2FDGA

Crystal structure of alkb in complex with fe(ii), succinate, and methylated trinucleotide t-mea-t
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
199
structure length
199
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*TP*(MA7)P*T)-3'
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase/dna
total genus 49
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdgA00
2FDGA 4IE0A 3S5AA 2FDHA 3H8XA 3O1MA 3BTXA 2FDFA 4CXYA 4QKDA 3BTZA 3O1OA 3S57A 4ZS3A 3RZKA 4ZS2A 4IDZA 3H8RA 4NIDA 3T4HB 4IE5A 3BUCA 3I3QA 3RZGA 4NROA 3O1TA 3RZMA 3KHCA 3BKZA 4NRMA 3BU0A 4NJ4A 3BI3A 4O61A 4O7XA 4ZHNA 3RZJA 3BTYA 3RZHA 4NIIA 4QHOA 4IE6A 3T4VA 3O1PA 4QKNA 3T3YA 4CXXA 4RFRB 4NIGA 4QKBA 3RZLA 3O1RA 4OCTA 3I2OA 3BIEA 4QKFA 3H8OA 3I49A 2FDIA 4IE7A 4MGTA 3O1VA 4JHTA 3O1SA 3O1UA 2FDJA 2FD8A 4NRQA 3KHBA 4NPLA 4NIHA 4NPMA 3LFMA 3I3MA 4IE4A 2IUWA 5DABA 5F8PA 2FDKA 4CXWA 4NRPA 4MG2A
chains in the Genus database with same CATH superfamily
3NJYA 3J4UH 1GWLA 3ZFEB 2BNOA 3M7AA 1A78A 2WO3A 3H7JA 3JD72 4RGGA 2WLQA 4SLIA 3ZMNA 4LO4B 2QJVA 5JWPA 1ND3A 1Q8QA 2WNUA 2WSUA 3JQXA 5FZCA 1FV3A 1NT0A 1Q56A 2Y6KA 2ZHMA 3WG2A 2MNGA 3AVRA 1RGSA 4I0WB 3RZKA 4CEWA 4R52A 4XUTA 3OPTA 2QDNA 4DINB 3RMYA 5JXGA 3VD5A 2JG9A 1ZBE1 1U5ZA 1GLHA 2JG8C 2XDVA 3NMBA 4P14A 3CO2A 2JDNA 4EN6B 4H55A 3NV1A 4NIDA 1AR62 3VBFC 1PGL1 2K0GA 1R64A 5FLHA 4WBBA 2O1QA 1VMFA 1IQDC 2HWE3 2W94A 3POEA 4Q2FA 3WZ1A 2AR6A 4W6XA 1LB2A 3SKVA 5IHRA 1V6JA 5T5LA 3RZMA 2D6MA 3CJIB 3BIWE 3HEIA 4XMAA 1UYYA 1YJKA 2E63A 3IT8A 2ZX3A 1AR92 1AX2A 2DV9A 1MS9A 1MS4A 3OY8B 1VE0A 4LBQA 5FYUA 5C3RA 2RDSA 1W6QB 4LOTA 1J84A 1STMA 2GH2A 3P3PA 4YW4A 4C90A 1OQEA 1R081 4N53A 5FZBA 2RS53 3G7DA 3POYA 1GZTA 1EPWA 1PX4A 3E5QA 1FYUA 1HB3A 2VAUA 4JX0A 1V70A 5D8AA 4JHZA 5GZGA 3O0WA 3PUQA 2VVEA 2YC2A 4MH0E 1V9U1 3I2GA 2VD7A 2D6PA 1W2UA 1UZWA 5CB7A 4CDWC 1KJLA 1C8M1 4GWNA 2G1MA 3VKNA 3EQEA 4C0BA 2Y26A 4QPYA 1M06G 4DO0A 5F32A 1AYN3 2VQTA 3SC7X 2JE8A 5CADA 4AVBA 3E1F1 3KMHA 1MS0A 1OLMA 3ME2A 1UKGA 1OPOA 3MW2A 4QKBA 2BP6A 1AR93 2XJVA 2BGOA 2ZGKA 1H2NA 4UI9L 2P34A 2IXLA 4CCDA 1NCQA 4MXWA 3BN6A 5BNOB 2W92A 2RS13 3B9IA 4XOGA 5FYCA 1IOAA 1ND2C 2IWGB 3NAPA 4XEZA 3UYJA 5JSRA 2R062 1EUUA 2LTNA 5A3PA 2JXAA 3AJZA 4BOWA 2BVVA 1KRIA 5BNNA 3AFKA 1CX1A 3N36A 1W06A 2ZMLA 5LA1A 3NV3A 2PXJA 2W3JA 1POQA 1LHNA 3MF6A 3U0ZA 2WFF1 2WYFA 1GICA 4A44A 1PO11 1XE8A 3ZFGA 5ABJA 2AC1A 5C8CB 1IS5A 2DYCA 3O1VA 4N90A 4Q4V3 1ZBA2 3D5OA 3RZZA 4AEDB 4BQ1A 2ZEXA 2FDJA 4Z2WA 3UNPA 1H1IA 2ZHNA 4HSJA 3ZSKA 1ZZ6A 1KS4A 1REEA 1TEIA 2HEVF 5T54A 3KB5A 2Y64A 4NHKA 1N47A 1J59A 1DDLA 1CJDA 5IYYA 1PGW1 3JXSA 1LGCA 5E89A 2ZAHA 2GSYA 3MEPA 4XTPA 1JN2P 3UGHA 2R063 4MVTA 2E53A 3S5AA 4YPJA 1YRZA 3VDBA 2R072 4YVWC 3V0AB 1IS4A 3BGAA 3GBWA 3O1OA 2V73A 5FZMA 4BA6A 1ALYA 4UW6A 3LDBA 2QBXA 2WQ4A 4WZCA 1NYWA 4PQ9A 3OGGA 1AL22 3O0VA 3ES4A 1SHWB 4Q4X2 1PX3A 2ET7A 1RUF2 2RS33 3LE0A 4PIZA 2BV4A 3MW4A 1FX5A 1PVC1 2RMU2 1XE0A 3SH4A 3WD5A 2RR13 3UV9A 3OGVA 2OPWA 5F9TA 1RUJ2 3MZHA 1QQP2 2BQPA 3VD3A 1GOFA 5HXVA 1UY2A 1JZ5A 1YQ5A 1CVNA 1AJOA 3R4DB 2ZGSA 1NQDA 4AFMA 4CP9B 2PYTA 1TMF2 2HEYF 4K9SA 1GP4A 4A42A 2XBO1 4I01A 3AC0A 3WQ1A 3PMSA 5G04L 3H3LA 5LA9A 4AOCA 4AVTA 2D40A 1IKPA 1TME2 4RHV3 5FY5A 4UF0A 1QF3A 1S55A 1KJRA 1RXGA 4RQPC 1O4YA 2ZXQA 2BVBA 3T30A 1YIPA 3DCQA 4AFAA 3IDBB 2PHUA 4IEZA 1HXS1 5IK7A 3S7EA 4E2SA 3LIHA 4ZHNA 2TNFA 3KQ4B 3F2ZA 1W39A 1H2LA 2DU1A 2ZCWA 3H0OA 1JTZX 3LD8A 4N9HA 1WW6A 3HWJA 4QQPA 2VC9A 2VZPA 3JBG3 4UFMA 2DVGA 4OUSA 1RUJ3 1VBA3 1Z7S2 1QQP3 3HN3A 4YW3A 1DQ2A 5GLWA 1HLCA 4BPZA 4XXPA 1YQ2A 4QDQA 4FOWA 5JOWA 3SISA 3ZR6A 5CFCC 1F4HA 4Q0VA 2GMPA 3J8F3 3JB8A 3MLJA 3WNPA 1IHMA 5A6XA 4ORFA 3JU9A 2VZRA 2W0XA 5IFTA 4FAGA 3KV4A 4FSJA 4MO3M 1IG3A 2XOMA 3VV1A 4RFRB 4AE2A 4NHXA 2Q30A 3OUIA 1J83A 5FYVA 3O1SA 2Q1MA 2DF7A 4Q26A 4QXCA 4BMEA 2YG0A 4ASKA 1FNYA 4JGZA 4Z8BA 4E4DX 3WW1A 1V6LA 3GZTB 3I2FA 4Y5Z0 2ZABA 3K4DA 1MQTC 2KR2A 4MLOA 4TLGA 3HNYM 4K20A 4ARXA 4BK4A 5C33A 2D97A 4EWEA 5C9AC 1XB9A 4FT8A 4HFSA 2PELA 3L2HA 4X6RB 2C26A 4XUOA 5FZLA 2BOJA 4TYSA 2GNDA 2WZPP 4K6BA 4AL9A 5K7PA 4CCLA 1WUVA 1UO9A 2XLFA 4HT1T 3ZIWA 2PMWB 2OVUA 2WO7A 2PAMA 3KWVA 3VBRB 2VZVA 1QKQA 1W3XA 4QMAA 5AVPA 4YZ2A 3DF0A 3THDA 1T6GC 3H8UA 3ZDVA 1O59A 1VBE2 1VMHA 1ASJ2 4KG0A 3VKFC 4FPJA 1XQNA 1LU1A 2GH8A 4KWLA 1XYOA 3MO4A 1YFXA 3PVOA 4PDWB 4RS5A 4UBGA 4CDQA 1RUH1 3KT4A 1ZM1A 4CCJA 5E1RA 3PL0A 4LIVA 5T5JA 4D7YA 5FPUA 4PT6A 1VAMA 4P00B 3I2JA 2EXJA 3ZPOA 3GXUA 1X9PA 5GZDA 3WV6A 1LTEA 1LCLA 2ET1A 5KXCA 4JDNA 2PHTA 2LS6A 4Y3OA 2AEYA 4TSVA 4BYYA 4B7KA 2YU1A 3UKVA 3WP4A 3AKTA 1E57A 2WC2A 1UNBA 3U78A 5IK5A 1MZ6A 3HIFA 3K75B 4SBVA 3VBHA 3GHMA 5IVYA 1G9AA 1J3RA 2QQKA 1V0AA 4P02B 3B3QE 1DG6A 2IFWA 2V09A 3MF9A 2PLV3 2Y8KA 2R1BA 2HWF2 1Y43B 2VOVA 2X10A 4GMP1 2VOTA 4JQRA 3RDIA 1AR81 4C1WA 1NLQA 2CNAA 4Q1PA 2ZTNA 3KV6A 1XC6A 2MHFA 2WO1A 3MDPA 1HKDA 4YVSA 2ZGTA 1POV3 2VGDA 1A6CA 3IIIA 5DZEA 2QVSB 1X9TA 2NN8A 3BOPA 5GLUA 4EN8B 5KHIA 4U2AA 4J1WA 3MICA 4O7XA 5FXZA 1ZRIA 4HL0A 2QQUA 3VDDC 5K4LA 1PZ8A 2VUDA 4LJHA 4K8FA 1XJAA 2OS2A 2VW2A 1COV1 2ZA9A 2Y60A 4YGEA 3ZXJA 1UMIA 4META 1BK0A 5FO9B 4XVHA 1RHI3 1WMEA 5FAXA 4RYDA 2CWMA 3H1YA 5GLZA 1OA4A 3THTA 3M4FA 4FPFA 4QM8A 1RINA 1SLCA 2QE3A 2VZUA 3O1PA 4TTGA 4NAMA 1H1AA 3UT0A 1RUD2 2VW0A 3GCWA 5L9BA 5AC92 4N43C 3LB9A 3D4KA 1OA3A 1W8NA 3H1WA 4QPGB 4Y33A 2YV8A 5D21A 1R1A2 2OXBA 5TSWA 4A7YA 1RUOA 1CAUA 1BEV1 5FZIA 3FFZA 1KQRA 2TUNA 5IK4A 3OBAA 1G9BA 4CDXB 4QT6A 1LESA 3RI8A 1ULEA 2VU9A 2AYHA 4WV8A 3M2MA 4E8DA 2RM21 2CSGA 1TVGA 3OB8A 1CAWB 1QJEA 3FZ3A 2HWC2 2ZEYA 4O9EA 3OGRA 3VB9A 5ERLA 1JW6A 2R7EB 4DY5A 3OY8A 3FLTA 4BLJA 5DUUA 1SLLA 3IPVB 4XPVA 1Y9GA 2XJTA 4JCKA 4A41A 4YM2A 3WW3A 4AGVA 3ST7A 1JUHA 3I49A 4WVWA 3B9CA 4OHZA 1LOGA 3AMPA 1S2BA 4UXAA 3CU7A 5AC93 2PFWA 1JODA 3O1UA 1X36A 2JENA 2ZX0A 3FUOA 3VDCA 4BK5A 4GJYA 4QHZA 5A7SA 3KVBA 1OXCA 3OEAA 5LASA 4AQTA 3ZYRA 4M4PA 2XR4A 4JC1A 1VB4A 2OZJA 1ZBE2 2WS91 2QQJA 4L97A 1ND3B 1E5HA 2HBTA 2WNUB 4CXWA 4IV1C 3WNXA 3HOBA 1PGL2 2HWC3 3K4ZA 1C5IA 4PBPA 5FYTA 4AG4A 2WZR1 4CEWB 2Z69A 2P6HA 3RG0A 4FAHA 1A8DA 1NA1C 2JG9B 3GJBA 2WJSA 2DUPA 2VZQA 4LHSA 4GB33 1SMVA 3SNMA 2VBPA 1QJY1 3WG1A 4NVPA 2AACA 1U5YA 1OVPA 1MS5A 1W8TA 1XNTA 3MIEA 4D7TA 4GULA 1H8VA 3T2QA 3H8RA 1QJX1 1OKOA 2XXZA 4BQWA 3UK9A 4HK8A 2Y6JA 1R082 1D0GA 5A6QA 4C1XA 5C8CA 1UU5A 3CKHA 1ZBE3 4AEDA 1ACCA 1ULFA 1E5IA 1UMZA 4MGSA 5FBZA 3SH5A 2ENRA 1W0PA 1DQ1A 1US3A 4XF1A 3RZGA 1V9U2 1GKBA 4YW5A 4XDPA 4FPLA 3KQRA 4Y26A 2DCKA 1WCUA 3WF4A 1C8M2 3RS6A 4IEQA 2UY9A 4LT5A 3GBFA 4N53B 4EN7B 1X82A 2HYKA 4AWDA 2Z42A 2ZPXA 4XQ4A 3SCGA 1VBB1 4KGGA 4XBNA 3USSA 4A4AA 1W9TA 4DEVA 2J22A 1PM7A 2WNVC 2IXCA 3N7KA 3NNMA 2W1UA 1ULDA 2VBDA 4XUNA 1YQ6A 2JKXA 3UJOA 3RPQA 1IPSA 1XNCA 5L7OC 1BVVA 1HRI1 