4ZA 3KF3A 1RUC3 2CV6A 4MGKE 4XILA 1RUH2 1TMF1 2A3YA 4MO3M 4META 1X8MA 2G1MA 4BYYA 1ODMA 2Y60A 2QTWB 3BU7A 4JDOA 3R0RA 4MH0E 1XQNA 4B3NA 1SZBA 2F6BA 3LDBA 1GZWB 3KD4A 3NNGA 1SBEA 1W2TA 3ZFEC 4UWDA 4XFAA 1ZBA3 2YGMA 5FYCA 3J8F3 1D4M1 3H1WA 5ABJC 2QQKA 4Q0SA 1DFQA 3MPBA 1ZRFA 1U12A 2JDKA 5FPXA 1ENSA 2FDKA 2RDSA 4Q0QA 5J37A 1O59A 2MEV2 5FPZA 1QXRA 1CN1A 2JKBA 4PT6A 1GZTA 1W6NB 2A6XA 4S2FA 2ZS6B 3LQCA 4NIIA 3HIFA 3M7AA 2CDPA 4CP1A 4E2SA 1U0AA 1CONA 2R063 2Y64A 5A80A 3AZVA 1OOPB 4BOWA 4QHZA 4QX3A 2EIBA 3AKRA 2B46X 4N7UA 3G7DA 1QXPA 2DTWA 3PJYA 4R52A 2QQNA 3ZYIB 5L7OA 2NLRA 1YC61 3OGGA 4IE6A 2D6KA 3T1LA 4BH9A 3AL6A 3S30A 3N9NA 2QQIA 3A22A 1RUJ1 2B9VA 3EJKA 5H9QA 3NNJA 5FUIA 4OHZA 5JXGA 4XQDA 1OVSA 2WFF3 3FZ3A 2UWAA 1PO21 5HCFA 1EUUA 2Q4SA 1W9TA 1AR62 1DYPA 2ADDA 2VU9A 3AKTA 3B69A 5T55A 2VD7A 3LEMA 4R9AA 1OLMA 2XJRA 3IIIA 3O1TA 4ZS2A 2H6CA 1JZ7A 2VOTA 4XDOA 4Q4X1 2UWCA 1V0AA 4PIYA 2Y6FA 1CQ9A 1SBDA 3VBFC 5L9BA 2JECA 3N7JA 1IS5A 1PHMA 1JS9A 4FPHA 3KQ4B 4JTNA 2JG8A 3HWJA 1UZYA 4LK7A 4YM0A 2UURA 4CP0A 4Z1VA 3PVEA 2ZGOA 4F7ZA 3WHUA 1LRHA 5FO8B 3CLPA 4TXWA 4P08A 4QX5A 1N47A 1RVF2 3WG3A 2P17A 3PJQA 4CRQA 1DQ4A 3RRDA 4F8AA 1X9TA 2PHTA 1PO22 1QQP3 5BYNA 5C5TA 2YFUA 1ALYA 2LALA 3JQWA 3I3DA 3KV9A 3RYPA 3WQ7A 2GZWA 1JMUB 3JU9A 3ILFA 1WBFA 2ZKLA 1ZM1A 2A73B 2C9KA 2IFRA 1OH3A 3WUCA 3OBZA 1O8PA 3VBSA 1UYZA 1HXS3 2YGLA 2YHJA 4Q1RA 3CIHA 5FMBA 2WYSA 4IEOA 1BYHA 1PVXA 3WHTA 3I2IA 3GBFA 1H6XA 4ZU7A 2W1UA 3V65A 4RQPA 4HLTA 3FLTA 4ARYA 1RUD1 3POYA 1UZ0A 2QNKA 5JXIA 3KSCA 4D6RA 5K0UB 4QM9A 1GFF2 2B4KA 4A7YA 5A6YA 2AH2A 1QJX3 4XUQA 4ZZ8A 1EY2A 4LMFA 4XZPA 2YC0A 3HQUA 5L7OB 1LHWA 1VPHA 2R062 3S7EA 3SCFA 1BXHA 3DPRC 2XGXA 1CX4A 1R1A1 3Q8FA 3T0BA 4A7KA 3NVCA 1R1A3 5ISLA 3AMNA 1J3PA 1L7LA 3AMQA 4JGZA 1C1FA 4QPWA 2LS6A 4Y5TA 3VBHA 3FFQA 2BOJA 1Q5OA 3MBWA 4CDQB 2W1SA 2P3JA 3ZYBA 5A70A 3ZYJB 2FCTA 3IIAA 4QMAA 5DDJ3 4HKLA 2WS93 1EV12 1FPN2 3BCWA 1GZ9A 1V9U3 1GP5A 1RC6A 4GQ7A 3HBKA 4H55A 1XYOA 1UQXA 3I59A 1R093 4KU7A 3VV1A 4H7LA 4NO4A 5IYYA 3PUAA 4HKWA 4NHMA 1LR5A 1LB2A 1D7PM 1W8NA 1UW8A 4RYDA 3WV6A 1W6PB 2E33A 2DU0A 1YQ8A 2XJSA 1UMHA 3UT0A 1NA1C 1N3OA 2ZHLA 1SLBA 2JENA 4YW4A 1CX1A 2GMEA 1PGL2 3U0ZA 4CTEA 3WVJA 3ZYRA 2W1QA 4IV1B 3AP4A 1XNCA 3BPZA 3WQ0A 2SBAA 1C5IA 1TMF3 2EF6A 2JICA 3HT2A 3GZAA 1S0CA 1MZFA 1CGPA 5K8SA 3AXEA 4XYXA 1VBB1 2HBTA 2TUNA 4LBLA 2GH8A 2BWAA 3OGJA 1YFYA 2ZGPA 4GWNA 5L9RA 1JH5A 4CEYA 3HVDA 4I0BA 3AC0A 3VD7A 1L3JA 4AK3A 5HV4A 4HN1A 5BNNC 2WUHA 3JB4C 4XF4A 4GKXA 4YZ3A 2OT7A 5EIYB 1HRI3 3NV1A 3ROUA 5LBCA 3FHIB 4AI0A 3ZR5A 5FLJA 3RI8A 2WQ8A 5A3UA 5HXVA 2WBKA 2NMOA 4YVSC 1PGL1 1F8VA 1K5MB 2HWE3 3C7FA 2XJQA 1XU1A 1JOBA 1RHI2 2BBAA 3AZXA 2DCYA 4EZHA 2ZABA 3LA3A 5I0UA 1C8M1 5I0DA 2RS32 2VNGA 2AENA 1ND3B 2VO5A 2OIIA 3K3NA 1QJY3 3NJXA 3KLSA 5CFDB 1NOVA 4JGZB 5FZGA 3TRSB 3VBHB 4D94A 2ET1A 1J3QA 1JBCA 5FZOA 3OY8B 3BTXA 2VTXJ 1POV0 4AGVA 1QOSA 5DN2A 4D3WA 4FT8A 4YZ5A 5L36A 4J1WA 3E6DA 4LOSA 1K12A 3HD8B 1H2KA 1GNHA 1LOAA 5F5QA 3WW4A 3EB7A 4YLZA 4O9EA 5DUUA 2E7QA 5DDJ2 1HJGA 4LBNA 3AP7A 3VKLA 4LO4B 3BGAA 4LIVA 3H7YA 4BDVB 4EWDA 2JG9C 2VZ3A 2ZEYA 3N7MA 3TNPB 5FYIA 5FZ7A 4Y1ZA 1V70A 1YRZA 4D69A 4V2WA 3IB3A 2AEZA 3UKVA 4A6OA 2XDVA 3C7OA 4EE2A 4Q4W2 3VD5A 2BBVA 1XJAA 3T4HB 2ZGSA 3UGGA 2WN2A 2XG3A 1MQTA 5M0TA 2VMFA 1L7RA 3ZM8A 1AR73 1XYNA 4JRAA 3ST7A 3UJOA 4YNIA 4BHPA 1SDDB 1CIWA 1D0HA 2ZMLA 3IPVB 3BODA 5A7SA 2IZWA 5FLHA 3VKOA 3ZXEA 2WO1A 2PHXA 1VE0A 2WNEA 3KT7A 4QX8A 4QX2A 1Y9MA 3J7HA 5F2WA 3TEYA 3VGIA 3VBFB 4K8FA 1O5LA 1S0EA 2VZSA 3LOBA 1NXD1 3JQXA 1VBA3 1QNWA 5FDBA 4HG6B 4CPBA 5EQUA 5C71A 1KGYA 5FYYA 4CA9A 4AQTA 5FZ6A 5J36A 1W99A 3NNMA 3OSDA 4M0HA 4O9GA 1VB2A 5FZ9A 3H3ZA 2WINB 5APAA 4K40A 1AYN1 2E7AA 1V6MA 5JSRA 3VBSB 3WQ1A 4JGYC 4EN7B 3H9AA 3AFKA 1ASJ1 2DTYA 1PO13 1PM4A 3AZYA 2PHFA 2W2IA 3EXUA 3FBYA 4I09A 2Z4FA 4LO8A 5JZGC 1AL21 4H7MA 5LBBA 3WG1A 1LOFC 2QFEA 3CNAA 1QJY2 3HJRA 4HSJA 4JQRA 4YW1A 2Q8CA 2OXBA 2KD7A 1KXGA 2ZGNA 5G05L 4AEDB 4Z2AA 2JWPA 1K5MC 1A3KA 1UYXA 2HWD2 2Q8EA 1O7FA 1NUKA 1JYTA 2BFUS 2P6HA 2QUOA 1Z7S3 4AHWA 2RS53 1TNFA 3AL5A 3MIGA 1MZ5A 5T54A 2WZR3 2TEPA 2DUPA 2YB7A 3N9QA 3ZSJA 1S0BA 2IVIB 1UKRA 4QXBA 2FMYA 2ZGMA 1POQA 5J1XA 1UZWA 1W8FA 5DXDA 4DY3A 1XNKA 5D8AB 1ODNA 1IS6A 5E89A 1MEC1 3GHMA 2WC2A 1DP0A 1XSQA 2R071 3VZMA 2JDHA 5L9VA 1UU5A 4LUKA 4C91A 1REFA 1JI6A 3FUOA 1WCSA 4ARXA 2XPJA 3RZKA 2NM1A 3WD5A 2BWCA 2VBPA 4QKFA 3OG2A 2CYFA 4UOJA 3O7OA 3WUDA 5ABJB 1GOFA 4B4RA 1HKDA 2BOIA 1VJ2A 4UW6A 3SMHA 3ZXAC 2WT1A 5B4NA 1JODA 2RS31 3CMGA 4EWAA 5JOXA 3V56A 4QKNA 4XTMA 1GKBA 4P00B 1UNBA 5FO9B 5FPBA 5T5PA 5A3LA 4AVSA 2ES3A 5DQ0A 3E5UA 3PIJA 4PLMA 1UXZA 4FVVA 5A7QA 1AYM2 3VBRC 4Q8KA 3N9LA 5IATA 1O5UA 3JXSA 3USSA 5IK7A 1GNYA 2XVKA 1W9WA 2XHKA 2VAUA 3ZSLA 2CSGA 3PIGA 5GLTA 2CL2A 1FATA 1OOPA 1FXZA 5DPNA 3TOJA 3U37A 5ACA2 4OZXA 2R041 3POFA 5DMYA 2W95A 1UF2C 1WW4A 2D43A 4G3YC 4YVWC 3QOPA 2Y34A 2R043 5BNOC 5FYZA 3MEPA 3WNKA 1JZ6A 3IN9A 4IGPA 3GGLA 3ZOIA 1YUDA 4G9SB 2PELA 4P9LA 4K1YA 1J3RA 3F95A 2BGPA 5CFCA 2NYYA 3ELNA 1H8VA 3JBG3 2K2SA 5LA9A 1OUXA 2PAEA 2ZGUA 3GYDA 1BMV1 3BALA 4WM7C 2LTNA 4RS5A 4D7TA 4BLJA 3I2OA 1OT5A 1DGRN 3SH3A 1KJRA 5EYXA 3QACA 5I0SA 1XE8A 3OGSA 4Y26A 2GC3A 4WM8A 4MYEA 5C4WB 2JG8B 3LDRA 3BTAA 2V72A 1N1YA 4B29A 1CAVB 1OFNA 4FQZA 2B5HA 5DAPA 2HYKA 3WP4A 3CDZB 4XF0A 3A23A 5DZFA 5JAXA 1US2A 1XE7A 3IZOA 4NHXA 4PF5A 5IVCA 3DF0A 1PX4A 2W91A 1UX6A 3INAA 2VULA 5FZ8A 5JLVA 1LOCA 1XNAA 4JHTA 2FZ1A 2VCMA 2WWUA 4YM1A 4HL0A 2XQRA 2AC1A 1UOBA 1WW5A 4LBQD 3LSDA 5DUXA 1WLWA 5HV0A 2G4IA 1LU2A 4QX0A 1CAXB 2YFZA 3AP9A 3DV8A 4IEPA 4UF0B 1HW5A 1Q8PA 2K0GA 4XUTA 1NQDA 2EIDA 1S2KA 1MR5A 4KQ7A 1JOJA 4OFGA 1OVPA 1WCUA 1UPIA 3O1RA 4RR3A 2GC0A 1AYM3 2RM22 2RS11 4KGQA 5LBFA 3F2ZA 4BZ4A 1GR3A 1BQPA 3DEMA 1LHUA 2VNVA 3K4AA 4TTGA 2RDRA 4LLFA 4CDWA 5J48A 3I3QA 2D6OX 5A3WA 4FFFA 1W2AX 2E63A 5F37A 2EVXA 4PF1A 4PHZA 2XL7A 2WLQA 3HAGA 5IFTA 1RUOA 2CWMA 4ISQA 2YZ4A 2DU1A 4WZCA 1W3VA 2ZX1A 4NR1A 1SDWA 1JZ2A 5IAVA 4OZOA 2R042 3FE5A 5EHDA 1NCQC 2ZHKA 3EO6A 3TWIA 3WY6A 3SH5A 5KXEA 3Q9OA 4NWWA 3FLRA 1BBT3 1VP6A 1GV9A 1FOD3 4AL9A 5K9YA 2UU8A 2P5BA 3SKVA 4GJYA 1WW7A 2O8OA 2JE7A 1E5IA 1H8TA 3NV3A 4OULA 5EXOA 5CA6A 4YG3A 4XFFA 2ZTNA 2DF7A 4WM8B 4WM7B 2G19A 5ERLA 1O8SA 4K9SA 1C28A 1W6OA 1WMEA 4CCOA 4Q4Y1 2PFWA 2VW0A 1S0GA 4LBQA 2RG4A 1DHKB 1S0IA 2YU1A 2WNUA 2WIIB 4M4PA 4XACA 3PVNA 2CGOA 3WR0A 1FNYA 3KMHA 5IJRA 1ZZCA 2GMMA 4DXRA 2GC1A 2XKOA 2QJVA 1V6LA 2W9XA 4Y22A 2E26A 4MGSA 3MIDA 5LEKA 2P3YA 5BNNA 2A6YA 3RZZA 4B7EA 5J3UA 4Z92B 3OD4A 2VZTA 1YFXA 2YROA 3M3QA 5H9RA 3D0SA 5GALA 2D97A 2OX0A 2Y26A 4IEZA 1REDA 1EAH2 1DQ6A 3K77A 4WVMA 1OFSA 2O0OA 1QDCA 2MHFA 2X29A 5H9SA 2VMEA 2I45A 3UETA 2KR2A 2RV9A 2LW8A 3GBWA 4QX1A 2BPA2 3VUOA 1WMFA 3ZO0B 4CDWB 1K5MA 2AACA 3KS7A 4AOCA 5JXJA 2FDGA 1OD3A 1H6YA 2P34A 4LUMA 5EYYA 2OPWA 4GWMA 4N43C 1K42A 1JN2P 1PNGA 2JX9A 4XFIA 2EICA 4BK5A 3ACHA 4HZFA 3RVHA 3P3PA 4OHYA 1RUJ3 5C70A 3RZJA 2MPFA 2Q30A 3ZXLA 3GDBA 1TVGA 2JDNA 1WMDA 1HDKA 4RFT0 1LESA 5CEHA 1RIRA 1COV1 2ZGTA 4DUXA 3AZZA 1X7NA 3MUY1 1QQP2 3NKGA 1TEIA 2HYXA 3USUB 1NCQB 1IKPA 3BVCA 4OI4A 4R8HA 1H2MA 2KXLA 2GN7A 2X10A 1XBFA 1X8EA 2NZ9A 4BQYA 4WM7A 5KHKA 1WD4A 1ND2A 2C0ZA 1MEC2 1RITA 5GZDA 4Q4X3 1DGWX 4URTA 1F31A 5F8PA 5C7GA 5FOJB 2GU9A 4HSLA 2HWB3 4IE4A 3EQEA 3MUZ1 3LFMA 3VL8A 4UAPA 2JE9A 1R082 1DZRA 4NVPA 2JJ6A 4I0AA 3WDVA 3ZIWA 4DFSA 1MQTC 4FP3A 4DQAA 4Q4V2 4ES9A 1OI6A 2H0BA 4Q4Y3 4FAGA 2DCKA 2R6QA 1RUE2 4LHNA 1RXFA 1I9RA 1Q43A 4QDQA 5IW0A 1O91A 2O8QA 3SC7X 2BNOA 3WCRA 2Y6LA 4Q26A 2GMPA 4PI2A 5DUWA 5FZMA 5FQ0A 4LLOA 2JB8A 5BUVA 4QPIB 5J7MA 4Y3OA 1BZWA 5F2SA 2YYOA 3LKJA 3H8RA 3LEKA 3NO8A 4MGIE 3LFIA 4PQQA 1YIFA 2VOVA 1LGBA 2W3JA 4JHZA 4IEWA 4AE2A 4FP2A 3KWVA 1W8HA 4GWIA 1RUE1 3A0KA 3P1IA 3VDAA 1NLRA 4WVWA 3WW3A 3J8F1 3GHNA 3BU0A 4RGGA 2PAKA 2IFWA 1T6GC 3OCPA 2VY0A 1N3PA 2XJTA 3TB0A 3THCA 2WNVC 3K75B 3WCSA 4AQSA 1D4M3 2VE1A 4N53A 2J1SA 3CJIA 2DUOA 4R9BA 4OLLA 4Y1YA 2D6NA 2V4AA 2W87A 2WNUC 4K3UA 5F6LB 5BNPC 4A3ZA 3R4SA 1URXA 4Q0UA 4XIKA 3B5LB 2A3WA 3POIA 4CDUC 4Y24A 1DCSA 4KWLA 4YFZA 3U78A 1UCXA 5DUVA 1OLME 1VAKA 4AFDA 1AR92 1DG6A 2DCJA 2YY1A 2WS91 3U07A 2YBPA 3VHOA 3A4UA 4NMIA 1H1IA 5IWFA 5CFDC 2VZPA 1R091 3RFRA 1MEC3 5EWSA 2UY9A 1HB4A 3BOPA 4AVVA 1ZBE1 4YRDA 1GUIA 4GZ9A 1YFWA 4PDWA 5GLVA 2HWB2 1V00A 2BV4A 3HMYA 4P9WA 