2FDGA

Crystal structure of alkb in complex with fe(ii), succinate, and methylated trinucleotide t-mea-t
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
199
structure length
199
Chain Sequence
b'LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*TP*(MA7)P*T)-3'
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase/dna
total genus 49
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdgA00
3I49A 3O1UA 4ZS2A 3KHCA 2FD8A 3BTZA 3I3QA 3O1RA 3O1SA 3BKZA 4ZS3A 4NRMA 3BTYA 3O1TA 3I3MA 3I2OA 4IE6A 4NPLA 3RZHA 3O1MA 4QKNA 4MG2A 3RZMA 4RFRB 3BUCA 2FDFA 4NIGA 2FDKA 4NRQA 4IE4A 4QKFA 4NIHA 4NRPA 3T4HB 4O61A 4QKBA 3BTXA 4OCTA 3T4VA 4IE7A 3BU0A 3O1VA 3O1PA 5DABA 3RZJA 3RZGA 4IE0A 2IUWA 4NPMA 2FDIA 5F8PA 4QKDA 4O7XA 3RZKA 4NIDA 3S5AA 3LFMA 3RZLA 3H8OA 4CXWA 4ZHNA 2FDHA 4QHOA 2FDJA 4CXXA 4JHTA 3BI3A 3S57A 3H8RA 4CXYA 3O1OA 3H8XA 4NROA 3KHBA 2FDGA 4NJ4A 4MGTA 4IDZA 4NIIA 3T3YA 3BIEA 4IE5A
chains in the Genus database with same CATH superfamily
2VUAA 2RJ2A 3GYDA 3JD72 1YQ6A 3O12A 4LUMA 2YXSA 3I49A 5T3NA 3BOPA 4ZU7A 1U5YA 1UU5A 4UW6A 5FBZA 3FFQA 4LKFA 4JC1A 5AVPA 5HCHA 5ABJB 1XU1A 3VBSB 5A3NA 2DWRA 3I8TA 3AFKA 4OFGA 5FPAA 4BQWA 1OLQA 2ZHMA 3AMHA 1W3XA 2FMYA 3IKWA 3USSA 3BVCA 2QJVA 1RUF2 2AGSA 4QM9A 1H8TB 2NLRA 2DUOA 2BJSA 3R4UA 5FO7B 3DPRC 2D6LX 2J22A 1R1ZA 2P17A 4FPKA 1X8MA 5C8WA 2IXCA 1OLMA 2W1UA 1XNTA 4OHXA 4Y33A 3BUCA 2Z69A 2QQVA 4N53C 4MYEA 2VZSA 3MUY1 4XF4A 3VKMA 2XQXA 5GZGA 4AQTA 2AR6A 5KXCA 2FDKA 1S2EA 5GLWA 2WWJA 3TRSB 5T5JA 3VBRA 2RR12 5BNOB 2YPDA 4CA9A 5KWRA 4MH0E 5A1AA 2OQ7A 1UXXX 4AYUA 4O61A 5IW0A 2W9XA 4ZXEA 4FPFA 4UF0B 5HCBA 4ZXKA 3FL7A 4L99A 1D2QA 3TEZA 2D43A 2QQMA 1RUH1 3GM8A 5FZLA 5CIRA 2HEYF 1V6IA 1ZNPA 1PZ9A 4YG6A 1PIV2 3THCA 3ZMOA 5A6QA 2ZGNA 3S0MA 4XURA 1C57A 4KNCA 5BNQA 3OOXA 1SBFA 1DYPA 3ST7A 1QU0A 1CJPA 1V00A 1ZZ7A 2VOXA 2DV9A 3D0JA 4CP9A 3JB4C 5FMOL 2CAVA 1VBC3 1MEC2 1X7NA 4XC9A 3B7MA 4AHYA 5IAVA 3ITQA 3ZSJA 1DZQA 2RDRA 1CX4A 3KGLA 4ARYA 3MIDA 3K51A 5FXXA 4BQ5A 2XKOA 2F6BA 3SQOA 4YRDA 1JBCA 3H8OA 3ZDSA 3K4ZA 5CB7A 4XJAA 3DUIA 2VCAA 4QHZA 4EN7B 3F95A 3J7NA 1C8NA 4Z82A 4YVWB 1OT5A 2VMDA 3EHKA 3J7HA 1W0NA 2WFPA 4HG6B 5H9RA 3DXTA 1RMU1 1PK6C 2D44A 3H1WA 3H42B 1RUJ3 4JGYC 3MIHA 3AM2A 2HWE2 1W2NA 2Y0OA 3GHNA 1ZBA3 3CBNA 5DZFA 4P9JA 2QZ3A 5AFBA 1AR82 3KVBA 2QQNA 5FLHA 4N7UA 1YQCA 1HB3A 2HLEA 5I0TA 1IKQA 4A3XA 4XQ4A 5C7GA 1VAVA 2DF7A 1Z7S1 2F4PA 3IDEA 2Q30A 1RUI3 2GN3A 2MNGA 1UMIA 4EYUA 5I8YA 3F2ZA 5LBEA 1JZ2A 2ZXQA 4AXOA 3B93A 1VAMA 4KG0A 2BZDA 3U10A 5GKAC 1VBD1 1S2KA 4HZFA 3VDDA 2DBNA 5ACA2 2VM9A 1J3QA 2VZQA 2CTVA 3CNAA 1MVEA 3H8UA 5FPBA 3VBUA 4A41A 2D3RA 4P02B 1YI9A 3KQRA 4HOOA 2C9AA 4QU2A 2PLV1 2VNOA 3BTAA 1D4VB 2VR4A 1YYNA 2ZOEB 2YV8A 1BEV3 3O1RA 2WS91 4BYYA 1W2AX 2R063 4MGZE 4QPIA 1J3RA 4HLTA 4Y1VA 2VGDA 4UOJA 1I3HA 1ULCA 1WLWA 3NKTA 1RHI2 5FPLA 3ZYJB 2ZAAA 4DEVA 1BYHA 2HEWF 2W0XA 3PMEA 2VOTA 2PYTA 5HXVA 5KHHA 4U36A 1W8FA 1UN1A 5F2WA 4RN5A 1SLIA 1GWMA 4WV8A 1LHNA 2RMU2 3P5BA 1OKQA 1YHFA 3ZYIB 2LALA 2ZZQA 5JUVA 3TEWA 4PIYA 1CGPA 4RHV3 3UKVA 1AR72 4IEVA 4XAAA 1IG3A 1PNGA 3KD4A 3WF3A 3RFRA 3OF1A 4COWA 1PHMA 2HWC3 5IVJA 3JZVA 2UYAA 3M2MA 4Q27A 3ZIXA 4CU9A 1VRBA 2NYYA 3PVBB 4LXLA 1RUG3 2VMCA 4J1XA 5BNNC 2GC0A 4M01A 4XMIA 2DUPA 3MZHA 2D3PA 3BU7A 3T4VA 3ZXJA 1OHFA 2R32A 2A6VA 3JD73 3NAPC 5DAQA 1NY71 4AZZA 1LHWA 3IMNA 4KWLA 5JOWA 4BWOA 1G7YA 4XVHA 5CG8A 1LODA 4XFIA 1YIPA 4NHKA 3RZJA 4FFGA 1NZIA 2HWD1 2Y6KA 5DUWA 3KF5A 1C5HA 2ZGLA 4GULA 1CAUA 1RUC1 5JZGC 1O6UA 3VBOA 5C70A 3L2HA 4OZOA 5FZIA 2ZJCA 3VBRB 3GNEA 1IS6A 2UWBA 4Q4W2 1REEA 2P6HA 2JICA 2JE8A 3EJKA 3UJQA 1AL21 4CCLA 4ZZ8A 2D5HA 1WBLA 5A7WA 1SPPA 2VMFA 1UNBA 3J7MA 4G9SB 1S0BA 3H3ZA 5JSPA 2Q5TA 4GKYA 3WNKA 1RUOA 1OUSA 4BM8A 3N7LA 5CKQA 4SBVA 2C6SA 1W8WA 3GALA 1UMHA 2ARXA 3PNAA 4KGQA 5LA2A 2FDHA 1SEFA 2RR13 2VNVA 2VE1A 1W0OA 2CGOA 2E32A 2XL9A 3HJRA 3O0WA 4Y3OA 5LK7B 1OFNA 4CDQA 1NCRC 1WCSA 3PUAA 1B35C 4CP9B 1VE0A 2VD7A 1W06A 2VZUA 1QJY2 3ELNA 4FFHA 5CNAA 4COZA 3IPVA 1RTVA 1PIV3 4I30A 5FP4A 2VZRA 4E4ZA 4BQ4A 3CZJA 2ID4A 1JN2P 4V2WA 2A1XA 2ZX2A 3ZFGC 2FDGA 4CCJA 1PX3A 4IEXA 1US3A 2GH8A 3UT0A 1MZEA 2JDPA 5DUVA 4ES9A 3RMYA 1ND3C 2D40A 4E4DX 1WZXA 4A6SA 2GALA 4OUMA 4E2GA 5EJ3A 4DRVA 1MEC3 2G4IA 2PQQA 2WC2A 2WZEA 2WO7A 2CYFA 4QQOA 1FATA 1EP0A 1GUIA 2JDNA 4GJZA 1JH5A 5FY4A 3NNJA 1NLSA 4CCMA 5CISA 5CG9A 2AEYA 5FYSA 2YGLA 3I3QA 1R1A1 3J8F2 2IVJA 3LEGA 2QQUA 5GM0A 1A78A 2MEV2 1NYWA 2EIDA 2LRPA 2WYSA 1VJ2A 3DYOA 1IS4A 1UYXA 1IHMA 2JDAA 4LE4A 3WW3A 5L9VA 5GALA 3SKVA 4D3WA 2XG3A 3I3EA 4D6QA 1ZRCA 3JB8A 4AQSA 3V0AB 5K0UC 1H30A 2HYKA 4X8NA 3W20A 4A4AA 4CPBA 4CEWC 2HWE3 1W99A 2Y6LA 3VBHC 2YGMA 1DHKB 1MS1A 4JAAA 4XJ8A 4B8EA 4CDXA 1GU3A 3FBMA 4MXVA 5JXHA 3VBUB 5LA9A 2JEMA 4Q4X1 1WLCA 4JGZC 2VAUA 4QPGC 4WVVA 4AHXA 1NLQA 5A3PA 1A3KA 2FQPA 2E7QA 1SLLA 4AEMA 1SQ4A 2QQWA 1V9U1 1R083 2JXAA 1E5HA 5T5OA 5FAXA 1UZZA 2D6PA 2OYZA 4QPIB 3T2PA 4AVSA 1LB2A 4K3UA 2QDRA 5ACA3 1DYKA 4LIVA 1ULGA 3C7GA 5F2SA 3URFA 3LSDA 4MXWB 4AFAA 3AKTA 3HBZA 3AK0A 3AP4A 5E88A 4B7EA 1X9PA 2I07B 4OI2A 5D8AA 3LPFA 4HVOA 1AYN2 1ZRDA 4WVWA 4DXZA 2JDUA 3FFZA 1YI7A 2PHFA 2RHPA 5GZCA 1OVSA 1O7FA 1O91A 3KV5A 4RS5B 1LNSA 5ABJC 1D7PM 2CDOA 2P3YA 1WMXA 3VBSC 3VZKA 1IOAA 2D6NA 1UX7A 1HV0A 3B02A 3S5QA 3OBTA 4XOGA 1RHI3 1Q5OA 1S0IA 2DURA 2X10A 2P5BA 1XSQA 2PHUA 2EF6A 2A7AA 1H8TC 1BXHA 1WLDA 1KS5A 2RMU3 1DLLA 5FYTA 4R9BA 3LIHA 2RS12 2W1QA 4JDMA 4BZ4A 2BWAA 4OVEA 2EA7A 3TWIA 3SXWA 2RS52 2QVSB 5BNOC 4BISA 4HKWA 2D6KA 4BU2A 2ORZA 4JHTA 1MZ6A 1ULEA 1NCQA 2HWD3 2QDNA 1L7RA 1D2SA 5EZWA 2Y64A 5KHJA 4R8HA 3VBOB 3VKNA 3Q8BA 5E89A 5JI7A 3MICA 3N9QA 2JIJA 4COYA 1AYM2 4FPGA 4DUWA 4NOTA 4QT6A 5A7WB 1R64A 1SPPB 1QJU1 4XUOA 4K1YA 1AL23 4XJ9A 5IUQA 3RGBA 2XXZA 1ZM1A 1H9PA 4NIIA 2VZVA 1LEDA 5F9TA 2IXJA 3NQHA 1LRHA 2WT2A 4URAA 1H4HA 3WNLA 1AVBA 2VC9A 3OUIA 2DCZA 4PCRA 3OEAA 4CYDA 1JODA 4PLOA 4XCAA 3O14A 2IXKA 3WSOA 2Y60A 2BNMA 4E8DA 3B3QE 3BTZA 4N53B 1CVNA 1LJ7A 3T2TA 1EV13 4CDQB 1SBEA 2EICA 2X53S 4Q0QA 3AYDA 3M70A 2Q8DA 2ADDA 4IGPA 4XACA 4XF9A 2B7YA 3OG2A 3D8CA 1QJFA 1UL9A 3WOGA 1UU4A 5FP7A 4YM1A 3IPVB 4NMIA 3WINE 5FUIA 5FZKA 4UYBA 4D69A 4YVWC 4V2VA 2VVDA 2R071 3M8LA 1H8VA 5CKNA 2VVFA 3JQXA 1AX2A 3WD5A 4YZ3A 2BU9A 5JWPA 1O5UA 4UFIA 3HPNA 4MG2A 2FCVA 2XOMA 2WA4A 3N36A 4BMEA 2W46A 4CDWA 2B9UA 3TN92 4OI1A 1QJY3 4E4HA 2NPIA 5LBCA 5FY8A 4K7JA 4DUXA 1YJLA 2BERA 1LR5A 4AI1A 1UY0A 4C1XA 4L92A 1WMDA 4K21A 5LA0A 3LQCA 3WW1A 4AOCA 4Y1XA 2ARAA 2UU8A 3J4UH 5F3GA 3VHOA 5DPNA 5FY5A 2PHRA 1HXS2 3LA7A 3VDCA 5FZBA 3VL9A 1TMF2 3WT3A 4UFMA 1TQ5A 4IE7A 3VZOA 3WG1A 5FYVA 4C0BA 4W8JA 1REDA 5I8SA 2GNBA 1V0AA 2VL4A 5C3OA 4GXLA 1NZCA 3U75A 3J8F3 1E5SA 2NMNA 2VG9A 5J98B 4CDXB 2MEV3 4MHRA 2C24A 1YFWA 2WAOA 3V64A 4S2HA 2FDIA 2LS6A 3WNNA 3E5QA 4P9YA 2E7TA 3N9NA 2UY9A 2WZR1 2E7AA 5F5IA 1PO12 1PGW1 1CAXA 2JKXA 1BK0A 2ZEWA 1XXNA 2JX9A 1HRI1 1EY2A 1UY4A 4P5YA 2D98A 3LA3A 3V0AA 1I1EA 2ZTNA 5LW9A 5D21A 3PLQA 3PL0A 4LBMA 5DZEA 1VBB2 1LOFA 3LSEA 3NNGA 4QB2A 3USUA 3K77A 3UJOA 3HAGA 3AKRA 5LA1A 5I8TA 3C2UA 1FOD1 1HKDA 4H2AA 1LGBA 5JOXA 5D8AB 1K42A 1BBT1 2J1RA 5IVYA 4YW6A 3VKLA 5IVBA 4XBQA 1O4TA 2FZ1A 3ZFEA 4FTSA 3ASIA 2Y26A 3GGLA 1J3PA 4XILA 4GWIA 5IYYA 2E63A 2ZBJA 3CDZB 2FBEA 2J1TA 3M4FA 1DBNA 4NROA 3FLPA 2YBKA 4PJYA 1GZ9A 4IESA 4UW3A 4Y1UA 1OD5A 1TEIA 2ZHKA 5FQ0A 5FPUA 3ZSKA 2WR9A 1KDMA 4CE8A 1V6KA 1PVC1 1YO8A 1S0EA 3K2OA 2RDQA 1VALA 1SDDB 4D94A 4MZUA 1I5ZA 1V70A 5FP9A 2HJIA 5A3MA 1Y9GA 3ZN6A 1PO21 3N3HA 3NV3A 1US2A 3N7MA 4IW3A 4HK9A 4ZS2A 3VBRC 3Q9OA 4KBZA 3D3AA 4LT5A 3SISA 3GDBA 1XSRA 3MV11 4QGLA 4BCUA 1NCQB 4YZ2A 3P1IA 4NRMA 3HMYA 5FYBA 2Q1MA 4L9BA 1FMD2 1NUKA 2RS13 2AC1A 4JKKA 4V1PA 5FBJA 1HRV2 3OB8A 2W1WA 2EAKA 3WV6A 4GA9A 2VECA 2XUEA 2HWB1 4OMDA 4Y5SA 4DPNA 4OUEA 1DIWA 4A7YA 1OI6A 2RS53 5BNNB 2PFWA 3A22A 2ETEA 5T55A 2GMPA 1UY3A 2PQSA 4LK6A 1H4GA 1NAEA 4I3PA 3ZFFA 5FUNA 5FPXA 5EYYA 1JZ6A 1MS0A 2G19A 1NX9A 5T5LA 4ZY9A 1W3VA 4WZFA 1Z78A 1VR3A 2JG9A 4E8CA 1U5IA 3AP5A 4R9CA 5DUUA 2WINB 3POYA 5FXVA 5L7OA 3K4DA 4KI5M 4NHMA 1C8M1 5CFCA 1D4M2 4AK3A 4E2QA 1Q8QA 2XVGA 5F39A 4G4FA 4PIXA 2A71A 2V72A 2ZMKA 3MW2A 1KDKA 2ZGTA 3WP4A 1VBC2 5GZEA 3ZIWA 1QHDA 4PBOA 1SLAA 2BDRA 2XBO1 5FZFA 5A32B 4Q4V2 4Q4Y2 1XRUA 2VCCA 4OI0A 3LIGA 5DG1A 3NJYA 4Y22B 5C33A 1JHJA 4BDVB 1LHVA 4FQ4A 3A4UA 5DDJ2 3H0OA 4JDNA 1O3SA 2J1AA 1OA2A 4IE0A 3R4DB 4RA0A 3UK9A 4CDWB 4XUTA 5JDBA 3KT7A 1PNFA 1H2NA 2EIGA 1JYXA 1Q8PA 3POJA 1FPN2 1F8VA 1NCRB 1RUJ2 4UT5A 3TNQA 1FX5A 3WR0A 4QGNA 4RYDA 1AZDA 4AFMA 2XB6C 2R16A 4I01A 1N47A 2VMHA 2LTNA 1UOJA 5FO9B 1FNYA 1AX0A 4QQ2A 1EYBA 2ZGOA 5A1LA 2I74A 3TN93 