1G9FA 2YFZA 3U11A 2BOIA 3MIFA 3FJSA 3DN7A 3KZ4C 4FXGB 4S2GA 5GALA 2RVAA 4DIQA 5K0UC 3U37A 3F95A 3ZX7A 5LA2A 1NCQB 4MXWB 3SH3A 4A7ZA 2CWSA 1YWKA 1I3HA 2WFF2 1IPKA 5FTTC 1PO12 4OI0A 1W0OA 4CP9A 2D5FA 4NIGA 3IDEA 1ULGA 4LIUA 5FZ0A 1UYZA 5L9RA 2PQQA 1YXWA 2YPDA 3CDZB 5FJHA 2ATFA 2VQ0A 4LOSA 5LBBA 3RZLA 1YC61 2W47A 3T2OA 1UOFA 4ISQA 3W21A 3FX3A 5CKMA 4KWJA 4FI9A 5FYMA 4ZXKA 1ZRFA 1UOBA 2VPVA 5FYIA 3FLPA 4OCTA 4QX1A 3ZFGB 5ABJB 2VOWA 4OHXA 5FXXA 3ZVXA 3WNLA 4I30A 1PGW2 1FPN1 2GMEA 1XPWA 1ENRA 4Q4Y1 3NW4A 5I0DA 3GM8A 1C1FA 1I9RA 4S2HA 3ZFFC 2A6ZA 2CHHA 3AB0A 4XHBA 5C3SA 3TBDA 3H9AA 3SMHA 3Q8AA 2G9FA 1AYM1 3OUJA 4CE8A 5LA0A 1IS6A 3AZYA 5J37A 3JUUA 4JRAA 2VTXA 3AKPA 2NPIA 4NPLA 3OCPA 4NIHA 1PVC2 4I2OA 3POIA 2RDQA 2VMEA 2Q0AA 2JB8A 3IMMA 3J7NA 3DPRA 3HN1A 4OI4A 4W65A 5FREA 5DMYA 2C6SA 1QDOA 2FMDA 4XZUG 1GBGA 2I2SA 4XMIA 1W6PA 1C28A 2XBO2 2BWCA 4IUGA 3BTXA 1W8UA 3DGTA 2HWB1 3MPBA 2QQNA 1EAH3 1QH7A 4QAWA 3EYPA 1TQ5A 4LBNA 4YG3A 2JWPA 2AREA 4QPWA 4GH4C 4RR3C 3WNNA 1H2KA 3QLQA 3C7HA 2D3RA 5L36A 5DXDA 2XVLA 2XUEA 2ZZQA 4W6YA 1BQPA 1HXS2 2AENA 4NHYA 5A3LA 2D7FA 1W2TA 1DF0A 1I1EA 5J3UA 4XJ9A 1OLME 3A0NA 2X09A 2NYYA 4BQ2A 1JH5A 3E97A 4W4ZA 4CZSA 3I3QA 3RJ2X 1GMMA 1NLRA 3OD0A 5FK7A 4NROA 3VLBB 1SCRA 4CP2A 2XLAA 3LDKA 1PMJX 2D98A 1DQ6A 4HVRA 1VRBA 4YNIA 2P4EA 3L9JT 2P17A 5H9QA 4HG6B 4YFWA 3ZXAC 1LHUA 4D7SA 4FFIA 3DECA 1FMD3 3NV4A 3WF1A 4WVVA 1DHKB 1OQ1A 5DPNA 3Q8CA 4Y22B 1ZREA 1HXS3 1J3PA 3FE5A 1YLLA 5FKBA 5F37A 4MSVA 1CAVB 4PIXA 1NOVA 4EWAA 4AGRA 1OD3A 1IZ3A 2BFUL 5FPBA 1HJGA 3RZHA 2YC4A 2E51A 4YARA 4P9WA 4LLOA 1NKGA 3ZLIA 4XBLA 1U0AA 2VW1A 4JGZB 5FZ8A 3LKJA 4WM8C 2X5IC 1W2NA 2FCVA 2ADDA 3PJQA 3OPZA 2VVFA 1LGNA 4CXXA 2BBVA 2HJIA 3A22A 3E6DA 1V6IA 1OOPA 2MEV1 2VZ3A 1W6OA 1GOGA 4XF0A 3MFAA 1ENQA 2A6VA 5KHJA 1OFNA 1YNAA 4YW1A 3CZUA 1J58A 3IM0A 3PUSA 4R9CA 1UKRA 3EBRA 4RGAA 4D94A 2CGPA 4EV0A 1UZZA 4B1LA 5M0TA 1W90A 1RUH2 3RVHA 1Q5OA 3NNFA 4LO6B 4M0HA 4EE2A 1K3IA 4QPIC 2WT0A 4IQPA 1F9KA 2JDPA 4XF3A 5I8SA 2WL1A 3P1IA 1SLTA 4AF9A 5A33B 2DFBA 2Y6FA 1DIWA 2TEPA 1WMFA 1Q8VA 1UF2C 4N7IA 1GNYA 3ZO0B 3AYAA 4FQZA 5FXWA 4AI1A 4XURA 4MGTA 1BZWA 3AXDA 1HQLA 1HDKA 4RS5B 1VBD1 1EYBA 5BPXA 2B7YA 4WM7A 3MW3A 4L9BA 1LODA 4LPLA 5C4WC 4HETA 4HOOA 1OKQA 4KI5M 2CTVA 1D4M3 4GWMA 5BNPA 5BYNA 5KXBA 1KDMA 5IW0A 1IPJA 1S0FA 2EXIA 2CDPA 4LNVA 4IE4A 3H3ZA 5JSPA 1W3VA 4XFFA 2FMYA 5I91A 1XXNA 2RDRA 5C9AB 2ORZA 3WQBA 1CWPA 4CRQA 4GD4A 1BCXA 1T6BX 3ON7A 3C7FA 1RUH3 2FDGA 1AR82 5GLTA 2W9XA 4I3GA 4CDXA 2XKOA 3MUZ1 3ZXDA 2ZKLA 3SLIA 2UWAA 1EV11 4LTAA 1XRUA 1VLNA 4JAAA 1W8OA 4UOJA 3J9SA 2ADEA 1U5IA 2WQZC 4KGQA 5FYZA 5A3MA 4FQ4A 2R043 4BMBA 4OHYA 1D4VB 1NE6A 4M4RA 1JZ7A 1S1AA 4XIKA 5KXDA 5G05L 4TXWA 4F83A 1N3PA 2ZBJA 2IFRA 3U1XA 2Q5TA 1DGLA 4HKLA 5FYHA 5FZ1A 4YVSB 5GJ6A 5KHHA 4FVVA 3THPA 1COV2 2BERA 1GFF2 4G9SB 1VRH1 1UWWA 1LOEA 3GALA 5JXJA 2WA3A 4L92A 1VBC3 3LWCA 1CZVA 5BUVA 4CDUC 5FLIA 3WP3A 3Q8FA 4NPRA 3O1TA 4Q4W1 3I7DA 5DAPA 4DRVA 3BCWA 4OMDA 1B35C 3I3EA 1AF9A 2DWRA 1A8MA 5CKQA 5A7QA 2R32A 2NMOA 1K12A 4LBMA 2V5DA 5J09A 1LEDA 2DVDA 1O4ZA 4NUBA 4IV3C 5FJKA 1EUTA 1NE4A 4HXCA 1BEV2 3O0XA 4XUQA 4ZU4A 3LZZA 5F7UA 1QJU1 3CIHA 4LA3A 3EXUA 4GJZA 5T3NA 3WF2A 3QH6A 5FO7B 3ALQA 2RM22 2EXKA 3VZKA 3GHNA 2JKBA 4QGMA 4XFBA 4LO5B 1UYPA 3J26N 1VAKA 1CAUB 5LBCA 3WNKA 5JLVA 2MPFA 2EAAA 5AFBA 1QWRA 3HD8B 1D0HA 3T2PA 2JD9A 4XILA 1MZEA 1L7RA 1GZCA 2UU8A 2YGMA 2XVGA 4UFJA 5JI7A 3JD73 3RYKA 4D3WA 2VCBA 1UZVA 5FPVA 2DCZA 3SCFA 1FOD1 5BV6A 3VDDB 1SDWA 5EWSA 1GP6A 2A6XA 4N9IA 5LK7B 3D0SA 3AXEA 4LKEA 4ISRA 1J3QA 2R0HA 5ANNA 1XU2A 1BLZA 2WS92 5C8WA 5E8AA 4BXSV 3VBOC 2RM23 3GZEA 4LORA 3ZSLA 2XHNA 2JG8A 3HNBM 1AR63 3LA2A 2WZR2 5DN2A 3VBFA 5T52A 4BQXA 2ZGQA 1KFUL 4QU2A 4AI3A 4F8AA 1WCDJ 4XFHA 5LW9A 3DUIA 2QQIA 4P9IA 4XDQA 2VMDA 5A1AA 1LENA 3I54A 4NE9A 1OT5A 4IL7A 1RVF1 3N3HA 1O5LA 3WXPA 1SPPB 5JVVA 3N9OA 1L7QA 5F8PA 2Q8DA 3NQHA 1W05A 1H9WA 1JBCA 1QJX2 3V64A 3BYWA 3TEZA 2I45A 4OUMA 5A3TA 2OKXA 2WKKA 2A75A 4QX3A 5F3EA 2GZWA 5GZCA 2HWD1 2JDUA 1XE7A 3EJKA 3O1MA 1A3KA 1RJ8A 1D7PM 1WBFA 3TEYA 2WZ8A 5T5PA 1JZ8A 2ZX1A 1RUI1 3Q8EA 2JICA 4UW5A 4COYA 1UZYA 5A1LA 2H6CA 4CDWA 1OSGA 1VBB2 2YC0A 1R091 4HPKB 3BPZA 5F6KA 2LW8A 1CAXB 1WW5A 2ORXA 1Q8SA 3B93A 4QXHA 2RE9A 4GAZA 4OHVA 1C4RA 4YZ5A 3ACHA 4DPNA 2X8KA 3KM5A 4JV4A 4P9LA 4F7ZA 4LK6A 1FI2A 1F4AA 1HRI2 3PTYA 3HT1A 5FY8A 2VTFA 4Y4RA 3CHXA 5FCCA 1OI6A 4CCKA 1KGYA 4FPCA 4LEJA 1ND2A 1XYNA 1NQJA 5EV7A 2J1RA 2OW4A 3OOXA 3U14A 3WUCA 3AP7A 4D6QA 3USUA 4IEWA 3ZSMA 3TN91 1JZ6A 4XCBA 1APNA 2X29A 1O4TA 4IXLA 4ET7A 5FR3A 4O61A 1ZBA3 3RSJA 5CFDC 2CAVA 4UFHA 2L9LA 1QDCA 3C7OA 2WNEA 1ODNA 2PHDA 3POJA 1S0DA 4MHRA 1W03A 5JAXA 4Q0PA 5HPOA 4Y5SA 4BIOA 1IS3A 4PI2A 5DAVA 2B42B 2Y0IA 1L3JA 2K46A 1FPN2 1ZRCA 2BPA2 1HV0A 5EJZB 4Q4Y2 2BBAA 4KWUA 4Q1RA 4QKNA 2W1WA 2BGCA 2PTMA 4IEXA 4WVMB 5KR7A 2WNVB 3CLPA 4A2UA 2GN3A 2R073 1QOSA 3NVCA 4YGCA 4PF5A 2JE9A 3QCWA 1AYM2 1JYXA 4BU2A 4ZKTB 2SBAA 2ZGMA 3JCIA 4INDA 4YVWA 5F2SA 5F5AA 5L7OB 4S2DA 4IEPA 3LFIA 1AL23 4BLIA 4Q4X3 3ACFA 1RUF3 2JECA 4CCCA 2OQ6A 1S2EA 2BEOA 2RMU3 3I97A 3TNQA 3WQ0A 4Z2AA 3VL9A 5K0UB 4L8QA 3ZXGA 4PLOA 3WW2A 1UD1A 4OUEA 3HPNA 5K8SA 3WDVA 1U5XA 3OBTA 1PK6C 2NLRA 5GLVA 5L73A 3ZR5A 5AFEA 5KBFA 3M3EA 1RUNA 1P8JA 3UKTA 1TMF3 3IIAA 2VMIA 1FPN3 3PUAA 2WBKA 3CQOA 3WINE 4BWOA 1W8HA 2OA2A 4Y22A 3E5UA 2HWB2 3J7MA 1HRV1 3DPRB 4AEMA 3WP6A 1DQ4A 2OYZA 1TME3 3ZIXA 1CAVA 4XDOA 2XB6C 1PZ9A 4JHTA 2V4VA 4HN0A 1RITA 3RYRA 4AQ2A 2KXLA 2PHWA 2ZX2A 4QX0A 4RQPA 1W6PB 3B94A 2A6YA 4BM8A 3VD9A 1SBDA 1SQ4A 2N7GA 3NRUA 1CR7A 4AW7A 4XJWA 2CU5A 1SG3A 1K5MC 2VVDA 4CUGA 3FN9A 2V5YA 1NXD1 4MG2A 1Z7S3 1UU4A 1BVP1 4LHKA 3H8XA 2VZTA 3I4IA 3X29B 5FWEA 2ZMKA 4CXYA 1ZRDA 4NMIA 1POV0 2JB4A 3FMGA 5D1IA 5CISA 4B4QA 3QD6A 1RYYA 3T0BA 5CFCA 5DUVA 1JYCA 5IFPA 5CNAA 4DNYA 4E4HA 2B45X 2BU9A 4FFFA 5FP9A 4D69A 5HXMA 1XYPA 5A33A 3KV5A 5J98B 1WMXA 1MEC1 2UURA 3GF6A 5JZGC 3C7GA 2GMMA 2VULA 5FZOA 4DRRA 4GXLA 3ATGA 3CBNA 3MI8A 3J7HA 4B29A 3AMHA 3C2UA 1RUE1 1LECA 1SBEA 3OG2A 4XJ8A 4HN1A 1CD3G 2VMCA 1MQTA 5JIAA 3AKSA 4CPBD 5HCAA 2D5HA 4DFSA 3VKOA 5FBJA 4GH4B 4RR3B 3BODA 2LUWA 3LIGA 5C9AA 3ZXFA 5IVBA 1IG0A 4PLMA 3GYDA 4A45A 2MEV2 4Y1ZA 3TNPB 1ONAA 1UOJA 3WW4A 5FYYA 4K8RB 4KU8A 4CEYC 2B8MA 1BBT1 3PURA 1OHFA 2O8OA 4QDRA 1BHGA 1VBE3 4Q0UA 1ASJ3 5HI0A 1LAJA 2WNOA 2XLGA 4YFZA 2VMFA 2QQPA 1V6KA 5JDBA 5LEKA 3SKJE 4FFHA 1OOPB 1W0NA 1W6OB 1F31A 4BQ5A 4EJRA 3MFCA 3I3DA 1DQ0A 4R8HA 1Y4WA 5DDJ1 3AMQA 3TB0A 3ZFEC 4PLNA 3GGLA 4FBFA 2A71A 1IQAA 2JDZA 3C7EA 3DYMA 4CU7A 4RGKA 2Q8CA 1VBD2 2GP3A 3VKLA 3ASIA 3LOBA 3PU8A 3ORJA 4LULA 1LHVA 2XGXA 3ACIA 3P3NA 4COUA 3LA7A 4Z82A 4U36A 3O1RA 1Y9QA 4YYOA 3VHNA 5FZKA 3KVAA 4LITA 1LHOA 1UOGA 5GKAC 1RJ7A 4MGIE 1Q8OA 1OF4A 4WM7B 2D6OX 3R05A 2E31A 5FZFA 