5KXDA 1WBLA 1DQ0A 2YUEA 1XNBA 5IUQA 2JB4A 1ENQA 4CDQC 5JOZA 2ZGQA 1JYXA 5TSWA 5I0RA 1NYWA 1TZOA 2XWBB 4QPGC 1QNYA 5FYSA 5FWEA 2PQQA 1AR91 4TSVA 1RUE3 3J7MA 4NHLA 1HB1A 5IAXA 2ZMNA 5EZWA 1H30A 2D6LX 3VKFC 3ZYHA 4KI5M 1IOAA 2WZEA 3PLQA 1UYYA 2C26A 2Y6JA 1VLNA 2I07B 2VZUA 3CKHA 1G6NA 3C7GA 3KVAA 3E97A 1X9PA 4XUOA 3K51A 4LULA 1NG0A 4JV4A 3NV2A 4NN0A 1VBA1 2UYAA 1W8ZA 2WRAA 3LEGA 4GA9A 3MLJA 5L73A 2ORZA 3V0BA 4CDUA 3FBMA 3S6PA 1RL3A 1LAJA 1E5SA 3HT1A 1UY1A 2WT0A 3HBZA 3J9SA 2QCSB 3KV6A 2WNVB 4ET7A 2YBKA 5A6ZA 2VMGA 1MZ6A 5JSPA 1OOPC 3ZDSA 1OA2A 1J1LA 3BUCA 1RTVA 1H8TC 2ZCWA 2JD4A 4UBGA 2ZEZA 3RS6A 3C7HA 4GJZA 3VZKA 4DB5A 4JAAA 3NWKA 1FI2A 1NZCA 3KV4A 5CZKA 1I5PA 2D3RA 3I3BA 3SKJE 3MIFA 5IVFA 3GJBA 5CKNA 4FAHA 3E6BA 4GH4A 4Y20A 3H50A 5FKBA 3WXPA 1W28A 2Q8OA 1NCRB 1WWYA 4AG4A 1ACCA 3NJZA 4XW3A 5C5UA 4HK9A 1FV2A 1NLQA 3NL1A 5C8WA 1UOJA 2B7YA 5CG9A 1YXWA 2G9ZA 1NCQA 4D7YA 2FZ2A 1Q8QA 2EXJA 3AYEA 4F83A 3VHPA 3ZYFA 1AHSA 3I59B 3R4UA 1UU6A 1HV0A 4W6WA 1LOBA 4W6XA 5A7OA 4YZ1A 1HJFA 3V0AB 1M4WA 2AEYA 1W39A 3O0XA 4N53C 1I5ZA 3Q8AA 1JZ3A 4AF9A 1FX5A 2BJSA 3HNMA 2OUJA 3GNEA 1CESA 1ZBE3 1W9SA 2A6VA 5T50A 2GSYA 4ITCA 1QF3A 4R9DA 4LK6A 2HWD3 1NZIA 1W04A 1G86A 5CBLA 2E32A 4TYSA 5FZ4A 1UO9A 4LKSA 1JYNA 2XWJB 2A70A 3CBNA 3MZHA 3OEBA 1XPWA 3NNLA 3T0DA 5CADA 4GWJA 2WZR2 1GMMA 4NPRA 3PDQA 4UFJA 4AHXA 2PMWB 1BCXA 5ANQA 4RR3B 1LODA 1UKGA 1VBB3 2EAKA 2WA3A 4UFMA 4HOOA 3NJYA 1W0PA 3B9IA 1ZNPA 3M3EA 4YGCA 2OKXA 3VBOA 4XDPA 4Q29A 3LDKA 3A21A 2WAAA 3T2PA 4IGQA 1RUD2 1XB9A 5JZGA 3IAPA 5I0TA 4CEWC 4DEQA 1JZ4A 3W20A 2Q1ZB 3BKZA 3R05A 3D8CA 1H2NA 3FUQA 3LSEA 3SNMA 1W9YA 5HXMA 2A6WA 2R49A 3OJBA 1BMV2 2X8KA 4IE5A 5KHJA 3HR9A 2ZGLA 4YW2A 1LHNA 4KL1A 3I49A 1KITA 2J1EA 1EAH1 2Q1MA 1OQ1A 4DXZA 1BEV3 4ORFA 2Z5WA 4JDMA 1A8MA 1SQ4A 1VBE2 1RVF1 1UX7A 2R30A 1OXCA 2P37A 4X6QB 1BHGA 4INDA 3ZXGA 3KZ4C 4Z07A 3M3IA 1RMU1 3ZDVA 5I91A 3QCWA 5A33B 5F5IA 4A44A 1DZTA 1O4YA 4OHXA 4CVUA 3I97A 1F15A 1PVC2 2WNOA 2DCTA 3ACIA 4NE9A 4DOUA 1PIV2 1OHFA 4AWDA 1QJU1 4J1XA 3HQXA 1HXS2 2DCZA 1VBC1 2VG9A 4EN8B 1QJU3 5IK5A 1LEMA 1OURA 3WDTA 3POBA 4Y22B 2RE9A 3T1MA 3UGFA 1POV1 1TQ5A 4COZA 3O1PA 4LOTA 2VZ1A 1SEFA 5KC6A 1IPJA 4K1ZA 3BI3A 5I8YA 3O1SA 2PHWA 1PIV1 5CYYA 4I0WB 1QY4A 2R0FA 3IPVA 2Z69A 4K6BA 4XETA 4WVMB 2XBO2 1S4CA 4CDXC 1QJX2 2XH6A 4PBPA 1H4GA 4AEDC 1ZYBA 4BIFA 2QQWA 2ZA9A 3W9AA 3WOGA 3IDCB 3DL3A 1AYN2 1LGCA 5HCHA 2XJVA 4XUNA 3ACFA 5HI0A 1V6JA 3JCIA 4CE8A 5IVVA 3QBQA 1YYNA 1VBB2 2CGNA 3PU8A 1KFXL 3GCWA 4XE9A 1HXS1 1L7QA 1Q8VA 2WO7A 2ZHNA 3O0WA 2D98A 4FPFA 1W2OA 2RHPA 3LE0A 4BWOA 1ZX5A 3J7NA 4FPLA 1F9KA 1N1TA 4QX7A 5FP3A 3AB0A 5FXZA 3THTA 2VC9A 4YW3A 5JXHA 2YG0A 1FMD2 3LA7A 4A4AA 3C2UA 1KJLA 4IV1C 4BLIA 3LB9A 2PHDA 4XJZA 1W6MA 2A7AA 1QJX1 5D1IA 3VBUB 2VCCA 2WNVA 2JG9A 1CJPA 3PTRB 1F2NA 4TN7A 4DS0A 1ZZBA 3RZGA 3OGVA 1RMU3 4YVWB 4HVOA 1WLCA 1CAUB 2RJKA 3DYMA 4O7XA 1DDLA 1H4HA 1OC1A 2GN3A 2HWB1 3PUQA 1CAVA 3ZFFC 2ZEXA 1RUC2 3QD6A 1RUH3 1JYCA 5LRSA 4IE0A 1CWPA 5JSOA 4JKKA 4YM2A 4IV1A 3ILNA 4N7IA 1QXJA 3BYWA 3IWZA 5ANNA 1FYUA 4UFHA 1VRH1 1Y3TA 4XJ9A 5FR3A 4DPNA 1PK6A 5LCWL 5SV5A 4LEJA 4XFGA 5CNAA 3WSOA 1AL0G 3NAPB 3AMPA 5LEJA 1QJU2 2GNMA 3TN92 1SLCA 2DVAA 3A0NA 4LE3A 2BYVE 3PURA 1PZ8A 3TYJA 1OQEA 3CU7A 3B7MA 2ZXQA 3WF0A 5T5OA 4QB6A 1W6PA 1AXYA 2VZRA 1UY4A 3KQRA 5F39A 2FMDA 4OUEA 1S0DA 2XBO3 1E5RA 4NHYA 1MS0A 5FK7A 1F5JA 3CO2A 3D5OA 3FMGA 5FZHA 2VJXA 1CVNA 5JIAA 1GWLA 5FFOC 5FYMA 3BIEA 1PGW2 1TME2 4EWEA 4CEYC 5FIXA 1A8DA 2GDFA 1KDMA 3I3EA 2WYFA 4CCLA 2OA2A 4NHKA 1MS9A 3CJIB 3U11A 3DXTA 3WW2A 1H2LA 1ASJ3 2DUQA 3L2YA 4JC1A 4GKYA 4YVSB 2D7FA 4IEXA 5HBAA 4DEVA 4S2DA 2VVDA 3W5MA 1W8TA 2Q8DA 1JW6A 3MF9A 3GJAA 3MW3A 4QB1A 1RUI1 5A6XA 1IPSA 1IS3A 5CIRA 1GSLA 3CEWA 1CAUA 4RFRB 5FMOL 1SFYA 1RUF1 3HQRA 2X5IC 4QXKA 2A6ZA 3RZMA 1AX1A 1C8M3 3N3HA 2WWSA 1GQPA 1GQHA 2BU9A 4RHV1 4LBQB 1IGOA 1F4HA 4WVZA 4XAEA 5CFDA 5CFCB 1GBGA 3J26N 2G9GA 5FY4A 2VXRA 3LPFA 4CPBD 3RYKA 4BQ5A 2HEWF 1W0OA 5HCAA 3DGTA 4LPLA 2TBVA 1RUC1 2J1AA 4A3XA 4CDXB 2WSVA 1LHVA 1HLCA 1Z0HA 1JZ8A 2RDQA 5EJZB 2DBNA 3I8TA 4P9GA 3RJ2X 1BK1A 4XAAA 3N35A 1SBFA 1HV1A 2KA3A 3IBMA 5FWJA 2BUKA 4OI0A 4RGKA 3N7LA 2ZAHA 4EJRA 2ID4A 5A3PA 5GZCA 4IGOA 4FTSA 3I2GA 2VMIA 1W8OA 4QB2A 2Y6HA 1N1VA 1J1TA 3A7QA 1JZ5A 3VBOC 4WVVA 5H9PA 5F1RA 3SXWA 5FLIA 5LY1A 4IESA 2BVBA 4IL7A 4XCBA 1QOTA 1SLIA 1SHWB 5LATA 2ZAAA 1SMVA 2YXSA 2QVSB 1O4ZA 3WINE 2AUYA 1AR83 2HWC1 2JKXA 2WDBA 4Q4X2 5SV8A 2YMZA 3ZR6A 3IAQA 4CUAA 4XBQA 5FTTC 3W21A 2CU5A 2ZX3A 4L97A 5A1FA 4LO7A 3MYXA 4Y1VA 1Q8SA 1G9CA 4BQ2A 4Q1PA 4UI9L 3B3QE 2BERA 4IEYA 4QQLA 3WDUA 3ME2A 4ASLA 1PNFA 2CAVA 4M0NA 4XBNA 4YYOA 2G9FA 1V6IA 2WS92 3ITQA 2WA4A 2WZ8A 1COV3 3OB8A 3PMEA 5FZKA 2L9LA 5FZBA 4BCUA 4CU6A 5BV6A 4G4FA 3O1MA 4XJUA 1PMIA 5A3NA 1UMIA 3KT4A 1UOFA 1S2EA 5DAXA 3WF2A 1XOYA 4JGZC 3VBHC 2OQ7A 3TEXA 1NCRA 1BVVA 3TN91 4GIQA 1RUI3 1DGRA 4FPEA 1ULDA 4XZUG 4XHBA 4X6RB 5JUVA 1VBD1 5F3IA 1J58A 3U75A 1CPNA 3VL9A 4QPGA 2AR6A 4N90A 4OQ9A 1VBC2 4YVWA 1KD7A 5DAVA 2V09A 3RG0A 1YO8A 3WEZA 5GKAC 1W6OB 2XL9A 1VRH3 4W6YA 4YFWA 1MS4A 2XB6C 2ZGKA 1PMJX 2RM21 4AW7A 4Q0PA 3HOBA 3PVOA 4LJHA 4CP9A 3AKPA 4C8DA 4AI3A 4AFMA 2W68A 1VALA 4AFAA 3BTZA 1XXNA 2AGSA 4UFLA 5EJ1B 4IV3C 2A1XA 4C0BA 3I2HA 3PUIA 4FOYA 4OMCA 4QQPA 3M70A 4CYDA 4HMZA 4RN5A 4Q4W1 5D8AA 5IVEA 1KRIA 4AR2A 3BIWE 5IK8A 2Y33A 1Q8OA 4D7SA 1UD1A 4BQ1A 1RHI3 5A7NA 3S5QA 2P6CA 4DY5A 3RPQA 4AZZA 4YARA 1W03A 1HRI1 1WUVA 4QKBA 2B42B 3PU3A 5ABJA 2VQAA 2ZZQA 3PUHA 1IQDC 4IV3A 3ZN6A 3AK0A 3APBA 1EUTA 3EHKA 1GP6A 2P3IA 1F35A 4QGMA 5FY0A 1GANA 3U4SA 1VR3A 1CZTA 2XJUA 3SEPA 2NQYA 5BNQA 2R061 3VZJA 1R1ZA 2WN3A 4XUPA 3DECA 2RMU3 3ZFGA 4CCDA 1CPMA 4FPYA 3AFGA 1ZRCA 1HN0A 2PHRA 3OUHA 2CNAA 1S0FA 1LTEA 3P5BA 4HPKB 1US3A 5KWRA 4P9XA 1OUSA 2Z79A 3BB6A 4MVTA 1B35B 4NPLA 5C8CB 3ZKUA 1DIWA 1VMHA 3THPA 1AX0A 3T2QA 4XPVA 1ULEA 3ETPA 1WA6X 4QPGB 2D40A 5AVAA 5GJ6A 5JI7A 4E2GA 4A45A 5JOYA 2Y6KA 5C4WA 4L99A 2YDEA 2ILMA 2LRPA 2XLAA 1MACA 3AMMA 1VBC3 3X29B 5ACA1 5CISA 1WD3A 2HWC2 3OF1A 5JR7B 1SLTA 1LOEA 5FZDA 3L9JT 4CP9B 4CCJA 2D6MA 1JYWA 1NCRC 1C57A 1E5HA 5LRRA 3RQ0A 5C3PA 1G9AA 5DG1A 1UZZA 3JD71 4GB31 4HFSA 4X8NA 1Y43B 2FQPA 2FD8A 2EXKA 2XVGA 1PM7A 3D4KA 4B1MA 4NUBA 2DV9A 1HQNA 1GYKA 3H3LA 3MHZA 4PIXA 2ARXA 1DQ1A 2VUAA 3OBTA 4EN0A 4FFIA 4AEKA 2FDHA 4H2AA 5FMCA 3RMYA 4CU8A 4CDUB 2B8MA 1X36A 4HONA 4PJYA 2A71A 4QXCA 4CU9A 4QT6A 3UGHA 5A6QA 1GZCA 3VDDB 2BNNA 1C1LA 1PO12 1TE1B 4M00A 4IE7A 4LTAA 5FYVA 4YGDA 1UY2A 3ZSKA 2W47A 3VHRA 5BY5A 4BK4A 2RMU1 3RWKX 4ONUA 1KS5A 3ACGA 5L7OC 1RUNA 3I2KA 2PAMA 3VZLA 1JOPA 2JXAA 2K46A 3MW4A 3H42B 3SCGA 4CZSA 1RB8G 2DDUA 4MOAA 1U5XA 3IDEA 4XDQA 4Q27A 1Z7S2 4IETA 2ADEA 2V5DA 3ZSMA 5JDBA 5D2AA 4BQ4A 3RGBA 4NAOA 5JMOA 3VBUA 4A41A 1UU4A 3AP6A 1C5HA 2XLFA 5T5JA 3WF1A 2OW4A 3C8XA 5DDJ1 4LBMA 3AVSA 1V9U1 3LIHA 2PXJA 3LGRA 2C24A 4OHWA 4QM8A 1F4AA 3UKNA 1D2SA 1ULPA 1HQLA 5GZGA 1OMIA 4NAMA 2VVEA 4X8PA 3N4MA 2E6VA 1V6NA 1VBD2 4AVBA 1OPMA 5FO7B 3B9CA 4Y4RA 2GNTA 1BJQA 1ZVFA 2HWD1 2PTMA 2XR4A 3B94A 1AF9A 2AZ5A 3P6BA 1ZREA 4MG2A 2IXCA 2Y38A 3ZYPA 5AC93 5C3QA 1N3QA 5KC5A 4LA2A 1OKOA 1C3HA 4YZ2A 1S1AA 2WNUB 5BNOB 4MX3A 2BVVA 1E57A 1XU2A 3TEZA 3EMRA 2VMDA 3FX3A 4U36A 4YG6A 4Y1XA 5FV3A 4ASKA 1RUJ2 3KT1A 2Y6GA 3WNXA 4JTOA 3ZN4A 1AXKA 5BXXA 1J83A 3WDYA 4RS5C 1QHDA 4HVRA 2RR12 3D82A 4OHVA 1P8JA 1ZRIA 4JGYB 4H14A 5FPVA 4AQ2A 2OS2A 3V0BB 5A7WB 5CFCC 4LE4A 4EV0A 4BE3A 1YI9A 2VBBA 2CDOA 1OQDA 3ZFGC 1O6UA 3ASIA 5BNPB 4QAWA 3OBRA 4Y4YA 1EPZA 3J8F2 2BQPA 1R64A 3Q8BA 3FN9A 4BPZA 3ZN6B 3PTYA 2YPJA 1YWKA 4QPYA 3NV4A 4S2HA 2VUCA 2QQLA 3AX4A 5CKQA 1B09A 3ZXFA 3ZFEB 3O1VA 3WT3A 4L8QA 2W92A 2PHLA 1IZ3A 1Z78A 4EN9B 5FK8A 2UWBA 2B39A 1SCSA 2GNBA 1R083 1TNRA 2GH2A 4COYA 2WFF1 1ONAA 1HQWA 4Y1UA 4FI9A 2BP6A 1B35A 3O14A 2WABA 2E9QA 4M3CE 1LECA 2QKDA 3UESA 3USUA 5FZFA 1MVQA 1RUH1 1LHOA 2ZX2A 3IMNA 4K8RB 5HPOA 4WM8C 1YCIA 3ZVXA 4N43B 4CP2A 5KXBA 2WFF2 4JCKA 4A7ZA 2WZR1 1MS5A 2DBIA 2IXHA 4P9YA 4AI8A 1OF4A 4XIOA 5C9AA 5E16A 4C1XA 3HPNA 5LZ6A 1ZZ7A 3M2MA 1QGLA 5GM0A 3TBDA 3MFCA 3N9OA 4LA3A 5C3SA 2ZZJA 5LK5A 1QH7A 3MGUA 1APNA 1RXGA 2HWF2 3IDAA 4PIZA 5F7UA 1QQP1 4LQRA 1O3SA 3ZXKA 3N7KA 4Z82A 3MLLA 4QQ2A 3ATGA 4YGBA 1H0BA 3OYWA 5FPUA 1LU1A 4XHXA 2CAUA 5BPXA 3QH7A 4QPIA 2RR13 4D6SA 5EV7A 3O5SA 4NIHA 1YQCA 5KHGA 2VMCA 1QWRA 1W6MB 4BQWA 2VXJA 4N9IA 