3VDDC 4COUA 4MGYE 5FYHA 1GV9A 1J58A 2CGNA 3NRUA 1IKPA 3T08A 3VBUC 2PHXA 1QJX1 1O59A 1DGWX 2RM21 3POSA 3T1MA 5IATA 4FI9A 5J09A 3OPZA 3FBYA 5HXMA 4PQQA 3SNMA 1H1IA 2JB4A 4DNYA 5A80A 5FR3A 1W6OA 1PZ8A 5G04L 4BXSV 4QPIC 3WP6A 3H8RA 1HXS3 3BIWE 3WNXA 2C0ZA 4YW3A 2TBVA 1VMJA 1TMF3 4YW1A 3SEEA 1CAXB 1JOPA 1TZOA 4Y5Z0 1O3RA 4XHBA 5K4LA 4A2UA 2DVGA 4KG8A 2D6OX 1EUTA 1VBA1 4XFGA 4EZ4A 5FDBA 2G1MA 4URTA 5C3RA 2A6WA 3KGZA 4OULA 2RS31 1HQLA 5EFUA 1VB4A 2DVBA 4XYXA 2NN8A 3AL6A 1HB4A 3USUB 3LZZA 2R041 4BXFA 2QCSB 2YC0A 4IE5A 1J83A 4Q0VA 3R0RA 1JMUB 4YG0A 1QXRA 2VNRA 3RWKX 3ZR5A 5B4NA 1PO13 3POGA 5A7NA 1GLHA 2VOWA 2WLQA 1JZ8A 1GZWA 1OQ1A 3MHZA 4IUGA 1KD7A 4Y4YA 4HPKB 1QJEA 4QQLA 5FPVA 2ZHLA 1ENXA 4DRRA 2Y38A 2XWJB 4ZS3A 2EXIA 1VBB3 4PQ9A 4QX0A 2BGOA 5CU1A 3GHMA 2HWC2 3O1TA 2XLGA 3I2OA 1WW5A 3KVAA 2DUQA 4TXWA 4CCCA 3IWZA 1X50A 2WQZC 1QOOA 3QH6A 4N90A 1IS5A 1ODMA 1FV2A 1P8JA 1RUG2 1XE0A 2Q0AA 3KV9A 4XJWA 5FQ0B 2BVVA 1CWPA 1A34A 5DUXA 3PVNA 3PUHA 2G9FA 2X05A 4AVTA 3FE5A 5FRAA 4Y5TA 3EB7A 1GOHA 1QKQA 2IZWA 3WP3A 3WY6A 4NR1A 3VBOC 1OUXA 3ZN6B 1W9YA 1ALYA 3P6BA 4CU6A 3RJ2X 2OPWA 4RGAA 1V6OA 2LW8A 4XTMA 2HKXA 4QPYA 4RR3A 1O8PA 2VMGA 3OD0A 3R4SA 4N9HA 5HCFA 4HBNA 1RGSA 4HETA 2ZEXA 4LORA 2J42A 1BQPA 3RMXA 2W95A 3ILFA 5GZDA 4P9XA 4FPJA 1UO9A 2XVKA 4GMP0 4WZCA 1SFPA 2CNAA 2WT1A 1QQP1 1UXZA 2XWBB 1AL0G 3GBWA 2HWB3 4UW5A 4K9SA 2Z79A 1F4AA 2ILMA 4P9GA 4ZPIA 5A3WA 4ATEA 4BB3A 3VB9A 3VKOA 3JQWA 5J48A 3MO4A 4LBQB 3WW4A 2ZX0A 1ZBE1 3C7FA 3ZFFB 4CDQC 5C5UA 1RUH2 1W8UA 4LBKA 2BBAA 2DBIA 4UI9L 3N9LA 5C3SA 2JG9B 4OHYA 1FMD3 2GU9A 2ET1A 1HRV3 2VW0A 5FZDA 5L7OB 2DFBA 1S0CA 3U11A 2PAEA 5GLTA 3ZXGA 2Y6GA 4LLOA 3ACFA 2EXKA 4XZUG 2W91A 4LKEA 1C8M3 3CEWA 4DOUA 1Q56A 4LHSA 4UBHA 4XJUA 3RPQA 5JXIA 4XW3A 4AR2A 2BVBA 1Q8OA 4KU7A 1XNBA 2XBO3 4N9IA 5IVFA 3H1MA 2GP3A 4JHZA 2HWF1 1N1YA 1Y3TA 5BNPA 5F7UA 1FV3A 1F4HA 1QEXA 5FIXA 5CAZA 4CP0A 1EUUA 4IEUA 4AGRA 3NJXA 1D4M3 4EN6B 3AMQA 1UZVA 3AP7A 1RJ7A 3MLKA 1Y43B 3VHPA 2P3JA 1V6JA 4CRQA 5F1RA 3KM5A 3T0AA 2C1FA 4JKMA 1MS4A 5JOYA 3IDBB 3H3UA 4F83A 4IERA 4Q4V3 4Q4Y3 2WNVA 2VOKA 4BMBA 1CPNA 1RMU2 5K8SA 1BVP1 3WQ1A 3B9IA 1H9WA 1POV3 2XLAA 5DDJ3 4PBPA 3AB0A 3G6JB 3W21A 3HN1A 4JZRA 1CIYA 4MVTA 4MX3A 2P3KA 3IAPA 4CDXC 3M1HA 1G6NA 2X5IA 2Q1FA 4D6RA 2EIEA 1MQTA 1W8OA 1NT0A 1XPWA 5IJRA 4LBLA 1GWLA 1Z7S2 1CAWA 1FPN3 4QQHA 3RSJA 2Z2SB 2OW4A 2JB8A 1QJX3 3NW4A 3LFIA 2VY0A 4W6YA 1RXGA 2HBTA 1TVGA 3MIGA 1W6OB 1VMHA 1CR7A 1VBD2 4XQDA 5K7PA 3KCCA 3N35A 4MGKE 4Q2FA 2B45X 2BOJA 4INDA 4Q8KA 2QTWB 4AEDA 3FHIB 3ZSLA 4TYSA 1XQNA 2VTFA 2H0VA 1BCXA 1D0HA 1G9CA 2PLV2 2YB7A 2A70A 5FZMA 3JBG3 5HI0A 3BOWA 1R082 4H3WA 2Y6HA 5D8AC 1GQPA 2ZEYA 4XDOA 4AWDA 1VBA3 4LIUA 3GBGA 2WS92 3T2OA 3UGFA 2XL7A 3NJZA 1XNKA 4HXCA 1PZ7A 5A70A 2RS33 4A7KA 4BK4A 1L3JA 3FJSA 5IK5A 1OLME 2A75A 3POBA 5JCTA 3KV4A 1RUD1 4GMP1 1KS4A 1J1TA 2YZ4A 1GOGA 2PA7A 1GZWB 1G8WA 1QJZA 2K2SA 3GZTB 1WWYA 3NNLA 3T4HB 4FQZA 3M3EA 2E6VA 1LU1A 3BPSA 5LBBA 3SCFA 5I0SA 1NQDA 4AVCA 3T30A 4TTGA 2NP0A 1XU2A 1AUYA 2W1SA 4OHVA 3O7OA 1JS9A 1BZWA 3VD9A 2VJXA 5FWJA 1CZVA 3LE0A 2DYCA 4LMFA 3KSCA 3QOPA 3AP9A 4LKSA 1YWKA 4FBFA 1IQDC 1PM4A 1VIWB 4AAPA 5DABA 3RZGA 1VP6A 3AYEA 1XNAA 5JSRA 3DV8A 4PI2A 2IUWA 4Q1RA 1NCQC 2JD4A 1VPHA 3VZNA 5DAWA 1KITA 2XJPA 3UNPA 1NG0A 1UY2A 4QKDA 3CIHA 4LOSA 4LHLA 1NE6A 5EIYB 1WMEA 2P2KA 1MZFA 2GZWA 1V6MA 4FPLA 2PMWB 3ALQA 3I2HA 3KCXA 4RR3B 1UOBA 2HWD2 4EV0A 1T6BX 1GR3A 1LECA 2Q1ZB 1GWKA 3FZ3A 4W6XA 1W6NA 1RUC2 1QF3A 1E57A 1W03A 2A5ZA 4LQRA 3RVHA 3MIFA 4KH9A 1FXZA 4F3JA 1I9RA 1STMA 1OMIA 5H9PA 5CEHA 3AP6A 1IG0A 3MF6A 3HNYM 5HBAA 1DQ2A 4FOQA 1QQP3 2R6QA 4XCBA 1AL22 3VGIA 4NO4A 1DYOA 3POIA 1SACA 3DXUA 2VZ1A 2SLIA 4HSLA 5FLJA 4X6QB 1RITA 2OIIA 4WM8A 1ZBE3 5CBLA 2GNDA 3S30A 5FZGA 1COV1 3S57A 1L7LA 1HV1A 1CD3G 1RVF1 2ZGQA 3O1OA 1BLZA 2VW1A 3P3NA 1R091 3AYAA 1O8SA 1UIKA 1H0BA 1EV12 4B7KA 1W9TA 3RQ0A 3ACLA 3HEIA 3WNMA 5LCWL 4MGSA 2EVXA 1F31A 4X6RB 1RUH3 2TNFA 3HBKA 4XETA 1ZZ8A 4CDWC 1RUNA 1ENQA 2AYHA 2XVLA 3NO8A 3OGGA 4DO0A 2H6BA 5BNPB 3ZPYA 4QX7A 1DLCA 5FKBA 5FYMA 4C90A 2W47A 1UCXA 4YM0A 1ENSA 2X8KA 4UFKA 1O3TA 3BKZA 2CWMA 4JTOA 1DQ0A 1DZTA 2VQ0A 1H6YA 2VZ3A 5ERLA 5AFEA 2WNVB 2BEOA 2JENA 1HJFA 1TME1 3LPGA 4YARA 5JXGA 4YZ4A 4LO4B 4YW7A 4AHZA 3O1MA 5J1XA 2A3WA 1R1A2 1OH4A 2ZACA 3PHMA 5GLUA 3MDPA 3WLUA 3UGGA 2Y0IA 1WCQA 1LOBA 4ORFA 4AI2A 2X5IB 3BODA 1GQHA 3NJVA 1MQTB 4LO8A 2JG8A 3OGSA 1CAWB 3HWJA 3CMGA 1RMU3 3FN9A 4CCOA 1ASJ1 4XXAA 2GNTA 3DKQA 5AVAA 1S4CA 2AACA 4RQPA 1LOAA 3GZAA 4YGBA 1WA6X 1UPIA 4RGKA 2WQ4A 1JU3A 4JCKA 1JYCA 3W9AA 1CIWA 4NHXA 3THDA 4AEDB 5L19A 4ISRA 4Q4X2 1LOFC 3LF7A 2F17A 4Q5OA 4ASLA 3AZZA 5I91A 4D7YA 2K46A 5HV0A 1QGLA 3ENRA 3Q8FA 4XJZA 1Z7S3 1WA4A 5IAXA 2WFF1 2E31A 1V9U2 1OD3A 2Z42A 2QUOA 3VDDB 3A23A 3ZFEC 1VBD3 2XONA 4XFCA 1VBE1 1LEMA 5A7SA 3IM0A 3KCYA 2DCTA 2J7MA 4S2DA 2PTMA 3C3VA 3T1LA 2OT7A 3UKTA 1C5IA 2PLV3 3S5AA 1U5ZA 5IHRA 1OPOA 4DS0A 5AC91 3JU9A 1RJ8A 1JYNA 4HFSA 2HBUA 4DEQA 2WS93 2ZMLA 4Z92B 4GALA 4JDOA 1DQ6A 5JPMB 1YFUA 5FZ8A 1QNWA 4ITCA 2ZABA 1JXNA 5FXZA 2A3XA 5FYCA 2MHFA 3S7EA 1UWWA 4QD2A 4ZHNA 2V5DA 5C5TA 2YC2A 4XUQA 1WW4A 4CSWA 2ZHNA 3SKJE 5APAA 4EE2A 2PHDA 5JMOA 4R4ZA 2RJKA 4B4RA 3VZLA 2YUEA 4UFHA 2WSVA 1LESA 4GWMA 3C7OA 5L9RA 3ZPOA 1WCDJ 4ARXA 1E5IA 2OZ6A 1H1AA 5C6CA 2WO1A 3VZJA 4AI9A 3U37A 1LENA 4H7MA 1UZWA 1OF4A 4F7ZA 1OFSA 2WIIB 4FT8A 3ECQA 3H3LA 1FNZA 3RYRA 2GMEA 1W6NB 4AF9A 3E5XA 3FHQA 4M3CA 3ZFFC 5FWEA 5FK7A 2QE3A 5FZEA 5DQ0A 4GWNA 2JG9C 2ZX4A 3ZYBA 3ZYFA 1TE1B 1WMFA 3FWEA 3OGJA 3Q8EA 3WQ7A 1X8EA 5L7OC 1W9FA 4FFFA 1QJU2 4I0BA 5FZ9A 2GP5A 1JYVA 4LUKA 4HVQA 3GCWA 5CFCC 5FREA 1CAUB 2TUNA 4WM8B 1HIXA 4CUBA 3O1SA 3I3DA 4YWAA 1W6MA 1X36A 1RUC3 2FMDA 1IPJA 4KWUA 2B39A 2VCMA 1COV3 4GJYA 2A6YA 1S0GA 2FZ2A 1W6PA 5JR7B 1QOSA 4QKNA 1OOPA 4W65A 4FOVA 1QDCA 2I2SA 4ZU5A 3WXPA 3D6EA 4RFRB 3WDUA 4FOYA 1DQ5A 4Q0UA 2KM2A 5C9AA 2JDMA 5E8AA 3K48A 5C4WA 4I09A 4YW2A 1B09A 3RI9A 1KJLA 1JZ4A 2R072 4IV1A 4BLIA 2JDZA 4NN0A 4YYOA 1F35A 3ZMNA 2XJRA 5CFDA 4WM7A 3UESA 4NRPA 2D93A 5FZ0A 4BIOA 3K46A 1FAYA 1V6NA 5FCCA 4ZZ5A 2GC2A 2PHTA 3PTRB 3PJQA 2VQTA 2ERFA 4CP2A 2YROA 3E5UA 4GB31 1AR62 2VOVA 2BNNA 1XYOA 2YFZA 3C8XA 3OJBA 4W6WA 3S6PA 4EN0A 2WN3A 5M0TA 1D0GA 1ENRA 1YUDA 4NUBA 3DF0A 1HN0A 3NWKA 4NAMA 5FO8B 1UU6A 1X9TA 2JKBA 1N1VA 2ARCA 4K40A 3SMHA 4M0NA 5IT6A 1WD4A 2E9QA 2BFUS 1GKBA 5EHDA 5FYIA 2EIBA 4A42A 2W52A 3MYXA 5A6YA 2P4EA 4DXSA 2JG8B 2DVFA 1SFNA 5EYXA 2UYBA 5FUPA 3WG2A 4C91A 3IZOA 1K5JA 1BVVA 3AZVA 3D0SA 4BQYA 1ZVFA 3FLRA 4RQPB 1R1A3 5A3LA 2P37A 2WZ8A 5I0RA 5IK7A 1IS3A 1URXA 5T52A 4UWDA 4Q8LA 1RUE1 2ZKNA 3QH7A 5JR2A 2WZR2 5LB6A 3WUCA 5DAPA 1PM7A 4Y24A 1PGW2 1ND2A 1UOGA 3ACHA 3H9AA 1SHWB 5FLIA 1CAVA 1HRI2 3U4SA 4A7ZA 4Y1YA 1AR61 3VL8A 4O65A 5HV4A 3M3QA 3OBRA 4Q0PA 3R6SA 2D7FA 2MPFA 4CVUA 4L8QA 2IC1A 1S0DA 4B29A 4EJRA 2PN5A 4GIQA 2FHRA 1QDOA 4Q4X3 2WAAA 4D7SA 1FOD2 4FPHA 5DXDA 3ZN4A 4KWJA 5C8CA 1CESA 5FZOA 1BBT2 4QU1A 2RDNA 4D6SA 3A0KA 2IXHA 3RS6A 5FMDA 1V9U3 1WLTA 2ADEA 4ATFA 2IVIB 3HD8B 4CCDA 1W04A 4C0HA 2VXJA 3HT1A 1W8ZA 2O0OA 1K45A 3VV1A 4L11A 5L73A 1GFF2 3OGRA 2FD8A 2WBKA 3RNSA 4OI4A 3LEKA 5FP3A 1JW6A 5F5CA 4BPZA 2VUJA 2Q8CA 3ZYRA 4FPYA 4IEOA 1HQNA 4RR3C 5J7MA 1ZREA 1PVC2 1CN1A 4YGEA 5F3IA 2WO2A 4QHBA 4CDUA 1OURA 4KGGA 2NZ9A 2WA3A 3FLTA 5BPXA 3PVOA 5FP8A 2DCJA 4P14A 1JOBA 4FFIA 1A8DA 2DVAA 4FP3A 3WNOA 3RZHA 3K3NA 3ZXKA 3OBZA 5C71A 1AHSA 5F5AA 3ZDVA 1DU3D 2JDYA 4XBNA 1XNCA 4IEQA 2XJQA 4M3CB 5KBFA 3O0XA 3E97A 3FUOA 4JTNA 2UY8A 3O5SA 1O5LA 2L9LA 2HWB2 2JJ6A 5JIUA 1DG6A 3VBFA 4N8MA 3POWA 4BQ3A 2J1EA 4HKLA 1VRH1 2GC3A 1UZ0A 3VD4A 3A0NA 3BTXA 2CWSA 1W6MB 4QWNA 4YFZA 3K3OA 2DU1A 1EAH1 1UW8A 3VN4A 3T0DA 4G3YC 3AFGA 1MPXA 4K8RB 4XEZA 3RDIA 4UFLA 4YW5A 1C8M2 5FTTC 5BNPC 3HN3A 1W9SA 2C5DA 4MV2A 5FZHA 1QJU3 2W2IA 2YU2A 4AEJA 4LHKA 1OOPB 3EBRA 3SLIA 3VHNA 3I97A 4Q26A 1NLRA 4IEYA 4PI0A 2XGXA 5FXWA 1UX6A 2XBO2 4FCAA 4AI8A 5C9AB 4QX2A 4QDQA 3WUDA 4AE2A 1SG3A 4FPOB 4I3GA 2WNVC 4CEYA 1ULFA 5F5QA 4QMAA 5CFDB 5FMBA 2V5YA 1O3QA 5FY7A 3WQBA 3CHXA 5JPNB 1IPSA 4Z2AA 4N7IA 4QPWA 4HL0A 3J9SA 3CJIA 4FXGB 4OHZA 3WDWA 2IXIA 2HEVF 3NL1A 2A73B 3PU3A 4GB33 1QXPA 2IWGB 3UETA 3ABZA 3U1XA 3MIEA 2OA2A 2X5IC 4LA2A 1LCLA 2R073 1MQTC 3L9JT 4TN7A 3WF2A 4HK8A 3OSDA 4N43A 2WQ8A 2ZS6B 1AXZA 2ZGMA 1YC61 1CONA 4UW4A 1G86A 5I93A 5BV6A 1BMV1 4UF0A 2R0HA 1N3PA 3AXDA 4Q0SA 5SV8A 3WP5A 4MOAA 1ULPA 3TB0A 1ONAA 3IN9A 4AEDC 3H8XA 1QJX2 1BK1A 1MS3A 2RM22 2ZGKA 5CVRA 2CY6A 1GQGA 3TYJA 4IEPA 4PLNA 4A6OA 1SCSA 4NJ4A 3AKSA 3OCPA 3UGHA 3B5LB 4KMQA 3HQXA 5E6HA 4B3NA 4CZSA 1JZ3A 1JUHA 1GZCA 2VVEA 5CA6A 2OS2A 1GP4A 