4Y1XA 3ZYGA 5HV0A 4TZDA 3MLLA 3SEPA 5FPAA 2HWF3 1DQ5A 5BNPB 5IVFA 4QXBA 1WCQA 4B1MA 3LSDA 4XJAA 2XJRA 1NCRC 1DZTA 2C24A 3CJIC 4BXFA 1JHJA 5A3NA 5C3QA 1EV12 2YBKA 3D0JA 4HLTA 3VZLA 3RJRA 3AJYA 1BXHA 1DBNA 1YCIA 1ZZ9A 3KHBA 1G7YA 3VHOA 2X05A 4YSFA 2FHRA 2V72A 3O14A 5FZAA 1K45A 5A6ZA 2C4XA 1GNZA 4QPIB 1C5HA 3PMEA 4QX5A 2PAEA 3VN4A 5EZWA 4CCNA 1VRH2 3T09A 5FKCA 3VDDA 3TYJA 2VCAA 1UPSA 1VB2A 3LA3A 1W28A 2D3PA 3FHIB 5I0RA 3APBA 5J36A 3M3IA 4Q4W2 4XJZA 2IZWA 3K2OA 2RG4A 4ZS3A 5LRRA 5C4WB 4YG6A 4MGQA 2JEMA 1RUD3 2WDBA 3O5SA 5JOZA 2Y0OA 5FMOL 2F4LA 1EV13 2RS51 4HVOA 4NOTA 5AVAA 5JMOA 4N43A 2R49A 1R1A3 3DXTA 3I2IA 4XQDA 1AZDA 1VALA 2D6LX 1QJU2 4C0HA 3B7MA 1RL3A 2VOKA 3ZYHA 1ZA4A 5BNOC 3CMGA 5J48A 4K1YA 4CA9A 1EPZA 4IE5A 3BUCA 1H6YA 3R4SA 2WABA 2LALA 2P3YA 3B5LB 5FXVA 2DFCA 1AYN1 3ZYFA 3HBZA 3GBGA 4AQSA 2KA3A 5FRAA 2WFPA 1SPPA 3SEEA 2VNVA 5C3PA 2IXIA 4XFGA 2E7QA 5D2AA 2VH9A 2WN2A 2Z4FA 4KWKA 5A6YA 3DYOA 4A7KA 3VBUC 5L19A 3AMNA 4Q4W3 3KT1A 4UW3A 3WEZA 1JOJA 3PDQA 2PA7A 3R6SA 3BI3A 2RS11 1FOD2 3LPFA 3PUIA 1IGOA 3HT2A 4LKSA 1Q8PA 4ITCA 3FBMA 3P5BA 1H8TC 4RL7A 1LKNA 1JHNA 1VJ2A 3UKNA 3AYDA 3FHAA 4CDUB 1O5UA 2RJKA 1MS8A 1WCKA 4HPKA 4YM0A 5C3OA 3WY6A 2W5FA 1W9SA 2VM9A 5F3GA 1CAXA 1B35B 3NO8A 4K40A 3W59A 5LK5A 1VAVA 4QQHA 3W9AA 4D8MA 1MZ5A 2GNMA 4Q4V1 4IV1A 4HONA 2WN3A 3IB3A 4PCRA 1GWKA 5FUPA 4A3ZA 3FC0A 4IV3B 1KS5A 5CU1A 4MX3A 4FPHA 4LK7A 5LCWL 1ZVFA 1NA1A 1JU4A 2VZSA 4BQYA 2JG8B 1AXYA 2YMZA 1RVF2 2FZ1A 4OI1A 1RXFA 5T50A 1ZZ8A 1V6OA 3K3OA 1FATA 3VBFB 4LR4A 5A3WA 3BOWA 1ZZ7A 5FV3A 2ARAA 5FUIA 4O9GA 5JSOA 1R083 3POWA 5CVRA 5IVJA 3BB6A 4LKFA 2RDNA 5LBFA 1RC6A 1X50A 3WHTA 2HWD2 1FNZA 2XKPA 3NKTA 5C70A 1NX9A 1S4CA 2F6BA 1V9U3 2RS31 2ZMNA 3PJYA 2A3XA 3EO6A 4H14A 4QGLA 1RUG1 1I5PA 2RR11 2Y33A 1RUI2 1C8M3 4L11A 4P08A 2EAKA 5JMCA 5IWFA 4DUWA 2VXJA 1R092 3AX4A 3SITA 3ACLA 2YGLA 4KBBA 1Y3TA 2JDAA 4UFKA 4YZ4A 4COZA 4WVMA 1CPMA 3VBOB 4V2WA 4BISA 1WLTA 2WNVA 3T08A 2WA4A 2XG3A 3UL2A 3AKRA 4I02A 5FIXA 4EN9B 4IEOA 1OD5A 4RHV1 2YXSA 4HANA 4CDWB 3IMNA 5L7OA 1UIKA 4AVCA 5JI9A 2KM2A 1SBFA 1TNFA 4KQ7A 2WUHA 1W9YA 4BB3A 4OFGA 4CU9A 4UYBA 1LOFC 1MS1A 2HWD3 4EZHA 1YO8A 3JQWA 5K0UA 3T2TA 3VGIA 4URAA 5KHGA 2VUCA 4HSLA 4COVA 3B01A 2WFF3 2UYAA 1OUSA 2ZGPA 3TN92 1V6MA 3JBG1 1PO13 4LMFA 4B8EA 1VBA1 4MOAA 3RFRA 1LOCA 3N7JA 3S0MA 2IVJA 2X53S 5J96B 3GNEA 1R093 4CU8A 1DGWA 1ND2B 5B4XA 1DYOA 4FP3A 3J8F1 4QDSA 2Q8EA 5IAXA 3OUHA 2UWBA 4JRLA 4LHLA 3ZMOA 1LHWA 3ZYPA 4XW3A 4JQTA 3USUB 1UL9A 2HLEA 5FWJA 1O8PA 1QXPA 2RHPA 4H3WA 4IW3A 4K7JA 4ZONA 3WHUA 4EN0A 4ZZ5A 3BKZA 4UFIA 1Y7BA 2DBIA 2J1UA 3S30A 3ZFFA 1UAIA 4COWA 3VBRC 5IAVA 3KLSA 2WR9A 5IK8A 2QDRA 2ERFA 1WLWA 5EIYB 4X6QB 4DOUA 2D6NA 1QU0A 2C9AA 2OZ6A 3UJQA 3A7QA 3E6CC 3BVCA 4PBOA 3WNMA 4XAEA 4FP2A 2QUOA 1JS9A 1PVC3 4AZZA 1WD3A 3VD7A 1OURA 3RZJA 4PDWC 5T5OA 5H9RA 4OQ8A 1AR71 1YFYA 4GQ7A 3ZXKA 4YVWB 2XQXA 3WDUA 1JXNA 4CVUA 3K3NA 2DBNA 2QTWB 2QCSB 2RJLA 5FFOC 2BFUS 1I6XA 1PIV1 4CPBA 2DUOA 2XBO3 2AZ5A 2ZGNA 4E9KA 1HRV2 3H7YA 4NWWA 2BDRA 4A6OA 1J1LA 3ILFA 3KCCA 4CUAA 1JZ2A 4J6GA 2XJSA 3VUOA 5DZFA 2E7AA 3MGUA 2QQOA 2NP0A 4DY3A 1OH3A 3HNMA 3POGA 2PN5A 3DV8A 3NKGA 2JDHA 2EF6A 4JGYC 3RYPA 3TRSB 4YRDA 3HQRA 2GN7A 2D44A 2XJUA 4GH4A 1Z78A 2DU0A 4RR3A 1NXMA 5FY7A 3I2OA 3BIEA 4ZXEA 4YLZA 2FBEA 1QY4A 3DXUA 4XE9A 5F5IA 4JDOA 2A70A 4LA2A 2W91A 4BZ4A 2OUJA 4RQPB 4Y4YA 1ZZCA 1JMUB 1JU3A 2YPJA 2A3YA 1LJ7A 3FHQA 4IE7A 4LBOA 4G3YC 3AP5A 1QJFA 2W1SA 4W6WA 4D6RA 3IZOA 1W8FA 2DVFA 3WP5A 5DG1A 1F8VA 2ZHKA 2Q4SA 2W68A 4L2NA 4FPOB 1YFWA 4HK9A 4XFCA 2PLV1 4AHWA 5H9SA 1C8NA 1DZRA 2EIEA 3I3MA 3GZAA 3OJBA 2QNKA 4BQ3A 4ZU7A 1OUXA 2D3SA 2XL9A 1PK6B 3T0AA 1MEC2 1UX6A 4J1XA 5BXXA 4ONUA 5CFCB 2HYXA 5FZDA 5CAZA 2WINB 5LRSA 1EY2A 1POV1 1YI9A 3Q9OA 4FO9A 4DS0A 4L99A 1RUE2 2EIDA 3RMXA 5A32B 2IXHA 4DUVA 4QXKA 3A23A 1GQHA 1YQ8A 4OZXA 2BTVC 3S57A 2ARBA 1GSLA 1WLCA 3S7IA 4C8DA 2B5HA 2Q1FA 4XHXA 1K5JA 5JOYA 4CSWA 5FZOB 3AM2A 4QPGC 3W58A 4WM8A 1O7FA 2JDMA 2W2IA 2X5IA 1RHI1 3HJRA 1MQTB 1VMJA 5C71A 1K5MB 2OUHA 3KCXA 4YGDA 1BBT2 4HMZA 3VBSC 1TG7A 1QXRA 2TBVA 4Q0SA 2XQRA 2ETEA 3JZVA 1DCSA 5I0TA 1QMJA 5HBAA 1XNBA 3HVDA 4E2GA 1N1SA 2VMGA 4XAAA 1NY71 4QX7A 4LHNA 3NWKA 3U4XA 1VPHA 3H1MA 1HX6A 3K46A 2ILMA 4AFBA 5JXHA 1H2MA 4FCAA 5DDJ2 4OLLA 4QPIA 2Y6HA 4F3JA 2F4PA 1HB2A 2W95A 2AGSA 5A7WA 2H0BA 3POSA 3IAQA 2VE1A 3RQ0A 1HIXA 3VZNA 4PQQA 3B02A 4TWTA 2F17A 2VO5A 3ZYJB 3MHZA 2QQWA 2XMLA 1B09A 5C4WA 1JI6A 5ANQA 3KGLA 2ARXA 4GALA 1ND3C 3K4AA 4OVEA 1UXXX 2WNUC 4M3CA 4P5YA 4E27A 3M70A 3M1HA 2YDEA 1GANA 2J1SA 2VXRA 3T4VA 4GMP3 5FDBA 2VBBA 4CEWC 2QZ3A 1QIQA 1AR83 5C7GA 2YB7A 5F1RA 1XNDA 3G6JB 1V00A 3DL3A 1G9CA 2B46X 2JG9C 4HKWA 1UQXA 2YROA 4KBZA 3WDTA 4XFAA 3ZM8A 4CEYB 2OT7A 3FWEA 2O8QA 5BY5A 1KITA 1LEMA 1XBFA 5IJRA 4LUMA 3AKQA 3MIHA 2BZDA 3BALA 3I2KA 5DZGA 3ECQA 3VZOA 5EHDA 2BYVE 1KFXL 1GP5A 2QFEA 1COV3 1CONA 2C9KA 1OBNA 4QWNA 2P1BA 4NWVA 4GB31 2ZS6B 2LRPA 2JE7A 4NAOA 1L7LA 4XTMA 2FDIA 5C5TA 2ZEZA 2BUKA 3AMMA 1AJKA 1CX4A 2G19A 4CDUA 1UZ0A 4YGBA 1UIJA 4N53C 3OPWA 4CCMA 1ST8A 2GNTA 1KD7A 2OPKA 3OYWA 3J7LA 3OBRA 1MR5A 3PLQA 5D8AC 3S5QA 4M00A 1B35A 2CAUA 2RS52 4K21A 4M01A 2IXJA 1WWYA 1CZTA 2K2SA 4KH9A 1JZ3A 4ZZ8A 1BEV3 1UW8A 4P9JA 4EQVA 4LO7A 1WD4A 5DAWA 3ZN6B 4IV3A 5CG9A 3RWKX 4NRPA 2FZ2A 3URFA 2DDUA 3OEBA 1F15A 2YYOA 3WR0A 2GC2A 1W6NB 4IE0A 1DYPA 1NCRB 4Q0QA 1AYN2 4Y1UA 3ZYBA 1RTVA 3E5XA 4N43B 4YW2A 2BNMA 3AZVA 4PF1A 4XQWA 4NHLA 3DEMA 4NO4A 4Q27A 3ZKYA 1NCQC 4ASLA 2XJPA 2A5ZA 2EIBA 1HV1A 2PHRA 3ETPA 3GZUC 4FOYA 5FMDA 4JDMA 3HQUA 2ZEWA 3NAPC 4XYXA 1WBLA 3ETQA 5IT6A 2RS12 1QJY2 3N35A 5IVCA 2ZGRA 5A7NA 1LU2A 5EJ1B 4DXZA 5BNNC 4IESA 2JX9A 3N9LA 1VIWB 4JVAA 3CNAA 4XJUA 5FOJB 4PHZA 3QH7A 3AL6A 4QD2A 3LEMA 5FK8A 5FZHA 3WOGA 4Z1VA 2JJ6A 1SCSA 2DTYA 3ZFGC 5ABJC 2WS93 1SLIA 3DYPA 5APAA 3WDXA 2ZJCA 5L9VA 3IDCB 3POFA 1URXA 1AHSA 3EMRA 3KHCA 2ZGLA 2R0FA 4HKOA 4Q4V2 4FPGA 3VBOA 2WZR3 4IEVA 3JB4C 4NN0A 3HBKA 4R4ZA 1SEFA 4HBNA 3BU0A 2GALA 1JYTA 2CYFA 2OQ7A 2ZHLA 3NJXA 4B4RA 4RFT0 4MGYE 2VCMA 2QKDA 4P9YA 4FTSA 1RUC1 3MIGA 2WQ8A 5F3IA 5J7MA 1QJY3 4IV1B 4QQLA 1OLRA 3DKQA 3W5MA 2BGPA 2H0VA 4QX2A 2Y6LA 5EXOA 1H30A 5CIRA 3M8LA 1QJX3 2YBSA 4RD7A 2KD7A 1QJZA 5CKNA 2ZGOA 3LCPA 3QBQA 1NA1B 3FFQA 3VDAA 3VBUB 5KXEA 3VKMA 4E4SA 3H42B 5FP3A 4IEUA 1QNYA 4E2QA 1WMDA 3NSTA 4YG0A 3T3YA 4B3NA 3O12A 2RS32 5FLJA 3O7OA 1RUG2 1QNWA 2RR12 2JIJA 1W6MB 3KSCA 5IUQA 5I93A 5GZEA 5KWRA 5FY4A 1WLDA 5B2GB 1S0EA 3WCRA 3SQOA 1H8TB 1YFUA 4URTA 1TNRA 3WT3A 1E5SA 1VBB3 2EXHA 3ILNA 4HZFA 3P6BA 2JD4A 4YZ3A 1UYXA 3INAA 4DXSA 4CCEA 2XJQA 3RI9A 2D93A 3Q8BA 4A6SA 1QXJA 2J7MA 4RHV2 2VQAA 1EAH1 2DCTA 1HRI3 4FTBA 5F5CA 4YM3A 5KC6A 2UWCA 1CGPA 2A6WA 1H6XA 1UX7A 2W52A 3U10A 1W8ZA 2Z79A 2FCTA 2XHKA 3VZJA 1SACA 1AXZA 5EYXA 1PO21 