2VTFA 4LBOA 4MUVA 4QU1A 4XABA 1CD3G 4BMBA 2RJLA 1NE4A 5FZIA 4AAPA 4AVCA 2PLV3 3ETQA 4OUSA 4YWAA 4Q0VA 5JZGB 1LOFA 2YC4A 1R081 2VGDA 2VOWA 2XMLA 4KWKA 4XXAA 4F3JA 1WCDJ 3S5AA 5AFBA 2OQ6A 2X09A 4XQWA 3MF6A 4NROA 3ZKYA 4COWA 2HWE1 4N53B 4COUA 1JU3A 2E7TA 4QD2A 2BZDA 2ERFA 2ARBA 5FZOB 2I74A 1ZA4A 2HLEA 2QE3A 1PGSA 1PX3A 3N36A 2QQMA 5CB7A 5IK4A 4Q2FA 4K21A 4BM8A 3E6CC 1NX9A 1O3RA 1CIYA 1IG0A 3D0JA 1GWKA 1HB3A 3LAGA 4OCTA 1QOOA 4LO5B 5F32A 1YQ5A 4DINB 5FYBA 4YM3A 3U1XA 3LPGA 1DZQA 3S0MA 4I30A 1ASJ2 3U4XA 1WCQA 3JBG1 3K4ZA 4RD7A 2VNOA 1ULCA 4M3CB 5C9AB 5DZEA 2Z2SB 2I2SA 4L2NA 4UW3A 3V64A 1XNTA 4JDNA 2FHRA 1NKGA 5EP9A 1UPSA 1S0JA 1W90A 2BDRA 2QQVA 3AKSA 1ZBA1 3KGLA 4GULA 3O12A 4RA0A 4XF9A 5JIUA 2ARAA 2ENRA 2XJPA 3MI8A 1OSGA 1YFUA 1PK6C 2J22A 4D0QA 1D4VB 3DCQA 3OYWB 2R32A 2W94A 1W06A 5I93A 4QU2A 2ZMKA 3S57A 4UT5A 3NAPC 3K3OA 4XURA 3E5XA 3C7EA 4QGLA 2XUEA 3OD0A 5JR2A 3KVBA 1RINA 1W6QA 1XE0A 4CCNA 1WGPA 3B93A 3IKWA 5JVVA 2CWSA 5G04L 3KM5A 4D8MA 2IXJA 4IEUA 3VBRB 1GP4A 2FBEA 4B1LA 2JDPA 2ZOEB 1JUHA 3GF6A 5CU1A 1NA1B 5DAQA 4AGRA 2XOMA 4S2GA 3ABZA 1MVEA 2ZPXA 3LEIA 4Y33A 5K4LA 4B7KA 2ZEWA 2A75A 3LOIA 1ZBA2 4HPKA 3H3UA 3RDIA 3SH4A 2RR11 2A5ZA 4MXWB 5JWPA 3I54A 3BTYA 1QJEA 1TG7A 4AEMA 2JE8A 3ALQA 3I7DA 4CSWA 4MGZE 2O1QA 2W39A 2VCAA 4BISA 4NWVA 2HWE2 5I8TA 4AHZA 2AYHA 2XKPA 2VW1A 1H8TB 1GNZA 5C4WC 5FXWA 1NT0A 1S55A 2MNGA 3BN6A 3NJVA 1S2BA 2HBUA 4ZS3A 3NRUA 1ULOA 1X82A 1IG3A 4Q4Y2 4DIQA 2PN5A 4E9KA 5FP8A 2YU2A 4Z8BA 3B00A 4AVTA 1WW6A 2VMHA 4CCKA 2RS51 2QDNA 3T4VA 2W08A 1OA4A 2BRTA 3IDBB 1VBE1 3RJRA 4MGTA 1HRV1 4NRQA 5FCCA 4DZGA 1ZZ6A 1LULA 4DUVA 2HH9A 3WP5A 2IXLA 3TAYA 2B9UA 2TNFA 2VNRA 3MDPA 3NAPA 3AXDA 5KHIA 3O0VA 1I1EA 2QQJA 1ST8A 1FMD1 4JZRA 3W5NA 2QQOA 2RVAA 1DQ5A 4QDSA 3VHNA 1ULGA 3V0AA 2K9ZA 2J42A 1G9FA 2BNMA 2VTXA 3PL0A 4K20A 5GLWA 4ZPIA 4Q4W3 3VDDA 1YQ2A 1XYPA 1W6QB 3AYCA 3E5QA 4FFGA 5FBJA 2LUWA 1OD5A 4I01A 1UZVA 3VBOB 2XQXA 4MLOA 1UY3A 2MEV1 4FO9A 1LOGA 1IS4A 2JDZA 4BXFA 2OVUA 3ZYGA 1KS4A 2RS13 1Y7BA 3GZTB 2C9AA 5LASA 1LNSA 3SEEA 3KCCA 1UOGA 3EBRA 3T2TA 5FMOS 5C3RA 1NQJA 3NW4A 4QDRA 1AYM1 3AJZA 4LXLA 1JXNA 4FTEA 1AJOA 1VBA2 3L2HA 2WAOA 4ZY9A 4CDQA 1U5YA 2KM2A 2ETEA 3U10A 3VBUC 5LA2A 3POJA 2H0VA 3RWNA 4MHRA 4RHV2 3RNSA 3WDWA 1OH4A 4C1WA 1H1MA 1RJ8A 1G9BA 2BGCA 4WZFA 3VKMA 1XC6A 5FREA 5T5LA 4E4DX 2Z42A 4CXWA 1MZEA 3H7JA 3MICA 2W5FA 3JD72 4GB32 1EPWA 4GMP3 4KWJA 4O61A 5F9TA 3ACLA 4IUGA 3FWEA 1H9WA 3ENRA 3KV5A 3VDBA 1OF3A 1GOHA 1JTZX 3SCHA 1ZRRA 2JIJA 3MLKA 4JX0A 4FCAA 2WO3A 2CTVA 3SLIA 3DN7A 4CDWC 1SPPB 3UK9A 1G8WA 4J6GA 5AVPA 1MS1A 3AVRA 1W3XA 2RS52 3H0OA 4I02A 3WZ1A 3ZMNA 4DUWA 2PYTA 3MIBA 2JG8C 2WLPA 4OI1A 3H8OA 4KH9A 5E88A 1YNAA 3ZX7A 3CZJA 1EV13 3MIHA 4YGEA 3UL2A 5CVRA 3MW2A 4UXAA 5A33A 4RGAA 4QPIC 1KQRA 1ULFA 1OLRA 2VL4A 3D6EA 2IVJA 2E51A 2J1VA 4M3CA 1GLHA 4Q5OA 5C8CC 3RYRA 1J59A 1U5IA 4MZUA 4XFBA 3LWCA 3POGA 1AJKA 1OBNA 3DXUA 5A3OA 1FMD3 1NLSA 3DKQA 2W46A 2VZVA 5FZ0A 1RUG1 3ZFGB 1SLLA 2VQ0A 1GWMA 2WQZC 3WQBA 3ZIXA 5LA0A 1KDKA 3D3AA 5FY1A 3LD8A 4OI2A 4CCMA 2IWGB 1AR81 1ND3A 2HWC3 2EALA 2JDYA 3MO4A 1VIWB 3GCXA 4XMAA 4W8JA 5D8AC 5EFUA 4EZ4A 1RMU2 3POSA 3AM2A 2HJIA 3HEIA 4N9HA 2R16A 2OZ6A 3WW1A 4AI1A 4CXYA 2CY6A 2GAUA 3CJXA 1FV3A 2SLIA 3K46A 2WZPP 4HANA 5CKMA 1KEXA 4YW7A 1CR7A 3NNFA 4ISRA 4NOTA 2OZJA 1VMFA 2WWJA 4N8MA 4HN0A 3W59A 4C0HA 3S7IA 3ECQA 2QZ3A 5KR7A 1QMJA 1XNDA 3SQOA 4AI2A 4YG0A 4RHV3 4IQPA 4JQTA 4ASMB 1O3TA 4LIUA 4B8EA 4LBKA 3VN4A 4Q8LA 4URAA 4FBFA 4MGYE 5GZEA 1G7YA 1QEXA 2C6SA 3LIGA 5FZ3A 1PK6B 3R6SA 3TN93 2DFBA 1REEA 4WBBA 4P02B 4DRVA 3JD73 2NPIA 4GB33 1D0GA 1ZBE2 2GP5A 2JG9B 3E1F1 4PDWB 1WCKA 2CHHA 1QKQA 5FJHA 1FNZA 3JB8A 5JPNB 2NN8A 3JUUA 2VPVA 5FPAA 3GZEA 5DZGA 5C3OA 5LBEA 1AX2A 1IPKA 4FFHA 1Y4WA 2IC1A 4QWNA 4H3WA 3JBG2 5T3NA 2E31A 3PNAA 4UW4A 1K3IA 1VAVA 1NY72 1TME3 4DXTA 1WKYA 4JKLA 1EYBA 1NE6A 2GP3A 2JD9A 4KWUA 3OBAA 3K48A 4L92A 4RL7A 4P14A 3WF3A 3CF6E 3N9MA 5D21A 4TLFA 3I3MA 5FBZA 1UL9A 5IT6A 3WNPA 4XMIA 2D3PA 5IVYA 4LHLA 5FZEA 1MS8A 4PLNA 5KHHA 2P4EA 1RUD3 4ZZ5A 4D6QA 1ENXA 3OPWA 4KG0A 3AMHA 1W05A 2C5DA 1AR72 4LHKA 2P3KA 4XTPA 1PO11 4HXCA 2NMNA 3ORJA 1A78A 4AGGA 4XEZA 2ZX4A 1GZWA 2Y0OA 4R9CA 3OGRA 3VD3A 1K5JA 1I3HA 1JUIA 2H6BA 3U14A 1IKQA 3CHXA 3MV01 3DYPA 5F3GA 3URFA 3VKNA 4IEVA 2FDFA 3VLBB 4IW3A 5AC92 3QH6A 4HKOA 4XFCA 1DGLA 1QJFA 1UXXX 5B4XA 1UMZA 3KF5A 4YVSA 4LORA 3WP6A 4E8DA 4LHSA 3THDA 3KHBA 4O65A 4A6SA 1BKZA 4IEQA 4CDXA 1WZXA 2QQUA 3NMBA 5FY9A 2F4PA 1AXZA 3SITA 2VUDA 4GALA 4XF1A 5KXCA 1FOD1 1VAMA 4FPOB 2YC2A 1V6OA 5GLZA 4B4PA 5A1LA 4XVHA 4ZXEA 4LT5A 3KGZA 1LJ7A 1FAYA 3LZZA 4NPMA 1PMHX 5A7PA 1TME1 2BGOA 1O4TA 4GD4A 4DNYA 4P9JA 3CZUA 1RYYA 1AZDA 1GICA 1WLTA 2WT2A 5JOWA 5EJ3A 2CGPA 1BBT2 3B02A 5FY7A 1FOD2 4QQHA 1STMA 2J7MA 5IVBA 4EROA 4KBBA 1AR82 1K45A 3FC0A 3POEA 1HB2A 3H1YA 4LKEA 1EV11 4MXVA 4AHYA 4PLOA 1QH6A 3I2DA 4KU8A 2YBSA 5FY5A 2VW2A 3N9PA 1DLCA 2VVFA 3M3OA 4ATFA 3P3NA 1W8UA 4ZXKA 2R1DA 1IHMA 4FPKA 2WJSA 4UFKA 2C1FA 1N1SA 1CZSA 4PQ9A 1H1AA 1OKQA 2V73A 4FOWA 4YZ4A 1DF0A 4U2AA 5BNPA 1ENRA 1COV2 1LCLA 4ZU4A 1G9DA 1AR63 1BVP1 1SFNA 4CUCA 5FP9A 4P9IA 5A32B 3VDCA 5FZCA 4MHUA 5AFEA 2GNDA 1DLLA 4W65A 4XFHA 4QHOA 5FY8A 1Q56A 1PGW1 2RJ2A 1FPN1 2W0XA 4UW5A 5LK7B 3VD9A 1QJY1 4MXWA 2DFCA 4HVQA 1HIXA 3ES1A 4LITA 3OY8A 2PLV1 2J1TA 1QJZA 3J4UH 4RS5B 4HK8A 1RVF3 1AL23 4MSVA 5C33A 1PO23 2EAAA 2NP0A 5LB6A 2WKKA 1T6BX 4YW6A 4GH4C 1B35C 2HEYF 3PUSA 1WA4A 1YEWA 3WNMA 5ACA3 4FOVA 3AYDA 2VQTA 4OYUA 2WFPA 2E53A 5FXXA 2JEMA 1U5ZA 2J1UA 3R4DB 3EYPA 4CUBA 4SLIA 5EPAA 4DO0A 1AR71 3I4IA 3WNLA 5I8SA 1DGWA 3QLQA 2VQUA 3IM0A 4AYUA 4GAZA 4AXOA 3TNQA 3CJIC 5C9AC 3T0AA 3OPTA 3Q8EA 4QGNA 1SACA 2W1WA 4COVA 2X5IB 4KNCA 4DMIA 1DYOA 5E6HA 4QQOA 5F5AA 4XJAA 2D6PA 3DYOA 2FCVA 3GXUA 3T08A 2P2KA 2XUMA 2VH9A 1R1A2 2XXZA 4FOQA 2F17A 5FUPA 3VBFA 4AI9A 4BB3A 1DQ2A 2W52A 2OUHA 1NY71 5A3TA 4HETA 4R4XA 4IERA 2IXKA 5AC91 5J96B 4L9BA 1DU3D 4XJ8A 3C3VA 4Q4V3 1FPN3 1XRUA 1V9U2 4CEWB 5FZLA 3ZFFA 3CQOA 1YLLA 2EIEA 4KGGA 3UJQA 1R092 2JIGA 4XF3A 1YJLA 1CAXA 4LKDA 4NRPA 5FJKA 3T30A 3KHCA 4OQ8A 1OLQA 2DVDA 4JGYA 1LEDA 1C8M2 4I3PA 3OTFA 3LCPA 3VZNA 5A7WA 2BW8A 3ZMOA 1AR61 1W6NA 3O1OA 4Y5SA 1D2QA 2YPDA 3BPSA 3NSTA 3ES4A 3ON7A 5FOBB 2JDAA 4A2UA 1Z7S1 2EA7A 3O1UA 2QQPA 4IV3B 4J25A 2DVGA 4AQ6A 4OUMA 3WNNA 4EYUA 1TMF2 5FZ1A 1YI7A 1AL22 1SCRA 5FP4A 3HN1A 3LA2A 4MV2A 2C4XA 4BA6A 2FDJA 4V1PA 3ZFEA 4CUGA 1M06G 5CAZA 3IMMA 3FHQA 1UIKA 4PBOA 3ZSEA 4M4RA 4NIAA 4GH4B 3OUIA 4P5YA 1GU3A 1CAWA 2Q5TA 4C90A 3DPRA 4GMP0 1QU0A 4AFBA 5C8CA 1SLAA 1HRI2 4YPJA 5J09A 1YJKA 3M8LA 1SFPA 3H1MA 2BFUL 4ES8A 1RGSA 2X5IA 1WLDA 1V6KA 3I2JA 4N43A 5FUNA 2WSUA 2XVLA 5FMDA 5A1AA 2GC2A 1ZRDA 2PHUA 3FHAA 4DXSA 4MGQA 1ZZ9A 1ND3C 2RS33 4NIDA 4UBHA 4Q4V1 4E8CA 3GALA 4PCRA 5J98B 4AFCA 3MV11 4SBVA 4BJ0A 1RJ7A 2DVBA 4BIOA 5L19A 3UNPA 4A42A 1LENA 4ZU5A 4V2VA 4FPJA 4K7JA 2HKXA 3VD4A 2VZOA 5BNNB 5F3EA 4YSFA 4AEJA 1LKNA 1QDOA 1C8NA 2ZBJA 1A34A 4RR3C 4RQPB 2A3XA 3FFZA 1XSRA 5A3MA 2FCUA 1YQ6A 1RUI2 1A6CA 3OOXA 1J84A 4L11A 2QBXA 3LF7A 1EAH3 4LBJA 3ILRA 3WF4A 5A32A 3CL1A 2GALA 3B01A 3MPPG 3OPZA 4NRMA 1NAEA 5E1RA 4B4QA 4LR4A 5IHRA 3RZLA 1F5FA 3FJSA 1RUF2 3KB5A 3RI9A 4PI0A 2VECA 2EXHA 2J1RA 2ARCA 4FPCA 3WDXA 4AVAA 2D5HA 4FQ4A 5E8AA 3AZWA 1LGNA 4YW5A 2P1BA 2RDNA 4ATEA 1VRH2 1CAWB 3WX5A 5JPMB 3I2FA 3VBSC 3VDDC 1VMJA 2PQSA 2XHNA 3H8UA 1DBNA 1W9FA 4TLGA 5GZFA 4HBNA 3RMXA 1VRBA 4JKMA 1YHFA 4FSJA 4QHBA 4I2OA 3HN3A 2RS12 4KMQA 4ZHNA 4ZONA 2YV8A 4IXLA 1GOGA 1BEV1 1DYKA 2R072 3MFAA 3WP3A 3AJYA 2VR4A 5FQ0B 3OUJA 2ZKNA 2ORXA 5GLUA 1QIQA 2V4VA 4WV8A 1H9PA 3DKWA 2IXIA 5JI9A 4CCCA 3PHMA 2V5YA 3ZLIA 4BQ3A 3UV9A 2D3SA 1OPOA 4KG8A 5HCBA 3T09A 1Y9GA 2N7GA 1UIJA 3WG2A 4W50A 5JCTA 1W0NA 4JVAA 3M4FA 2WL1A 2XONA 3AP5A 4UYBA 3BOWA 4M3CF 1PZ9A 2Y0IA 4EQVA 2FDIA 2BEOA 4Z2WA 5JMCA 1UWWA 2ATFA 2EXIA 2VZQA 3ZN5A 2WO2A 2XBO1 1W2UA 3ZFFB 2RMU2 5FP7A 4LKFA 3NQHA 1O3QA 2IUWA 3ZXDA 4CEYB 2LM3A 1UY0A 2VBDA 2OPKA 1RUG3 2DVFA 2VOXA 5BNOA 2X53S 3HNYM 4RSUA 5KBFA 3OEAA 1W2NA 1YIPA 2ZHMA 3VBRA 3ZXJA 1HN1A 5FPLA 5FYHA 5FRAA 2UYBA 4XXPA 5T52A 1NA1A 1Y9QA 4XC9A 4AAXA 2Y8KA 4CEWA 4CXXA 3M1HA 1UAIA 4EN6B 5DABA 3GBGA 1GQGA 1SG3A 3RZHA 2R7EB 1BK0A 3KCYA 2PA7A 5FAXA 2HEVF 1RUF3 4E4SA 4OVEA 4E2QA 1ZA7A 3M3CA 4TZDA 1JHNA 2LROA 4RQPC 4TWTA 3RSJA 5FYUA 3VB9A 2VUJA 4I3GA