3AMPA 2ZGPA 1KXGA 3JUUA 3JXSA 4PIZA 1RUE3 2SBAA 4PDWA 3JBG2 1LU2A 1Q8SA 1ND2B 1W8TA 1J59A 4TWTA 1AR91 1CAVB 3DEMA 5A3OA 1M06G 2VH9A 1VBA2 2Y33A 4MADA 5JVVA 3PVEA 4YG3A 2RS32 3LWCA 5LASA 1UQXA 2UURA 4NHYA 1H2LA 4LEJA 2R042 5F37A 3CO2A 4HN0A 2VUDA 4XTPA 5GZFA 4NWVA 2WZR3 5C8CB 2YU1A 5DAVA 1UD1A 1OF3A 5FZOB 2ZGRA 3FMGA 1U0AA 4IV3A 3P3PA 2OPKA 2WKKA 5EQUA 1Y4WA 1HRI3 1KFUL 1ULDA 2CAUA 3T09A 4DQAA 1LOGA 2K9ZA 3V0BA 3IIAA 2AUYA 1JYIA 4AEKA 2QZ2A 2VTXA 4YZ1A 1ZBA1 1U12A 2I45A 4D7TA 3ZYHA 4AG4A 4XAEA 5A6XA 3ZXEA 2ZX1A 3AKQA 1XJAA 1FOD3 4HANA 1ZRRA 4EQVA 4IXLA 3FHAA 1EPWA 1NKGA 1BBT3 4JKLA 1RUI1 3ZFEB 3WDTA 1OSGA 1X82A 4M3CF 5FJHA 5FYUA 1YNAA 4K20A 1SLTA 4YVSA 3DCQA 3VD3A 3H7JA 4IQPA 3W58A 3ZLIA 4FSJA 1W0PA 2J1UA 4CDUB 4CTEA 3POEA 3TNPB 5CADA 2XJUA 4XABA 3I2DA 3ME2A 4AI0A 1Y9MA 2O8QA 4IEWA 4L2NA 1LAJA 2PHLA 2CSGA 3MF9A 2N7GA 4ZONA 1ZA7A 2CDPA 5G05L 1G9BA 1ZYBA 1QIQA 1BEV1 3NV2A 2WJSA 4XF3A 1PVC3 4XIOA 1C4RA 2R061 4WM8C 2VXRA 2KA3A 3RWNA 4LLFA 1QQP2 2DDUA 5I0UA 2XR4A 3WVJA 3AVRA 5K9YA 4MHUA 3OBAA 1W05A 1WCKA 1C1LA 2FCTA 1PO23 3WX5A 3OPTA 3VBFB 4LITA 5D2AA 1NXD1 1C3HA 1ZA4A 2A6ZA 1PGL1 3CL1A 5GJ6A 1T6GC 1ZBE2 3SC7X 1H1MA 1T2XA 1QNYA 5LZ6A 1DDLA 5KXDA 1H6XA 1ODNA 1WUVA 4GD4A 4RHV1 5LWBA 5IK4A 4LOTA 2ZCWA 4QGMA 5DZGA 2HWC1 4LK7A 3MFCA 5IFPA 2H6CA 2QNKA 2YG0A 4DIQA 3QLQA 1S2BA 1TG7A 1RUG1 3IT8A 2LROA 5FOJB 5DMYA 1YIFA 3DECA 1UYZA 4S2FA 1S1AA 2W3JA 3PUIA 1VB2A 4MGIE 1ZRIA 1XOYA 4RGGA 4CXYA 2HWF2 2XQRA 3WNPA 1N1SA 1NE4A 2ZPXA 2Q4SA 4CEYB 5CFCB 2CL2A 3JD71 4MO3M 4ISQA 3SHRA 4AQ6A 5J96B 4QX3A 3VDAA 3PDQA 3WQ0A 5FFOC 2C26A 3N4MA 2VCBA 3W5NA 2Q8OA 3CJIB 1F15A 1AX1A 1YQ5A 2X29A 3BALA 3ZM8A 1WKYA 2D6MA 4BQXA 5BY5A 4CCEA 2ZGSA 1OC1A 4XUPA 5HCAA 3IAQA 4PT6A 1LHUA 1I5PA 1LOCA 1VLNA 1OKOA 3EXUA 3VDBA 1FI2A 2JG8C 4N43B 3O1UA 4CU7A 1RUF1 3AZYA 1HDKA 3OY8A 3LB9A 3KHCA 2C4XA 4GH4A 4XF0A 2OKXA 4A45A 3LDKA 2P6CA 5DN2A 5KC5A 1PX4A 4RQPC 2HH9A 2R30A 2WDBA 1OVPA 4Y1ZA 2E53A 3U07A 4WBBA 4HT1T 2JWPA 1K5MA 3LCPA 3AJYA 4FAGA 2IFRA 4IE6A 1F9KA 3ZVXA 3LEIA 2W87A 3GXUA 1SLBA 3APBA 4LO6B 2RR11 1NA1A 2JECA 4W50A 5KR7A 3PIJA 5BUVA 2BPA2 5E1RA 2VNGA 3SH3A 3WDVA 3RZMA 3B00A 1O4YA 2FDFA 1HB1A 4QQPA 2JDKA 3I2IA 2XH6A 4PDWB 1DZRA 1DQ4A 4IEZA 4YNIA 1PIV1 4KQ7A 3A21A 2YFUA 2E26A 2RM23 4QXBA 4XPVA 2BBVA 3GBFA 2PAMA 3ZXAC 4Y20A 1AR93 4Z8BA 4JRLA 2V73A 2ZAHA 5T5PA 5CYYA 3WDYA 4BJ0A 2WNUA 1UOFA 4O9EA 4L97A 2VW2A 4CCKA 3AZXA 3B01A 1QMJA 4AGGA 4U2AA 1MEC1 2QKDA 3UL2A 1RUD2 4JX0A 3RJRA 3NVCA 3ZXLA 4IV3B 3Q8CA 3L2YA 3TAYA 4CUAA 1BJQA 2QQIA 1JHNA 3V0BB 1LHOA 3LA2A 5FMCA 1XC6A 4UAPA 3N7JA 4NPMA 4EROA 2R043 5F8PA 1YXWA 5IK8A 3EO6A 3ZX7A 1RC6A 2ES3A 1AXKA 1GP6A 2XHNA 1MS8A 1DF0A 2BYVE 3LFMA 1TNRA 1WD3A 4GQ7A 3KF3A 4YVSB 2HWE1 3GZUC 2BV4A 4Q1PA 2J1VA 1PMHX 2PELA 3ZOIA 4NAOA 1AR81 4BHPA 4I02A 2VQUA 4C8DA 5L9BA 4J25A 3UKNA 1QXJA 4QXCA 2IXLA 1YCIA 1GNZA 3PU8A 2XPJA 3LOBA 3LKJA 4Z07A 1W28A 1SDWA 4KU8A 4ZKTB 1R081 2P1BA 4BK5A 5L36A 2B8MA 4R9DA 4WVZA 5FZ3A 3OEBA 4DB5A 1NY72 3A7QA 4Z2WA 5ACA1 3LD8A 1QWRA 5T50A 3OUHA 3VD5A 1YQ8A 2VU9A 3FUQA 4MXWA 4EZHA 5KHGA 3MBWA 4IDZA 1OOPC 1ZZ9A 1OH3A 4S2GA 4UFJA 4DXTA 1COV2 2K0GA 2NMOA 4YW4A 4QXKA 3VKFC 1RVF2 4LO5B 1WW7A 4RS5A 5C9AC 3ZN5A 2BOIA 3WEZA 2P3IA 3H1YA 1R092 5C4WC 1RHI1 5J37A 1ULOA 1FT9A 4IV1C 1KEXA 2BRTA 3Q8AA 1YEWA 4OMCA 2WNEA 1PMJX 5CFDC 4WM7C 1J1LA 4FVVA 3KT4A 4R9AA 4LBQD 4YPJA 4E9KA 1C28A 1DGRN 2RMU1 5F32A 4B1LA 4TSVA 3NMBA 4B4PA 4DINB 3HR9A 3SH5A 1DGWA 1RL3A 1UKGA 4RL7A 3I3MA 1AR71 3ZSMA 2BQPA 3CF6E 2WL1A 4B4QA 4NPLA 1IPKA 3ZKYA 1W2OA 1AF9A 1H2KA 4D8MA 5IWFA 4HONA 4AFDA 1W39A 3I2GA 4QX8A 3VLBB 4UXAA 3AKPA 1SCRA 2AREA 2XJVA 2LM3A 3LDBA 3J26N 4HKOA 4YGDA 5LRRA 3ROUA 1TME2 2XUMA 4XDQA 3GCXA 2HWF3 4NRQA 4QB1A 1HB2A 5IVVA 1E5RA 2CHHA 2E51A 1OA3A 3OY8B 3MW4A 1RUF3 4FP2A 4GH4B 5EXOA 5JXJA 2VTXJ 1LTEA 1OXCA 4CUGA 2TEPA 1S55A 1H2MA 2F4LA 4CU8A 1YLLA 1DP0A 1GZTA 1HN1A 2W94A 2ZGUA 3PMSA 4OCTA 1UZYA 4NWWA 4YGCA 2QQJA 1NXMA 2DCYA 1K5MB 4LJHA 5FZ7A 4FAHA 5B4XA 5SV5A 1REFA 4LKDA 4AHWA 1X33A 5EJZB 3I59A 1ASJ2 2OUHA 3DPRA 1NA1B 1ND2C 4Q4W1 2CGPA 2UWAA 1GNYA 3O1PA 1EV11 2X09A 2IFWA 4N53A 1GNHA 1N3QA 4FPCA 1A8MA 2WT0A 1YFYA 1CJDA 3RZZA 3QCWA 1M4WA 5LRSA 4AQ2A 2VQAA 3CKHA 5C8CC 2AENA 3N9PA 4Y20B 4NIDA 2WFF2 3T0BA 4AI3A 2WNUB 3THPA 3IB3A 4XQWA 5A33A 1IZ3A 4LTAA 4BIFA 3PUQA 4DY3A 4TLGA 2VO5A 4ZU4A 3KWVA 4DUVA 4LR4A 1VBE2 4H55A 1NOVA 3DYPA 4YM3A 1KFXL 3E6CC 1QJY1 2BWCA 5KHIA 1SBDA 5JI9A 4Q29A 2NM1A 1L7QA 2WO3A 2FDJA 4FOWA 1JYTA 1K3IA 5AC92 4CXXA 1XE7A 2YBPA 5E16A 5I0DA 1GOFA 1YFXA 1NQJA 1YJKA 1LULA 2B4KA 3AXEA 5KHKA 2OUJA 2XDVA 2AEZA 3SITA 1UPSA 1GBGA 4MSVA 3N9OA 1GICA 2YHJA 3OUJA 4B1MA 2D97A 4CDUC 1TNFA 4BE3A 2YC4A 1WCUA 2GN7A 1RXFA 1RUD3 3ILNA 1BHGA 3MPPG 3MV01 4GMP3 4NHLA 1UIJA 4BA6A 5KC6A 5LEJA 1ZZCA 3BB6A 4KBBA 2UWCA 3HVDA 4EWAA 1F5FA 1UYPA 3J8F1 5JIAA 2XHKA 2GAUA 1OLRA 3T3YA 2ET7A 4I0WB 5FOBB 2MEV1 4AFCA 3E6BA 3I7DA 4DFSA 3U0ZA 4NVPA 1AR83 3CZUA 3ZYGA 3WG3A 1VMFA 1C1FA 4AL9A 4AVVA 4JRAA 2RJLA 1PK6A 2ZZJA 3WF0A 3AZWA 4JGYA 4P9LA 3VBFC 1WGPA 3WF1A 1JOJA 5IFTA 1IGOA 4UBGA 1Z0HA 5IVEA 1A6CA 2XMLA 4YZ5A 3ZO0B 1AXYA 3BTYA 3NNMA 3OYWA 4M4PA 1Q43A 4H14A 3H50A 4LHNA 2QQOA 3AL5A 2PAKA 4OUSA 5KXEA 3HQUA 3WF4A 2D3SA 4LNVA 4XE9A 3WW2A 3MEPA 3V65A 2J1SA 4LBNA 3SEPA 3B94A 1V6LA 4M4RA 1GSLA 1OPMA 2XLFA 3D5OA 4P5HA 3ORJA 4W4ZA 1KJRA 2YBSA 3VD7A 1G9AA 2KR2A 5FY0A 3THTA 1SMVA 4QX5A 3HNMA 4JQRA 4FTBA 3IDCB 2QQLA 3WCRA 4QKFA 5FV3A 4CEYC 1IQAA 1JUIA 2VBDA 1U5XA 4HVRA 1W6QA 2FCUA 3M3OA 3BGAA 1AYN1 1KGYA 1OBNA 1DQ1A 2PHWA 4XF1A 2YYOA 3HOBA 2DCKA 3CJIC 2R0FA 4PF1A 2Q8EA 2Z5WA 3W59A 3D4KA 4LBOA 4QX1A 3J7LA 4Y26A 1RVF3 1RIRA 2AH2A 5BXXA 1R093 3WCSA 5FZCA 5FYZA 5LBFA 4EWDA 1AR73 3MLLA 4LE3A 4N43C 3QBQA 2O14A 3O0VA 3PURA 3CQOA 1YQ2A 3DL3A 4QM8A 3SH4A 4CCNA 4YSFA 4P9WA 3E1F1 1OQEA 5EV7A 2JE7A 4QDSA 1HLCA 2QFEA 1UMZA 2BGPA 2DU0A 2WNOA 4GB32 1XYNA 3RYPA 4DZGA 1F2NA 4DXRA 4BH9A 3OTFA 4GKXA 4AVAA 2RS11 3LOIA 2JD9A 2WSUA 3CLPA 2Y34A 4XFBA 2YPJA 3EMRA 3RZKA 2GNMA 1Y9QA 5C3PA 1POQA 3HNBM 2RS51 2VMEA 4EN8B 1ST8A 2ZEZA 4SLIA 2RVAA 3BYWA 1RYYA 2VUCA 5BNNA 2WN2A 3BPZA 2QBXA 3KQ4B 5FZ1A 5TSWA 5JOZA 4GAZA 5ANNA 1SLCA 2BNOA 3EYPA 1G9DA 4XBLA 4WVMA 3NAPA 1TME3 4PDWC 3I59B 3DPRB 3ZYPA 5H9SA 5LATA 1AYM1 2KXLA 5FYYA 4Q4W3 3W5MA 3CU7A 2R1DA 5FZAA 3BCWA 1HJGA 3KV6A 2A6XA 1JI6A 1RUE2 5JZGA 4LA3A 2WWSA 1EPZA 4IL7A 1S0FA 1XBFA 5F6LB 5A32A 2JIGA 4L0PA 2VBBA 4J1WA 2WWUA 1Q3EA 2ATFA 1ASJ3 1K12A 3EQEA 4IV3C 2H0BA 2O8OA 3KHBA 4Y22A 1PGSA 3MUZ1 5A33B 3N9MA 4D0QA 2GH2A 2Y6FA 3AYCA 2ZMNA 1MVQA 3WHUA 1DFQA 2ZKLA 4O9GA 4XXPA 4BLJA 5JLVA 2AZ5A 3BIEA 4NIAA 2VZTA 3PJYA 3INAA 5A1FA 2NQYA 5F6KA 4M3CE 1W8HA 1G9FA 1QY4A 3RRDA 3WDXA 3WZ1A 2CU5A 2WFF3 2YMZA 1NCRA 1UY1A 2VZPA 4M00A 1B35A 4NPRA 3CJXA 4NE9A 2DFCA 4J6GA 3PTYA 3G7DA 5D1IA 3ACIA 4YVSC 1VBE3 5A3TA 4ASKA 3M3CA 2GC1A 2RDSA 1GYKA 3M3IA 3AX4A 3MGUA 4META 5FY1A 2EXJA 3D82A 3K4AA 3TN91 5EP9A 2BGCA 5JSOA 4JV4A 1PVXA 1DGLA 3RI8A 4BQ1A 4FO9A 3ZFGA 3KMHA 1W90A 3UV9A 4PLMA 1UAIA 3NSTA 5AC93 2RE9A 3MPBA 3NNFA 4X8PA 1QH7A 3I2KA 1UYYA 4XUNA 1DGRA 5EWSA 1ND3A 2EXHA 1FYUA 5FKCA 2DTWA 3DN7A 1LGCA 5H9QA 5T54A 4YFWA 4HSJA 4AW7A 4DY5A 1CZSA 4RSUA 1HXS1 1GMMA 1F5JA 4A3ZA 1TMF1 5F3EA 2Y6JA 4IE4A 3ZXDA 1PK6B 1HX6A 1HQWA 4JGYB 3T2QA 3ZKUA 1APNA 1ACCA 3HIFA 4I2OA 3B69A 3RG0A 1XNDA 3ZR6A 5LEKA 5FMOS 4ET7A 3RYKA 4IETA 5FZ4A 1HW5A 1S0JA 1SZBA 3VHRA 3IDAA 2BP6A 2V4VA 3OYWB 4QXHA 3POFA 2BUKA 1PO22 3GJBA 1POV0 1W9WA 3BU0A 1PO11 5K0UA 1UF2C 2W92A 3ETPA 4P08A 2D5FA 3C7HA 3PIGA 1UKRA 1O4ZA 1VRH2 4R4XA 3SCGA 4CEWA 3VBHA 3U4XA 3IIIA 2B46X 4KWKA 4HPKA 4XDPA 1PMIA 4TZDA 2OQ6A 1EAH2 2RG4A 3AVSA 1VBB1 3I3BA 3TOJA 2Z4FA 4CUCA 5HPOA 2PXJA 4AFBA 3N7KA 2OZJA 3AJZA 4XIKA 4JGZA 5EPAA 4QPGA 4M0HA 1N1TA 4O7XA 5A3UA 2WLPA 3I2JA 3E6DA 4PHZA 1Q8VA 1W6QB 2JE9A 1OQDA 4F8AA 1AYN3 3AMMA 3KZ4C 3BN6A 4CXWA 5A7QA 3VUOA 4K8FA 4A44A 4HN1A 3ACGA 1GP5A 1W6PB 4QHOA 3OGVA 5CKMA 3B9CA 1LOEA 3H7YA 4GH4C 3WG4A 3NV1A 1W8NA 3FX3A 4JVAA 4E2SA 1W2UA 5ABJA 3VBSA 5FZ6A 2WRAA 1RINA 3MFAA 5C4WB 4DMIA 3NKGA 3BI3A 1ZRFA 2XJTA 2R7EB 2VULA 3C7EA 4IV1B 5LY2A 1N3OA 5LK5A 3UYJA 1CX1A 3U78A 1K5MC 4WM7B 2V09A 4MGQA 1CQ9A 1H8TA 1SFYA 3I2FA 4YLZA 5DG2A 2HYXA 2WUHA 1NA1C 3QACA 3ATGA 1CPMA 3MLJA 4OQ9A 4MLOA 5J3UA 4E4SA 1DCSA 2OVUA 1BMV2 1QH6A 3MIBA 4FXKB 1XE8A 4LBQA 4QB6A 4GWJA 2W08A 4YM2A 4E27A 1AJOA 3AC0A 2DTYA 1FMD1 3NAPB 4WVMB 2P34A 4OZXA 4AAXA 2YDEA 1HRV1 4XFFA 2W5FA 2W39A 2R1BA 4FTEA 2XKPA 4OHWA 3OD4A 4GZ9A 3I4IA 5BNOA 5JMCA 1AYM3 2E33A 4RFT0 3VZMA 1MR5A 2WNUC 3ZSEA 2LUWA 3X29B 1ZZ6A 1JU4A 1W2TA 1WBFA 5JZGB 2YY1A 3DYMA 