4R4XA 1S0GA 3WCSA 1OC1A 1OLQA 1OPMA 1RMU1 2J1TA 2O14A 1RUG3 4Q8KA 2VL4A 3JBG2 1W2AX 1VBA2 2V4AA 3KV9A 3MBWA 2BNNA 1KEXA 2LROA 3KCYA 1HQNA 1SDDB 3WF0A 2YBPA 2WT2A 2NZ9A 3WF3A 1Y9MA 4G4FA 4R9DA 3PNAA 4IGPA 3J8F2 2XWBB 5FP7A 3OBZA 4AHXA 4I3PA 5FQ0A 4R9AA 3K51A 4W50A 5CFDA 2IXKA 3NV2A 1SFNA 4C91A 4H2AA 2P2KA 2DUQA 1GQPA 4LBKA 2JDKA 4QKDA 2VY0A 1FMD1 4JKLA 4TN7A 4Q4Y3 3WUDA 4ASMB 4JGZC 5DQ0A 4DXRA 5EFUA 1EP0A 5K9YA 2VMHA 1BK1A 1X33A 3WG4A 5LATA 4AYUA 3D3AA 3AZZA 2W1QA 3CF6E 1AYM3 5JIUA 3RRDA 3LF7A 2R6QA 4L0PA 5FUNA 1A34A 1YHFA 2YFUA 1H9PA 1OVSA 3A4UA 4Y20B 5J1XA 4AVSA 2A3WA 4X8NA 1PNGA 5F6LB 4BIFA 3I8TA 3MPPG 3V0BB 4RN5A 4NHMA 3ZFFB 1ULOA 1MPXA 1AR72 2RJ2A 4AFCA 1O3TA 1T2XA 4E8CA 4AHZA 2A73B 3KF3A 4R9BA 2R30A 1DGRN 2PHXA 3U4SA 1V6NA 3U75A 1PIV2 3D82A 3LOIA 4N8MA 1PK6A 4QX8A 1CZSA 4XABA 5LB6A 2D6KA 2HWB3 5SV8A 2BRTA 1PM4A 4RS5C 4CDQC 1VP6A 5IVEA 3NNLA 1W99A 2WLPA 4QGNA 3T0DA 5FZ4A 1QGLA 1HB1A 4V1PA 3N9MA 5A32A 4Y24A 3I59B 1US2A 5A7OA 4D6SA 4OQ9A 3CZJA 1S2KA 2YY1A 2WO2A 3ELNA 4P9XA 5HCFA 5LZ6A 3ZDSA 4AI0A 5DUWA 2VNGA 2ES3A 4ES8A 2CGNA 5KC5A 4YW6A 2Y38A 2J1VA 4I0BA 1VR3A 1S0CA 1SLAA 4GKXA 1O6UA 1AR73 3VBHC 1DU3D 3OF1A 4CP0A 1K5MA 2HH9A 4P9GA 1D4M1 4XF4A 4CTEA 4QB1A 2P5BA 4IGQA 4BCUA 4UBHA 4CP1A 1PIV3 4XXAA 5B4NA 1XSRA 2W39A 4NR1A 4CYDA 2DCJA 2PLV2 1C3HA 2Z5WA 3A21A 4E4ZA 1OFSA 1WW4A 2I74A 1REFA 1LULA 1NZCA 1BJQA 4MADA 4YVSC 1GV9A 4LBJA 1UN1A 4QKFA 2AH2A 5LWBA 3IN9A 3H3UA 5FP8A 1CIWA 3WDYA 3ZPYA 5JZGA 1LOAA 5C5UA 2YZ4A 1DLCA 2A7AA 2R041 3E6BA 1H4HA 3FLRA 2QZ2A 1I5ZA 1JUIA 2CDOA 3LEIA 4HVQA 5ACA1 4YM1A 1ZX5A 4XF9A 3KGZA 3V65A 2EICA 4JGYB 1O3SA 4NRQA 4XZPA 3ABZA 4BE3A 1W9FA 3MIDA 2CL2A 1RIRA 4IETA 2P37A 1RHI2 5DABA 2MEV3 2XONA 1VBC1 1CQ9A 1UCXA 2NQYA 4RA0A 3R4UA 2XVKA 4KL1A 3TOJA 4EROA 5JPMB 2W46A 1YJLA 5FOBB 4WZFA 4UT5A 4CEYA 2J1EA 1ULPA 1H0BA 2DVBA 2GC1A 3LGRA 1GUIA 4WM8B 2X5IB 3PIGA 4LXLA 3T1LA 1NY72 5H9PA 1GZ9A 4KMQA 5FMCA 3BTZA 2GC0A 3BTAA 5CEHA 4PI0A 3C3VA 3N7MA 4RSUA 1OF3A 5FZEA 4H7MA 2ZACA 4EZ4A 1BMV1 5GZFA 4FFGA 4XUPA 1F5JA 1QH6A 2P3IA 4AXOA 1DGRA 1LRHA 3ZFEA 3WNOA 1VBD3 2QQLA 3ZN5A 5EPAA 3FUQA 1QOTA 3GCXA 5FMOS 2XWJB 1PNFA 1GNHA 1UY3A 4Q8LA 2RV9A 2HWE1 1UXZA 2JIGA 4LE3A 5FZ6A 3ZXEA 2VZOA 3IKWA 1XNAA 3ZOIA 1O3RA 3BPSA 5A7WB 3JD71 3OTFA 3MYXA 4M0NA 5A70A 5DAQA 1HJFA 3MIBA 4W8JA 3ZN6A 3VZMA 1OQDA 1C57A 2UYBA 2XUMA 1M4WA 5SV5A 2EA7A 2SLIA 4M3CB 5C6CA 4KNCA 1AVBA 1W6NA 4XACA 1MZFA 4NIAA 1NCRA 3VBSB 1XOYA 3N9NA 2PQSA 4I0AA 3L2YA 2K9ZA 3CJIA 5LBEA 5A80A 3R0RA 3ZXLA 5LEJA 1OH4A 1ZZBA 5F5QA 1GZWB 1AR61 2P3JA 4XBQA 5IVVA 2ZX4A 4ATFA 3MLKA 4MYEA 1W6QA 4NIIA 1CPNA 1NAEA 4QHOA 4Z92B 1VRH3 4GB32 2AEZA 2XL7A 3KT7A 1JYVA 4YW7A 3MUY1 1AUYA 1ODMA 2R1DA 3KF5A 1O91A 2O0OA 2WSVA 1AR91 2PAKA 3WSOA 1UY0A 4OZOA 2P6CA 5EP9A 4MGKE 3CEWA 1GYKA 1R1ZA 4GZ9A 4ZPIA 3WQ7A 5E16A 4YWAA 5C8CC 4XETA 1GOHA 1YYNA 1FXZA 5A7PA 4AEDC 1ZNPA 3DKWA 2E32A 3AZXA 5EJ3A 4EWDA 2VJXA 2LM3A 5CYYA 1ZRRA 4AFDA 1QJU3 2ZOEB 1NZIA 3NL1A 3H8OA 3OYWB 5BNOA 4QM9A 3LAGA 5E6HA 1WA4A 3CJXA 4X8PA 3TEXA 4GA9A 1JOPA 1MACA 2PHLA 1OMIA 4XCAA 3PVBB 1LR5A 1QHDA 2VR4A 3OGSA 3B69A 2EVXA 1CIYA 4Q29A 4ARYA 2ID4A 1YUDA 4D0QA 1WW7A 1O3QA 3PIJA 4K1ZA 3LDRA 3N4MA 2UY8A 4GWIA 4N7UA 4Y5TA 3ACGA 3LFMA 5I0UA 3VBUA 1FOD3 3UGGA 5IATA 2PHFA 4M3CF 1BYHA 1JYNA 2R061 1ZYBA 1ZA7A 4CUBA 1X8EA 4EYUA 4IGOA 1HQWA 5LY1A 4QB6A 1W6MA 1SLBA 4LBQB 3TWIA 4UFLA 1N3QA 4MXVA 2FDHA 1H8TA 3OSDA 3PUHA 2FDFA 2VNRA 2ARCA 4QU1A 4Q5OA 3ROUA 2Z2SB 3AVSA 4OULA 3ES1A 4Y1YA 1ZBA1 5D8AB 2WWUA 3CL1A 4M3CE 3MV11 5F3CA 3HAGA 4LBQD 4XFIA 2GP5A 2VQUA 3SXWA 1JYWA 1UY1A 4DXTA 4AK3A 1HW5A 3S6PA 4B7EA 1G9DA 4LO8A 2CV6A 2FCUA 2W87A 4XIOA 3V0AA 2WZEA 3OGJA 5FO8B 4GKYA 1RUC2 4JTOA 2D43A 3M3CA 3AP4A 2C1FA 1RVF3 4OI2A 2QQVA 1WKYA 1HB4A 1K42A 4AR2A 2NM1A 3WG3A 4ATEA 4CUCA 1JYIA 1G86A 2E7TA 3VHPA 5I0SA 1JZ4A 3THCA 2R071 4UWDA 1CJPA 1PVXA 1YQCA 2IVIB 1F2NA 2ZGUA 5FZGA 4IEYA 3M3OA 4ZU5A 4BHPA 4UW4A 4AVVA 3W5NA 5BNQA 2VZ1A 3I3BA 3NAPB 4NRMA 1GR3A 1AL21 3DPRC 4Q4X1 1RUF1 5FPLA 1WGPA 3B00A 4BDVB 5BNNB 2BW8A 2RMU1 5HV4A 1RUI3 5FPXA 4BJ0A 1RUJ1 1NLSA 1QQP1 3ZN4A 2VECA 2OX0A 2YUEA 1REDA 4MV2A 5T55A 3HMYA 4YZ1A 5JOXA 1KXGA 1FAYA 4GWJA 1SZBA 3SCHA 1RUC3 3QOPA 1TMF1 4ZY9A 2E6VA 1W04A 1MS3A 2WWSA 2OIIA 5HCHA 2G9ZA 1EAH2 1S0BA 1F35A 1N1VA 1TME1 4JKKA 1MVQA 2VCCA 1DYKA 4LE4A 2VUAA 3AP6A 2CGOA 1G8WA 5JR7B 1PMIA 4FPYA 1Z0HA 2P3KA 4Y20A 1ULCA 2B9UA 4J25A 3V0BA 1QOOA 1QEXA 1YEWA 4S2FA 3H50A 3AFGA 1PO22 5A3OA 4A3XA 1RMU2 4JTNA 1LOFA 2ZAAA 1JOBA 4Y1VA 4AI9A 4DMIA 1X7NA 2GAUA 2E33A 4OYUA 3TN93 1E5RA 2ZZJA 3AP9A 1Z7S1 2J1AA 5ISLA 4MUVA 4OMCA 4K3UA 4DUXA 4FTEA 3HQXA 1SFPA 1AXKA 2VTXJ 4AHYA 5FMBA 3TAYA 2G4IA 5FY9A 3GJAA 3NNGA 2GNBA 3AYCA 1NUKA 3T1MA 1PHMA 3LSEA 3I59A 1WA6X 4FPEA 4QHBA 1FMD2 2WYSA 3AYEA 1DZQA 4P5HA 3KS7A 1AX0A 2ZKNA 3POBA 4XC9A 5FY1A 3N7LA 1UPIA 5FQ0B 5CFDB 4JZRA 5CBLA 3GDBA 1PGSA 4LLFA 4LUKA 3ITQA 1XSQA 3K77A 1PO23 5EYYA 1UMHA 3ZYIB 1RMU3 2J42A 4UF0B 4CCOA 1W8WA 4KU7A 4MGZE 2GU9A 3RGBA 5I8YA 1W2OA 2DTWA 4O65A 1X8MA 5FYBA 3VBRA 3WVJA 2BJSA 1LOBA 2CY6A 3HR9A 3IAPA 1F5FA 2A1XA 1HN1A 1N3OA 1DP0A 2GC3A 3QACA 3W20A 4PIYA 4DB5A 1CESA 1Q3EA 3NNJA 3D6EA 3C8XA 4FOQA 3NJZA 1OOPC 5FZ3A 3RNSA 3PVEA 5FY0A 3U07A 3ZSEA 3D8CA 5HCBA 2IC1A 5FP4A 5CG8A 1D2SA 4PDWA 5JXIA 4B4PA 3ENRA 5EQUA 4AQ6A 4AVAA 1J1TA 1GWMA 2HBUA 2Y34A 4FPKA 4AGGA 5FYSA 3EB7A 1GU3A 1N1TA 1W9WA 5A1FA 3IDAA 3WDWA 5JUVA 1VBE1 1HRV3 1ASJ1 2WWJA 4ZS2A 5DG2A 4IDZA 3VL8A 3NJVA 2GDFA 2AUYA 3LEGA 1WCSA 1S0IA 2WAAA 4QQ2A 3UETA 2C0ZA 2EIGA 2W08A 1PMHX 3T4HB 1OA2A 4FXKB 3ZKUA 4AEJA 4JGYA 1TE1B 4AI8A 1ENXA 5JR2A 3N9PA 4LQRA 2VUJA 4WM7C 1D2QA 4GMP0 3PVNA 1NG0A 4FOVA 5FZ9A 1IKQA 3MV01 4DEQA 5BNPC 3VD4A 2YU2A 4CU6A 3V56A 1D4M2 3PTRB 4NJ4A 3A0KA 3ILRA 3LEKA 4UAPA 4WVZA 1U12A 2WT1A 3N9QA 1DGWX 2NMNA 3AK0A 1Q43A 4DZGA 3WLUA 2R16A 4DQAA 2YHJA 4GIQA 2B9VA 1DLLA 2VG9A 3IWZA 3UGFA 2G9GA 1FT9A 2HWF1 4CDXC 1FV2A 2VNOA 4AI2A 2Y6GA 5E88A 2E9QA 3RWNA 3BTYA 4BH9A 4V2VA 1MEC3 1XU1A 1YIFA 5F2WA 5I8TA 4QQOA 4MZUA 2B4KA 4IE6A 1G6NA 5LY2A 5JCTA 3AZWA 4KG8A 5F39A 3EHKA 3SHRA 2WIIB 2HEWF 3UESA 4PJYA 1RUE3 1GQGA 3OD4A 1UU6A 1KDKA 2DCYA 2R042 1DFQA 4AAXA 4CDQB 3VHRA 1O8SA 1BKZA 3LPGA 5ACA2 2E26A 3WX5A 3ZSJA 5KHKA 3BU7A 2QQMA 4LKDA 1YI7A 1XNKA 4MHUA 1CN1A 1UY4A 2I07B 3AL5A 1TZOA 3K48A 4JKMA 3LQCA 5JZGB 1ENSA 1VBC2 4TLFA 4QPGA 1AX1A 1LNSA 5JPNB 1BBT3 2H6BA 2JDYA 5GM0A 3VBHB 3PU3A 3VBSA 3PHMA 2DVAA 2VOXA 3KD4A 5CZKA 1RUD1 5FZ7A 1AL0G 4H7LA 5AC91 5FPZA 4AEKA 2XH6A 1CAWA 4I09A 5DAXA 4BQ4A 1GZWA 4IERA 4OHWA 5DUXA 1MVEA 4ES9A 3TEWA 1R1A1 2Q1ZB 1BMV2 1PZ7A 4AAPA 5DDJ3 1H1MA 2B39A 3IPVA 2WRAA 2FD8A 2HKXA 1WZXA 3FBYA 5ACA3 4LBLA 1LGBA 3M3QA 1S0JA 1C1LA 2C5DA 4NPMA 2XPJA 3FL7A 2IUWA 2DURA 2BWAA 2EALA 3IBMA 5A3UA 1N1YA 2HWC1 4Z07A 3I2DA 2FQPA 2FDKA 1SFYA 1HN0A 3I2HA 4QB2A 1RB8G 5CA6A 2HWE2 1H4GA 2Q8OA 2WAOA