chains in the Genus database with same CATH topology
4QKBA 3BIEA 3H8OA 4ZS3A 2FDHA 3I49A 2FDGA 4NIDA 4NIGA 2FDJA 3BI3A 2FDKA 4CXYA 5F8PA 2IUWA 3KHBA 4NROA 3I2OA 3O1SA 4NRMA 4MG2A 3BUCA 4IE4A 3O1MA 3RZLA 3RZKA 3O1TA 3LFMA 3BU0A 3RZJA 3BTZA 4ZS2A 4NIIA 3T4VA 4NRPA 4QKDA 3KHCA 4IE7A 4MGTA 4CXWA 4QKFA 4NRQA 3T3YA 3RZGA 3O1RA 4O61A 4NIHA 4NPMA 4CXXA 4O7XA 5DABA 3O1OA 3BTYA 3T4HB 3BTXA 3H8XA 3BKZA 3RZHA 3S57A 4QKNA 4OCTA 2FD8A 4JHTA 3I3QA 3O1VA 4NJ4A 4NPLA 2FDIA 4IE6A 3O1UA 4RFRB 2FDFA 3I3MA 4IE0A 4QHOA 4IE5A 4IDZA 3RZMA 3H8RA 4ZHNA 3S5AA 3O1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QKB A;  3BIE A;  3H8O A;  4ZS3 A;  2FDH A;  3I49 A;  2FDG A;  4NID A;  4NIG A;  2FDJ A;  3BI3 A;  2FDK A;  4CXY A;  5F8P A;  2IUW A;  3KHB A;  4NRO A;  3I2O A;  3O1S A;  4NRM A;  4MG2 A;  3BUC A;  4IE4 A;  3O1M A;  3RZL A;  3RZK A;  3O1T A;  3LFM A;  3BU0 A;  3RZJ A;  3BTZ A;  4ZS2 A;  4NII A;  3T4V A;  4NRP A;  4QKD A;  3KHC A;  4IE7 A;  4MGT A;  4CXW A;  4QKF A;  4NRQ A;  3T3Y A;  3RZG A;  3O1R A;  4O61 A;  4NIH A;  4NPM A;  4CXX A;  4O7X A;  5DAB A;  3O1O A;  3BTY A;  3T4H B;  3BTX A;  3H8X A;  3BKZ A;  3RZH A;  3S57 A;  4QKN A;  4OCT A;  2FD8 A;  4JHT A;  3I3Q A;  3O1V A;  4NJ4 A;  4NPL A;  2FDI A;  4IE6 A;  3O1U A;  4RFR B;  2FDF A;  3I3M A;  4IE0 A;  4QHO A;  4IE5 A;  4IDZ A;  3RZM A;  3H8R A;  4ZHN A;  3S5A A;  3O1P A; 
#chains in the Genus database with same CATH topology
 1D4M 2;  3AYA A;  3Q8C A;  1SPP A;  2ZJC A;  2QDR A;  4GMP 1;  4P5H A;  4JRL A;  2Q0A A;  3UKT A;  3SHR A;  4ZKT B;  2ET7 A;  2VM9 A;  4FXK B;  4GXL A;  3ZPO A;  4BQX A;  5F5C A;  1JYV A;  4OMD A;  3AKQ A;  4Y5Z 0;  5DAW A;  5LA1 A;  2HWF 1;  1HRV 2;  2JDM A;  5DG2 A;  1CJD A;  1UYP A;  4R4Z A;  1KFU L;  2ARE A;  3SIS A;  1PZ7 A;  1X33 A;  2B45 X;  2HWF 3;  3MIE A;  2R07 3;  2WR9 A;  2X05 A;  1AR9 3;  3PVB B;  1BLZ A;  4LO6 B;  1BEV 2;  1FT9 A;  4FXG B;  3TEW A;  3H8X A;  5FZA A;  3FLP A;  4FTB A;  3DPR B;  3J7L A;  1VBE 3;  3DUI A;  4HT1 T;  5F6K A;  3VZO A;  4CCE A;  3G6J B;  1AVB A;  1MQT B;  2VCB A;  1Q3E A;  1POV 3;  3IT8 A;  2R0H A;  1CZV A;  1PVC 1;  5LW9 A;  2R1B A;  4NIG A;  2DYC A;  1MPX A;  1PVC 3;  4FPG A;  5B2G B;  2D5F A;  1PIV 3;  4E4H A;  4M01 A;  2DWR A;  3NKT A;  1HX6 A;  3WNO A;  2PLV 2;  5FKC A;  4DRR A;  3POW A;  5K0U A;  3WLU A;  4MAD A;  5FXV A;  3T3Y A;  3K2O A;  4QXH A;  4BXS V;  1JHJ A;  2ZAC A;  2F4L A;  2Q1F A;  2MEV 3;  1OA3 A;  2O14 A;  3UYJ A;  1RUG 2;  5CG8 A;  1EP0 A;  4NJ4 A;  1RHI 1;  2ZGR A;  4UF0 A;  2D44 A;  1I6X A;  5K7P A;  3WG4 A;  2XLG A;  4LNV A;  4Y20 B;  4L0P A;  3W58 A;  4BME A;  1AYN 3;  2JDU A;  4XCA A;  1WMX A;  3K4D A;  1NXM A;  3ZPY A;  1ND2 C;  1C4R A;  1JU4 A;  2QZ2 A;  3JZV A;  3GM8 A;  5IVJ A;  5IFP A;  4QKD A;  4BU2 A;  2D93 A;  2ZX0 A;  5C6C A;  4XJW A;  2UY8 A;  4E27 A;  5FYT A;  4AED A;  1X50 A;  3FL7 A;  1VBD 3;  2OYZ A;  1ND2 B;  1UN1 A;  3T2O A;  5K0U C;  2DUR A;  3KCX A;  5LY2 A;  3PMS A;  3GZU C;  4W4Z A;  4XQ4 A;  4XBL A;  1VB4 A;  5LWB A;  4XOG A;  5F3C A;  1JYI A;  4KBZ A;  1BBT 1;  4IDZ A;  1HRV 3;  2BTV C;  2RM2 3;  2VOK A;  2WQ4 A;  4PDW C;  4UFI A;  3HNB M;  4CU7 A;  1ZZ8 A;  1AUY A;  1IQA A;  1MS3 A;  2EIG A;  1T2X A;  1W8W A;  4E4Z A;  3KF3 A;  1RUC 3;  2CV6 A;  4MGK E;  4XIL A;  1RUH 2;  1TMF 1;  2A3Y A;  4MO3 M;  4MET A;  1X8M A;  2G1M A;  4BYY A;  1ODM A;  2Y60 A;  2QTW B;  3BU7 A;  4JDO A;  3R0R A;  4MH0 E;  1XQN A;  4B3N A;  1SZB A;  2F6B A;  3LDB A;  1GZW B;  3KD4 A;  3NNG A;  1SBE A;  1W2T A;  3ZFE C;  4UWD A;  4XFA A;  1ZBA 3;  2YGM A;  5FYC A;  3J8F 3;  1D4M 1;  3H1W A;  5ABJ C;  2QQK A;  4Q0S A;  1DFQ A;  3MPB A;  1ZRF A;  1U12 A;  2JDK A;  5FPX A;  1ENS A;  2FDK A;  2RDS A;  4Q0Q A;  5J37 A;  1O59 A;  2MEV 2;  5FPZ A;  1QXR A;  1CN1 A;  2JKB A;  4PT6 A;  1GZT A;  1W6N B;  2A6X A;  4S2F A;  2ZS6 B;  3LQC A;  4NII A;  3HIF A;  3M7A A;  2CDP A;  4CP1 A;  4E2S A;  1U0A A;  1CON A;  2R06 3;  2Y64 A;  5A80 A;  3AZV A;  1OOP B;  4BOW A;  4QHZ A;  4QX3 A;  2EIB A;  3AKR A;  2B46 X;  4N7U A;  3G7D A;  1QXP A;  2DTW A;  3PJY A;  4R52 A;  2QQN A;  3ZYI B;  5L7O A;  2NLR A;  1YC6 1;  3OGG A;  4IE6 A;  2D6K A;  3T1L A;  4BH9 A;  3AL6 A;  3S30 A;  3N9N A;  2QQI A;  3A22 A;  1RUJ 1;  2B9V A;  3EJK A;  5H9Q A;  3NNJ A;  5FUI A;  4OHZ A;  5JXG A;  4XQD A;  1OVS A;  2WFF 3;  3FZ3 A;  2UWA A;  1PO2 1;  5HCF A;  1EUU A;  2Q4S A;  1W9T A;  1AR6 2;  1DYP A;  2ADD A;  2VU9 A;  3AKT A;  3B69 A;  5T55 A;  2VD7 A;  3LEM A;  4R9A A;  1OLM A;  2XJR A;  3III A;  3O1T A;  4ZS2 A;  2H6C A;  1JZ7 A;  2VOT A;  4XDO A;  4Q4X 1;  2UWC A;  1V0A A;  4PIY A;  2Y6F A;  1CQ9 A;  1SBD A;  3VBF C;  5L9B A;  2JEC A;  3N7J A;  1IS5 A;  1PHM A;  1JS9 A;  4FPH A;  3KQ4 B;  4JTN A;  2JG8 A;  3HWJ A;  1UZY A;  4LK7 A;  4YM0 A;  2UUR A;  4CP0 A;  4Z1V A;  3PVE A;  2ZGO A;  4F7Z A;  3WHU A;  1LRH A;  5FO8 B;  3CLP A;  4TXW A;  4P08 A;  4QX5 A;  1N47 A;  1RVF 2;  3WG3 A;  2P17 A;  3PJQ A;  4CRQ A;  1DQ4 A;  3RRD A;  4F8A A;  1X9T A;  2PHT A;  1PO2 2;  1QQP 3;  5BYN A;  5C5T A;  2YFU A;  1ALY A;  2LAL A;  3JQW A;  3I3D A;  3KV9 A;  3RYP A;  3WQ7 A;  2GZW A;  1JMU B;  3JU9 A;  3ILF A;  1WBF A;  2ZKL A;  1ZM1 A;  2A73 B;  2C9K A;  2IFR A;  1OH3 A;  3WUC A;  3OBZ A;  1O8P A;  3VBS A;  1UYZ A;  1HXS 3;  2YGL A;  2YHJ A;  4Q1R A;  3CIH A;  5FMB A;  2WYS A;  4IEO A;  1BYH A;  1PVX A;  3WHT A;  3I2I A;  3GBF A;  1H6X A;  4ZU7 A;  2W1U A;  3V65 A;  4RQP A;  4HLT A;  3FLT A;  4ARY A;  1RUD 1;  3POY A;  1UZ0 A;  2QNK A;  5JXI A;  3KSC A;  4D6R A;  5K0U B;  4QM9 A;  1GFF 2;  2B4K A;  4A7Y A;  5A6Y A;  2AH2 A;  1QJX 3;  4XUQ A;  4ZZ8 A;  1EY2 A;  4LMF A;  4XZP A;  2YC0 A;  3HQU A;  5L7O B;  1LHW A;  1VPH A;  2R06 2;  3S7E A;  3SCF A;  1BXH A;  3DPR C;  2XGX A;  1CX4 A;  1R1A 1;  3Q8F A;  3T0B A;  4A7K A;  3NVC A;  1R1A 3;  5ISL A;  3AMN A;  1J3P A;  1L7L A;  3AMQ A;  4JGZ A;  1C1F A;  4QPW A;  2LS6 A;  4Y5T A;  3VBH A;  3FFQ A;  2BOJ A;  1Q5O A;  3MBW A;  4CDQ B;  2W1S A;  2P3J A;  3ZYB A;  5A70 A;  3ZYJ B;  2FCT A;  3IIA A;  4QMA A;  5DDJ 3;  4HKL A;  2WS9 3;  1EV1 2;  1FPN 2;  3BCW A;  1GZ9 A;  1V9U 3;  1GP5 A;  1RC6 A;  4GQ7 A;  3HBK A;  4H55 A;  1XYO A;  1UQX A;  3I59 A;  1R09 3;  4KU7 A;  3VV1 A;  4H7L A;  4NO4 A;  5IYY A;  3PUA A;  4HKW A;  4NHM A;  1LR5 A;  1LB2 A;  1D7P M;  1W8N A;  1UW8 A;  4RYD A;  3WV6 A;  1W6P B;  2E33 A;  2DU0 A;  1YQ8 A;  2XJS A;  1UMH A;  3UT0 A;  1NA1 C;  1N3O A;  2ZHL A;  1SLB A;  2JEN A;  4YW4 A;  1CX1 A;  2GME A;  1PGL 2;  3U0Z A;  4CTE A;  3WVJ A;  3ZYR A;  2W1Q A;  4IV1 B;  3AP4 A;  1XNC A;  3BPZ A;  3WQ0 A;  2SBA A;  1C5I A;  1TMF 3;  2EF6 A;  2JIC A;  3HT2 A;  3GZA A;  1S0C A;  1MZF A;  1CGP A;  5K8S A;  3AXE A;  4XYX A;  1VBB 1;  2HBT A;  2TUN A;  4LBL A;  2GH8 A;  2BWA A;  3OGJ A;  1YFY A;  2ZGP A;  4GWN A;  5L9R A;  1JH5 A;  4CEY A;  3HVD A;  4I0B A;  3AC0 A;  3VD7 A;  1L3J A;  4AK3 A;  5HV4 A;  4HN1 A;  5BNN C;  2WUH A;  3JB4 C;  4XF4 A;  4GKX A;  4YZ3 A;  2OT7 A;  5EIY B;  1HRI 3;  3NV1 A;  3ROU A;  5LBC A;  3FHI B;  4AI0 A;  3ZR5 A;  5FLJ A;  3RI8 A;  2WQ8 A;  5A3U A;  5HXV A;  2WBK A;  2NMO A;  4YVS C;  1PGL 1;  1F8V A;  1K5M B;  2HWE 3;  3C7F A;  2XJQ A;  1XU1 A;  1JOB A;  1RHI 2;  2BBA A;  3AZX A;  2DCY A;  4EZH A;  2ZAB A;  3LA3 A;  5I0U A;  1C8M 1;  5I0D A;  2RS3 2;  2VNG A;  2AEN A;  1ND3 B;  2VO5 A;  2OII A;  3K3N A;  1QJY 3;  3NJX A;  3KLS A;  5CFD B;  1NOV A;  4JGZ B;  5FZG A;  3TRS B;  3VBH B;  4D94 A;  2ET1 A;  1J3Q A;  1JBC A;  5FZO A;  3OY8 B;  3BTX A;  2VTX J;  1POV 0;  4AGV A;  1QOS A;  5DN2 A;  4D3W A;  4FT8 A;  4YZ5 A;  5L36 A;  4J1W A;  3E6D A;  4LOS A;  1K12 A;  3HD8 B;  1H2K A;  1GNH A;  1LOA A;  5F5Q A;  3WW4 A;  3EB7 A;  4YLZ A;  4O9E A;  5DUU A;  2E7Q A;  5DDJ 2;  1HJG A;  4LBN A;  3AP7 A;  3VKL A;  4LO4 B;  3BGA A;  4LIV A;  3H7Y A;  4BDV B;  4EWD A;  2JG9 C;  2VZ3 A;  2ZEY A;  3N7M A;  3TNP B;  5FYI A;  5FZ7 A;  4Y1Z A;  1V70 A;  1YRZ A;  4D69 A;  4V2W A;  3IB3 A;  2AEZ A;  3UKV A;  4A6O A;  2XDV A;  3C7O A;  4EE2 A;  4Q4W 2;  3VD5 A;  2BBV A;  1XJA A;  3T4H B;  2ZGS A;  3UGG A;  2WN2 A;  2XG3 A;  1MQT A;  5M0T A;  2VMF A;  1L7R A;  3ZM8 A;  1AR7 3;  1XYN A;  4JRA A;  3ST7 A;  3UJO A;  4YNI A;  