4Y4RA 4KL1A 2GMMA 3KT1A 4ASMB 1AR92 5IVCA 4HMZA 1JTZX 4P00B 3HQRA 3DGTA 2O1QA 4OYUA 3SCHA 1D4M1 1ZX5A 1MS5A 5CZKA 1QOTA 3PUSA 3WHTA 1LGNA 1GANA 1VBC1 5DAXA 3OPWA 4H7LA 4NIGA 1AJKA 5FK8A 4RD7A 2B9VA 2Y8KA 4Q4V1 4Q4Y1 2OXBA 2QQPA 1VAKA 3S7IA 5J36A 3LEMA 3GF6A 4CP1A 4NIHA 2R49A 3ZXFA 2ZA9A 4PF5A 5A7PA 4CPBD 1POV1 1AR63 4QDRA 3U14A 3R05A 5DDJ1 1B35B 2ARBA 2V4AA 5FY9A 2B5HA 2W68A 2VMIA 3K75B 3LDRA 1ZBA2 3V56A 4AGVA 4QKBA 4EN9B 5A6ZA 5ANQA 1YRZA 4XZPA 1J84A 4IGOA 2VPVA 3ES4A 3TBDA 4I0AA 3GZEA 1I6XA 2JDHA 4YVWA 4C1WA 5B2GB 2ENRA 3MW3A 2BTVC 1JZ7A 4OQ8A 4XFAA 3JCIA 2WYFA 3LGRA 1WW6A 1FPN1 4LO7A 3ZFGB 1RUI2 1JZ5A 1RUJ1 5EJ1B 3O1VA 4QAWA 1ND3B 3TEXA 5A7OA 5GLVA 2ORXA 3M7AA 5GLZA 2GDFA 2XJSA 2ZX3A 3IMMA 3TEYA 5BYNA 1MS9A 2QQKA 2A3YA 1BKZA 2OX0A 2EAAA 3HT2A 2C9KA 3JBG1 3RZLA 5JAXA 1BEV2 2VZOA 3ES1A 3MI8A 1CZTA 5K0UB 2R062 2KD7A 3AMNA 4IGQA 4RS5C 3ON7A 4P9IA 3KB5A 4XHXA 3KS7A 5C3QA 4K1ZA 2GSYA 4BOWA 4COVA 1PGL2 2BW8A 5KXBA 3LAGA 4AVBA 4OLLA 4LULA 1MZ5A 4XMAA 5LY1A 4CEWB 5FJKA 2WABA 1OA4A 3VBHB 2G9ZA 4XFHA 4ES8A 5ISLA 5F3CA 4ONUA 2VBPA 4LBJA 4MUVA 4RHV2 1MACA 3KLSA 4LPLA 3FC0A 2DVDA 4EWEA 1KRIA 2G9GA 4JGZB 4QPGB 1XB9A 4TLFA 2RV9A 4JQTA 4R52A 4MGTA 3GJAA 1RB8G 2CV6A 1LKNA 3DKWA 1VRH3 1XYPA 1Y7BA 5FPZA 3IBMA 3ETQA 4BQ2A 2BFUL 2EALA 3NV4A 2B42B 3QD6A 4Z1VA 1EAH3 1ZZBA 4K6BA 3ILRA 1JYWA 3I54A 2WZPP 1KQRA 4FPEA
chains in the Genus database with same CATH topology
3I49A 3O1UA 4ZS2A 3KHCA 2FD8A 3BTZA 3I3QA 3O1RA 3O1SA 3BKZA 4ZS3A 4NRMA 3BTYA 3O1TA 3I3MA 3I2OA 4IE6A 4NPLA 3RZHA 3O1MA 4QKNA 4MG2A 3RZMA 4RFRB 3BUCA 2FDFA 4NIGA 2FDKA 4NRQA 4IE4A 4QKFA 4NIHA 4NRPA 3T4HB 4O61A 4QKBA 3BTXA 4OCTA 3T4VA 4IE7A 3BU0A 3O1VA 3O1PA 5DABA 3RZJA 3RZGA 4IE0A 2IUWA 4NPMA 2FDIA 5F8PA 4QKDA 4O7XA 3RZKA 4NIDA 3S5AA 3LFMA 3RZLA 3H8OA 4CXWA 4ZHNA 2FDHA 4QHOA 2FDJA 4CXXA 4JHTA 3BI3A 3S57A 3H8RA 4CXYA 3O1OA 3H8XA 4NROA 3KHBA 2FDGA 4NJ4A 4MGTA 4IDZA 4NIIA 3T3YA 3BIEA 4IE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I49 A;  3O1U A;  4ZS2 A;  3KHC A;  2FD8 A;  3BTZ A;  3I3Q A;  3O1R A;  3O1S A;  3BKZ A;  4ZS3 A;  4NRM A;  3BTY A;  3O1T A;  3I3M A;  3I2O A;  4IE6 A;  4NPL A;  3RZH A;  3O1M A;  4QKN A;  4MG2 A;  3RZM A;  4RFR B;  3BUC A;  2FDF A;  4NIG A;  2FDK A;  4NRQ A;  4IE4 A;  4QKF A;  4NIH A;  4NRP A;  3T4H B;  4O61 A;  4QKB A;  3BTX A;  4OCT A;  3T4V A;  4IE7 A;  3BU0 A;  3O1V A;  3O1P A;  5DAB A;  3RZJ A;  3RZG A;  4IE0 A;  2IUW A;  4NPM A;  2FDI A;  5F8P A;  4QKD A;  4O7X A;  3RZK A;  4NID A;  3S5A A;  3LFM A;  3RZL A;  3H8O A;  4CXW A;  4ZHN A;  2FDH A;  4QHO A;  2FDJ A;  4CXX A;  4JHT A;  3BI3 A;  3S57 A;  3H8R A;  4CXY A;  3O1O A;  3H8X A;  4NRO A;  3KHB A;  2FDG A;  4NJ4 A;  4MGT A;  4IDZ A;  4NII A;  3T3Y A;  3BIE A;  4IE5 A; 
#chains in the Genus database with same CATH topology
 2VUA A;  2RJ2 A;  3GYD A;  3JD7 2;  1YQ6 A;  3O12 A;  4LUM A;  2YXS A;  3I49 A;  5T3N A;  3BOP A;  4ZU7 A;  1U5Y A;  1UU5 A;  4UW6 A;  5FBZ A;  3FFQ A;  4LKF A;  4JC1 A;  5AVP A;  5HCH A;  5ABJ B;  1XU1 A;  3VBS B;  5A3N A;  2DWR A;  3I8T A;  3AFK A;  4OFG A;  5FPA A;  4BQW A;  1OLQ A;  2ZHM A;  3AMH A;  1W3X A;  2FMY A;  3IKW A;  3USS A;  3BVC A;  2QJV A;  1RUF 2;  2AGS A;  4QM9 A;  1H8T B;  2NLR A;  2DUO A;  2BJS A;  3R4U A;  5FO7 B;  3DPR C;  2D6L X;  2J22 A;  1R1Z A;  2P17 A;  4FPK A;  1X8M A;  5C8W A;  2IXC A;  1OLM A;  2W1U A;  1XNT A;  4OHX A;  4Y33 A;  3BUC A;  2Z69 A;  2QQV A;  4N53 C;  4MYE A;  2VZS A;  3MUY 1;  4XF4 A;  3VKM A;  2XQX A;  5GZG A;  4AQT A;  2AR6 A;  5KXC A;  2FDK A;  1S2E A;  5GLW A;  2WWJ A;  3TRS B;  5T5J A;  3VBR A;  2RR1 2;  5BNO B;  2YPD A;  4CA9 A;  5KWR A;  4MH0 E;  5A1A A;  2OQ7 A;  1UXX X;  4AYU A;  4O61 A;  5IW0 A;  2W9X A;  4ZXE A;  4FPF A;  4UF0 B;  5HCB A;  4ZXK A;  3FL7 A;  4L99 A;  1D2Q A;  3TEZ A;  2D43 A;  2QQM A;  1RUH 1;  3GM8 A;  5FZL A;  5CIR A;  2HEY F;  1V6I A;  1ZNP A;  1PZ9 A;  4YG6 A;  1PIV 2;  3THC A;  3ZMO A;  5A6Q A;  2ZGN A;  3S0M A;  4XUR A;  1C57 A;  4KNC A;  5BNQ A;  3OOX A;  1SBF A;  1DYP A;  3ST7 A;  1QU0 A;  1CJP A;  1V00 A;  1ZZ7 A;  2VOX A;  2DV9 A;  3D0J A;  4CP9 A;  3JB4 C;  5FMO L;  2CAV A;  1VBC 3;  1MEC 2;  1X7N A;  4XC9 A;  3B7M A;  4AHY A;  5IAV A;  3ITQ A;  3ZSJ A;  1DZQ A;  2RDR A;  1CX4 A;  3KGL A;  4ARY A;  3MID A;  3K51 A;  5FXX A;  4BQ5 A;  2XKO A;  2F6B A;  3SQO A;  4YRD A;  1JBC A;  3H8O A;  3ZDS A;  3K4Z A;  5CB7 A;  4XJA A;  3DUI A;  2VCA A;  4QHZ A;  4EN7 B;  3F95 A;  3J7N A;  1C8N A;  4Z82 A;  4YVW B;  1OT5 A;  2VMD A;  3EHK A;  3J7H A;  1W0N A;  2WFP A;  4HG6 B;  5H9R A;  3DXT A;  1RMU 1;  1PK6 C;  2D44 A;  3H1W A;  3H42 B;  1RUJ 3;  4JGY C;  3MIH A;  3AM2 A;  2HWE 2;  1W2N A;  2Y0O A;  3GHN A;  1ZBA 3;  3CBN A;  5DZF A;  4P9J A;  2QZ3 A;  5AFB A;  1AR8 2;  3KVB A;  2QQN A;  5FLH A;  4N7U A;  1YQC A;  1HB3 A;  2HLE A;  5I0T A;  1IKQ A;  4A3X A;  4XQ4 A;  5C7G A;  1VAV A;  2DF7 A;  1Z7S 1;  2F4P A;  3IDE A;  2Q30 A;  1RUI 3;  2GN3 A;  2MNG A;  1UMI A;  4EYU A;  5I8Y A;  3F2Z A;  5LBE A;  1JZ2 A;  2ZXQ A;  4AXO A;  3B93 A;  1VAM A;  4KG0 A;  2BZD A;  3U10 A;  5GKA C;  1VBD 1;  1S2K A;  4HZF A;  3VDD A;  2DBN A;  5ACA 2;  2VM9 A;  1J3Q A;  2VZQ A;  2CTV A;  3CNA A;  1MVE A;  3H8U A;  5FPB A;  3VBU A;  4A41 A;  2D3R A;  4P02 B;  1YI9 A;  3KQR A;  4HOO A;  2C9A A;  4QU2 A;  2PLV 1;  2VNO A;  3BTA A;  1D4V B;  2VR4 A;  1YYN A;  2ZOE B;  2YV8 A;  1BEV 3;  3O1R A;  2WS9 1;  4BYY A;  1W2A X;  2R06 3;  4MGZ E;  4QPI A;  1J3R A;  4HLT A;  4Y1V A;  2VGD A;  4UOJ A;  1I3H A;  1ULC A;  1WLW A;  3NKT A;  1RHI 2;  5FPL A;  3ZYJ B;  2ZAA A;  4DEV A;  1BYH A;  2HEW F;  2W0X A;  3PME A;  2VOT A;  2PYT A;  5HXV A;  5KHH A;  4U36 A;  1W8F A;  1UN1 A;  5F2W A;  4RN5 A;  1SLI A;  1GWM A;  4WV8 A;  1LHN A;  2RMU 2;  3P5B A;  1OKQ A;  1YHF A;  3ZYI B;  2LAL A;  2ZZQ A;  5JUV A;  3TEW A;  4PIY A;  1CGP A;  4RHV 3;  3UKV A;  1AR7 2;  4IEV A;  4XAA A;  1IG3 A;  1PNG A;  3KD4 A;  3WF3 A;  3RFR A;  3OF1 A;  4COW A;  1PHM A;  2HWC 3;  5IVJ A;  3JZV A;  2UYA A;  3M2M A;  4Q27 A;  3ZIX A;  4CU9 A;  1VRB A;  2NYY A;  3PVB B;  4LXL A;  1RUG 3;  2VMC A;  4J1X A;  5BNN C;  2GC0 A;  4M01 A;  4XMI A;  2DUP A;  3MZH A;  2D3P A;  3BU7 A;  3T4V A;  3ZXJ A;  1OHF A;  2R32 A;  2A6V A;  3JD7 3;  3NAP C;  5DAQ A;  1NY7 1;  4AZZ A;  1LHW A;  3IMN A;  4KWL A;  5JOW A;  4BWO A;  1G7Y A;  4XVH A;  5CG8 A;  1LOD A;  4XFI A;  1YIP A;  4NHK A;  3RZJ A;  4FFG A;  1NZI A;  2HWD 1;  2Y6K A;  5DUW A;  3KF5 A;  1C5H A;  2ZGL A;  4GUL A;  1CAU A;  1RUC 1;  5JZG C;  1O6U A;  3VBO A;  5C70 A;  3L2H A;  4OZO A;  5FZI A;  2ZJC A;  3VBR B;  3GNE A;  1IS6 A;  2UWB A;  4Q4W 2;  1REE A;  2P6H A;  2JIC A;  2JE8 A;  3EJK A;  3UJQ A;  1AL2 1;  4CCL A;  4ZZ8 A;  2D5H A;  1WBL A;  5A7W A;  1SPP A;  2VMF A;  1UNB A;  3J7M A;  4G9S B;  1S0B A;  3H3Z A;  5JSP A;  2Q5T A;  4GKY A;  3WNK A;  1RUO A;  1OUS A;  4BM8 A;  3N7L A;  5CKQ A;  4SBV A;  2C6S A;  1W8W A;  3GAL A;  1UMH A;  2ARX A;  3PNA A;  4KGQ A;  5LA2 A;  2FDH A;  1SEF A;  2RR1 3;  2VNV A;  2VE1 A;  1W0O A;  2CGO A;  2E32 A;  2XL9 A;  3HJR A;  3O0W A;  4Y3O A;  5LK7 B;  1OFN A;  4CDQ A;  1NCR C;  1WCS A;  3PUA A;  1B35 C;  4CP9 B;  1VE0 A;  2VD7 A;  1W06 A;  2VZU A;  1QJY 2;  3ELN A;  4FFH A;  5CNA A;  4COZ A;  3IPV A;  1RTV A;  1PIV 3;  4I30 A;  5FP4 A;  2VZR A;  4E4Z A;  4BQ4 A;  3CZJ A;  2ID4 A;  1JN2 P;  4V2W A;  2A1X A;  2ZX2 A;  3ZFG C;  2FDG A;  4CCJ A;  1PX3 A;  4IEX A;  1US3 A;  2GH8 A;  3UT0 A;  1MZE A;  2JDP A;  5DUV A;  4ES9 A;  3RMY A;  1ND3 C;  2D40 A;  4E4D X;  1WZX A;  4A6S A;  2GAL A;  4OUM A;  4E2G A;  5EJ3 A;  4DRV A;  1MEC 3;  2G4I A;  2PQQ A;  2WC2 A;  2WZE A;  2WO7 A;  2CYF A;  4QQO A;  1FAT A;  1EP0 A;  1GUI A;  2JDN A;  4GJZ A;  1JH5 A;  5FY4 A;  3NNJ A;  1NLS A;  4CCM A;  5CIS A;  5CG9 A;  2AEY A;  5FYS A;  2YGL A;  3I3Q A;  1R1A 1;  3J8F 2;  2IVJ A;  3LEG A;  2QQU A;  5GM0 A;  1A78 A;  2MEV 2;  1NYW A;  2EID A;  2LRP A;  2WYS A;  1VJ2 A;  3DYO A;  1IS4 A;  1UYX A;  1IHM A;  2JDA A;  4LE4 A;  3WW3 A;  5L9V A;  5GAL A;  3SKV A;  4D3W A;  2XG3 A;  3I3E A;  4D6Q A;  1ZRC A;  3JB8 A;  4AQS A;  3V0A B;  5K0U C;  1H30 A;  2HYK A;  4X8N A;  3W20 A;  4A4A A;  4CPB A;  4CEW C;  2HWE 3;  1W99 A;  2Y6L A;  3VBH C;  2YGM A;  1DHK B;  1MS1 A;  4JAA A;  4XJ8 A;  4B8E A;  4CDX A;  1GU3 A;  3FBM A;  4MXV A;  5JXH A;  3VBU B;  5LA9 A;  2JEM A;  4Q4X 1;  1WLC A;  4JGZ C;  2VAU A;  4QPG C;  4WVV A;  4AHX A;  1NLQ A;  5A3P A;  1A3K A;  2FQP A;  2E7Q A;  1SLL A;  4AEM A;  1SQ4 A;  