chains in the Genus database with same CATH topology
2FDGA 4IE0A 3S5AA 2FDHA 3H8XA 3O1MA 3BTXA 2FDFA 4CXYA 4QKDA 3BTZA 3O1OA 3S57A 4ZS3A 3RZKA 4ZS2A 4IDZA 3H8RA 4NIDA 3T4HB 4IE5A 3BUCA 3I3QA 3RZGA 4NROA 3O1TA 3RZMA 3KHCA 3BKZA 4NRMA 3BU0A 4NJ4A 3BI3A 4O61A 4O7XA 4ZHNA 3RZJA 3BTYA 3RZHA 4NIIA 4QHOA 4IE6A 3T4VA 3O1PA 4QKNA 3T3YA 4CXXA 4RFRB 4NIGA 4QKBA 3RZLA 3O1RA 4OCTA 3I2OA 3BIEA 4QKFA 3H8OA 3I49A 2FDIA 4IE7A 4MGTA 3O1VA 4JHTA 3O1SA 3O1UA 2FDJA 2FD8A 4NRQA 3KHBA 4NPLA 4NIHA 4NPMA 3LFMA 3I3MA 4IE4A 2IUWA 5DABA 5F8PA 2FDKA 4CXWA 4NRPA 4MG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FDG A;  4IE0 A;  3S5A A;  2FDH A;  3H8X A;  3O1M A;  3BTX A;  2FDF A;  4CXY A;  4QKD A;  3BTZ A;  3O1O A;  3S57 A;  4ZS3 A;  3RZK A;  4ZS2 A;  4IDZ A;  3H8R A;  4NID A;  3T4H B;  4IE5 A;  3BUC A;  3I3Q A;  3RZG A;  4NRO A;  3O1T A;  3RZM A;  3KHC A;  3BKZ A;  4NRM A;  3BU0 A;  4NJ4 A;  3BI3 A;  4O61 A;  4O7X A;  4ZHN A;  3RZJ A;  3BTY A;  3RZH A;  4NII A;  4QHO A;  4IE6 A;  3T4V A;  3O1P A;  4QKN A;  3T3Y A;  4CXX A;  4RFR B;  4NIG A;  4QKB A;  3RZL A;  3O1R A;  4OCT A;  3I2O A;  3BIE A;  4QKF A;  3H8O A;  3I49 A;  2FDI A;  4IE7 A;  4MGT A;  3O1V A;  4JHT A;  3O1S A;  3O1U A;  2FDJ A;  2FD8 A;  4NRQ A;  3KHB A;  4NPL A;  4NIH A;  4NPM A;  3LFM A;  3I3M A;  4IE4 A;  2IUW A;  5DAB A;  5F8P A;  2FDK A;  4CXW A;  4NRP A;  4MG2 A; 
#chains in the Genus database with same CATH topology
 3NJY A;  3J4U H;  1GWL A;  3ZFE B;  2BNO A;  3M7A A;  1A78 A;  2WO3 A;  3H7J A;  3JD7 2;  4RGG A;  2WLQ A;  4SLI A;  3ZMN A;  4LO4 B;  2QJV A;  5JWP A;  1ND3 A;  1Q8Q A;  2WNU A;  2WSU A;  3JQX A;  5FZC A;  1FV3 A;  1NT0 A;  1Q56 A;  2Y6K A;  2ZHM A;  3WG2 A;  2MNG A;  3AVR A;  1RGS A;  4I0W B;  3RZK A;  4CEW A;  4R52 A;  4XUT A;  3OPT A;  2QDN A;  4DIN B;  3RMY A;  5JXG A;  3VD5 A;  2JG9 A;  1ZBE 1;  1U5Z A;  1GLH A;  2JG8 C;  2XDV A;  3NMB A;  4P14 A;  3CO2 A;  2JDN A;  4EN6 B;  4H55 A;  3NV1 A;  4NID A;  1AR6 2;  3VBF C;  1PGL 1;  2K0G A;  1R64 A;  5FLH A;  4WBB A;  2O1Q A;  1VMF A;  1IQD C;  2HWE 3;  2W94 A;  3POE A;  4Q2F A;  3WZ1 A;  2AR6 A;  4W6X A;  1LB2 A;  3SKV A;  5IHR A;  1V6J A;  5T5L A;  3RZM A;  2D6M A;  3CJI B;  3BIW E;  3HEI A;  4XMA A;  1UYY A;  1YJK A;  2E63 A;  3IT8 A;  2ZX3 A;  1AR9 2;  1AX2 A;  2DV9 A;  1MS9 A;  1MS4 A;  3OY8 B;  1VE0 A;  4LBQ A;  5FYU A;  5C3R A;  2RDS A;  1W6Q B;  4LOT A;  1J84 A;  1STM A;  2GH2 A;  3P3P A;  4YW4 A;  4C90 A;  1OQE A;  1R08 1;  4N53 A;  5FZB A;  2RS5 3;  3G7D A;  3POY A;  1GZT A;  1EPW A;  1PX4 A;  3E5Q A;  1FYU A;  1HB3 A;  2VAU A;  4JX0 A;  1V70 A;  5D8A A;  4JHZ A;  5GZG A;  3O0W A;  3PUQ A;  2VVE A;  2YC2 A;  4MH0 E;  1V9U 1;  3I2G A;  2VD7 A;  2D6P A;  1W2U A;  1UZW A;  5CB7 A;  4CDW C;  1KJL A;  1C8M 1;  4GWN A;  2G1M A;  3VKN A;  3EQE A;  4C0B A;  2Y26 A;  4QPY A;  1M06 G;  4DO0 A;  5F32 A;  1AYN 3;  2VQT A;  3SC7 X;  2JE8 A;  5CAD A;  4AVB A;  3E1F 1;  3KMH A;  1MS0 A;  1OLM A;  3ME2 A;  1UKG A;  1OPO A;  3MW2 A;  4QKB A;  2BP6 A;  1AR9 3;  2XJV A;  2BGO A;  2ZGK A;  1H2N A;  4UI9 L;  2P34 A;  2IXL A;  4CCD A;  1NCQ A;  4MXW A;  3BN6 A;  5BNO B;  2W92 A;  2RS1 3;  3B9I A;  4XOG A;  5FYC A;  1IOA A;  1ND2 C;  2IWG B;  3NAP A;  4XEZ A;  3UYJ A;  5JSR A;  2R06 2;  1EUU A;  2LTN A;  5A3P A;  2JXA A;  3AJZ A;  4BOW A;  2BVV A;  1KRI A;  5BNN A;  3AFK A;  1CX1 A;  3N36 A;  1W06 A;  2ZML A;  5LA1 A;  3NV3 A;  2PXJ A;  2W3J A;  1POQ A;  1LHN A;  3MF6 A;  3U0Z A;  2WFF 1;  2WYF A;  1GIC A;  4A44 A;  1PO1 1;  1XE8 A;  3ZFG A;  5ABJ A;  2AC1 A;  5C8C B;  1IS5 A;  2DYC A;  3O1V A;  4N90 A;  4Q4V 3;  1ZBA 2;  3D5O A;  3RZZ A;  4AED B;  4BQ1 A;  2ZEX A;  2FDJ A;  4Z2W A;  3UNP A;  1H1I A;  2ZHN A;  4HSJ A;  3ZSK A;  1ZZ6 A;  1KS4 A;  1REE A;  1TEI A;  2HEV F;  5T54 A;  3KB5 A;  2Y64 A;  4NHK A;  1N47 A;  1J59 A;  1DDL A;  1CJD A;  5IYY A;  1PGW 1;  3JXS A;  1LGC A;  5E89 A;  2ZAH A;  2GSY A;  3MEP A;  4XTP A;  1JN2 P;  3UGH A;  2R06 3;  4MVT A;  2E53 A;  3S5A A;  4YPJ A;  1YRZ A;  3VDB A;  2R07 2;  4YVW C;  3V0A B;  1IS4 A;  3BGA A;  3GBW A;  3O1O A;  2V73 A;  5FZM A;  4BA6 A;  1ALY A;  4UW6 A;  3LDB A;  2QBX A;  2WQ4 A;  4WZC A;  1NYW A;  4PQ9 A;  3OGG A;  1AL2 2;  3O0V A;  3ES4 A;  1SHW B;  4Q4X 2;  1PX3 A;  2ET7 A;  1RUF 2;  2RS3 3;  3LE0 A;  4PIZ A;  2BV4 A;  3MW4 A;  1FX5 A;  1PVC 1;  2RMU 2;  1XE0 A;  3SH4 A;  3WD5 A;  2RR1 3;  3UV9 A;  3OGV A;  2OPW A;  5F9T A;  1RUJ 2;  3MZH A;  1QQP 2;  2BQP A;  3VD3 A;  1GOF A;  5HXV A;  1UY2 A;  1JZ5 A;  1YQ5 A;  1CVN A;  1AJO A;  3R4D B;  2ZGS A;  1NQD A;  4AFM A;  4CP9 B;  2PYT A;  1TMF 2;  2HEY F;  4K9S A;  1GP4 A;  4A42 A;  2XBO 1;  4I01 A;  3AC0 A;  3WQ1 A;  3PMS A;  5G04 L;  3H3L A;  5LA9 A;  4AOC A;  4AVT A;  2D40 A;  1IKP A;  1TME 2;  4RHV 3;  5FY5 A;  4UF0 A;  1QF3 A;  1S55 A;  1KJR A;  1RXG A;  4RQP C;  1O4Y A;  2ZXQ A;  2BVB A;  3T30 A;  1YIP A;  3DCQ A;  4AFA A;  3IDB B;  2PHU A;  4IEZ A;  1HXS 1;  5IK7 A;  3S7E A;  4E2S A;  3LIH A;  4ZHN A;  2TNF A;  3KQ4 B;  3F2Z A;  1W39 A;  1H2L A;  2DU1 A;  2ZCW A;  3H0O A;  1JTZ X;  3LD8 A;  4N9H A;  1WW6 A;  3HWJ A;  4QQP A;  2VC9 A;  2VZP A;  3JBG 3;  4UFM A;  2DVG A;  4OUS A;  1RUJ 3;  1VBA 3;  1Z7S 2;  1QQP 3;  3HN3 A;  4YW3 A;  1DQ2 A;  5GLW A;  1HLC A;  4BPZ A;  4XXP A;  1YQ2 A;  4QDQ A;  4FOW A;  5JOW A;  3SIS A;  3ZR6 A;  5CFC C;  1F4H A;  4Q0V A;  2GMP A;  3J8F 3;  3JB8 A;  3MLJ A;  3WNP A;  1IHM A;  5A6X A;  4ORF A;  3JU9 A;  2VZR A;  2W0X A;  5IFT A;  4FAG A;  3KV4 A;  4FSJ A;  4MO3 M;  1IG3 A;  2XOM A;  3VV1 A;  4RFR B;  4AE2 A;  4NHX A;  2Q30 A;  3OUI A;  1J83 A;  5FYV A;  3O1S A;  2Q1M A;  2DF7 A;  4Q26 A;  4QXC A;  4BME A;  2YG0 A;  4ASK A;  1FNY A;  4JGZ A;  4Z8B A;  4E4D X;  3WW1 A;  1V6L A;  3GZT B;  3I2F A;  4Y5Z 0;  2ZAB A;  3K4D A;  1MQT C;  2KR2 A;  4MLO A;  4TLG A;  3HNY M;  4K20 A;  4ARX A;  4BK4 A;  5C33 A;  2D97 A;  4EWE A;  5C9A C;  1XB9 A;  4FT8 A;  4HFS A;  2PEL A;  3L2H A;  4X6R B;  2C26 A;  4XUO A;  5FZL A;  2BOJ A;  4TYS A;  2GND A;  2WZP P;  4K6B A;  4AL9 A;  5K7P A;  4CCL A;  1WUV A;  1UO9 A;  2XLF A;  4HT1 T;  3ZIW A;  2PMW B;  2OVU A;  2WO7 A;  2PAM A;  3KWV A;  3VBR B;  2VZV A;  1QKQ A;  1W3X A;  4QMA A;  5AVP A;  4YZ2 A;  3DF0 A;  3THD A;  1T6G C;  3H8U A;  3ZDV A;  1O59 A;  1VBE 2;  1VMH A;  1ASJ 2;  4KG0 A;  3VKF C;  4FPJ A;  1XQN A;  1LU1 A;  2GH8 A;  4KWL A;  1XYO A;  3MO4 A;  1YFX A;  3PVO A;  4PDW B;  4RS5 A;  4UBG A;  4CDQ A;  1RUH 1;  3KT4 A;  1ZM1 A;  4CCJ A;  5E1R A;  3PL0 A;  4LIV A;  5T5J A;  4D7Y A;  5FPU A;  4PT6 A;  1VAM A;  4P00 B;  3I2J A;  2EXJ A;  3ZPO A;  