4BHP A;  1SDD B;  1CIW A;  1D0H A;  2ZML A;  3IPV B;  3BOD A;  5A7S A;  2IZW A;  5FLH A;  3VKO A;  3ZXE A;  2WO1 A;  2PHX A;  1VE0 A;  2WNE A;  3KT7 A;  4QX8 A;  4QX2 A;  1Y9M A;  3J7H A;  5F2W A;  3TEY A;  3VGI A;  3VBF B;  4K8F A;  1O5L A;  1S0E A;  2VZS A;  3LOB A;  1NXD 1;  3JQX A;  1VBA 3;  1QNW A;  5FDB A;  4HG6 B;  4CPB A;  5EQU A;  5C71 A;  1KGY A;  5FYY A;  4CA9 A;  4AQT A;  5FZ6 A;  5J36 A;  1W99 A;  3NNM A;  3OSD A;  4M0H A;  4O9G A;  1VB2 A;  5FZ9 A;  3H3Z A;  2WIN B;  5APA A;  4K40 A;  1AYN 1;  2E7A A;  1V6M A;  5JSR A;  3VBS B;  3WQ1 A;  4JGY C;  4EN7 B;  3H9A A;  3AFK A;  1ASJ 1;  2DTY A;  1PO1 3;  1PM4 A;  3AZY A;  2PHF A;  2W2I A;  3EXU A;  3FBY A;  4I09 A;  2Z4F A;  4LO8 A;  5JZG C;  1AL2 1;  4H7M A;  5LBB A;  3WG1 A;  1LOF C;  2QFE A;  3CNA A;  1QJY 2;  3HJR A;  4HSJ A;  4JQR A;  4YW1 A;  2Q8C A;  2OXB A;  2KD7 A;  1KXG A;  2ZGN A;  5G05 L;  4AED B;  4Z2A A;  2JWP A;  1K5M C;  1A3K A;  1UYX A;  2HWD 2;  2Q8E A;  1O7F A;  1NUK A;  1JYT A;  2BFU S;  2P6H A;  2QUO A;  1Z7S 3;  4AHW A;  2RS5 3;  1TNF A;  3AL5 A;  3MIG A;  1MZ5 A;  5T54 A;  2WZR 3;  2TEP A;  2DUP A;  2YB7 A;  3N9Q A;  3ZSJ A;  1S0B A;  2IVI B;  1UKR A;  4QXB A;  2FMY A;  2ZGM A;  1POQ A;  5J1X A;  1UZW A;  1W8F A;  5DXD A;  4DY3 A;  1XNK A;  5D8A B;  1ODN A;  1IS6 A;  5E89 A;  1MEC 1;  3GHM A;  2WC2 A;  1DP0 A;  1XSQ A;  2R07 1;  3VZM A;  2JDH A;  5L9V A;  1UU5 A;  4LUK A;  4C91 A;  1REF A;  1JI6 A;  3FUO A;  1WCS A;  4ARX A;  2XPJ A;  3RZK A;  2NM1 A;  3WD5 A;  2BWC A;  2VBP A;  4QKF A;  3OG2 A;  2CYF A;  4UOJ A;  3O7O A;  3WUD A;  5ABJ B;  1GOF A;  4B4R A;  1HKD A;  2BOI A;  1VJ2 A;  4UW6 A;  3SMH A;  3ZXA C;  2WT1 A;  5B4N A;  1JOD A;  2RS3 1;  3CMG A;  4EWA A;  5JOX A;  3V56 A;  4QKN A;  4XTM A;  1GKB A;  4P00 B;  1UNB A;  5FO9 B;  5FPB A;  5T5P A;  5A3L A;  4AVS A;  2ES3 A;  5DQ0 A;  3E5U A;  3PIJ A;  4PLM A;  1UXZ A;  4FVV A;  5A7Q A;  1AYM 2;  3VBR C;  4Q8K A;  3N9L A;  5IAT A;  1O5U A;  3JXS A;  3USS A;  5IK7 A;  1GNY A;  2XVK A;  1W9W A;  2XHK A;  2VAU A;  3ZSL A;  2CSG A;  3PIG A;  5GLT A;  2CL2 A;  1FAT A;  1OOP A;  1FXZ A;  5DPN A;  3TOJ A;  3U37 A;  5ACA 2;  4OZX A;  2R04 1;  3POF A;  5DMY A;  2W95 A;  1UF2 C;  1WW4 A;  2D43 A;  4G3Y C;  4YVW C;  3QOP A;  2Y34 A;  2R04 3;  5BNO C;  5FYZ A;  3MEP A;  3WNK A;  1JZ6 A;  3IN9 A;  4IGP A;  3GGL A;  3ZOI A;  1YUD A;  4G9S B;  2PEL A;  4P9L A;  4K1Y A;  1J3R A;  3F95 A;  2BGP A;  5CFC A;  2NYY A;  3ELN A;  1H8V A;  3JBG 3;  2K2S A;  5LA9 A;  1OUX A;  2PAE A;  2ZGU A;  3GYD A;  1BMV 1;  3BAL A;  4WM7 C;  2LTN A;  4RS5 A;  4D7T A;  4BLJ A;  3I2O A;  1OT5 A;  1DGR N;  3SH3 A;  1KJR A;  5EYX A;  3QAC A;  5I0S A;  1XE8 A;  3OGS A;  4Y26 A;  2GC3 A;  4WM8 A;  4MYE A;  5C4W B;  2JG8 B;  3LDR A;  3BTA A;  2V72 A;  1N1Y A;  4B29 A;  1CAV B;  1OFN A;  4FQZ A;  2B5H A;  5DAP A;  2HYK A;  3WP4 A;  3CDZ B;  4XF0 A;  3A23 A;  5DZF A;  5JAX A;  1US2 A;  1XE7 A;  3IZO A;  4NHX A;  4PF5 A;  5IVC A;  3DF0 A;  1PX4 A;  2W91 A;  1UX6 A;  3INA A;  2VUL A;  5FZ8 A;  5JLV A;  1LOC A;  1XNA A;  4JHT A;  2FZ1 A;  2VCM A;  2WWU A;  4YM1 A;  4HL0 A;  2XQR A;  2AC1 A;  1UOB A;  1WW5 A;  4LBQ D;  3LSD A;  5DUX A;  1WLW A;  5HV0 A;  2G4I A;  1LU2 A;  4QX0 A;  1CAX B;  2YFZ A;  3AP9 A;  3DV8 A;  4IEP A;  4UF0 B;  1HW5 A;  1Q8P A;  2K0G A;  4XUT A;  1NQD A;  2EID A;  1S2K A;  1MR5 A;  4KQ7 A;  1JOJ A;  4OFG A;  1OVP A;  1WCU A;  1UPI A;  3O1R A;  4RR3 A;  2GC0 A;  1AYM 3;  2RM2 2;  2RS1 1;  4KGQ A;  5LBF A;  3F2Z A;  4BZ4 A;  1GR3 A;  1BQP A;  3DEM A;  1LHU A;  2VNV A;  3K4A A;  4TTG A;  2RDR A;  4LLF A;  4CDW A;  5J48 A;  3I3Q A;  2D6O X;  5A3W A;  4FFF A;  1W2A X;  2E63 A;  5F37 A;  2EVX A;  4PF1 A;  4PHZ A;  2XL7 A;  2WLQ A;  3HAG A;  5IFT A;  1RUO A;  2CWM A;  4ISQ A;  2YZ4 A;  2DU1 A;  4WZC A;  1W3V A;  2ZX1 A;  4NR1 A;  1SDW A;  1JZ2 A;  5IAV A;  4OZO A;  2R04 2;  3FE5 A;  5EHD A;  1NCQ C;  2ZHK A;  3EO6 A;  3TWI A;  3WY6 A;  3SH5 A;  5KXE A;  3Q9O A;  4NWW A;  3FLR A;  1BBT 3;  1VP6 A;  1GV9 A;  1FOD 3;  4AL9 A;  5K9Y A;  2UU8 A;  2P5B A;  3SKV A;  4GJY A;  1WW7 A;  2O8O A;  2JE7 A;  1E5I A;  1H8T A;  3NV3 A;  4OUL A;  5EXO A;  5CA6 A;  4YG3 A;  4XFF A;  2ZTN A;  2DF7 A;  4WM8 B;  4WM7 B;  2G19 A;  5ERL A;  1O8S A;  4K9S A;  1C28 A;  1W6O A;  1WME A;  4CCO A;  4Q4Y 1;  2PFW A;  2VW0 A;  1S0G A;  4LBQ A;  2RG4 A;  1DHK B;  1S0I A;  2YU1 A;  2WNU A;  2WII B;  4M4P A;  4XAC A;  3PVN A;  2CGO A;  3WR0 A;  1FNY A;  3KMH A;  5IJR A;  1ZZC A;  2GMM A;  4DXR A;  2GC1 A;  2XKO A;  2QJV A;  1V6L A;  2W9X A;  4Y22 A;  2E26 A;  4MGS A;  3MID A;  5LEK A;  2P3Y A;  5BNN A;  2A6Y A;  3RZZ A;  4B7E A;  5J3U A;  4Z92 B;  3OD4 A;  2VZT A;  1YFX A;  2YRO A;  3M3Q A;  5H9R A;  3D0S A;  5GAL A;  2D97 A;  2OX0 A;  2Y26 A;  4IEZ A;  1RED A;  1EAH 2;  1DQ6 A;  3K77 A;  4WVM A;  1OFS A;  2O0O A;  1QDC A;  2MHF A;  2X29 A;  5H9S A;  2VME A;  2I45 A;  3UET A;  2KR2 A;  2RV9 A;  2LW8 A;  3GBW A;  4QX1 A;  2BPA 2;  3VUO A;  1WMF A;  3ZO0 B;  4CDW B;  1K5M A;  2AAC A;  3KS7 A;  4AOC A;  5JXJ A;  2FDG A;  1OD3 A;  1H6Y A;  2P34 A;  4LUM A;  5EYY A;  2OPW A;  4GWM A;  4N43 C;  1K42 A;  1JN2 P;  1PNG A;  2JX9 A;  4XFI A;  2EIC A;  4BK5 A;  3ACH A;  4HZF A;  3RVH A;  3P3P A;  4OHY A;  1RUJ 3;  5C70 A;  3RZJ A;  2MPF A;  2Q30 A;  3ZXL A;  3GDB A;  1TVG A;  2JDN A;  1WMD A;  1HDK A;  4RFT 0;  1LES A;  5CEH A;  1RIR A;  1COV 1;  2ZGT A;  4DUX A;  3AZZ A;  1X7N A;  3MUY 1;  1QQP 2;  3NKG A;  1TEI A;  2HYX A;  3USU B;  1NCQ B;  1IKP A;  3BVC A;  4OI4 A;  4R8H A;  1H2M A;  2KXL A;  2GN7 A;  2X10 A;  1XBF A;  1X8E A;  2NZ9 A;  4BQY A;  4WM7 A;  5KHK A;  1WD4 A;  1ND2 A;  2C0Z A;  1MEC 2;  1RIT A;  5GZD A;  4Q4X 3;  1DGW X;  4URT A;  1F31 A;  5F8P A;  5C7G A;  5FOJ B;  2GU9 A;  4HSL A;  2HWB 3;  4IE4 A;  3EQE A;  3MUZ 1;  3LFM A;  3VL8 A;  4UAP A;  2JE9 A;  1R08 2;  1DZR A;  4NVP A;  2JJ6 A;  4I0A A;  3WDV A;  3ZIW A;  4DFS A;  1MQT C;  4FP3 A;  4DQA A;  4Q4V 2;  4ES9 A;  1OI6 A;  2H0B A;  4Q4Y 3;  4FAG A;  2DCK A;  2R6Q A;  1RUE 2;  4LHN A;  1RXF A;  1I9R A;  1Q43 A;  4QDQ A;  5IW0 A;  1O91 A;  2O8Q A;  3SC7 X;  2BNO A;  3WCR A;  2Y6L A;  4Q26 A;  2GMP A;  4PI2 A;  5DUW A;  5FZM A;  5FQ0 A;  4LLO A;  2JB8 A;  5BUV A;  4QPI B;  5J7M A;  4Y3O A;  1BZW A;  5F2S A;  2YYO A;  3LKJ A;  3H8R A;  3LEK A;  3NO8 A;  4MGI E;  3LFI A;  4PQQ A;  1YIF A;  2VOV A;  1LGB A;  2W3J A;  4JHZ A;  4IEW A;  4AE2 A;  4FP2 A;  3KWV A;  1W8H A;  4GWI A;  1RUE 1;  3A0K A;  3P1I A;  3VDA A;  1NLR A;  4WVW A;  3WW3 A;  3J8F 1;  3GHN A;  3BU0 A;  4RGG A;  2PAK A;  2IFW A;  1T6G C;  3OCP A;  2VY0 A;  1N3P A;  2XJT A;  3TB0 A;  3THC A;  2WNV C;  3K75 B;  3WCS A;  4AQS A;  1D4M 3;  2VE1 A;  4N53 A;  2J1S A;  3CJI A;  2DUO A;  4R9B A;  4OLL A;  4Y1Y A;  2D6N A;  2V4A A;  2W87 A;  2WNU C;  4K3U A;  5F6L B;  5BNP C;  4A3Z A;  3R4S A;  1URX A;  4Q0U A;  4XIK A;  3B5L B;  2A3W A;  3POI A;  4CDU C;  4Y24 A;  1DCS A;  4KWL A;  4YFZ A;  3U78 A;  1UCX A;  5DUV A;  1OLM E;  1VAK A;  4AFD A;  1AR9 2;  1DG6 A;  2DCJ A;  2YY1 A;  2WS9 1;  3U07 A;  2YBP A;  3VHO A;  3A4U A;  4NMI A;  1H1I A;  5IWF A;  5CFD C;  2VZP A;  1R09 1;  3RFR A;  1MEC 3;  5EWS A;  2UY9 A;  1HB4 A;  3BOP A;  4AVV A;  1ZBE 1;  4YRD A;  1GUI A;  4GZ9 A;  1YFW A;  4PDW A;  5GLV A;  2HWB 2;  1V00 A;  2BV4 A;  3HMY A;  4P9W A;  5KXD A;  1WBL A;  1DQ0 A;  2YUE A;  1XNB A;  5IUQ A;  2JB4 A;  1ENQ A;  4CDQ C;  5JOZ A;  2ZGQ A;  1JYX A;  5TSW A;  5I0R A;  1NYW A;  1TZO A;  2XWB B;  4QPG C;  1QNY A;  5FYS A;  5FWE A;  2PQQ A;  1AR9 1;  4TSV A;  1RUE 3;  3J7M A;  4NHL A;  1HB1 A;  5IAX A;  2ZMN A;  5EZW A;  1H30 A;  2D6L X;  3VKF C;  3ZYH A;  4KI5 M;  1IOA A;  2WZE A;  3PLQ A;  1UYY A;  2C26 A;  2Y6J A;  1VLN A;  2I07 B;  2VZU A;  3CKH A;  1G6N A;  3C7G A;  3KVA A;  3E97 A;  1X9P A;  4XUO A;  3K51 A;  4LUL A;  1NG0 A;  4JV4 A;  3NV2 A;  4NN0 A;  1VBA 1;  2UYA A;  1W8Z A;  2WRA A;  3LEG A;  4GA9 A;  3MLJ A;  5L73 A;  2ORZ A;  3V0B A;  4CDU A;  3FBM A;  3S6P A;  1RL3 A;  1LAJ A;  1E5S A;  3HT1 A;  1UY1 A;  2WT0 A;  3HBZ A;  3J9S A;  2QCS B;  3KV6 A;  2WNV B;  4ET7 A;  2YBK A;  5A6Z A;  2VMG A;  1MZ6 A;  5JSP A;  1OOP C;  3ZDS A;  1OA2 A;  1J1L A;  3BUC