2QQW A;  1V9U 1;  1R08 3;  2JXA A;  1E5H A;  5T5O A;  5FAX A;  1UZZ A;  2D6P A;  2OYZ A;  4QPI B;  3T2P A;  4AVS A;  1LB2 A;  4K3U A;  2QDR A;  5ACA 3;  1DYK A;  4LIV A;  1ULG A;  3C7G A;  5F2S A;  3URF A;  3LSD A;  4MXW B;  4AFA A;  3AKT A;  3HBZ A;  3AK0 A;  3AP4 A;  5E88 A;  4B7E A;  1X9P A;  2I07 B;  4OI2 A;  5D8A A;  3LPF A;  4HVO A;  1AYN 2;  1ZRD A;  4WVW A;  4DXZ A;  2JDU A;  3FFZ A;  1YI7 A;  2PHF A;  2RHP A;  5GZC A;  1OVS A;  1O7F A;  1O91 A;  3KV5 A;  4RS5 B;  1LNS A;  5ABJ C;  1D7P M;  2CDO A;  2P3Y A;  1WMX A;  3VBS C;  3VZK A;  1IOA A;  2D6N A;  1UX7 A;  1HV0 A;  3B02 A;  3S5Q A;  3OBT A;  4XOG A;  1RHI 3;  1Q5O A;  1S0I A;  2DUR A;  2X10 A;  2P5B A;  1XSQ A;  2PHU A;  2EF6 A;  2A7A A;  1H8T C;  1BXH A;  1WLD A;  1KS5 A;  2RMU 3;  1DLL A;  5FYT A;  4R9B A;  3LIH A;  2RS1 2;  2W1Q A;  4JDM A;  4BZ4 A;  2BWA A;  4OVE A;  2EA7 A;  3TWI A;  3SXW A;  2RS5 2;  2QVS B;  5BNO C;  4BIS A;  4HKW A;  2D6K A;  4BU2 A;  2ORZ A;  4JHT A;  1MZ6 A;  1ULE A;  1NCQ A;  2HWD 3;  2QDN A;  1L7R A;  1D2S A;  5EZW A;  2Y64 A;  5KHJ A;  4R8H A;  3VBO B;  3VKN A;  3Q8B A;  5E89 A;  5JI7 A;  3MIC A;  3N9Q A;  2JIJ A;  4COY A;  1AYM 2;  4FPG A;  4DUW A;  4NOT A;  4QT6 A;  5A7W B;  1R64 A;  1SPP B;  1QJU 1;  4XUO A;  4K1Y A;  1AL2 3;  4XJ9 A;  5IUQ A;  3RGB A;  2XXZ A;  1ZM1 A;  1H9P A;  4NII A;  2VZV A;  1LED A;  5F9T A;  2IXJ A;  3NQH A;  1LRH A;  2WT2 A;  4URA A;  1H4H A;  3WNL A;  1AVB A;  2VC9 A;  3OUI A;  2DCZ A;  4PCR A;  3OEA A;  4CYD A;  1JOD A;  4PLO A;  4XCA A;  3O14 A;  2IXK A;  3WSO A;  2Y60 A;  2BNM A;  4E8D A;  3B3Q E;  3BTZ A;  4N53 B;  1CVN A;  1LJ7 A;  3T2T A;  1EV1 3;  4CDQ B;  1SBE A;  2EIC A;  2X53 S;  4Q0Q A;  3AYD A;  3M70 A;  2Q8D A;  2ADD A;  4IGP A;  4XAC A;  4XF9 A;  2B7Y A;  3OG2 A;  3D8C A;  1QJF A;  1UL9 A;  3WOG A;  1UU4 A;  5FP7 A;  4YM1 A;  3IPV B;  4NMI A;  3WIN E;  5FUI A;  5FZK A;  4UYB A;  4D69 A;  4YVW C;  4V2V A;  2VVD A;  2R07 1;  3M8L A;  1H8V A;  5CKN A;  2VVF A;  3JQX A;  1AX2 A;  3WD5 A;  4YZ3 A;  2BU9 A;  5JWP A;  1O5U A;  4UFI A;  3HPN A;  4MG2 A;  2FCV A;  2XOM A;  2WA4 A;  3N36 A;  4BME A;  2W46 A;  4CDW A;  2B9U A;  3TN9 2;  4OI1 A;  1QJY 3;  4E4H A;  2NPI A;  5LBC A;  5FY8 A;  4K7J A;  4DUX A;  1YJL A;  2BER A;  1LR5 A;  4AI1 A;  1UY0 A;  4C1X A;  4L92 A;  1WMD A;  4K21 A;  5LA0 A;  3LQC A;  3WW1 A;  4AOC A;  4Y1X A;  2ARA A;  2UU8 A;  3J4U H;  5F3G A;  3VHO A;  5DPN A;  5FY5 A;  2PHR A;  1HXS 2;  3LA7 A;  3VDC A;  5FZB A;  3VL9 A;  1TMF 2;  3WT3 A;  4UFM A;  1TQ5 A;  4IE7 A;  3VZO A;  3WG1 A;  5FYV A;  4C0B A;  4W8J A;  1RED A;  5I8S A;  2GNB A;  1V0A A;  2VL4 A;  5C3O A;  4GXL A;  1NZC A;  3U75 A;  3J8F 3;  1E5S A;  2NMN A;  2VG9 A;  5J98 B;  4CDX B;  2MEV 3;  4MHR A;  2C24 A;  1YFW A;  2WAO A;  3V64 A;  4S2H A;  2FDI A;  2LS6 A;  3WNN A;  3E5Q A;  4P9Y A;  2E7T A;  3N9N A;  2UY9 A;  2WZR 1;  2E7A A;  5F5I A;  1PO1 2;  1PGW 1;  1CAX A;  2JKX A;  1BK0 A;  2ZEW A;  1XXN A;  2JX9 A;  1HRI 1;  1EY2 A;  1UY4 A;  4P5Y A;  2D98 A;  3LA3 A;  3V0A A;  1I1E A;  2ZTN A;  5LW9 A;  5D21 A;  3PLQ A;  3PL0 A;  4LBM A;  5DZE A;  1VBB 2;  1LOF A;  3LSE A;  3NNG A;  4QB2 A;  3USU A;  3K77 A;  3UJO A;  3HAG A;  3AKR A;  5LA1 A;  5I8T A;  3C2U A;  1FOD 1;  1HKD A;  4H2A A;  1LGB A;  5JOX A;  5D8A B;  1K42 A;  1BBT 1;  2J1R A;  5IVY A;  4YW6 A;  3VKL A;  5IVB A;  4XBQ A;  1O4T A;  2FZ1 A;  3ZFE A;  4FTS A;  3ASI A;  2Y26 A;  3GGL A;  1J3P A;  4XIL A;  4GWI A;  5IYY A;  2E63 A;  2ZBJ A;  3CDZ B;  2FBE A;  2J1T A;  3M4F A;  1DBN A;  4NRO A;  3FLP A;  2YBK A;  4PJY A;  1GZ9 A;  4IES A;  4UW3 A;  4Y1U A;  1OD5 A;  1TEI A;  2ZHK A;  5FQ0 A;  5FPU A;  3ZSK A;  2WR9 A;  1KDM A;  4CE8 A;  1V6K A;  1PVC 1;  1YO8 A;  1S0E A;  3K2O A;  2RDQ A;  1VAL A;  1SDD B;  4D94 A;  4MZU A;  1I5Z A;  1V70 A;  5FP9 A;  2HJI A;  5A3M A;  1Y9G A;  3ZN6 A;  1PO2 1;  3N3H A;  3NV3 A;  1US2 A;  3N7M A;  4IW3 A;  4HK9 A;  4ZS2 A;  3VBR C;  3Q9O A;  4KBZ A;  3D3A A;  4LT5 A;  3SIS A;  3GDB A;  1XSR A;  3MV1 1;  4QGL A;  4BCU A;  1NCQ B;  4YZ2 A;  3P1I A;  4NRM A;  3HMY A;  5FYB A;  2Q1M A;  4L9B A;  1FMD 2;  1NUK A;  2RS1 3;  2AC1 A;  4JKK A;  4V1P A;  5FBJ A;  1HRV 2;  3OB8 A;  2W1W A;  2EAK A;  3WV6 A;  4GA9 A;  2VEC A;  2XUE A;  2HWB 1;  4OMD A;  4Y5S A;  4DPN A;  4OUE A;  1DIW A;  4A7Y A;  1OI6 A;  2RS5 3;  5BNN B;  2PFW A;  3A22 A;  2ETE A;  5T55 A;  2GMP A;  1UY3 A;  2PQS A;  4LK6 A;  1H4G A;  1NAE A;  4I3P A;  3ZFF A;  5FUN A;  5FPX A;  5EYY A;  1JZ6 A;  1MS0 A;  2G19 A;  1NX9 A;  5T5L A;  4ZY9 A;  1W3V A;  4WZF A;  1Z78 A;  1VR3 A;  2JG9 A;  4E8C A;  1U5I A;  3AP5 A;  4R9C A;  5DUU A;  2WIN B;  3POY A;  5FXV A;  5L7O A;  3K4D A;  4KI5 M;  4NHM A;  1C8M 1;  5CFC A;  1D4M 2;  4AK3 A;  4E2Q A;  1Q8Q A;  2XVG A;  5F39 A;  4G4F A;  4PIX A;  2A71 A;  2V72 A;  2ZMK A;  3MW2 A;  1KDK A;  2ZGT A;  3WP4 A;  1VBC 2;  5GZE A;  3ZIW A;  1QHD A;  4PBO A;  1SLA A;  2BDR A;  2XBO 1;  5FZF A;  5A32 B;  4Q4V 2;  4Q4Y 2;  1XRU A;  2VCC A;  4OI0 A;  3LIG A;  5DG1 A;  3NJY A;  4Y22 B;  5C33 A;  1JHJ A;  4BDV B;  1LHV A;  4FQ4 A;  3A4U A;  5DDJ 2;  3H0O A;  4JDN A;  1O3S A;  2J1A A;  1OA2 A;  4IE0 A;  3R4D B;  4RA0 A;  3UK9 A;  4CDW B;  4XUT A;  5JDB A;  3KT7 A;  1PNF A;  1H2N A;  2EIG A;  1JYX A;  1Q8P A;  3POJ A;  1FPN 2;  1F8V A;  1NCR B;  1RUJ 2;  4UT5 A;  3TNQ A;  1FX5 A;  3WR0 A;  4QGN A;  4RYD A;  1AZD A;  4AFM A;  2XB6 C;  2R16 A;  4I01 A;  1N47 A;  2VMH A;  2LTN A;  1UOJ A;  5FO9 B;  1FNY A;  1AX0 A;  4QQ2 A;  1EYB A;  2ZGO A;  5A1L A;  2I74 A;  3TN9 3;  3VDD C;  4COU A;  4MGY E;  5FYH A;  1GV9 A;  1J58 A;  2CGN A;  3NRU A;  1IKP A;  3T08 A;  3VBU C;  2PHX A;  1QJX 1;  1O59 A;  1DGW X;  2RM2 1;  3POS A;  3T1M A;  5IAT A;  4FI9 A;  5J09 A;  3OPZ A;  3FBY A;  5HXM A;  4PQQ A;  3SNM A;  1H1I A;  2JB4 A;  4DNY A;  5A80 A;  5FR3 A;  1W6O A;  1PZ8 A;  5G04 L;  4BXS V;  4QPI C;  3WP6 A;  3H8R A;  1HXS 3;  3BIW E;  3WNX A;  2C0Z A;  4YW3 A;  2TBV A;  1VMJ A;  1TMF 3;  4YW1 A;  3SEE A;  1CAX B;  1JOP A;  1TZO A;  4Y5Z 0;  1O3R A;  4XHB A;  5K4L A;  4A2U A;  2DVG A;  4KG8 A;  2D6O X;  1EUT A;  1VBA 1;  4XFG A;  4EZ4 A;  5FDB A;  2G1M A;  4URT A;  5C3R A;  2A6W A;  3KGZ A;  4OUL A;  2RS3 1;  1HQL A;  5EFU A;  1VB4 A;  2DVB A;  4XYX A;  2NN8 A;  3AL6 A;  1HB4 A;  3USU B;  3LZZ A;  2R04 1;  4BXF A;  2QCS B;  2YC0 A;  4IE5 A;  1J83 A;  4Q0V A;  3R0R A;  1JMU B;  4YG0 A;  1QXR A;  2VNR A;  3RWK X;  3ZR5 A;  5B4N A;  1PO1 3;  3POG A;  5A7N A;  1GLH A;  2VOW A;  2WLQ A;  1JZ8 A;  1GZW A;  1OQ1 A;  3MHZ A;  4IUG A;  1KD7 A;  4Y4Y A;  4HPK B;  1QJE A;  4QQL A;  5FPV A;  2ZHL A;  1ENX A;  4DRR A;  2Y38 A;  2XWJ B;  4ZS3 A;  2EXI A;  1VBB 3;  4PQ9 A;  4QX0 A;  2BGO A;  5CU1 A;  3GHM A;  2HWC 2;  3O1T A;  2XLG A;  3I2O A;  1WW5 A;  3KVA A;  2DUQ A;  4TXW A;  4CCC A;  3IWZ A;  1X50 A;  2WQZ C;  1QOO A;  3QH6 A;  4N90 A;  1IS5 A;  1ODM A;  1FV2 A;  1P8J A;  1RUG 2;  1XE0 A;  2Q0A A;  3KV9 A;  4XJW A;  5FQ0 B;  2BVV A;  1CWP A;  1A34 A;  5DUX A;  3PVN A;  3PUH A;  2G9F A;  2X05 A;  4AVT A;  3FE5 A;  5FRA A;  4Y5T A;  3EB7 A;  1GOH A;  1QKQ A;  2IZW A;  3WP3 A;  3WY6 A;  4NR1 A;  3VBO C;  1OUX A;  3ZN6 B;  1W9Y A;  1ALY A;  3P6B A;  4CU6 A;  3RJ2 X;  2OPW A;  4RGA A;  1V6O A;  2LW8 A;  4XTM A;  2HKX A;  4QPY A;  4RR3 A;  1O8P A;  2VMG A;  3OD0 A;  3R4S A;  4N9H A;  5HCF A;  4HBN A;  1RGS A;  4HET A;  2ZEX A;  4LOR A;  2J42 A;  1BQP A;  3RMX A;  2W95 A;  3ILF A;  5GZD A;  4P9X A;  4FPJ A;  1UO9 A;  2XVK A;  4GMP 0;  4WZC A;  1SFP A;  2CNA A;  2WT1 A;  1QQP 1;  1UXZ A;  2XWB B;  1AL0 G;  3GBW A;  2HWB 3;  4UW5 A;  4K9S A;  2Z79 A;  1F4A A;  2ILM A;  4P9G A;  4ZPI A;  5A3W A;  4ATE A;  4BB3 A;  3VB9 A;  3VKO A;  3JQW A;  5J48 A;  3MO4 A;  4LBQ B;  3WW4 A;  2ZX0 A;  1ZBE 1;  3C7F A;  3ZFF B;  4CDQ C;  5C5U A;  1RUH 2;  1W8U A;  4LBK A;  2BBA A;  2DBI A;  4UI9 L;  3N9L A;  5C3S A;  2JG9 B;  4OHY A;  1FMD 3;  2GU9 A;  2ET1 A;  1HRV 3;  2VW0 A;  5FZD A;  5L7O B;  2DFB A;  1S0C A;  3U11 A;  2PAE A;  5GLT A;  3ZXG A;  2Y6G A;  4LLO A;  3ACF A;  2EXK A;  4XZU G;  2W91 A;  4LKE A;  1C8M 3;  3CEW A;  4DOU A;  1Q56 A;  4LHS A;  4UBH A;  4XJU A;  3RPQ A;  5JXI A;  4XW3 A;  4AR2 A;  2BVB A;  1Q8O A;  4KU7 A;  1XNB A;  2XBO 3;  4N9I A;  5IVF A;  3H1M A;  2GP3 A;  4JHZ A;  2HWF 1;  1N1Y A;  1Y3T A;  5BNP A;  5F7U A;  1FV3 A;  1F4H A;  1QEX A;  5FIX A;  5CAZ A;  4CP0 A;  1EUU A;  4IEU A;  4AGR A;  3NJX A;  1D4M 3;  4EN6 B;  3AMQ A;  1UZV A;  3AP7 A;  1RJ7 