3GXU A;  1X9P A;  5GZD A;  3WV6 A;  1LTE A;  1LCL A;  2ET1 A;  5KXC A;  4JDN A;  2PHT A;  2LS6 A;  4Y3O A;  2AEY A;  4TSV A;  4BYY A;  4B7K A;  2YU1 A;  3UKV A;  3WP4 A;  3AKT A;  1E57 A;  2WC2 A;  1UNB A;  3U78 A;  5IK5 A;  1MZ6 A;  3HIF A;  3K75 B;  4SBV A;  3VBH A;  3GHM A;  5IVY A;  1G9A A;  1J3R A;  2QQK A;  1V0A A;  4P02 B;  3B3Q E;  1DG6 A;  2IFW A;  2V09 A;  3MF9 A;  2PLV 3;  2Y8K A;  2R1B A;  2HWF 2;  1Y43 B;  2VOV A;  2X10 A;  4GMP 1;  2VOT A;  4JQR A;  3RDI A;  1AR8 1;  4C1W A;  1NLQ A;  2CNA A;  4Q1P A;  2ZTN A;  3KV6 A;  1XC6 A;  2MHF A;  2WO1 A;  3MDP A;  1HKD A;  4YVS A;  2ZGT A;  1POV 3;  2VGD A;  1A6C A;  3III A;  5DZE A;  2QVS B;  1X9T A;  2NN8 A;  3BOP A;  5GLU A;  4EN8 B;  5KHI A;  4U2A A;  4J1W A;  3MIC A;  4O7X A;  5FXZ A;  1ZRI A;  4HL0 A;  2QQU A;  3VDD C;  5K4L A;  1PZ8 A;  2VUD A;  4LJH A;  4K8F A;  1XJA A;  2OS2 A;  2VW2 A;  1COV 1;  2ZA9 A;  2Y60 A;  4YGE A;  3ZXJ A;  1UMI A;  4MET A;  1BK0 A;  5FO9 B;  4XVH A;  1RHI 3;  1WME A;  5FAX A;  4RYD A;  2CWM A;  3H1Y A;  5GLZ A;  1OA4 A;  3THT A;  3M4F A;  4FPF A;  4QM8 A;  1RIN A;  1SLC A;  2QE3 A;  2VZU A;  3O1P A;  4TTG A;  4NAM A;  1H1A A;  3UT0 A;  1RUD 2;  2VW0 A;  3GCW A;  5L9B A;  5AC9 2;  4N43 C;  3LB9 A;  3D4K A;  1OA3 A;  1W8N A;  3H1W A;  4QPG B;  4Y33 A;  2YV8 A;  5D21 A;  1R1A 2;  2OXB A;  5TSW A;  4A7Y A;  1RUO A;  1CAU A;  1BEV 1;  5FZI A;  3FFZ A;  1KQR A;  2TUN A;  5IK4 A;  3OBA A;  1G9B A;  4CDX B;  4QT6 A;  1LES A;  3RI8 A;  1ULE A;  2VU9 A;  2AYH A;  4WV8 A;  3M2M A;  4E8D A;  2RM2 1;  2CSG A;  1TVG A;  3OB8 A;  1CAW B;  1QJE A;  3FZ3 A;  2HWC 2;  2ZEY A;  4O9E A;  3OGR A;  3VB9 A;  5ERL A;  1JW6 A;  2R7E B;  4DY5 A;  3OY8 A;  3FLT A;  4BLJ A;  5DUU A;  1SLL A;  3IPV B;  4XPV A;  1Y9G A;  2XJT A;  4JCK A;  4A41 A;  4YM2 A;  3WW3 A;  4AGV A;  3ST7 A;  1JUH A;  3I49 A;  4WVW A;  3B9C A;  4OHZ A;  1LOG A;  3AMP A;  1S2B A;  4UXA A;  3CU7 A;  5AC9 3;  2PFW A;  1JOD A;  3O1U A;  1X36 A;  2JEN A;  2ZX0 A;  3FUO A;  3VDC A;  4BK5 A;  4GJY A;  4QHZ A;  5A7S A;  3KVB A;  1OXC A;  3OEA A;  5LAS A;  4AQT A;  3ZYR A;  4M4P A;  2XR4 A;  4JC1 A;  1VB4 A;  2OZJ A;  1ZBE 2;  2WS9 1;  2QQJ A;  4L97 A;  1ND3 B;  1E5H A;  2HBT A;  2WNU B;  4CXW A;  4IV1 C;  3WNX A;  3HOB A;  1PGL 2;  2HWC 3;  3K4Z A;  1C5I A;  4PBP A;  5FYT A;  4AG4 A;  2WZR 1;  4CEW B;  2Z69 A;  2P6H A;  3RG0 A;  4FAH A;  1A8D A;  1NA1 C;  2JG9 B;  3GJB A;  2WJS A;  2DUP A;  2VZQ A;  4LHS A;  4GB3 3;  1SMV A;  3SNM A;  2VBP A;  1QJY 1;  3WG1 A;  4NVP A;  2AAC A;  1U5Y A;  1OVP A;  1MS5 A;  1W8T A;  1XNT A;  3MIE A;  4D7T A;  4GUL A;  1H8V A;  3T2Q A;  3H8R A;  1QJX 1;  1OKO A;  2XXZ A;  4BQW A;  3UK9 A;  4HK8 A;  2Y6J A;  1R08 2;  1D0G A;  5A6Q A;  4C1X A;  5C8C A;  1UU5 A;  3CKH A;  1ZBE 3;  4AED A;  1ACC A;  1ULF A;  1E5I A;  1UMZ A;  4MGS A;  5FBZ A;  3SH5 A;  2ENR A;  1W0P A;  1DQ1 A;  1US3 A;  4XF1 A;  3RZG A;  1V9U 2;  1GKB A;  4YW5 A;  4XDP A;  4FPL A;  3KQR A;  4Y26 A;  2DCK A;  1WCU A;  3WF4 A;  1C8M 2;  3RS6 A;  4IEQ A;  2UY9 A;  4LT5 A;  3GBF A;  4N53 B;  4EN7 B;  1X82 A;  2HYK A;  4AWD A;  2Z42 A;  2ZPX A;  4XQ4 A;  3SCG A;  1VBB 1;  4KGG A;  4XBN A;  3USS A;  4A4A A;  1W9T A;  4DEV A;  2J22 A;  1PM7 A;  2WNV C;  2IXC A;  3N7K A;  3NNM A;  2W1U A;  1ULD A;  2VBD A;  4XUN A;  1YQ6 A;  2JKX A;  3UJO A;  3RPQ A;  1IPS A;  1XNC A;  5L7O C;  1BVV A;  1HRI 1;  1G9F A;  2YFZ A;  3U11 A;  2BOI A;  3MIF A;  3FJS A;  3DN7 A;  3KZ4 C;  4FXG B;  4S2G A;  5GAL A;  2RVA A;  4DIQ A;  5K0U C;  3U37 A;  3F95 A;  3ZX7 A;  5LA2 A;  1NCQ B;  4MXW B;  3SH3 A;  4A7Z A;  2CWS A;  1YWK A;  1I3H A;  2WFF 2;  1IPK A;  5FTT C;  1PO1 2;  4OI0 A;  1W0O A;  4CP9 A;  2D5F A;  4NIG A;  3IDE A;  1ULG A;  4LIU A;  5FZ0 A;  1UYZ A;  5L9R A;  2PQQ A;  1YXW A;  2YPD A;  3CDZ B;  5FJH A;  2ATF A;  2VQ0 A;  4LOS A;  5LBB A;  3RZL A;  1YC6 1;  2W47 A;  3T2O A;  1UOF A;  4ISQ A;  3W21 A;  3FX3 A;  5CKM A;  4KWJ A;  4FI9 A;  5FYM A;  4ZXK A;  1ZRF A;  1UOB A;  2VPV A;  5FYI A;  3FLP A;  4OCT A;  4QX1 A;  3ZFG B;  5ABJ B;  2VOW A;  4OHX A;  5FXX A;  3ZVX A;  3WNL A;  4I30 A;  1PGW 2;  1FPN 1;  2GME A;  1XPW A;  1ENR A;  4Q4Y 1;  3NW4 A;  5I0D A;  3GM8 A;  1C1F A;  1I9R A;  4S2H A;  3ZFF C;  2A6Z A;  2CHH A;  3AB0 A;  4XHB A;  5C3S A;  3TBD A;  3H9A A;  3SMH A;  3Q8A A;  2G9F A;  1AYM 1;  3OUJ A;  4CE8 A;  5LA0 A;  1IS6 A;  3AZY A;  5J37 A;  3JUU A;  4JRA A;  2VTX A;  3AKP A;  2NPI A;  4NPL A;  3OCP A;  4NIH A;  1PVC 2;  4I2O A;  3POI A;  2RDQ A;  2VME A;  2Q0A A;  2JB8 A;  3IMM A;  3J7N A;  3DPR A;  3HN1 A;  4OI4 A;  4W65 A;  5FRE A;  5DMY A;  2C6S A;  1QDO A;  2FMD A;  4XZU G;  1GBG A;  2I2S A;  4XMI A;  1W6P A;  1C28 A;  2XBO 2;  2BWC A;  4IUG A;  3BTX A;  1W8U A;  3DGT A;  2HWB 1;  3MPB A;  2QQN A;  1EAH 3;  1QH7 A;  4QAW A;  3EYP A;  1TQ5 A;  4LBN A;  4YG3 A;  2JWP A;  2ARE A;  4QPW A;  4GH4 C;  4RR3 C;  3WNN A;  1H2K A;  3QLQ A;  3C7H A;  2D3R A;  5L36 A;  5DXD A;  2XVL A;  2XUE A;  2ZZQ A;  4W6Y A;  1BQP A;  1HXS 2;  2AEN A;  4NHY A;  5A3L A;  2D7F A;  1W2T A;  1DF0 A;  1I1E A;  5J3U A;  4XJ9 A;  1OLM E;  3A0N A;  2X09 A;  2NYY A;  4BQ2 A;  1JH5 A;  3E97 A;  4W4Z A;  4CZS A;  3I3Q A;  3RJ2 X;  1GMM A;  1NLR A;  3OD0 A;  5FK7 A;  4NRO A;  3VLB B;  1SCR A;  4CP2 A;  2XLA A;  3LDK A;  1PMJ X;  2D98 A;  1DQ6 A;  4HVR A;  1VRB A;  4YNI A;  2P4E A;  3L9J T;  2P17 A;  5H9Q A;  4HG6 B;  4YFW A;  3ZXA C;  1LHU A;  4D7S A;  4FFI A;  3DEC A;  1FMD 3;  3NV4 A;  3WF1 A;  4WVV A;  1DHK B;  1OQ1 A;  5DPN A;  3Q8C A;  4Y22 B;  1ZRE A;  1HXS 3;  1J3P A;  3FE5 A;  1YLL A;  5FKB A;  5F37 A;  4MSV A;  1CAV B;  4PIX A;  1NOV A;  4EWA A;  4AGR A;  1OD3 A;  1IZ3 A;  2BFU L;  5FPB A;  1HJG A;  3RZH A;  2YC4 A;  2E51 A;  4YAR A;  4P9W A;  4LLO A;  1NKG A;  3ZLI A;  4XBL A;  1U0A A;  2VW1 A;  4JGZ B;  5FZ8 A;  3LKJ A;  4WM8 C;  2X5I C;  1W2N A;  2FCV A;  2ADD A;  3PJQ A;  3OPZ A;  2VVF A;  1LGN A;  4CXX A;  2BBV A;  2HJI A;  3A22 A;  3E6D A;  1V6I A;  1OOP A;  2MEV 1;  2VZ3 A;  1W6O A;  1GOG A;  4XF0 A;  3MFA A;  1ENQ A;  2A6V A;  5KHJ A;  1OFN A;  1YNA A;  4YW1 A;  3CZU A;  1J58 A;  3IM0 A;  3PUS A;  4R9C A;  1UKR A;  3EBR A;  4RGA A;  4D94 A;  2CGP A;  4EV0 A;  1UZZ A;  4B1L A;  5M0T A;  1W90 A;  1RUH 2;  3RVH A;  1Q5O A;  3NNF A;  4LO6 B;  4M0H A;  4EE2 A;  1K3I A;  4QPI C;  2WT0 A;  4IQP A;  1F9K A;  2JDP A;  4XF3 A;  5I8S A;  2WL1 A;  3P1I A;  1SLT A;  4AF9 A;  5A33 B;  2DFB A;  2Y6F A;  1DIW A;  2TEP A;  1WMF A;  1Q8V A;  1UF2 C;  4N7I A;  1GNY A;  3ZO0 B;  3AYA A;  4FQZ A;  5FXW A;  4AI1 A;  4XUR A;  4MGT A;  1BZW A;  3AXD A;  1HQL A;  1HDK A;  4RS5 B;  1VBD 1;  1EYB A;  5BPX A;  2B7Y A;  4WM7 A;  