A;  1RTV A;  1H8T C;  2ZCW A;  2JD4 A;  4UBG A;  2ZEZ A;  3RS6 A;  3C7H A;  4GJZ A;  3VZK A;  4DB5 A;  4JAA A;  3NWK A;  1FI2 A;  1NZC A;  3KV4 A;  5CZK A;  1I5P A;  2D3R A;  3I3B A;  3SKJ E;  3MIF A;  5IVF A;  3GJB A;  5CKN A;  4FAH A;  3E6B A;  4GH4 A;  4Y20 A;  3H50 A;  5FKB A;  3WXP A;  1W28 A;  2Q8O A;  1NCR B;  1WWY A;  4AG4 A;  1ACC A;  3NJZ A;  4XW3 A;  5C5U A;  4HK9 A;  1FV2 A;  1NLQ A;  3NL1 A;  5C8W A;  1UOJ A;  2B7Y A;  5CG9 A;  1YXW A;  2G9Z A;  1NCQ A;  4D7Y A;  2FZ2 A;  1Q8Q A;  2EXJ A;  3AYE A;  4F83 A;  3VHP A;  3ZYF A;  1AHS A;  3I59 B;  3R4U A;  1UU6 A;  1HV0 A;  4W6W A;  1LOB A;  4W6X A;  5A7O A;  4YZ1 A;  1HJF A;  3V0A B;  1M4W A;  2AEY A;  1W39 A;  3O0X A;  4N53 C;  1I5Z A;  3Q8A A;  1JZ3 A;  4AF9 A;  1FX5 A;  2BJS A;  3HNM A;  2OUJ A;  3GNE A;  1CES A;  1ZBE 3;  1W9S A;  2A6V A;  5T50 A;  2GSY A;  4ITC A;  1QF3 A;  4R9D A;  4LK6 A;  2HWD 3;  1NZI A;  1W04 A;  1G86 A;  5CBL A;  2E32 A;  4TYS A;  5FZ4 A;  1UO9 A;  4LKS A;  1JYN A;  2XWJ B;  2A70 A;  3CBN A;  3MZH A;  3OEB A;  1XPW A;  3NNL A;  3T0D A;  5CAD A;  4GWJ A;  2WZR 2;  1GMM A;  4NPR A;  3PDQ A;  4UFJ A;  4AHX A;  2PMW B;  1BCX A;  5ANQ A;  4RR3 B;  1LOD A;  1UKG A;  1VBB 3;  2EAK A;  2WA3 A;  4UFM A;  4HOO A;  3NJY A;  1W0P A;  3B9I A;  1ZNP A;  3M3E A;  4YGC A;  2OKX A;  3VBO A;  4XDP A;  4Q29 A;  3LDK A;  3A21 A;  2WAA A;  3T2P A;  4IGQ A;  1RUD 2;  1XB9 A;  5JZG A;  3IAP A;  5I0T A;  4CEW C;  4DEQ A;  1JZ4 A;  3W20 A;  2Q1Z B;  3BKZ A;  3R05 A;  3D8C A;  1H2N A;  3FUQ A;  3LSE A;  3SNM A;  1W9Y A;  5HXM A;  2A6W A;  2R49 A;  3OJB A;  1BMV 2;  2X8K A;  4IE5 A;  5KHJ A;  3HR9 A;  2ZGL A;  4YW2 A;  1LHN A;  4KL1 A;  3I49 A;  1KIT A;  2J1E A;  1EAH 1;  2Q1M A;  1OQ1 A;  4DXZ A;  1BEV 3;  4ORF A;  2Z5W A;  4JDM A;  1A8M A;  1SQ4 A;  1VBE 2;  1RVF 1;  1UX7 A;  2R30 A;  1OXC A;  2P37 A;  4X6Q B;  1BHG A;  4IND A;  3ZXG A;  3KZ4 C;  4Z07 A;  3M3I A;  1RMU 1;  3ZDV A;  5I91 A;  3QCW A;  5A33 B;  5F5I A;  4A44 A;  1DZT A;  1O4Y A;  4OHX A;  4CVU A;  3I97 A;  1F15 A;  1PVC 2;  2WNO A;  2DCT A;  3ACI A;  4NE9 A;  4DOU A;  1PIV 2;  1OHF A;  4AWD A;  1QJU 1;  4J1X A;  3HQX A;  1HXS 2;  2DCZ A;  1VBC 1;  2VG9 A;  4EN8 B;  1QJU 3;  5IK5 A;  1LEM A;  1OUR A;  3WDT A;  3POB A;  4Y22 B;  2RE9 A;  3T1M A;  3UGF A;  1POV 1;  1TQ5 A;  4COZ A;  3O1P A;  4LOT A;  2VZ1 A;  1SEF A;  5KC6 A;  1IPJ A;  4K1Z A;  3BI3 A;  5I8Y A;  3O1S A;  2PHW A;  1PIV 1;  5CYY A;  4I0W B;  1QY4 A;  2R0F A;  3IPV A;  2Z69 A;  4K6B A;  4XET A;  4WVM B;  2XBO 2;  1S4C A;  4CDX C;  1QJX 2;  2XH6 A;  4PBP A;  1H4G A;  4AED C;  1ZYB A;  4BIF A;  2QQW A;  2ZA9 A;  3W9A A;  3WOG A;  3IDC B;  3DL3 A;  1AYN 2;  1LGC A;  5HCH A;  2XJV A;  4XUN A;  3ACF A;  5HI0 A;  1V6J A;  3JCI A;  4CE8 A;  5IVV A;  3QBQ A;  1YYN A;  1VBB 2;  2CGN A;  3PU8 A;  1KFX L;  3GCW A;  4XE9 A;  1HXS 1;  1L7Q A;  1Q8V A;  2WO7 A;  2ZHN A;  3O0W A;  2D98 A;  4FPF A;  1W2O A;  2RHP A;  3LE0 A;  4BWO A;  1ZX5 A;  3J7N A;  4FPL A;  1F9K A;  1N1T A;  4QX7 A;  5FP3 A;  3AB0 A;  5FXZ A;  3THT A;  2VC9 A;  4YW3 A;  5JXH A;  2YG0 A;  1FMD 2;  3LA7 A;  4A4A A;  3C2U A;  1KJL A;  4IV1 C;  4BLI A;  3LB9 A;  2PHD A;  4XJZ A;  1W6M A;  2A7A A;  1QJX 1;  5D1I A;  3VBU B;  2VCC A;  2WNV A;  2JG9 A;  1CJP A;  3PTR B;  1F2N A;  4TN7 A;  4DS0 A;  1ZZB A;  3RZG A;  3OGV A;  1RMU 3;  4YVW B;  4HVO A;  1WLC A;  1CAU B;  2RJK A;  3DYM A;  4O7X A;  1DDL A;  1H4H A;  1OC1 A;  2GN3 A;  2HWB 1;  3PUQ A;  1CAV A;  3ZFF C;  2ZEX A;  1RUC 2;  3QD6 A;  1RUH 3;  1JYC A;  5LRS A;  4IE0 A;  1CWP A;  5JSO A;  4JKK A;  4YM2 A;  4IV1 A;  3ILN A;  4N7I A;  1QXJ A;  3BYW A;  3IWZ A;  5ANN A;  1FYU A;  4UFH A;  1VRH 1;  1Y3T A;  4XJ9 A;  5FR3 A;  4DPN A;  1PK6 A;  5LCW L;  5SV5 A;  4LEJ A;  4XFG A;  5CNA A;  3WSO A;  1AL0 G;  3NAP B;  3AMP A;  5LEJ A;  1QJU 2;  2GNM A;  3TN9 2;  1SLC A;  2DVA A;  3A0N A;  4LE3 A;  2BYV E;  3PUR A;  1PZ8 A;  3TYJ A;  1OQE A;  3CU7 A;  3B7M A;  2ZXQ A;  3WF0 A;  5T5O A;  4QB6 A;  1W6P A;  1AXY A;  2VZR A;  1UY4 A;  3KQR A;  5F39 A;  2FMD A;  4OUE A;  1S0D A;  2XBO 3;  1E5R A;  4NHY A;  1MS0 A;  5FK7 A;  1F5J A;  3CO2 A;  3D5O A;  3FMG A;  5FZH A;  2VJX A;  1CVN A;  5JIA A;  1GWL A;  5FFO C;  5FYM A;  3BIE A;  1PGW 2;  1TME 2;  4EWE A;  4CEY C;  5FIX A;  1A8D A;  2GDF A;  1KDM A;  3I3E A;  2WYF A;  4CCL A;  2OA2 A;  4NHK A;  1MS9 A;  3CJI B;  3U11 A;  3DXT A;  3WW2 A;  1H2L A;  1ASJ 3;  2DUQ A;  3L2Y A;  4JC1 A;  4GKY A;  4YVS B;  2D7F A;  4IEX A;  5HBA A;  4DEV A;  4S2D A;  2VVD A;  3W5M A;  1W8T A;  2Q8D A;  1JW6 A;  3MF9 A;  3GJA A;  3MW3 A;  4QB1 A;  1RUI 1;  5A6X A;  1IPS A;  1IS3 A;  5CIR A;  1GSL A;  3CEW A;  1CAU A;  4RFR B;  5FMO L;  1SFY A;  1RUF 1;  3HQR A;  2X5I C;  4QXK A;  2A6Z A;  3RZM A;  1AX1 A;  1C8M 3;  3N3H A;  2WWS A;  1GQP A;  1GQH A;  2BU9 A;  4RHV 1;  4LBQ B;  1IGO A;  1F4H A;  4WVZ A;  4XAE A;  5CFD A;  5CFC B;  1GBG A;  3J26 N;  2G9G A;  5FY4 A;  2VXR A;  3LPF A;  4CPB D;  3RYK A;  4BQ5 A;  2HEW F;  1W0O A;  5HCA A;  3DGT A;  4LPL A;  2TBV A;  1RUC 1;  2J1A A;  4A3X A;  4CDX B;  2WSV A;  1LHV A;  1HLC A;  1Z0H A;  1JZ8 A;  2RDQ A;  5EJZ B;  2DBN A;  3I8T A;  4P9G A;  3RJ2 X;  1BK1 A;  4XAA A;  3N35 A;  1SBF A;  1HV1 A;  2KA3 A;  3IBM A;  5FWJ A;  2BUK A;  4OI0 A;  4RGK A;  3N7L A;  2ZAH A;  4EJR A;  2ID4 A;  5A3P A;  5GZC A;  4IGO A;  4FTS A;  3I2G A;  2VMI A;  1W8O A;  4QB2 A;  2Y6H A;  1N1V A;  1J1T A;  3A7Q A;  1JZ5 A;  3VBO C;  4WVV A;  5H9P A;  5F1R A;  3SXW A;  5FLI A;  5LY1 A;  4IES A;  2BVB A;  4IL7 A;  4XCB A;  1QOT A;  1SLI A;  1SHW B;  5LAT A;  2ZAA A;  1SMV A;  2YXS A;  2QVS B;  1O4Z A;  3WIN E;  2AUY A;  1AR8 3;  2HWC 1;  2JKX A;  2WDB A;  4Q4X 2;  5SV8 A;  2YMZ A;  3ZR6 A;  3IAQ A;  4CUA A;  4XBQ A;  5FTT C;  3W21 A;  2CU5 A;  2ZX3 A;  4L97 A;  5A1F A;  4LO7 A;  3MYX A;  4Y1V A;  1Q8S A;  1G9C A;  4BQ2 A;  4Q1P A;  4UI9 L;  3B3Q E;  2BER A;  4IEY A;  4QQL A;  3WDU A;  3ME2 A;  4ASL A;  1PNF A;  2CAV A;  4M0N A;  4XBN A;  4YYO A;  2G9F A;  1V6I A;  2WS9 2;  3ITQ A;  2WA4 A;  2WZ8 A;  1COV 3;  3OB8 A;  3PME A;  5FZK A;  2L9L A;  5FZB A;  4BCU A;  4CU6 A;  5BV6 A;  4G4F A;  3O1M A;  4XJU A;  1PMI A;  5A3N A;  1UMI A;  3KT4 A;  1UOF A;  1S2E A;  5DAX A;  3WF2 A;  1XOY A;  4JGZ C;  3VBH C;  2OQ7 A;  3TEX A;  1NCR A;  1BVV A;  3TN9 1;  4GIQ A;  1RUI 3;  1DGR A;  4FPE A;  1ULD A;  4XZU G;  4XHB A;  4X6R B;  5JUV A;  1VBD 1;  5F3I A;  1J58 A;  3U75 A;  1CPN A;  3VL9 A;  4QPG A;  2AR6 A;  4N90 A;  4OQ9 A;  1VBC 2;  4YVW A;  1KD7 A;  5DAV A;  2V09 A;  3RG0 A;  1YO8 A;  3WEZ A;  5GKA C;  1W6O B;  2XL9 A;  1VRH 3;  4W6Y A;  4YFW A;  1MS4 A;  2XB6 C;  2ZGK A;  1PMJ X;  2RM2 1;  4AW7 A;  4Q0P A;  3HOB A;  3PVO A;  4LJH A;  4CP9 A;  3AKP A;  4C8D A;  4AI3 A;  4AFM A;  2W68 A;  1VAL A;  4AFA A;  3BTZ A;  1XXN A;  2AGS A;  4UFL A;  5EJ1 B;  4IV3 C;  2A1X A;  4C0B A;  3I2H A;  3PUI A;  4FOY A;  4OMC A;  4QQP A;  3M70 A;  4CYD A;  4HMZ A;  4RN5 A;  4Q4W 1;  5D8A A;  5IVE A;  1KRI A;  4AR2 A;  3BIW E;  5IK8 A;  2Y33 A;  1Q8O A;  4D7S A;  1UD1 A;  4BQ1 A;  1RHI 3;  5A7N A;  3S5Q A;  2P6C A;  4DY5 A;  3RPQ A;  4AZZ A;  4YAR A;  1W03 A;  1HRI 1;  1WUV A;  4QKB A;  2B42 B;  3PU3 A;  5ABJ A;  2VQA A;  2ZZQ A;  3PUH A;  1IQD C;  4IV3 A;  3ZN6 A;  3AK0 A;  3APB A;  1EUT A;  3EHK A;  1GP6 A;  2P3I A;  1F35 A;  4QGM A;  5FY0 A;  1GAN A;  3U4S A;  1VR3 A;  1CZT A;  2XJU A;  3SEP A;  2NQY A;  5BNQ A;  2R06 1;  3VZJ A;  1R1Z A;  2WN3 A;  4XUP A;  3DEC A;  2RMU 3;  3ZFG A;  4CCD A;  1CPM A;  4FPY A;  3AFG A;  1ZRC A;  1HN0 A;  2PHR A;  3OUH A;  2CNA A;  1S0F A;  1LTE A;  3P5B A;  4HPK B;  1US3 A;  5KWR A;  4P9X A;  1OUS A;  2Z79 A;  3BB6 A;  4MVT A;  1B35 B;  4NPL A;  5C8C B;  3ZKU A;  1DIW A;  1VMH A;  3THP A;  1AX0 A;  3T2Q A;  4XPV A;  1ULE A;  3ETP A;  1WA6 X;  4QPG B;  2D40 A;  5AVA A;  5GJ6 A;  5JI7 A;  4E2G A;  4A45 A;  5JOY A;  2Y6K A;  5C4W A;  4L99 A;  2YDE A;  2ILM A;  2LRP A;  2XLA A;  1MAC A;  3AMM A;  1VBC 3;  3X29 B;  5ACA 1;  5CIS A;  1WD3 A;  2HWC 2;  3OF1 A;  5JR7 B;  1SLT A;  1LOE A;  5FZD A;  3L9J T;  4CP9 B;  4CCJ A;  2D6M A;  1JYW A;  1NCR C;  1C57 A;  1E5H A;  5LRR A;  3RQ0 A;  5C3P A;  1G9A A;  5DG1 A;  1UZZ A;  