A;  3MLK A;  1Y43 B;  3VHP A;  2P3J A;  1V6J A;  4CRQ A;  5F1R A;  3KM5 A;  3T0A A;  2C1F A;  4JKM A;  1MS4 A;  5JOY A;  3IDB B;  3H3U A;  4F83 A;  4IER A;  4Q4V 3;  4Q4Y 3;  2WNV A;  2VOK A;  4BMB A;  1CPN A;  1RMU 2;  5K8S A;  1BVP 1;  3WQ1 A;  3B9I A;  1H9W A;  1POV 3;  2XLA A;  5DDJ 3;  4PBP A;  3AB0 A;  3G6J B;  3W21 A;  3HN1 A;  4JZR A;  1CIY A;  4MVT A;  4MX3 A;  2P3K A;  3IAP A;  4CDX C;  3M1H A;  1G6N A;  2X5I A;  2Q1F A;  4D6R A;  2EIE A;  1MQT A;  1W8O A;  1NT0 A;  1XPW A;  5IJR A;  4LBL A;  1GWL A;  1Z7S 2;  1CAW A;  1FPN 3;  4QQH A;  3RSJ A;  2Z2S B;  2OW4 A;  2JB8 A;  1QJX 3;  3NW4 A;  3LFI A;  2VY0 A;  4W6Y A;  1RXG A;  2HBT A;  1TVG A;  3MIG A;  1W6O B;  1VMH A;  1CR7 A;  1VBD 2;  4XQD A;  5K7P A;  3KCC A;  3N35 A;  4MGK E;  4Q2F A;  2B45 X;  2BOJ A;  4IND A;  4Q8K A;  2QTW B;  4AED A;  3FHI B;  3ZSL A;  4TYS A;  1XQN A;  2VTF A;  2H0V A;  1BCX A;  1D0H A;  1G9C A;  2PLV 2;  2YB7 A;  2A70 A;  5FZM A;  3JBG 3;  5HI0 A;  3BOW A;  1R08 2;  4H3W A;  2Y6H A;  5D8A C;  1GQP A;  2ZEY A;  4XDO A;  4AWD A;  1VBA 3;  4LIU A;  3GBG A;  2WS9 2;  3T2O A;  3UGF A;  2XL7 A;  3NJZ A;  1XNK A;  4HXC A;  1PZ7 A;  5A70 A;  2RS3 3;  4A7K A;  4BK4 A;  1L3J A;  3FJS A;  5IK5 A;  1OLM E;  2A75 A;  3POB A;  5JCT A;  3KV4 A;  1RUD 1;  4GMP 1;  1KS4 A;  1J1T A;  2YZ4 A;  1GOG A;  2PA7 A;  1GZW B;  1G8W A;  1QJZ A;  2K2S A;  3GZT B;  1WWY A;  3NNL A;  3T4H B;  4FQZ A;  3M3E A;  2E6V A;  1LU1 A;  3BPS A;  5LBB A;  3SCF A;  5I0S A;  1NQD A;  4AVC A;  3T30 A;  4TTG A;  2NP0 A;  1XU2 A;  1AUY A;  2W1S A;  4OHV A;  3O7O A;  1JS9 A;  1BZW A;  3VD9 A;  2VJX A;  5FWJ A;  1CZV A;  3LE0 A;  2DYC A;  4LMF A;  3KSC A;  3QOP A;  3AP9 A;  4LKS A;  1YWK A;  4FBF A;  1IQD C;  1PM4 A;  1VIW B;  4AAP A;  5DAB A;  3RZG A;  1VP6 A;  3AYE A;  1XNA A;  5JSR A;  3DV8 A;  4PI2 A;  2IUW A;  4Q1R A;  1NCQ C;  2JD4 A;  1VPH A;  3VZN A;  5DAW A;  1KIT A;  2XJP A;  3UNP A;  1NG0 A;  1UY2 A;  4QKD A;  3CIH A;  4LOS A;  4LHL A;  1NE6 A;  5EIY B;  1WME A;  2P2K A;  1MZF A;  2GZW A;  1V6M A;  4FPL A;  2PMW B;  3ALQ A;  3I2H A;  3KCX A;  4RR3 B;  1UOB A;  2HWD 2;  4EV0 A;  1T6B X;  1GR3 A;  1LEC A;  2Q1Z B;  1GWK A;  3FZ3 A;  4W6X A;  1W6N A;  1RUC 2;  1QF3 A;  1E57 A;  1W03 A;  2A5Z A;  4LQR A;  3RVH A;  3MIF A;  4KH9 A;  1FXZ A;  4F3J A;  1I9R A;  1STM A;  1OMI A;  5H9P A;  5CEH A;  3AP6 A;  1IG0 A;  3MF6 A;  3HNY M;  5HBA A;  1DQ2 A;  4FOQ A;  1QQP 3;  2R6Q A;  4XCB A;  1AL2 2;  3VGI A;  4NO4 A;  1DYO A;  3POI A;  1SAC A;  3DXU A;  2VZ1 A;  2SLI A;  4HSL A;  5FLJ A;  4X6Q B;  1RIT A;  2OII A;  4WM8 A;  1ZBE 3;  5CBL A;  2GND A;  3S30 A;  5FZG A;  1COV 1;  3S57 A;  1L7L A;  1HV1 A;  1CD3 G;  1RVF 1;  2ZGQ A;  3O1O A;  1BLZ A;  2VW1 A;  3P3N A;  1R09 1;  3AYA A;  1O8S A;  1UIK A;  1H0B A;  1EV1 2;  4B7K A;  1W9T A;  3RQ0 A;  3ACL A;  3HEI A;  3WNM A;  5LCW L;  4MGS A;  2EVX A;  1F31 A;  4X6R B;  1RUH 3;  2TNF A;  3HBK A;  4XET A;  1ZZ8 A;  4CDW C;  1RUN A;  1ENQ A;  2AYH A;  2XVL A;  3NO8 A;  3OGG A;  4DO0 A;  2H6B A;  5BNP B;  3ZPY A;  4QX7 A;  1DLC A;  5FKB A;  5FYM A;  4C90 A;  2W47 A;  1UCX A;  4YM0 A;  1ENS A;  2X8K A;  4UFK A;  1O3T A;  3BKZ A;  2CWM A;  4JTO A;  1DQ0 A;  1DZT A;  2VQ0 A;  1H6Y A;  2VZ3 A;  5ERL A;  5AFE A;  2WNV B;  2BEO A;  2JEN A;  1HJF A;  1TME 1;  3LPG A;  4YAR A;  5JXG A;  4YZ4 A;  4LO4 B;  4YW7 A;  4AHZ A;  3O1M A;  5J1X A;  2A3W A;  1R1A 2;  1OH4 A;  2ZAC A;  3PHM A;  5GLU A;  3MDP A;  3WLU A;  3UGG A;  2Y0I A;  1WCQ A;  1LOB A;  4ORF A;  4AI2 A;  2X5I B;  3BOD A;  1GQH A;  3NJV A;  1MQT B;  4LO8 A;  2JG8 A;  3OGS A;  1CAW B;  3HWJ A;  3CMG A;  1RMU 3;  3FN9 A;  4CCO A;  1ASJ 1;  4XXA A;  2GNT A;  3DKQ A;  5AVA A;  1S4C A;  2AAC A;  4RQP A;  1LOA A;  3GZA A;  4YGB A;  1WA6 X;  1UPI A;  4RGK A;  2WQ4 A;  1JU3 A;  4JCK A;  1JYC A;  3W9A A;  1CIW A;  4NHX A;  3THD A;  4AED B;  5L19 A;  4ISR A;  4Q4X 2;  1LOF C;  3LF7 A;  2F17 A;  4Q5O A;  4ASL A;  3AZZ A;  5I91 A;  4D7Y A;  2K46 A;  5HV0 A;  1QGL A;  3ENR A;  3Q8F A;  4XJZ A;  1Z7S 3;  1WA4 A;  5IAX A;  2WFF 1;  2E31 A;  1V9U 2;  1OD3 A;  2Z42 A;  2QUO A;  3VDD B;  3A23 A;  3ZFE C;  1VBD 3;  2XON A;  4XFC A;  1VBE 1;  1LEM A;  5A7S A;  3IM0 A;  3KCY A;  2DCT A;  2J7M A;  4S2D A;  2PTM A;  3C3V A;  3T1L A;  2OT7 A;  3UKT A;  1C5I A;  2PLV 3;  3S5A A;  1U5Z A;  5IHR A;  1OPO A;  4DS0 A;  5AC9 1;  3JU9 A;  1RJ8 A;  1JYN A;  4HFS A;  2HBU A;  4DEQ A;  2WS9 3;  2ZML A;  4Z92 B;  4GAL A;  4JDO A;  1DQ6 A;  5JPM B;  1YFU A;  5FZ8 A;  1QNW A;  4ITC A;  2ZAB A;  1JXN A;  5FXZ A;  2A3X A;  5FYC A;  2MHF A;  3S7E A;  1UWW A;  4QD2 A;  4ZHN A;  2V5D A;  5C5T A;  2YC2 A;  4XUQ A;  1WW4 A;  4CSW A;  2ZHN A;  3SKJ E;  5APA A;  4EE2 A;  2PHD A;  5JMO A;  4R4Z A;  2RJK A;  4B4R A;  3VZL A;  2YUE A;  4UFH A;  2WSV A;  1LES A;  4GWM A;  3C7O A;  5L9R A;  3ZPO A;  1WCD J;  4ARX A;  1E5I A;  2OZ6 A;  1H1A A;  5C6C A;  2WO1 A;  3VZJ A;  4AI9 A;  3U37 A;  1LEN A;  4H7M A;  1UZW A;  1OF4 A;  4F7Z A;  1OFS A;  2WII B;  4FT8 A;  3ECQ A;  3H3L A;  1FNZ A;  3RYR A;  2GME A;  1W6N B;  4AF9 A;  3E5X A;  3FHQ A;  4M3C A;  3ZFF C;  5FWE A;  5FK7 A;  2QE3 A;  5FZE A;  5DQ0 A;  4GWN A;  2JG9 C;  2ZX4 A;  3ZYB A;  3ZYF A;  1TE1 B;  1WMF A;  3FWE A;  3OGJ A;  3Q8E A;  3WQ7 A;  1X8E A;  5L7O C;  1W9F A;  4FFF A;  1QJU 2;  4I0B A;  5FZ9 A;  2GP5 A;  1JYV A;  4LUK A;  4HVQ A;  3GCW A;  5CFC C;  5FRE A;  1CAU B;  2TUN A;  4WM8 B;  1HIX A;  4CUB A;  3O1S A;  3I3D A;  4YWA A;  1W6M A;  1X36 A;  1RUC 3;  2FMD A;  1IPJ A;  4KWU A;  2B39 A;  2VCM A;  1COV 3;  4GJY A;  2A6Y A;  1S0G A;  2FZ2 A;  1W6P A;  5JR7 B;  1QOS A;  4QKN A;  1OOP A;  4W65 A;  4FOV A;  1QDC A;  2I2S A;  4ZU5 A;  3WXP A;  3D6E A;  4RFR B;  3WDU A;  4FOY A;  1DQ5 A;  4Q0U A;  2KM2 A;  5C9A A;  2JDM A;  5E8A A;  3K48 A;  5C4W A;  4I09 A;  4YW2 A;  1B09 A;  3RI9 A;  1KJL A;  1JZ4 A;  2R07 2;  4IV1 A;  4BLI A;  2JDZ A;  4NN0 A;  4YYO A;  1F35 A;  3ZMN A;  2XJR A;  5CFD A;  4WM7 A;  3UES A;  4NRP A;  2D93 A;  5FZ0 A;  4BIO A;  3K46 A;  1FAY A;  1V6N A;  5FCC A;  4ZZ5 A;  2GC2 A;  2PHT A;  3PTR B;  3PJQ A;  2VQT A;  2ERF A;  4CP2 A;  2YRO A;  3E5U A;  4GB3 1;  1AR6 2;  2VOV A;  2BNN A;  1XYO A;  2YFZ A;  3C8X A;  3OJB A;  4W6W A;  3S6P A;  4EN0 A;  2WN3 A;  5M0T A;  1D0G A;  1ENR A;  1YUD A;  4NUB A;  3DF0 A;  1HN0 A;  3NWK A;  4NAM A;  5FO8 B;  1UU6 A;  1X9T A;  2JKB A;  1N1V A;  2ARC A;  4K40 A;  3SMH A;  4M0N A;  5IT6 A;  1WD4 A;  2E9Q A;  2BFU S;  1GKB A;  5EHD A;  5FYI A;  2EIB A;  4A42 A;  2W52 A;  3MYX A;  5A6Y A;  2P4E A;  4DXS A;  2JG8 B;  2DVF A;  1SFN A;  5EYX A;  2UYB A;  5FUP A;  3WG2 A;  4C91 A;  3IZO A;  1K5J A;  1BVV A;  3AZV A;  3D0S A;  4BQY A;  1ZVF A;  3FLR A;  4RQP B;  1R1A 3;  5A3L A;  2P37 A;  2WZ8 A;  5I0R A;  5IK7 A;  1IS3 A;  1URX A;  5T52 A;  4UWD A;  4Q8L A;  1RUE 1;  2ZKN A;  3QH7 A;  5JR2 A;  2WZR 2;  5LB6 A;  3WUC A;  5DAP A;  1PM7 A;  4Y24 A;  1PGW 2;  1ND2 A;  1UOG A;  3ACH A;  3H9A A;  1SHW B;  5FLI A;  1CAV A;  1HRI 2;  3U4S A;  4A7Z A;  4Y1Y A;  1AR6 1;  3VL8 A;  4O65 A;  5HV4 A;  3M3Q A;  3OBR A;  4Q0P A;  3R6S A;  2D7F A;  2MPF A;  4CVU A;  4L8Q A;  2IC1 A;  1S0D A;  4B29 A;  4EJR A;  2PN5 A;  4GIQ A;  2FHR A;  1QDO A;  4Q4X 3;  2WAA A;  4D7S A;  1FOD 2;  4FPH A;  5DXD A;  3ZN4 A;  4KWJ A;  5C8C A;  1CES A;  5FZO A;  1BBT 2;  4QU1 A;  2RDN A;  4D6S A;  3A0K A;  2IXH A;  3RS6 A;  5FMD A;  1V9U 3;  1WLT A;  2ADE A;  4ATF A;  2IVI B;  3HD8 B;  4CCD A;  1W04 A;  4C0H A;  2VXJ A;  3HT1 A;  1W8Z A;  2O0O A;  1K45 A;  3VV1 A;  4L11 A;  5L73 A;  1GFF 2;  3OGR A;  2FD8 A;  2WBK A;  3RNS A;  4OI4 A;  3LEK A;  5FP3 A;  1JW6 A;  5F5C A;  4BPZ A;  2VUJ A;  2Q8C A;  3ZYR A;  4FPY A;  4IEO A;  1HQN A;  4RR3 C;  5J7M A;  1ZRE A;  1PVC 2;  1CN1 A;  4YGE A;  5F3I A;  2WO2 A;  4QHB A;  4CDU A;  1OUR A;  4KGG A;  2NZ9 A;  2WA3 A;  3FLT A;  5BPX A;  3PVO A;  5FP8 A;  2DCJ A;  4P14 A;  1JOB A;  4FFI A;  1A8D A;  2DVA A;  4FP3 A;  3WNO A;  3RZH A;  3K3N A;  3ZXK A;  3OBZ A;  5C71 A;  1AHS A;  5F5A A;  3ZDV A;  1DU3 D;  2JDY A;  4XBN A;  1XNC A;  4IEQ A;  2XJQ A;  4M3C B;  5KBF A;  3O0X A;  3E97 A;  3FUO A;  4JTN A;  2UY8 A;  3O5S A;  1O5L A;  2L9L A;  2HWB 2;  2JJ6 A;  5JIU A;  1DG6 A;  3VBF A;  4N8M A;  3POW A;  4BQ3 A;  2J1E A;  4HKL A;  1VRH 1;  2GC3 A;  1UZ0 A;  3VD4 A;  3A0N A;  3BTX A;  2CWS A;  1W6M B;  4QWN A;  4YFZ A;  3K3O A;  2DU1 A;  1EAH 1;  1UW8 A;  3VN4 A;  3T0D A;  4G3Y C;  3AFG A;  1MPX A;  4K8R B;  4XEZ A;  