3MW3 A;  4L9B A;  1LOD A;  4LPL A;  5C4W C;  4HET A;  4HOO A;  1OKQ A;  4KI5 M;  2CTV A;  1D4M 3;  4GWM A;  5BNP A;  5BYN A;  5KXB A;  1KDM A;  5IW0 A;  1IPJ A;  1S0F A;  2EXI A;  2CDP A;  4LNV A;  4IE4 A;  3H3Z A;  5JSP A;  1W3V A;  4XFF A;  2FMY A;  5I91 A;  1XXN A;  2RDR A;  5C9A B;  2ORZ A;  3WQB A;  1CWP A;  4CRQ A;  4GD4 A;  1BCX A;  1T6B X;  3ON7 A;  3C7F A;  1RUH 3;  2FDG A;  1AR8 2;  5GLT A;  2W9X A;  4I3G A;  4CDX A;  2XKO A;  3MUZ 1;  3ZXD A;  2ZKL A;  3SLI A;  2UWA A;  1EV1 1;  4LTA A;  1XRU A;  1VLN A;  4JAA A;  1W8O A;  4UOJ A;  3J9S A;  2ADE A;  1U5I A;  2WQZ C;  4KGQ A;  5FYZ A;  5A3M A;  4FQ4 A;  2R04 3;  4BMB A;  4OHY A;  1D4V B;  1NE6 A;  4M4R A;  1JZ7 A;  1S1A A;  4XIK A;  5KXD A;  5G05 L;  4TXW A;  4F83 A;  1N3P A;  2ZBJ A;  2IFR A;  3U1X A;  2Q5T A;  1DGL A;  4HKL A;  5FYH A;  5FZ1 A;  4YVS B;  5GJ6 A;  5KHH A;  4FVV A;  3THP A;  1COV 2;  2BER A;  1GFF 2;  4G9S B;  1VRH 1;  1UWW A;  1LOE A;  3GAL A;  5JXJ A;  2WA3 A;  4L92 A;  1VBC 3;  3LWC A;  1CZV A;  5BUV A;  4CDU C;  5FLI A;  3WP3 A;  3Q8F A;  4NPR A;  3O1T A;  4Q4W 1;  3I7D A;  5DAP A;  4DRV A;  3BCW A;  4OMD A;  1B35 C;  3I3E A;  1AF9 A;  2DWR A;  1A8M A;  5CKQ A;  5A7Q A;  2R32 A;  2NMO A;  1K12 A;  4LBM A;  2V5D A;  5J09 A;  1LED A;  2DVD A;  1O4Z A;  4NUB A;  4IV3 C;  5FJK A;  1EUT A;  1NE4 A;  4HXC A;  1BEV 2;  3O0X A;  4XUQ A;  4ZU4 A;  3LZZ A;  5F7U A;  1QJU 1;  3CIH A;  4LA3 A;  3EXU A;  4GJZ A;  5T3N A;  3WF2 A;  3QH6 A;  5FO7 B;  3ALQ A;  2RM2 2;  2EXK A;  3VZK A;  3GHN A;  2JKB A;  4QGM A;  4XFB A;  4LO5 B;  1UYP A;  3J26 N;  1VAK A;  1CAU B;  5LBC A;  3WNK A;  5JLV A;  2MPF A;  2EAA A;  5AFB A;  1QWR A;  3HD8 B;  1D0H A;  3T2P A;  2JD9 A;  4XIL A;  1MZE A;  1L7R A;  1GZC A;  2UU8 A;  2YGM A;  2XVG A;  4UFJ A;  5JI7 A;  3JD7 3;  3RYK A;  4D3W A;  2VCB A;  1UZV A;  5FPV A;  2DCZ A;  3SCF A;  1FOD 1;  5BV6 A;  3VDD B;  1SDW A;  5EWS A;  1GP6 A;  2A6X A;  4N9I A;  5LK7 B;  3D0S A;  3AXE A;  4LKE A;  4ISR A;  1J3Q A;  2R0H A;  5ANN A;  1XU2 A;  1BLZ A;  2WS9 2;  5C8W A;  5E8A A;  4BXS V;  3VBO C;  2RM2 3;  3GZE A;  4LOR A;  3ZSL A;  2XHN A;  2JG8 A;  3HNB M;  1AR6 3;  3LA2 A;  2WZR 2;  5DN2 A;  3VBF A;  5T52 A;  4BQX A;  2ZGQ A;  1KFU L;  4QU2 A;  4AI3 A;  4F8A A;  1WCD J;  4XFH A;  5LW9 A;  3DUI A;  2QQI A;  4P9I A;  4XDQ A;  2VMD A;  5A1A A;  1LEN A;  3I54 A;  4NE9 A;  1OT5 A;  4IL7 A;  1RVF 1;  3N3H A;  1O5L A;  3WXP A;  1SPP B;  5JVV A;  3N9O A;  1L7Q A;  5F8P A;  2Q8D A;  3NQH A;  1W05 A;  1H9W A;  1JBC A;  1QJX 2;  3V64 A;  3BYW A;  3TEZ A;  2I45 A;  4OUM A;  5A3T A;  2OKX A;  2WKK A;  2A75 A;  4QX3 A;  5F3E A;  2GZW A;  5GZC A;  2HWD 1;  2JDU A;  1XE7 A;  3EJK A;  3O1M A;  1A3K A;  1RJ8 A;  1D7P M;  1WBF A;  3TEY A;  2WZ8 A;  5T5P A;  1JZ8 A;  2ZX1 A;  1RUI 1;  3Q8E A;  2JIC A;  4UW5 A;  4COY A;  1UZY A;  5A1L A;  2H6C A;  4CDW A;  1OSG A;  1VBB 2;  2YC0 A;  1R09 1;  4HPK B;  3BPZ A;  5F6K A;  2LW8 A;  1CAX B;  1WW5 A;  2ORX A;  1Q8S A;  3B93 A;  4QXH A;  2RE9 A;  4GAZ A;  4OHV A;  1C4R A;  4YZ5 A;  3ACH A;  4DPN A;  2X8K A;  3KM5 A;  4JV4 A;  4P9L A;  4F7Z A;  4LK6 A;  1FI2 A;  1F4A A;  1HRI 2;  3PTY A;  3HT1 A;  5FY8 A;  2VTF A;  4Y4R A;  3CHX A;  5FCC A;  1OI6 A;  4CCK A;  1KGY A;  4FPC A;  4LEJ A;  1ND2 A;  1XYN A;  1NQJ A;  5EV7 A;  2J1R A;  2OW4 A;  3OOX A;  3U14 A;  3WUC A;  3AP7 A;  4D6Q A;  3USU A;  4IEW A;  3ZSM A;  3TN9 1;  1JZ6 A;  4XCB A;  1APN A;  2X29 A;  1O4T A;  4IXL A;  4ET7 A;  5FR3 A;  4O61 A;  1ZBA 3;  3RSJ A;  5CFD C;  2CAV A;  4UFH A;  2L9L A;  1QDC A;  3C7O A;  2WNE A;  1ODN A;  2PHD A;  3POJ A;  1S0D A;  4MHR A;  1W03 A;  5JAX A;  4Q0P A;  5HPO A;  4Y5S A;  4BIO A;  1IS3 A;  4PI2 A;  5DAV A;  2B42 B;  2Y0I A;  1L3J A;  2K46 A;  1FPN 2;  1ZRC A;  2BPA 2;  1HV0 A;  5EJZ B;  4Q4Y 2;  2BBA A;  4KWU A;  4Q1R A;  4QKN A;  2W1W A;  2BGC A;  2PTM A;  4IEX A;  4WVM B;  5KR7 A;  2WNV B;  3CLP A;  4A2U A;  2GN3 A;  2R07 3;  1QOS A;  3NVC A;  4YGC A;  4PF5 A;  2JE9 A;  3QCW A;  1AYM 2;  1JYX A;  4BU2 A;  4ZKT B;  2SBA A;  2ZGM A;  3JCI A;  4IND A;  4YVW A;  5F2S A;  5F5A A;  5L7O B;  4S2D A;  4IEP A;  3LFI A;  1AL2 3;  4BLI A;  4Q4X 3;  3ACF A;  1RUF 3;  2JEC A;  4CCC A;  2OQ6 A;  1S2E A;  2BEO A;  2RMU 3;  3I97 A;  3TNQ A;  3WQ0 A;  4Z2A A;  3VL9 A;  5K0U B;  4L8Q A;  3ZXG A;  4PLO A;  3WW2 A;  1UD1 A;  4OUE A;  3HPN A;  5K8S A;  3WDV A;  1U5X A;  3OBT A;  1PK6 C;  2NLR A;  5GLV A;  5L73 A;  3ZR5 A;  5AFE A;  5KBF A;  3M3E A;  1RUN A;  1P8J A;  3UKT A;  1TMF 3;  3IIA A;  2VMI A;  1FPN 3;  3PUA A;  2WBK A;  3CQO A;  3WIN E;  4BWO A;  1W8H A;  2OA2 A;  4Y22 A;  3E5U A;  2HWB 2;  3J7M A;  1HRV 1;  3DPR B;  4AEM A;  3WP6 A;  1DQ4 A;  2OYZ A;  1TME 3;  3ZIX A;  1CAV A;  4XDO A;  2XB6 C;  1PZ9 A;  4JHT A;  2V4V A;  4HN0 A;  1RIT A;  3RYR A;  4AQ2 A;  2KXL A;  2PHW A;  2ZX2 A;  4QX0 A;  4RQP A;  1W6P B;  3B94 A;  2A6Y A;  4BM8 A;  3VD9 A;  1SBD A;  1SQ4 A;  2N7G A;  3NRU A;  1CR7 A;  4AW7 A;  4XJW A;  2CU5 A;  1SG3 A;  1K5M C;  2VVD A;  4CUG A;  3FN9 A;  2V5Y A;  1NXD 1;  4MG2 A;  1Z7S 3;  1UU4 A;  1BVP 1;  4LHK A;  3H8X A;  2VZT A;  3I4I A;  3X29 B;  5FWE A;  2ZMK A;  4CXY A;  1ZRD A;  4NMI A;  1POV 0;  2JB4 A;  3FMG A;  5D1I A;  5CIS A;  4B4Q A;  3QD6 A;  1RYY A;  3T0B A;  5CFC A;  5DUV A;  1JYC A;  5IFP A;  5CNA A;  4DNY A;  4E4H A;  2B45 X;  2BU9 A;  4FFF A;  5FP9 A;  4D69 A;  5HXM A;  1XYP A;  5A33 A;  3KV5 A;  5J98 B;  1WMX A;  1MEC 1;  2UUR A;  3GF6 A;  5JZG C;  3C7G A;  2GMM A;  2VUL A;  5FZO A;  4DRR A;  4GXL A;  3ATG A;  3CBN A;  3MI8 A;  3J7H A;  4B29 A;  3AMH A;  3C2U A;  1RUE 1;  1LEC A;  1SBE A;  3OG2 A;  4XJ8 A;  4HN1 A;  1CD3 G;  2VMC A;  1MQT A;  5JIA A;  3AKS A;  4CPB D;  5HCA A;  2D5H A;  4DFS A;  3VKO A;  5FBJ A;  4GH4 B;  4RR3 B;  3BOD A;  2LUW A;  3LIG A;  5C9A A;  3ZXF A;  5IVB A;  1IG0 A;  4PLM A;  3GYD A;  4A45 A;  2MEV 2;  4Y1Z A;  3TNP B;  1ONA A;  1UOJ A;  3WW4 A;  5FYY A;  4K8R B;  4KU8 A;  4CEY C;  2B8M A;  1BBT 1;  3PUR A;  1OHF A;  2O8O A;  4QDR A;  1BHG A;  1VBE 3;  4Q0U A;  1ASJ 3;  5HI0 A;  1LAJ A;  2WNO A;  2XLG A;  4YFZ A;  2VMF A;  2QQP A;  1V6K A;  5JDB A;  5LEK A;  3SKJ E;  4FFH A;  1OOP B;  1W0N A;  1W6O B;  1F31 A;  4BQ5 A;  4EJR A;  3MFC A;  3I3D A;  1DQ0 A;  4R8H A;  1Y4W A;  5DDJ 1;  3AMQ A;  3TB0 A;  3ZFE C;  4PLN A;  3GGL A;  4FBF A;  2A71 A;  1IQA A;  2JDZ A;  3C7E A;  3DYM A;  4CU7 A;  4RGK A;  2Q8C A;  1VBD 2;  2GP3 A;  3VKL A;  3ASI A;  3LOB A;  3PU8 A;  3ORJ A;  4LUL A;  1LHV A;  2XGX A;  3ACI A;  3P3N A;  4COU A;  3LA7 A;  4Z82 A;  4U36 A;  3O1R A;  1Y9Q A;  4YYO A;  3VHN A;  5FZK A;  3KVA A;  4LIT A;  1LHO A;  1UOG A;  5GKA C;  1RJ7 A;  4MGI E;  