3JD7 1;  4GB3 1;  4HFS A;  4X8N A;  1Y43 B;  2FQP A;  2FD8 A;  2EXK A;  2XVG A;  1PM7 A;  3D4K A;  4B1M A;  4NUB A;  2DV9 A;  1HQN A;  1GYK A;  3H3L A;  3MHZ A;  4PIX A;  2ARX A;  1DQ1 A;  2VUA A;  3OBT A;  4EN0 A;  4FFI A;  4AEK A;  2FDH A;  4H2A A;  5FMC A;  3RMY A;  4CU8 A;  4CDU B;  2B8M A;  1X36 A;  4HON A;  4PJY A;  2A71 A;  4QXC A;  4CU9 A;  4QT6 A;  3UGH A;  5A6Q A;  1GZC A;  3VDD B;  2BNN A;  1C1L A;  1PO1 2;  1TE1 B;  4M00 A;  4IE7 A;  4LTA A;  5FYV A;  4YGD A;  1UY2 A;  3ZSK A;  2W47 A;  3VHR A;  5BY5 A;  4BK4 A;  2RMU 1;  3RWK X;  4ONU A;  1KS5 A;  3ACG A;  5L7O C;  1RUN A;  3I2K A;  2PAM A;  3VZL A;  1JOP A;  2JXA A;  2K46 A;  3MW4 A;  3H42 B;  3SCG A;  4CZS A;  1RB8 G;  2DDU A;  4MOA A;  1U5X A;  3IDE A;  4XDQ A;  4Q27 A;  1Z7S 2;  4IET A;  2ADE A;  2V5D A;  3ZSM A;  5JDB A;  5D2A A;  4BQ4 A;  3RGB A;  4NAO A;  5JMO A;  3VBU A;  4A41 A;  1UU4 A;  3AP6 A;  1C5H A;  2XLF A;  5T5J A;  3WF1 A;  2OW4 A;  3C8X A;  5DDJ 1;  4LBM A;  3AVS A;  1V9U 1;  3LIH A;  2PXJ A;  3LGR A;  2C24 A;  4OHW A;  4QM8 A;  1F4A A;  3UKN A;  1D2S A;  1ULP A;  1HQL A;  5GZG A;  1OMI A;  4NAM A;  2VVE A;  4X8P A;  3N4M A;  2E6V A;  1V6N A;  1VBD 2;  4AVB A;  1OPM A;  5FO7 B;  3B9C A;  4Y4R A;  2GNT A;  1BJQ A;  1ZVF A;  2HWD 1;  2PTM A;  2XR4 A;  3B94 A;  1AF9 A;  2AZ5 A;  3P6B A;  1ZRE A;  4MG2 A;  2IXC A;  2Y38 A;  3ZYP A;  5AC9 3;  5C3Q A;  1N3Q A;  5KC5 A;  4LA2 A;  1OKO A;  1C3H A;  4YZ2 A;  1S1A A;  2WNU B;  5BNO B;  4MX3 A;  2BVV A;  1E57 A;  1XU2 A;  3TEZ A;  3EMR A;  2VMD A;  3FX3 A;  4U36 A;  4YG6 A;  4Y1X A;  5FV3 A;  4ASK A;  1RUJ 2;  3KT1 A;  2Y6G A;  3WNX A;  4JTO A;  3ZN4 A;  1AXK A;  5BXX A;  1J83 A;  3WDY A;  4RS5 C;  1QHD A;  4HVR A;  2RR1 2;  3D82 A;  4OHV A;  1P8J A;  1ZRI A;  4JGY B;  4H14 A;  5FPV A;  4AQ2 A;  2OS2 A;  3V0B B;  5A7W B;  5CFC C;  4LE4 A;  4EV0 A;  4BE3 A;  1YI9 A;  2VBB A;  2CDO A;  1OQD A;  3ZFG C;  1O6U A;  3ASI A;  5BNP B;  4QAW A;  3OBR A;  4Y4Y A;  1EPZ A;  3J8F 2;  2BQP A;  1R64 A;  3Q8B A;  3FN9 A;  4BPZ A;  3ZN6 B;  3PTY A;  2YPJ A;  1YWK A;  4QPY A;  3NV4 A;  4S2H A;  2VUC A;  2QQL A;  3AX4 A;  5CKQ A;  1B09 A;  3ZXF A;  3ZFE B;  3O1V A;  3WT3 A;  4L8Q A;  2W92 A;  2PHL A;  1IZ3 A;  1Z78 A;  4EN9 B;  5FK8 A;  2UWB A;  2B39 A;  1SCS A;  2GNB A;  1R08 3;  1TNR A;  2GH2 A;  4COY A;  2WFF 1;  1ONA A;  1HQW A;  4Y1U A;  4FI9 A;  2BP6 A;  1B35 A;  3O14 A;  2WAB A;  2E9Q A;  4M3C E;  1LEC A;  2QKD A;  3UES A;  3USU A;  5FZF A;  1MVQ A;  1RUH 1;  1LHO A;  2ZX2 A;  3IMN A;  4K8R B;  5HPO A;  4WM8 C;  1YCI A;  3ZVX A;  4N43 B;  4CP2 A;  5KXB A;  2WFF 2;  4JCK A;  4A7Z A;  2WZR 1;  1MS5 A;  2DBI A;  2IXH A;  4P9Y A;  4AI8 A;  1OF4 A;  4XIO A;  5C9A A;  5E16 A;  4C1X A;  3HPN A;  5LZ6 A;  1ZZ7 A;  3M2M A;  1QGL A;  5GM0 A;  3TBD A;  3MFC A;  3N9O A;  4LA3 A;  5C3S A;  2ZZJ A;  5LK5 A;  1QH7 A;  3MGU A;  1APN A;  1RXG A;  2HWF 2;  3IDA A;  4PIZ A;  5F7U A;  1QQP 1;  4LQR A;  1O3S A;  3ZXK A;  3N7K A;  4Z82 A;  3MLL A;  4QQ2 A;  3ATG A;  4YGB A;  1H0B A;  3OYW A;  5FPU A;  1LU1 A;  4XHX A;  2CAU A;  5BPX A;  3QH7 A;  4QPI A;  2RR1 3;  4D6S A;  5EV7 A;  3O5S A;  4NIH A;  1YQC A;  5KHG A;  2VMC A;  1QWR A;  1W6M B;  4BQW A;  2VXJ A;  4N9I A;  2VTF A;  4LBO A;  4MUV A;  4QU1 A;  4XAB A;  1CD3 G;  4BMB A;  2RJL A;  1NE4 A;  5FZI A;  4AAP A;  4AVC A;  2PLV 3;  3ETQ A;  4OUS A;  4YWA A;  4Q0V A;  5JZG B;  1LOF A;  2YC4 A;  1R08 1;  2VGD A;  2VOW A;  2XML A;  4KWK A;  4XXA A;  4F3J A;  1WCD J;  3S5A A;  5AFB A;  2OQ6 A;  2X09 A;  4XQW A;  3MF6 A;  4NRO A;  3ZKY A;  4COW A;  2HWE 1;  4N53 B;  4COU A;  1JU3 A;  2E7T A;  4QD2 A;  2BZD A;  2ERF A;  2ARB A;  5FZO B;  2I74 A;  1ZA4 A;  2HLE A;  2QE3 A;  1PGS A;  1PX3 A;  3N36 A;  2QQM A;  5CB7 A;  5IK4 A;  4Q2F A;  4K21 A;  4BM8 A;  3E6C C;  1NX9 A;  1O3R A;  1CIY A;  1IG0 A;  3D0J A;  1GWK A;  1HB3 A;  3LAG A;  4OCT A;  1QOO A;  4LO5 B;  5F32 A;  1YQ5 A;  4DIN B;  5FYB A;  4YM3 A;  3U1X A;  3LPG A;  1DZQ A;  3S0M A;  4I30 A;  1ASJ 2;  3U4X A;  1WCQ A;  3JBG 1;  3K4Z A;  4RD7 A;  2VNO A;  1ULC A;  4M3C B;  5C9A B;  5DZE A;  2Z2S B;  2I2S A;  4L2N A;  4UW3 A;  3V64 A;  1XNT A;  4JDN A;  2FHR A;  1NKG A;  5EP9 A;  1UPS A;  1S0J A;  1W90 A;  2BDR A;  2QQV A;  3AKS A;  1ZBA 1;  3KGL A;  4GUL A;  3O12 A;  4RA0 A;  4XF9 A;  5JIU A;  2ARA A;  2ENR A;  2XJP A;  3MI8 A;  1OSG A;  1YFU A;  1PK6 C;  2J22 A;  4D0Q A;  1D4V B;  3DCQ A;  3OYW B;  2R32 A;  2W94 A;  1W06 A;  5I93 A;  4QU2 A;  2ZMK A;  3S57 A;  4UT5 A;  3NAP C;  3K3O A;  4XUR A;  3E5X A;  3C7E A;  4QGL A;  2XUE A;  3OD0 A;  5JR2 A;  3KVB A;  1RIN A;  1W6Q A;  1XE0 A;  4CCN A;  1WGP A;  3B93 A;  3IKW A;  5JVV A;  2CWS A;  5G04 L;  3KM5 A;  4D8M A;  2IXJ A;  4IEU A;  3VBR B;  1GP4 A;  2FBE A;  4B1L A;  2JDP A;  2ZOE B;  1JUH A;  3GF6 A;  5CU1 A;  1NA1 B;  5DAQ A;  4AGR A;  2XOM A;  4S2G A;  3ABZ A;  1MVE A;  2ZPX A;  3LEI A;  4Y33 A;  5K4L A;  4B7K A;  2ZEW A;  2A75 A;  3LOI A;  1ZBA 2;  4HPK A;  3H3U A;  3RDI A;  3SH4 A;  2RR1 1;  2A5Z A;  4MXW B;  5JWP A;  3I54 A;  3BTY A;  1QJE A;  1TG7 A;  4AEM A;  2JE8 A;  3ALQ A;  3I7D A;  4CSW A;  4MGZ E;  2O1Q A;  2W39 A;  2VCA A;  4BIS A;  4NWV A;  2HWE 2;  5I8T A;  4AHZ A;  2AYH A;  2XKP A;  2VW1 A;  1H8T B;  1GNZ A;  5C4W C;  5FXW A;  1NT0 A;  1S55 A;  2MNG A;  3BN6 A;  3NJV A;  1S2B A;  2HBU A;  4ZS3 A;  3NRU A;  1ULO A;  1X82 A;  1IG3 A;  4Q4Y 2;  4DIQ A;  2PN5 A;  4E9K A;  5FP8 A;  2YU2 A;  4Z8B A;  3B00 A;  4AVT A;  1WW6 A;  2VMH A;  4CCK A;  2RS5 1;  2QDN A;  3T4V A;  2W08 A;  1OA4 A;  2BRT A;  3IDB B;  1VBE 1;  3RJR A;  4MGT A;  1HRV 1;  4NRQ A;  5FCC A;  4DZG A;  1ZZ6 A;  1LUL A;  4DUV A;  2HH9 A;  3WP5 A;  2IXL A;  3TAY A;  2B9U A;  2TNF A;  2VNR A;  3MDP A;  3NAP A;  3AXD A;  5KHI A;  3O0V A;  1I1E A;  2QQJ A;  1ST8 A;  1FMD 1;  4JZR A;  3W5N A;  2QQO A;  2RVA A;  1DQ5 A;  4QDS A;  3VHN A;  1ULG A;  3V0A A;  2K9Z A;  2J42 A;  1G9F A;  2BNM A;  2VTX A;  3PL0 A;  4K20 A;  5GLW A;  4ZPI A;  4Q4W 3;  3VDD A;  1YQ2 A;  1XYP A;  1W6Q B;  3AYC A;  3E5Q A;  4FFG A;  5FBJ A;  2LUW A;  1OD5 A;  4I01 A;  1UZV A;  3VBO B;  2XQX A;  4MLO A;  1UY3 A;  2MEV 1;  4FO9 A;  1LOG A;  1IS4 A;  2JDZ A;  4BXF A;  2OVU A;  3ZYG A;  1KS4 A;  2RS1 3;  1Y7B A;  3GZT B;  2C9A A;  5LAS A;  1LNS A;  3SEE A;  3KCC A;  1UOG A;  3EBR A;  3T2T A;  5FMO S;  5C3R A;  1NQJ A;  3NW4 A;  4QDR A;  1AYM 1;  3AJZ A;  4LXL A;  1JXN A;  4FTE A;  1AJO A;  1VBA 2;  3L2H A;  2WAO A;  4ZY9 A;  4CDQ A;  1U5Y A;  2KM2 A;  2ETE A;  3U10 A;  3VBU C;  5LA2 A;  3POJ A;  2H0V A;  3RWN A;  4MHR A;  4RHV 2;  3RNS A;  3WDW A;  1OH4 A;  4C1W A;  1H1M A;  1RJ8 A;  1G9B A;  2BGC A;  4WZF A;  3VKM A;  1XC6 A;  5FRE A;  5T5L A;  4E4D X;  2Z42 A;  4CXW A;  1MZE A;  3H7J A;  3MIC A;  2W5F A;  3JD7 2;  4GB3 2;  1EPW A;  4GMP 3;  4KWJ A;  4O61 A;  5F9T A;  3ACL A;  4IUG A;  3FWE A;  1H9W A;  3ENR A;  3KV5 A;  3VDB A;  1OF3 A;  1GOH A;  1JTZ X;  3SCH A;  1ZRR A;  2JIJ A;  3MLK A;  4JX0 A;  4FCA A;  2WO3 A;  2CTV A;  3SLI A;  3DN7 A;  4CDW C;  1SPP B;  3UK9 A;  1G8W A;  4J6G A;  5AVP A;  1MS1 A;  3AVR A;  1W3X A;  2RS5 2;  3H0O A;  4I02 A;  3WZ1 A;  3ZMN A;  4DUW A;  2PYT A;  3MIB A;  2JG8 C;  2WLP A;  4OI1 A;  3H8O A;  4KH9 A;  5E88 A;  1YNA A;  3ZX7 A;  3CZJ A;  1EV1 3;  3MIH A;  4YGE A;  3UL2 A;  5CVR A;  3MW2 A;  4UXA A;  5A33 A;  4RGA A;  4QPI C;  1KQR A;  1ULF A;  1OLR A;  2VL4 A;  3D6E A;  2IVJ A;  2E51 A;  2J1V A;  4M3C A;  1GLH A;  4Q5O A;  5C8C C;  3RYR A;  1J59 A;  1U5I A;  4MZU A;  4XFB A;  3LWC A;  3POG A;  1AJK A;  1OBN A;  3DXU A;  5A3O A;  1FMD 3;  1NLS A;  3DKQ A;  2W46 A;  2VZV A;  5FZ0 A;  1RUG 1;  3ZFG B;  1SLL A;  2VQ0 A;  1GWM A;  2WQZ C;  3WQB A;  3ZIX A;  5LA0 A;  1KDK A;  3D3A A;  5FY1 A;  3LD8 A;  4OI2 A;  4CCM A;  2IWG B;  1AR8 1;  1ND3 A;  2HWC 3;  2EAL A;  2JDY A;  3MO4 A;  1VIW B;  3GCX A;  4XMA A;  4W8J A;  5D8A C;  5EFU A;  4EZ4 A;  1RMU 2;  3POS A;  3AM2 A;  2HJI A;  3HEI A;  4N9H A;  2R16 A;  2OZ6 A;  3WW1 A;  4AI1 A;  4CXY A;  2CY6 A;  2GAU A;  3CJX A;  1FV3 A;  2SLI A;  3K46 A;  2WZP P;  4HAN A;  5CKM A;  1KEX A;  4YW7 A;  1CR7 A;  3NNF A;  4ISR A;  4NOT A;  2OZJ A;  1VMF A;  2WWJ A;  4N8M A;  4HN0 A;  3W59 A;  