3RDI A;  4UFL A;  4YW5 A;  1C8M 2;  5FTT C;  5BNP C;  3HN3 A;  1W9S A;  2C5D A;  4MV2 A;  5FZH A;  1QJU 3;  2W2I A;  2YU2 A;  4AEJ A;  4LHK A;  1OOP B;  3EBR A;  3SLI A;  3VHN A;  3I97 A;  4Q26 A;  1NLR A;  4IEY A;  4PI0 A;  2XGX A;  5FXW A;  1UX6 A;  2XBO 2;  4FCA A;  4AI8 A;  5C9A B;  4QX2 A;  4QDQ A;  3WUD A;  4AE2 A;  1SG3 A;  4FPO B;  4I3G A;  2WNV C;  4CEY A;  1ULF A;  5F5Q A;  4QMA A;  5CFD B;  5FMB A;  2V5Y A;  1O3Q A;  5FY7 A;  3WQB A;  3CHX A;  5JPN B;  1IPS A;  4Z2A A;  4N7I A;  4QPW A;  4HL0 A;  3J9S A;  3CJI A;  4FXG B;  4OHZ A;  3WDW A;  2IXI A;  2HEV F;  3NL1 A;  2A73 B;  3PU3 A;  4GB3 3;  1QXP A;  2IWG B;  3UET A;  3ABZ A;  3U1X A;  3MIE A;  2OA2 A;  2X5I C;  4LA2 A;  1LCL A;  2R07 3;  1MQT C;  3L9J T;  4TN7 A;  3WF2 A;  4HK8 A;  3OSD A;  4N43 A;  2WQ8 A;  2ZS6 B;  1AXZ A;  2ZGM A;  1YC6 1;  1CON A;  4UW4 A;  1G86 A;  5I93 A;  5BV6 A;  1BMV 1;  4UF0 A;  2R0H A;  1N3P A;  3AXD A;  4Q0S A;  5SV8 A;  3WP5 A;  4MOA A;  1ULP A;  3TB0 A;  1ONA A;  3IN9 A;  4AED C;  3H8X A;  1QJX 2;  1BK1 A;  1MS3 A;  2RM2 2;  2ZGK A;  5CVR A;  2CY6 A;  1GQG A;  3TYJ A;  4IEP A;  4PLN A;  4A6O A;  1SCS A;  4NJ4 A;  3AKS A;  3OCP A;  3UGH A;  3B5L B;  4KMQ A;  3HQX A;  5E6H A;  4B3N A;  4CZS A;  1JZ3 A;  1JUH A;  1GZC A;  2VVE A;  5CA6 A;  2OS2 A;  1GP4 A;  3AMP A;  2ZGP A;  1KXG A;  3JUU A;  3JXS A;  4PIZ A;  1RUE 3;  2SBA A;  4PDW A;  3JBG 2;  1LU2 A;  1Q8S A;  1ND2 B;  1W8T A;  1J59 A;  4TWT A;  1AR9 1;  1CAV B;  3DEM A;  5A3O A;  1M06 G;  2VH9 A;  1VBA 2;  2Y33 A;  4MAD A;  5JVV A;  3PVE A;  4YG3 A;  2RS3 2;  3LWC A;  5LAS A;  1UQX A;  2UUR A;  4NHY A;  1H2L A;  4LEJ A;  2R04 2;  5F37 A;  3CO2 A;  4HN0 A;  2VUD A;  4XTP A;  5GZF A;  4NWV A;  2WZR 3;  5C8C B;  2YU1 A;  5DAV A;  1UD1 A;  1OF3 A;  5FZO B;  2ZGR A;  3FMG A;  1U0A A;  4IV3 A;  3P3P A;  2OPK A;  2WKK A;  5EQU A;  1Y4W A;  1HRI 3;  1KFU L;  1ULD A;  2CAU A;  3T09 A;  4DQA A;  1LOG A;  2K9Z A;  3V0B A;  3IIA A;  2AUY A;  1JYI A;  4AEK A;  2QZ2 A;  2VTX A;  4YZ1 A;  1ZBA 1;  1U12 A;  2I45 A;  4D7T A;  3ZYH A;  4AG4 A;  4XAE A;  5A6X A;  3ZXE A;  2ZX1 A;  3AKQ A;  1XJA A;  1FOD 3;  4HAN A;  1ZRR A;  4EQV A;  4IXL A;  3FHA A;  1EPW A;  1NKG A;  1BBT 3;  4JKL A;  1RUI 1;  3ZFE B;  3WDT A;  1OSG A;  1X82 A;  4M3C F;  5FJH A;  5FYU A;  1YNA A;  4K20 A;  1SLT A;  4YVS A;  3DCQ A;  3VD3 A;  3H7J A;  4IQP A;  3W58 A;  3ZLI A;  4FSJ A;  1W0P A;  2J1U A;  4CDU B;  4CTE A;  3POE A;  3TNP B;  5CAD A;  2XJU A;  4XAB A;  3I2D A;  3ME2 A;  4AI0 A;  1Y9M A;  2O8Q A;  4IEW A;  4L2N A;  1LAJ A;  2PHL A;  2CSG A;  3MF9 A;  2N7G A;  4ZON A;  1ZA7 A;  2CDP A;  5G05 L;  1G9B A;  1ZYB A;  1QIQ A;  1BEV 1;  3NV2 A;  2WJS A;  4XF3 A;  1PVC 3;  4XIO A;  1C4R A;  2R06 1;  4WM8 C;  2VXR A;  2KA3 A;  3RWN A;  4LLF A;  1QQP 2;  2DDU A;  5I0U A;  2XR4 A;  3WVJ A;  3AVR A;  5K9Y A;  4MHU A;  3OBA A;  1W05 A;  1WCK A;  1C1L A;  2FCT A;  1PO2 3;  3WX5 A;  3OPT A;  3VBF B;  4LIT A;  5D2A A;  1NXD 1;  1C3H A;  1ZA4 A;  2A6Z A;  1PGL 1;  3CL1 A;  5GJ6 A;  1T6G C;  1ZBE 2;  3SC7 X;  1H1M A;  1T2X A;  1QNY A;  5LZ6 A;  1DDL A;  5KXD A;  1H6X A;  1ODN A;  1WUV A;  4GD4 A;  4RHV 1;  5LWB A;  5IK4 A;  4LOT A;  2ZCW A;  4QGM A;  5DZG A;  2HWC 1;  4LK7 A;  3MFC A;  5IFP A;  2H6C A;  2QNK A;  2YG0 A;  4DIQ A;  3QLQ A;  1S2B A;  1TG7 A;  1RUG 1;  3IT8 A;  2LRO A;  5FOJ B;  5DMY A;  1YIF A;  3DEC A;  1UYZ A;  4S2F A;  1S1A A;  2W3J A;  3PUI A;  1VB2 A;  4MGI E;  1ZRI A;  1XOY A;  4RGG A;  4CXY A;  2HWF 2;  2XQR A;  3WNP A;  1N1S A;  1NE4 A;  2ZPX A;  2Q4S A;  4CEY B;  5CFC B;  2CL2 A;  3JD7 1;  4MO3 M;  4ISQ A;  3SHR A;  4AQ6 A;  5J96 B;  4QX3 A;  3VDA A;  3PDQ A;  3WQ0 A;  5FFO C;  2C26 A;  3N4M A;  2VCB A;  3W5N A;  2Q8O A;  3CJI B;  1F15 A;  1AX1 A;  1YQ5 A;  2X29 A;  3BAL A;  3ZM8 A;  1WKY A;  2D6M A;  4BQX A;  5BY5 A;  4CCE A;  2ZGS A;  1OC1 A;  4XUP A;  5HCA A;  3IAQ A;  4PT6 A;  1LHU A;  1I5P A;  1LOC A;  1VLN A;  1OKO A;  3EXU A;  3VDB A;  1FI2 A;  2JG8 C;  4N43 B;  3O1U A;  4CU7 A;  1RUF 1;  3AZY A;  1HDK A;  3OY8 A;  3LB9 A;  3KHC A;  2C4X A;  4GH4 A;  4XF0 A;  2OKX A;  4A45 A;  3LDK A;  2P6C A;  5DN2 A;  5KC5 A;  1PX4 A;  4RQP C;  2HH9 A;  2R30 A;  2WDB A;  1OVP A;  4Y1Z A;  2E53 A;  3U07 A;  4WBB A;  4HT1 T;  2JWP A;  1K5M A;  3LCP A;  3AJY A;  4FAG A;  2IFR A;  4IE6 A;  1F9K A;  3ZVX A;  3LEI A;  2W87 A;  3GXU A;  1SLB A;  3APB A;  4LO6 B;  2RR1 1;  1NA1 A;  2JEC A;  4W50 A;  5KR7 A;  3PIJ A;  5BUV A;  2BPA 2;  5E1R A;  2VNG A;  3SH3 A;  3WDV A;  3RZM A;  3B00 A;  1O4Y A;  2FDF A;  1HB1 A;  4QQP A;  2JDK A;  3I2I A;  2XH6 A;  4PDW B;  1DZR A;  1DQ4 A;  4IEZ A;  4YNI A;  1PIV 1;  4KQ7 A;  3A21 A;  2YFU A;  2E26 A;  2RM2 3;  4QXB A;  4XPV A;  2BBV A;  3GBF A;  2PAM A;  3ZXA C;  4Y20 A;  1AR9 3;  4Z8B A;  4JRL A;  2V73 A;  2ZAH A;  5T5P A;  5CYY A;  3WDY A;  4BJ0 A;  2WNU A;  1UOF A;  4O9E A;  4L97 A;  2VW2 A;  4CCK A;  3AZX A;  3B01 A;  1QMJ A;  4AGG A;  4U2A A;  1MEC 1;  2QKD A;  3UL2 A;  1RUD 2;  4JX0 A;  3RJR A;  3NVC A;  3ZXL A;  4IV3 B;  3Q8C A;  3L2Y A;  3TAY A;  4CUA A;  1BJQ A;  2QQI A;  1JHN A;  3V0B B;  1LHO A;  3LA2 A;  5FMC A;  1XC6 A;  4UAP A;  3N7J A;  4NPM A;  4ERO A;  2R04 3;  5F8P A;  1YXW A;  5IK8 A;  3EO6 A;  3ZX7 A;  1RC6 A;  2ES3 A;  1AXK A;  1GP6 A;  2XHN A;  1MS8 A;  1DF0 A;  2BYV E;  3LFM A;  1TNR A;  1WD3 A;  4GQ7 A;  3KF3 A;  4YVS B;  2HWE 1;  3GZU C;  2BV4 A;  4Q1P A;  2J1V A;  1PMH X;  2PEL A;  3ZOI A;  4NAO A;  1AR8 1;  4BHP A;  4I02 A;  2VQU A;  4C8D A;  5L9B A;  4J25 A;  3UKN A;  1QXJ A;  4QXC A;  2IXL A;  1YCI A;  1GNZ A;  3PU8 A;  2XPJ A;  3LOB A;  3LKJ A;  4Z07 A;  1W28 A;  1SDW A;  4KU8 A;  4ZKT B;  1R08 1;  2P1B A;  4BK5 A;  5L36 A;  2B8M A;  4R9D A;  4WVZ A;  5FZ3 A;  3OEB A;  4DB5 A;  1NY7 2;  3A7Q A;  4Z2W A;  5ACA 1;  3LD8 A;  1QWR A;  5T50 A;  3OUH A;  3VD5 A;  1YQ8 A;  2VU9 A;  3FUQ A;  4MXW A;  4EZH A;  5KHG A;  3MBW A;  4IDZ A;  1OOP C;  1ZZ9 A;  1OH3 A;  4S2G A;  4UFJ A;  4DXT A;  1COV 2;  2K0G A;  2NMO A;  4YW4 A;  4QXK A;  3VKF C;  1RVF 2;  4LO5 B;  1WW7 A;  4RS5 A;  5C9A C;  3ZN5 A;  2BOI A;  3WEZ A;  2P3I A;  3H1Y A;  1R09 2;  5C4W C;  1RHI 1;  5J37 A;  1ULO A;  1FT9 A;  4IV1 C;  1KEX A;  2BRT A;  3Q8A A;  1YEW A;  4OMC A;  2WNE A;  1PMJ X;  5CFD C;  4WM7 C;  1J1L A;  4FVV A;  3KT4 A;  4R9A A;  4LBQ D;  4YPJ A;  4E9K A;  1C28 A;  1DGR N;  2RMU 1;  5F32 A;  4B1L A;  4TSV A;  3NMB A;  4B4P A;  4DIN B;  3HR9 A;  3SH5 A;  1DGW A;  1RL3 A;  1UKG A;  4RL7 A;  3I3M A;  1AR7 1;  3ZSM A;  2BQP A;  3CF6 E;  2WL1 A;  4B4Q A;  4NPL A;  1IPK A;  3ZKY A;  1W2O A;  1AF9 A;  1H2K A;  4D8M A;  5IWF A;  4HON A;  4AFD A;  1W39 A;  3I2G A;  4QX8 A;  3VLB B;  4UXA A;  3AKP A;  1SCR A;  2ARE A;  2XJV A;  2LM3 A;  3LDB A;  3J26 N;  4HKO A;  4YGD A;  5LRR A;  3ROU A;  1TME 2;  2XUM A;  4XDQ A;  3GCX A;  2HWF 3;  4NRQ A;  4QB1 A;  1HB2 A;  5IVV A;  1E5R A;  2CHH A;  2E51 A;  1OA3 A;  3OY8 B;  3MW4 A;  1RUF 3;  4FP2 A;  4GH4 B;  5EXO A;  5JXJ A;  2VTX J;  1LTE A;  1OXC A;  4CUG A;  2TEP A;  1S55 A;  1H2M A;  2F4L A;  4CU8 A;  1YLL A;  1DP0 A;  1GZT A;  1HN1 A;  2W94 A;  2ZGU A;  3PMS A;  4OCT A;  1UZY A;  4NWW A;  4YGC A;  2QQJ A;  1NXM A;  2DCY A;  1K5M B;  4LJH A;  5FZ7 A;  4FAH A;  5B4X A;  5SV5 A;  1REF A;  4LKD A;  4AHW A;  1X33 A;  5EJZ B;  3I59 A;  1ASJ 2;  2OUH A;  3DPR A;  1NA1 B;  1ND2 C;  4Q4W 1;  2CGP A;  2UWA A;  1GNY A;  3O1P A;  1EV1 1;  2X09 A;  2IFW A;  4N53 A;  1GNH A;  1N3Q A;  4FPC A;  1A8M A;  2WT0 A;  1YFY A;  1CJD A;  3RZZ A;  3QCW A;  1M4W A;  5LRS A;  4AQ2 A;  2VQA A;  3CKH A;  5C8C C;  2AEN A;  3N9P A;  4Y20 B;  4NID A;  2WFF 2;  3T0B A;  4AI3 A;  2WNU B;  3THP A;  3IB3 A;  4XQW A;  5A33 A;  1IZ3 A;  4LTA A;  4BIF A;  3PUQ A;  4DY3 A;  4TLG A;  2VO5 A;  4ZU4 A;  3KWV A;  4DUV A;  4LR4 A;  1VBE 2;  4H55 A;  1NOV A;  3DYP A;  4YM3 A;  1KFX L;  3E6C C;  1QJY 1;  2BWC A;  5KHI A;  1SBD A;  5JI9 A;  4Q29 A;  2NM1 A;  1L7Q A;  2WO3 A;  2FDJ A;  4FOW A;  1JYT A;  1K3I A;  5AC9 2;  4CXX A;  1XE7 A;  2YBP A;  5E16 A;  5I0D A;  1GOF A;  1YFX A;  1NQJ A;  1YJK A;  1LUL A;  2B4K A;  3AXE A;  5KHK A;  2OUJ A;  2XDV A;  2AEZ A;  3SIT A;  1UPS A;  1GBG A;  4MSV A;  3N9O A;  1GIC A;  2YHJ A;  3OUJ A;  4B1M A;  2D97 A;  4CDU C;  1TNF A;  4BE3 A;  2YC4 A;  1WCU A;  2GN7 A;  1RXF A;  1RUD 3;  3ILN A;  1BHG A;  3MPP G;  3MV0 1;  4GMP 3;  4NHL A;  1UIJ A;  4BA6 A;  5KC6 A;  5LEJ A;  1ZZC A;  3BB6 A;  4KBB A;  2UWC A;  3HVD A;  4EWA A;  1F5F A;  1UYP A;  