4C0H A;  3S7I A;  3ECQ A;  2QZ3 A;  5KR7 A;  1QMJ A;  1XND A;  3SQO A;  4AI2 A;  4YG0 A;  4RHV 3;  4IQP A;  4JQT A;  4ASM B;  1O3T A;  4LIU A;  4B8E A;  4LBK A;  3VN4 A;  4Q8L A;  4URA A;  4FBF A;  4MGY E;  5GZE A;  1G7Y A;  1QEX A;  2C6S A;  3LIG A;  5FZ3 A;  1PK6 B;  3R6S A;  3TN9 3;  2DFB A;  1REE A;  4WBB A;  4P02 B;  4DRV A;  3JD7 3;  2NPI A;  4GB3 3;  1D0G A;  1ZBE 2;  2GP5 A;  2JG9 B;  3E1F 1;  4PDW B;  1WCK A;  2CHH A;  1QKQ A;  5FJH A;  1FNZ A;  3JB8 A;  5JPN B;  2NN8 A;  3JUU A;  2VPV A;  5FPA A;  3GZE A;  5DZG A;  5C3O A;  5LBE A;  1AX2 A;  1IPK A;  4FFH A;  1Y4W A;  2IC1 A;  4QWN A;  4H3W A;  3JBG 2;  5T3N A;  2E31 A;  3PNA A;  4UW4 A;  1K3I A;  1VAV A;  1NY7 2;  1TME 3;  4DXT A;  1WKY A;  4JKL A;  1EYB A;  1NE6 A;  2GP3 A;  2JD9 A;  4KWU A;  3OBA A;  3K48 A;  4L92 A;  4RL7 A;  4P14 A;  3WF3 A;  3CF6 E;  3N9M A;  5D21 A;  4TLF A;  3I3M A;  5FBZ A;  1UL9 A;  5IT6 A;  3WNP A;  4XMI A;  2D3P A;  5IVY A;  4LHL A;  5FZE A;  1MS8 A;  4PLN A;  5KHH A;  2P4E A;  1RUD 3;  4ZZ5 A;  4D6Q A;  1ENX A;  3OPW A;  4KG0 A;  3AMH A;  1W05 A;  2C5D A;  1AR7 2;  4LHK A;  2P3K A;  4XTP A;  1PO1 1;  4HXC A;  2NMN A;  3ORJ A;  1A78 A;  4AGG A;  4XEZ A;  2ZX4 A;  1GZW A;  2Y0O A;  4R9C A;  3OGR A;  3VD3 A;  1K5J A;  1I3H A;  1JUI A;  2H6B A;  3U14 A;  1IKQ A;  3CHX A;  3MV0 1;  3DYP A;  5F3G A;  3URF A;  3VKN A;  4IEV A;  2FDF A;  3VLB B;  4IW3 A;  5AC9 2;  3QH6 A;  4HKO A;  4XFC A;  1DGL A;  1QJF A;  1UXX X;  5B4X A;  1UMZ A;  3KF5 A;  4YVS A;  4LOR A;  3WP6 A;  4E8D A;  4LHS A;  3THD A;  3KHB A;  4O65 A;  4A6S A;  1BKZ A;  4IEQ A;  4CDX A;  1WZX A;  2QQU A;  3NMB A;  5FY9 A;  2F4P A;  1AXZ A;  3SIT A;  2VUD A;  4GAL A;  4XF1 A;  5KXC A;  1FOD 1;  1VAM A;  4FPO B;  2YC2 A;  1V6O A;  5GLZ A;  4B4P A;  5A1L A;  4XVH A;  4ZXE A;  4LT5 A;  3KGZ A;  1LJ7 A;  1FAY A;  3LZZ A;  4NPM A;  1PMH X;  5A7P A;  1TME 1;  2BGO A;  1O4T A;  4GD4 A;  4DNY A;  4P9J A;  3CZU A;  1RYY A;  1AZD A;  1GIC A;  1WLT A;  2WT2 A;  5JOW A;  5EJ3 A;  2CGP A;  1BBT 2;  3B02 A;  5FY7 A;  1FOD 2;  4QQH A;  1STM A;  2J7M A;  5IVB A;  4ERO A;  4KBB A;  1AR8 2;  1K45 A;  3FC0 A;  3POE A;  1HB2 A;  3H1Y A;  4LKE A;  1EV1 1;  4MXV A;  4AHY A;  4PLO A;  1QH6 A;  3I2D A;  4KU8 A;  2YBS A;  5FY5 A;  2VW2 A;  3N9P A;  1DLC A;  2VVF A;  3M3O A;  4ATF A;  3P3N A;  1W8U A;  4ZXK A;  2R1D A;  1IHM A;  4FPK A;  2WJS A;  4UFK A;  2C1F A;  1N1S A;  1CZS A;  4PQ9 A;  1H1A A;  1OKQ A;  2V73 A;  4FOW A;  4YZ4 A;  1DF0 A;  4U2A A;  5BNP A;  1ENR A;  1COV 2;  1LCL A;  4ZU4 A;  1G9D A;  1AR6 3;  1BVP 1;  1SFN A;  4CUC A;  5FP9 A;  4P9I A;  5A32 B;  3VDC A;  5FZC A;  4MHU A;  5AFE A;  2GND A;  1DLL A;  4W65 A;  4XFH A;  4QHO A;  5FY8 A;  1Q56 A;  1PGW 1;  2RJ2 A;  1FPN 1;  2W0X A;  4UW5 A;  5LK7 B;  3VD9 A;  1QJY 1;  4MXW A;  2DFC A;  4HVQ A;  1HIX A;  3ES1 A;  4LIT A;  3OY8 A;  2PLV 1;  2J1T A;  1QJZ A;  3J4U H;  4RS5 B;  4HK8 A;  1RVF 3;  1AL2 3;  4MSV A;  5C33 A;  1PO2 3;  2EAA A;  2NP0 A;  5LB6 A;  2WKK A;  1T6B X;  4YW6 A;  4GH4 C;  1B35 C;  2HEY F;  3PUS A;  1WA4 A;  1YEW A;  3WNM A;  5ACA 3;  4FOV A;  3AYD A;  2VQT A;  4OYU A;  2WFP A;  2E53 A;  5FXX A;  2JEM A;  1U5Z A;  2J1U A;  3R4D B;  3EYP A;  4CUB A;  4SLI A;  5EPA A;  4DO0 A;  1AR7 1;  3I4I A;  3WNL A;  5I8S A;  1DGW A;  3QLQ A;  2VQU A;  3IM0 A;  4AYU A;  4GAZ A;  4AXO A;  3TNQ A;  3CJI C;  5C9A C;  3T0A A;  3OPT A;  3Q8E A;  4QGN A;  1SAC A;  2W1W A;  4COV A;  2X5I B;  4KNC A;  4DMI A;  1DYO A;  5E6H A;  4QQO A;  5F5A A;  4XJA A;  2D6P A;  3DYO A;  2FCV A;  3GXU A;  3T08 A;  2P2K A;  2XUM A;  2VH9 A;  1R1A 2;  2XXZ A;  4FOQ A;  2F17 A;  5FUP A;  3VBF A;  4AI9 A;  4BB3 A;  1DQ2 A;  2W52 A;  2OUH A;  1NY7 1;  5A3T A;  4HET A;  4R4X A;  4IER A;  2IXK A;  5AC9 1;  5J96 B;  4L9B A;  1DU3 D;  4XJ8 A;  3C3V A;  4Q4V 3;  1FPN 3;  1XRU A;  1V9U 2;  4CEW B;  5FZL A;  3ZFF A;  3CQO A;  1YLL A;  2EIE A;  4KGG A;  3UJQ A;  1R09 2;  2JIG A;  4XF3 A;  1YJL A;  1CAX A;  4LKD A;  4NRP A;  5FJK A;  3T30 A;  3KHC A;  4OQ8 A;  1OLQ A;  2DVD A;  4JGY A;  1LED A;  1C8M 2;  4I3P A;  3OTF A;  3LCP A;  3VZN A;  5A7W A;  2BW8 A;  3ZMO A;  1AR6 1;  1W6N A;  3O1O A;  4Y5S A;  1D2Q A;  2YPD A;  3BPS A;  3NST A;  3ES4 A;  3ON7 A;  5FOB B;  2JDA A;  4A2U A;  1Z7S 1;  2EA7 A;  3O1U A;  2QQP A;  4IV3 B;  4J25 A;  2DVG A;  4AQ6 A;  4OUM A;  3WNN A;  4EYU A;  1TMF 2;  5FZ1 A;  1YI7 A;  1AL2 2;  1SCR A;  5FP4 A;  3HN1 A;  3LA2 A;  4MV2 A;  2C4X A;  4BA6 A;  2FDJ A;  4V1P A;  3ZFE A;  4CUG A;  1M06 G;  5CAZ A;  3IMM A;  3FHQ A;  1UIK A;  4PBO A;  3ZSE A;  4M4R A;  4NIA A;  4GH4 B;  3OUI A;  4P5Y A;  1GU3 A;  1CAW A;  2Q5T A;  4C90 A;  3DPR A;  4GMP 0;  1QU0 A;  4AFB A;  5C8C A;  1SLA A;  1HRI 2;  4YPJ A;  5J09 A;  1YJK A;  3M8L A;  1SFP A;  3H1M A;  2BFU L;  4ES8 A;  1RGS A;  2X5I A;  1WLD A;  1V6K A;  3I2J A;  4N43 A;  5FUN A;  2WSU A;  2XVL A;  5FMD A;  5A1A A;  2GC2 A;  1ZRD A;  2PHU A;  3FHA A;  4DXS A;  4MGQ A;  1ZZ9 A;  1ND3 C;  2RS3 3;  4NID A;  4UBH A;  4Q4V 1;  4E8C A;  3GAL A;  4PCR A;  5J98 B;  4AFC A;  3MV1 1;  4SBV A;  4BJ0 A;  1RJ7 A;  2DVB A;  4BIO A;  5L19 A;  3UNP A;  4A42 A;  1LEN A;  4ZU5 A;  4V2V A;  4FPJ A;  4K7J A;  2HKX A;  3VD4 A;  2VZO A;  5BNN B;  5F3E A;  4YSF A;  4AEJ A;  1LKN A;  1QDO A;  1C8N A;  2ZBJ A;  1A34 A;  4RR3 C;  4RQP B;  2A3X A;  3FFZ A;  1XSR A;  5A3M A;  2FCU A;  1YQ6 A;  1RUI 2;  1A6C A;  3OOX A;  1J84 A;  4L11 A;  2QBX A;  3LF7 A;  1EAH 3;  4LBJ A;  3ILR A;  3WF4 A;  5A32 A;  3CL1 A;  2GAL A;  3B01 A;  3MPP G;  3OPZ A;  4NRM A;  1NAE A;  5E1R A;  4B4Q A;  4LR4 A;  5IHR A;  3RZL A;  1F5F A;  3FJS A;  1RUF 2;  3KB5 A;  3RI9 A;  4PI0 A;  2VEC A;  2EXH A;  2J1R A;  2ARC A;  4FPC A;  3WDX A;  4AVA A;  2D5H A;  4FQ4 A;  5E8A A;  3AZW A;  1LGN A;  4YW5 A;  2P1B A;  2RDN A;  4ATE A;  1VRH 2;  1CAW B;  3WX5 A;  5JPM B;  3I2F A;  3VBS C;  3VDD C;  1VMJ A;  2PQS A;  2XHN A;  3H8U A;  1DBN A;  1W9F A;  4TLG A;  5GZF A;  4HBN A;  3RMX A;  1VRB A;  4JKM A;  1YHF A;  4FSJ A;  4QHB A;  4I2O A;  3HN3 A;  2RS1 2;  4KMQ A;  4ZHN A;  4ZON A;  2YV8 A;  4IXL A;  1GOG A;  1BEV 1;  1DYK A;  2R07 2;  3MFA A;  3WP3 A;  3AJY A;  2VR4 A;  5FQ0 B;  3OUJ A;  2ZKN A;  2ORX A;  5GLU A;  1QIQ A;  2V4V A;  4WV8 A;  1H9P A;  3DKW A;  2IXI A;  5JI9 A;  4CCC A;  3PHM A;  2V5Y A;  3ZLI A;  4BQ3 A;  3UV9 A;  2D3S A;  1OPO A;  4KG8 A;  5HCB A;  3T09 A;  1Y9G A;  2N7G A;  1UIJ A;  3WG2 A;  4W50 A;  5JCT A;  1W0N A;  4JVA A;  3M4F A;  2WL1 A;  2XON A;  3AP5 A;  4UYB A;  3BOW A;  4M3C F;  1PZ9 A;  2Y0I A;  4EQV A;  2FDI A;  2BEO A;  4Z2W A;  5JMC A;  1UWW A;  2ATF A;  2EXI A;  2VZQ A;  3ZN5 A;  2WO2 A;  2XBO 1;  1W2U A;  3ZFF B;  2RMU 2;  5FP7 A;  4LKF A;  3NQH A;  1O3Q A;  2IUW A;  3ZXD A;  4CEY B;  2LM3 A;  1UY0 A;  2VBD A;  2OPK A;  1RUG 3;  2DVF A;  2VOX A;  5BNO A;  2X53 S;  3HNY M;  4RSU A;  5KBF A;  3OEA A;  1W2N A;  1YIP A;  2ZHM A;  3VBR A;  3ZXJ A;  1HN1 A;  5FPL A;  5FYH A;  5FRA A;  2UYB A;  4XXP A;  5T52 A;  1NA1 A;  1Y9Q A;  4XC9 A;  4AAX A;  2Y8K A;  4CEW A;  4CXX A;  3M1H A;  1UAI A;  4EN6 B;  5DAB A;  3GBG A;  1GQG A;  1SG3 A;  3RZH A;  2R7E B;  1BK0 A;  3KCY A;  2PA7 A;  5FAX A;  2HEV F;  1RUF 3;  4E4S A;  4OVE A;  4E2Q A;  1ZA7 A;  3M3C A;  4TZD A;  1JHN A;  2LRO A;  4RQP C;  4TWT A;  3RSJ A;  5FYU A;  3VB9 A;  2VUJ A;  4I3G A; 
#chains in the Genus database with same CATH homology
 4QKB A;  3BIE A;  3H8O A;  4ZS3 A;  2FDH A;  3I49 A;  2FDG A;  4NID A;  4NIG A;  2FDJ A;  3BI3 A;  2FDK A;  4CXY A;  5F8P A;  2IUW A;  3KHB A;  4NRO A;  3I2O A;  3O1S A;  4NRM A;  4MG2 A;  3BUC A;  4IE4 A;  3O1M A;  3RZL A;  3RZK A;  3O1T A;  3LFM A;  3BU0 A;  3RZJ A;  3BTZ A;  4ZS2 A;  4NII A;  3T4V A;  4NRP A;  4QKD A;  3KHC A;  4IE7 A;  4MGT A;  4CXW A;  4QKF A;  4NRQ A;  3T3Y A;  3RZG A;  3O1R A;  4O61 A;  4NIH A;  4NPM A;  4CXX A;  4O7X A;  5DAB A;  3O1O A;  3BTY A;  3T4H B;  3BTX A;  3H8X A;  3BKZ A;  3RZH A;  3S57 A;  4QKN A;  4OCT A;  2FD8 A;  4JHT A;  3I3Q A;  3O1V A;  4NJ4 A;  4NPL A;  2FDI A;  4IE6 A;  3O1U A;  4RFR B;  2FDF A;  3I3M A;  4IE0 A;  4QHO A;  4IE5 A;  4IDZ A;  3RZM A;  3H8R A;  4ZHN A;  3S5A A;  3O1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...