3J8F 1;  5JIA A;  2XHK A;  2GAU A;  1OLR A;  3T3Y A;  2ET7 A;  4I0W B;  5FOB B;  2MEV 1;  4AFC A;  3E6B A;  3I7D A;  4DFS A;  3U0Z A;  4NVP A;  1AR8 3;  3CZU A;  3ZYG A;  3WG3 A;  1VMF A;  1C1F A;  4AL9 A;  4AVV A;  4JRA A;  2RJL A;  1PK6 A;  2ZZJ A;  3WF0 A;  3AZW A;  4JGY A;  4P9L A;  3VBF C;  1WGP A;  3WF1 A;  1JOJ A;  5IFT A;  1IGO A;  4UBG A;  1Z0H A;  5IVE A;  1A6C A;  2XML A;  4YZ5 A;  3ZO0 B;  1AXY A;  3BTY A;  3NNM A;  3OYW A;  4M4P A;  1Q43 A;  4H14 A;  3H50 A;  4LHN A;  2QQO A;  3AL5 A;  2PAK A;  4OUS A;  5KXE A;  3HQU A;  3WF4 A;  2D3S A;  4LNV A;  4XE9 A;  3WW2 A;  3MEP A;  3V65 A;  2J1S A;  4LBN A;  3SEP A;  3B94 A;  1V6L A;  4M4R A;  1GSL A;  1OPM A;  2XLF A;  3D5O A;  4P5H A;  3ORJ A;  4W4Z A;  1KJR A;  2YBS A;  3VD7 A;  1G9A A;  2KR2 A;  5FY0 A;  3THT A;  1SMV A;  4QX5 A;  3HNM A;  4JQR A;  4FTB A;  3IDC B;  2QQL A;  3WCR A;  4QKF A;  5FV3 A;  4CEY C;  1IQA A;  1JUI A;  2VBD A;  1U5X A;  4HVR A;  1W6Q A;  2FCU A;  3M3O A;  3BGA A;  1AYN 1;  1KGY A;  1OBN A;  1DQ1 A;  2PHW A;  4XF1 A;  2YYO A;  3HOB A;  2DCK A;  3CJI C;  2R0F A;  4PF1 A;  2Q8E A;  2Z5W A;  3W59 A;  3D4K A;  4LBO A;  4QX1 A;  3J7L A;  4Y26 A;  1RVF 3;  1RIR A;  2AH2 A;  5BXX A;  1R09 3;  3WCS A;  5FZC A;  5FYZ A;  5LBF A;  4EWD A;  1AR7 3;  3MLL A;  4LE3 A;  4N43 C;  3QBQ A;  2O14 A;  3O0V A;  3PUR A;  3CQO A;  1YQ2 A;  3DL3 A;  4QM8 A;  3SH4 A;  4CCN A;  4YSF A;  4P9W A;  3E1F 1;  1OQE A;  5EV7 A;  2JE7 A;  4QDS A;  1HLC A;  2QFE A;  1UMZ A;  2BGP A;  2DU0 A;  2WNO A;  4GB3 2;  1XYN A;  3RYP A;  4DZG A;  1F2N A;  4DXR A;  4BH9 A;  3OTF A;  4GKX A;  4AVA A;  2RS1 1;  3LOI A;  2JD9 A;  2WSU A;  3CLP A;  2Y34 A;  4XFB A;  2YPJ A;  3EMR A;  3RZK A;  2GNM A;  1Y9Q A;  5C3P A;  1POQ A;  3HNB M;  2RS5 1;  2VME A;  4EN8 B;  1ST8 A;  2ZEZ A;  4SLI A;  2RVA A;  3BYW A;  1RYY A;  2VUC A;  5BNN A;  2WN2 A;  3BPZ A;  2QBX A;  3KQ4 B;  5FZ1 A;  5TSW A;  5JOZ A;  4GAZ A;  5ANN A;  1SLC A;  2BNO A;  3EYP A;  1G9D A;  4XBL A;  4WVM A;  3NAP A;  1TME 3;  4PDW C;  3I59 B;  3DPR B;  3ZYP A;  5H9S A;  5LAT A;  1AYM 1;  2KXL A;  5FYY A;  4Q4W 3;  3W5M A;  3CU7 A;  2R1D A;  5FZA A;  3BCW A;  1HJG A;  3KV6 A;  2A6X A;  1JI6 A;  1RUE 2;  5JZG A;  4LA3 A;  2WWS A;  1EPZ A;  4IL7 A;  1S0F A;  1XBF A;  5F6L B;  5A32 A;  2JIG A;  4L0P A;  2VBB A;  4J1W A;  2WWU A;  1Q3E A;  2ATF A;  1ASJ 3;  1K12 A;  3EQE A;  4IV3 C;  2H0B A;  2O8O A;  3KHB A;  4Y22 A;  1PGS A;  3MUZ 1;  5A33 B;  3N9M A;  4D0Q A;  2GH2 A;  2Y6F A;  3AYC A;  2ZMN A;  1MVQ A;  3WHU A;  1DFQ A;  2ZKL A;  4O9G A;  4XXP A;  4BLJ A;  5JLV A;  2AZ5 A;  3BIE A;  4NIA A;  2VZT A;  3PJY A;  3INA A;  5A1F A;  2NQY A;  5F6K A;  4M3C E;  1W8H A;  1G9F A;  1QY4 A;  3RRD A;  3WDX A;  3WZ1 A;  2CU5 A;  2WFF 3;  2YMZ A;  1NCR A;  1UY1 A;  2VZP A;  4M00 A;  1B35 A;  4NPR A;  3CJX A;  4NE9 A;  2DFC A;  4J6G A;  3PTY A;  3G7D A;  5D1I A;  3ACI A;  4YVS C;  1VBE 3;  5A3T A;  4ASK A;  3M3C A;  2GC1 A;  2RDS A;  1GYK A;  3M3I A;  3AX4 A;  3MGU A;  4MET A;  5FY1 A;  2EXJ A;  3D82 A;  3K4A A;  3TN9 1;  5EP9 A;  2BGC A;  5JSO A;  4JV4 A;  1PVX A;  1DGL A;  3RI8 A;  4BQ1 A;  4FO9 A;  3ZFG A;  3KMH A;  1W90 A;  3UV9 A;  4PLM A;  1UAI A;  3NST A;  5AC9 3;  2RE9 A;  3MPB A;  3NNF A;  4X8P A;  1QH7 A;  3I2K A;  1UYY A;  4XUN A;  1DGR A;  5EWS A;  1ND3 A;  2EXH A;  1FYU A;  5FKC A;  2DTW A;  3DN7 A;  1LGC A;  5H9Q A;  5T54 A;  4YFW A;  4HSJ A;  4AW7 A;  4DY5 A;  1CZS A;  4RSU A;  1HXS 1;  1GMM A;  1F5J A;  4A3Z A;  1TMF 1;  5F3E A;  2Y6J A;  4IE4 A;  3ZXD A;  1PK6 B;  1HX6 A;  1HQW A;  4JGY B;  3T2Q A;  3ZKU A;  1APN A;  1ACC A;  3HIF A;  4I2O A;  3B69 A;  3RG0 A;  1XND A;  3ZR6 A;  5LEK A;  5FMO S;  4ET7 A;  3RYK A;  4IET A;  5FZ4 A;  1HW5 A;  1S0J A;  1SZB A;  3VHR A;  3IDA A;  2BP6 A;  2V4V A;  3OYW B;  4QXH A;  3POF A;  2BUK A;  1PO2 2;  3GJB A;  1POV 0;  1W9W A;  3BU0 A;  1PO1 1;  5K0U A;  1UF2 C;  2W92 A;  3ETP A;  4P08 A;  2D5F A;  3C7H A;  3PIG A;  1UKR A;  1O4Z A;  1VRH 2;  4R4X A;  3SCG A;  4CEW A;  3VBH A;  3U4X A;  3III A;  2B46 X;  4KWK A;  4HPK A;  4XDP A;  1PMI A;  4TZD A;  2OQ6 A;  1EAH 2;  2RG4 A;  3AVS A;  1VBB 1;  3I3B A;  3TOJ A;  2Z4F A;  4CUC A;  5HPO A;  2PXJ A;  4AFB A;  3N7K A;  2OZJ A;  3AJZ A;  4XIK A;  4JGZ A;  5EPA A;  4QPG A;  4M0H A;  1N1T A;  4O7X A;  5A3U A;  2WLP A;  3I2J A;  3E6D A;  4PHZ A;  1Q8V A;  1W6Q B;  2JE9 A;  1OQD A;  4F8A A;  1AYN 3;  3AMM A;  3KZ4 C;  3BN6 A;  4CXW A;  5A7Q A;  3VUO A;  4K8F A;  4A44 A;  4HN1 A;  3ACG A;  1GP5 A;  1W6P B;  4QHO A;  3OGV A;  5CKM A;  3B9C A;  1LOE A;  3H7Y A;  4GH4 C;  3WG4 A;  3NV1 A;  1W8N A;  3FX3 A;  4JVA A;  4E2S A;  1W2U A;  5ABJ A;  3VBS A;  5FZ6 A;  2WRA A;  1RIN A;  3MFA A;  5C4W B;  4DMI A;  3NKG A;  3BI3 A;  1ZRF A;  2XJT A;  2R7E B;  2VUL A;  3C7E A;  4IV1 B;  5LY2 A;  1N3O A;  5LK5 A;  3UYJ A;  1CX1 A;  3U78 A;  1K5M C;  4WM7 B;  2V09 A;  4MGQ A;  1CQ9 A;  1H8T A;  1SFY A;  3I2F A;  4YLZ A;  5DG2 A;  2HYX A;  2WUH A;  1NA1 C;  3QAC A;  3ATG A;  1CPM A;  3MLJ A;  4OQ9 A;  4MLO A;  5J3U A;  4E4S A;  1DCS A;  2OVU A;  1BMV 2;  1QH6 A;  3MIB A;  4FXK B;  1XE8 A;  4LBQ A;  4QB6 A;  4GWJ A;  2W08 A;  4YM2 A;  4E27 A;  1AJO A;  3AC0 A;  2DTY A;  1FMD 1;  3NAP B;  4WVM B;  2P34 A;  4OZX A;  4AAX A;  2YDE A;  1HRV 1;  4XFF A;  2W5F A;  2W39 A;  2R1B A;  4FTE A;  2XKP A;  4OHW A;  3OD4 A;  4GZ9 A;  3I4I A;  5BNO A;  5JMC A;  1AYM 3;  2E33 A;  4RFT 0;  3VZM A;  1MR5 A;  2WNU C;  3ZSE A;  2LUW A;  3X29 B;  1ZZ6 A;  1JU4 A;  1W2T A;  1WBF A;  5JZG B;  2YY1 A;  3DYM A;  4Y4R A;  4KL1 A;  2GMM A;  3KT1 A;  4ASM B;  1AR9 2;  5IVC A;  4HMZ A;  1JTZ X;  4P00 B;  3HQR A;  3DGT A;  2O1Q A;  4OYU A;  3SCH A;  1D4M 1;  1ZX5 A;  1MS5 A;  5CZK A;  1QOT A;  3PUS A;  3WHT A;  1LGN A;  1GAN A;  1VBC 1;  5DAX A;  3OPW A;  4H7L A;  4NIG A;  1AJK A;  5FK8 A;  4RD7 A;  2B9V A;  2Y8K A;  4Q4V 1;  4Q4Y 1;  2OXB A;  2QQP A;  1VAK A;  3S7I A;  5J36 A;  3LEM A;  3GF6 A;  4CP1 A;  4NIH A;  2R49 A;  3ZXF A;  2ZA9 A;  4PF5 A;  5A7P A;  4CPB D;  1POV 1;  1AR6 3;  4QDR A;  3U14 A;  3R05 A;  5DDJ 1;  1B35 B;  2ARB A;  2V4A A;  5FY9 A;  2B5H A;  2W68 A;  2VMI A;  3K75 B;  3LDR A;  1ZBA 2;  3V56 A;  4AGV A;  4QKB A;  4EN9 B;  5A6Z A;  5ANQ A;  1YRZ A;  4XZP A;  1J84 A;  4IGO A;  2VPV A;  3ES4 A;  3TBD A;  4I0A A;  3GZE A;  1I6X A;  2JDH A;  4YVW A;  4C1W A;  5B2G B;  2ENR A;  3MW3 A;  2BTV C;  1JZ7 A;  4OQ8 A;  4XFA A;  3JCI A;  2WYF A;  3LGR A;  1WW6 A;  1FPN 1;  4LO7 A;  3ZFG B;  1RUI 2;  1JZ5 A;  1RUJ 1;  5EJ1 B;  3O1V A;  4QAW A;  1ND3 B;  3TEX A;  5A7O A;  5GLV A;  2ORX A;  3M7A A;  5GLZ A;  2GDF A;  2XJS A;  2ZX3 A;  3IMM A;  3TEY A;  5BYN A;  1MS9 A;  2QQK A;  2A3Y A;  1BKZ A;  2OX0 A;  2EAA A;  3HT2 A;  2C9K A;  3JBG 1;  3RZL A;  5JAX A;  1BEV 2;  2VZO A;  3ES1 A;  3MI8 A;  1CZT A;  5K0U B;  2R06 2;  2KD7 A;  3AMN A;  4IGQ A;  4RS5 C;  3ON7 A;  4P9I A;  3KB5 A;  4XHX A;  3KS7 A;  5C3Q A;  4K1Z A;  2GSY A;  4BOW A;  4COV A;  1PGL 2;  2BW8 A;  5KXB A;  3LAG A;  4AVB A;  4OLL A;  4LUL A;  1MZ5 A;  4XMA A;  5LY1 A;  4CEW B;  5FJK A;  2WAB A;  1OA4 A;  3VBH B;  2G9Z A;  4XFH A;  4ES8 A;  5ISL A;  5F3C A;  4ONU A;  2VBP A;  4LBJ A;  4MUV A;  4RHV 2;  1MAC A;  3KLS A;  4LPL A;  3FC0 A;  2DVD A;  4EWE A;  1KRI A;  2G9G A;  4JGZ B;  4QPG B;  1XB9 A;  4TLF A;  2RV9 A;  4JQT A;  4R52 A;  4MGT A;  3GJA A;  1RB8 G;  2CV6 A;  1LKN A;  3DKW A;  1VRH 3;  1XYP A;  1Y7B A;  5FPZ A;  3IBM A;  3ETQ A;  4BQ2 A;  2BFU L;  2EAL A;  3NV4 A;  2B42 B;  3QD6 A;  4Z1V A;  1EAH 3;  1ZZB A;  4K6B A;  3ILR A;  1JYW A;  3I54 A;  2WZP P;  1KQR A;  4FPE A; 
#chains in the Genus database with same CATH homology
 3I49 A;  3O1U A;  4ZS2 A;  3KHC A;  2FD8 A;  3BTZ A;  3I3Q A;  3O1R A;  3O1S A;  3BKZ A;  4ZS3 A;  4NRM A;  3BTY A;  3O1T A;  3I3M A;  3I2O A;  4IE6 A;  4NPL A;  3RZH A;  3O1M A;  4QKN A;  4MG2 A;  3RZM A;  4RFR B;  3BUC A;  2FDF A;  4NIG A;  2FDK A;  4NRQ A;  4IE4 A;  4QKF A;  4NIH A;  4NRP A;  3T4H B;  4O61 A;  4QKB A;  3BTX A;  4OCT A;  3T4V A;  4IE7 A;  3BU0 A;  3O1V A;  3O1P A;  5DAB A;  3RZJ A;  3RZG A;  4IE0 A;  2IUW A;  4NPM A;  2FDI A;  5F8P A;  4QKD A;  4O7X A;  3RZK A;  4NID A;  3S5A A;  3LFM A;  3RZL A;  3H8O A;  4CXW A;  4ZHN A;  2FDH A;  4QHO A;  2FDJ A;  4CXX A;  4JHT A;  3BI3 A;  3S57 A;  3H8R A;  4CXY A;  3O1O A;  3H8X A;  4NRO A;  3KHB A;  2FDG A;  4NJ4 A;  4MGT A;  4IDZ A;  4NII A;  3T3Y A;  3BIE A;  4IE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...