1Q8O A;  1OF4 A;  4WM7 B;  2D6O X;  3R05 A;  2E31 A;  5FZF A;  4Y1X A;  3ZYG A;  5HV0 A;  4TZD A;  3MLL A;  3SEP A;  5FPA A;  2HWF 3;  1DQ5 A;  5BNP B;  5IVF A;  4QXB A;  1WCQ A;  4B1M A;  3LSD A;  4XJA A;  2XJR A;  1NCR C;  1DZT A;  2C24 A;  3CJI C;  4BXF A;  1JHJ A;  5A3N A;  5C3Q A;  1EV1 2;  2YBK A;  3D0J A;  4HLT A;  3VZL A;  3RJR A;  3AJY A;  1BXH A;  1DBN A;  1YCI A;  1ZZ9 A;  3KHB A;  1G7Y A;  3VHO A;  2X05 A;  4YSF A;  2FHR A;  2V72 A;  3O14 A;  5FZA A;  1K45 A;  5A6Z A;  2C4X A;  1GNZ A;  4QPI B;  1C5H A;  3PME A;  4QX5 A;  2PAE A;  3VN4 A;  5EZW A;  4CCN A;  1VRH 2;  3T09 A;  5FKC A;  3VDD A;  3TYJ A;  2VCA A;  1UPS A;  1VB2 A;  3LA3 A;  1W28 A;  2D3P A;  3FHI B;  5I0R A;  3APB A;  5J36 A;  3M3I A;  4Q4W 2;  4XJZ A;  2IZW A;  3K2O A;  2RG4 A;  4ZS3 A;  5LRR A;  5C4W B;  4YG6 A;  4MGQ A;  2JEM A;  1RUD 3;  2WDB A;  3O5S A;  5JOZ A;  2Y0O A;  5FMO L;  2F4L A;  1EV1 3;  2RS5 1;  4HVO A;  4NOT A;  5AVA A;  5JMO A;  4N43 A;  2R49 A;  1R1A 3;  3DXT A;  3I2I A;  4XQD A;  1AZD A;  1VAL A;  2D6L X;  1QJU 2;  4C0H A;  3B7M A;  1RL3 A;  2VOK A;  3ZYH A;  1ZA4 A;  5BNO C;  3CMG A;  5J48 A;  4K1Y A;  4CA9 A;  1EPZ A;  4IE5 A;  3BUC A;  1H6Y A;  3R4S A;  2WAB A;  2LAL A;  2P3Y A;  3B5L B;  5FXV A;  2DFC A;  1AYN 1;  3ZYF A;  3HBZ A;  3GBG A;  4AQS A;  2KA3 A;  5FRA A;  2WFP A;  1SPP A;  3SEE A;  2VNV A;  5C3P A;  2IXI A;  4XFG A;  2E7Q A;  5D2A A;  2VH9 A;  2WN2 A;  2Z4F A;  4KWK A;  5A6Y A;  3DYO A;  4A7K A;  3VBU C;  5L19 A;  3AMN A;  4Q4W 3;  3KT1 A;  4UW3 A;  3WEZ A;  1JOJ A;  3PDQ A;  2PA7 A;  3R6S A;  3BI3 A;  2RS1 1;  1FOD 2;  3LPF A;  3PUI A;  1IGO A;  3HT2 A;  4LKS A;  1Q8P A;  4ITC A;  3FBM A;  3P5B A;  1H8T C;  4RL7 A;  1LKN A;  1JHN A;  1VJ2 A;  3UKN A;  3AYD A;  3FHA A;  4CDU B;  1O5U A;  2RJK A;  1MS8 A;  1WCK A;  4HPK A;  4YM0 A;  5C3O A;  3WY6 A;  2W5F A;  1W9S A;  2VM9 A;  5F3G A;  1CAX A;  1B35 B;  3NO8 A;  4K40 A;  3W59 A;  5LK5 A;  1VAV A;  4QQH A;  3W9A A;  4D8M A;  1MZ5 A;  2GNM A;  4Q4V 1;  4IV1 A;  4HON A;  2WN3 A;  3IB3 A;  4PCR A;  1GWK A;  5FUP A;  4A3Z A;  3FC0 A;  4IV3 B;  1KS5 A;  5CU1 A;  4MX3 A;  4FPH A;  4LK7 A;  5LCW L;  1ZVF A;  1NA1 A;  1JU4 A;  2VZS A;  4BQY A;  2JG8 B;  1AXY A;  2YMZ A;  1RVF 2;  2FZ1 A;  4OI1 A;  1RXF A;  5T50 A;  1ZZ8 A;  1V6O A;  3K3O A;  1FAT A;  3VBF B;  4LR4 A;  5A3W A;  3BOW A;  1ZZ7 A;  5FV3 A;  2ARA A;  5FUI A;  4O9G A;  5JSO A;  1R08 3;  3POW A;  5CVR A;  5IVJ A;  3BB6 A;  4LKF A;  2RDN A;  5LBF A;  1RC6 A;  1X50 A;  3WHT A;  2HWD 2;  1FNZ A;  2XKP A;  3NKT A;  5C70 A;  1NX9 A;  1S4C A;  2F6B A;  1V9U 3;  2RS3 1;  2ZMN A;  3PJY A;  2A3X A;  3EO6 A;  4H14 A;  4QGL A;  1RUG 1;  1I5P A;  2RR1 1;  2Y33 A;  1RUI 2;  1C8M 3;  4L11 A;  4P08 A;  2EAK A;  5JMC A;  5IWF A;  4DUW A;  2VXJ A;  1R09 2;  3AX4 A;  3SIT A;  3ACL A;  2YGL A;  4KBB A;  1Y3T A;  2JDA A;  4UFK A;  4YZ4 A;  4COZ A;  4WVM A;  1CPM A;  3VBO B;  4V2W A;  4BIS A;  1WLT A;  2WNV A;  3T08 A;  2WA4 A;  2XG3 A;  3UL2 A;  3AKR A;  4I02 A;  5FIX A;  4EN9 B;  4IEO A;  1OD5 A;  4RHV 1;  2YXS A;  4HAN A;  4CDW B;  3IMN A;  5L7O A;  1UIK A;  4AVC A;  5JI9 A;  2KM2 A;  1SBF A;  1TNF A;  4KQ7 A;  2WUH A;  1W9Y A;  4BB3 A;  4OFG A;  4CU9 A;  4UYB A;  1LOF C;  1MS1 A;  2HWD 3;  4EZH A;  1YO8 A;  3JQW A;  5K0U A;  3T2T A;  3VGI A;  4URA A;  5KHG A;  2VUC A;  4HSL A;  4COV A;  3B01 A;  2WFF 3;  2UYA A;  1OUS A;  2ZGP A;  3TN9 2;  1V6M A;  3JBG 1;  1PO1 3;  4LMF A;  4B8E A;  1VBA 1;  4MOA A;  3RFR A;  1LOC A;  3N7J A;  3S0M A;  2IVJ A;  2X53 S;  5J96 B;  3GNE A;  1R09 3;  4CU8 A;  1DGW A;  1ND2 B;  5B4X A;  1DYO A;  4FP3 A;  3J8F 1;  4QDS A;  2Q8E A;  5IAX A;  3OUH A;  2UWB A;  4JRL A;  4LHL A;  3ZMO A;  1LHW A;  3ZYP A;  4XW3 A;  4JQT A;  3USU B;  1UL9 A;  2HLE A;  5FWJ A;  1O8P A;  1QXP A;  2RHP A;  4H3W A;  4IW3 A;  4K7J A;  4ZON A;  3WHU A;  4EN0 A;  4ZZ5 A;  3BKZ A;  4UFI A;  1Y7B A;  2DBI A;  2J1U A;  3S30 A;  3ZFF A;  1UAI A;  4COW A;  3VBR C;  5IAV A;  3KLS A;  2WR9 A;  5IK8 A;  2QDR A;  2ERF A;  1WLW A;  5EIY B;  4X6Q B;  4DOU A;  2D6N A;  1QU0 A;  2C9A A;  2OZ6 A;  3UJQ A;  3A7Q A;  3E6C C;  3BVC A;  4PBO A;  3WNM A;  4XAE A;  4FP2 A;  2QUO A;  1JS9 A;  1PVC 3;  4AZZ A;  1WD3 A;  3VD7 A;  1OUR A;  3RZJ A;  4PDW C;  5T5O A;  5H9R A;  4OQ8 A;  1AR7 1;  1YFY A;  4GQ7 A;  3ZXK A;  4YVW B;  2XQX A;  3WDU A;  1JXN A;  4CVU A;  3K3N A;  2DBN A;  2QTW B;  2QCS B;  2RJL A;  5FFO C;  2BFU S;  1I6X A;  1PIV 1;  4CPB A;  2DUO A;  2XBO 3;  2AZ5 A;  2ZGN A;  4E9K A;  1HRV 2;  3H7Y A;  4NWW A;  2BDR A;  4A6O A;  1J1L A;  3ILF A;  3KCC A;  4CUA A;  1JZ2 A;  4J6G A;  2XJS A;  3VUO A;  5DZF A;  2E7A A;  3MGU A;  2QQO A;  2NP0 A;  4DY3 A;  1OH3 A;  3HNM A;  3POG A;  2PN5 A;  3DV8 A;  3NKG A;  2JDH A;  2EF6 A;  4JGY C;  3RYP A;  3TRS B;  4YRD A;  3HQR A;  2GN7 A;  2D44 A;  2XJU A;  4GH4 A;  1Z78 A;  2DU0 A;  4RR3 A;  1NXM A;  5FY7 A;  3I2O A;  3BIE A;  4ZXE A;  4YLZ A;  2FBE A;  1QY4 A;  3DXU A;  4XE9 A;  5F5I A;  4JDO A;  2A70 A;  4LA2 A;  2W91 A;  4BZ4 A;  2OUJ A;  4RQP B;  4Y4Y A;  1ZZC A;  1JMU B;  1JU3 A;  2YPJ A;  2A3Y A;  1LJ7 A;  3FHQ A;  4IE7 A;  4LBO A;  4G3Y C;  3AP5 A;  1QJF A;  2W1S A;  4W6W A;  4D6R A;  3IZO A;  1W8F A;  2DVF A;  3WP5 A;  5DG1 A;  1F8V A;  2ZHK A;  2Q4S A;  2W68 A;  4L2N A;  4FPO B;  1YFW A;  4HK9 A;  4XFC A;  2PLV 1;  4AHW A;  5H9S A;  1C8N A;  1DZR A;  2EIE A;  3I3M A;  3GZA A;  3OJB A;  2QNK A;  4BQ3 A;  4ZU7 A;  1OUX A;  2D3S A;  2XL9 A;  1PK6 B;  3T0A A;  1MEC 2;  1UX6 A;  4J1X A;  5BXX A;  4ONU A;  5CFC B;  2HYX A;  5FZD A;  5CAZ A;  2WIN B;  5LRS A;  1EY2 A;  1POV 1;  1YI9 A;  3Q9O A;  4FO9 A;  4DS0 A;  4L99 A;  1RUE 2;  2EID A;  3RMX A;  5A32 B;  2IXH A;  4DUV A;  4QXK A;  3A23 A;  1GQH A;  1YQ8 A;  4OZX A;  2BTV C;  3S57 A;  2ARB A;  1GSL A;  1WLC A;  3S7I A;  4C8D A;  2B5H A;  2Q1F A;  4XHX A;  1K5J A;  5JOY A;  4CSW A;  5FZO B;  3AM2 A;  4QPG C;  3W58 A;  4WM8 A;  1O7F A;  2JDM A;  2W2I A;  2X5I A;  1RHI 1;  3HJR A;  1MQT B;  1VMJ A;  5C71 A;  1K5M B;  2OUH A;  3KCX A;  4YGD A;  1BBT 2;  4HMZ A;  3VBS C;  1TG7 A;  1QXR A;  2TBV A;  4Q0S A;  2XQR A;  2ETE A;  3JZV A;  1DCS A;  5I0T A;  1QMJ A;  5HBA A;  1XNB A;  3HVD A;  4E2G A;  1N1S A;  2VMG A;  4XAA A;  1NY7 1;  4QX7 A;  4LHN A;  3NWK A;  3U4X A;  1VPH A;  3H1M A;  1HX6 A;  3K46 A;  2ILM A;  4AFB A;  5JXH A;  1H2M A;  4FCA A;  5DDJ 2;  4OLL A;  4QPI A;  2Y6H A;  4F3J A;  2F4P A;  1HB2 A;  2W95 A;  2AGS A;  5A7W A;  2H0B A;  3POS A;  3IAQ A;  2VE1 A;  3RQ0 A;  1HIX A;  3VZN A;  4PQQ A;  3B02 A;  4TWT A;  2F17 A;  2VO5 A;  3ZYJ B;  3MHZ A;  2QQW A;  2XML A;  1B09 A;  5C4W A;  1JI6 A;  5ANQ A;  3KGL A;  2ARX A;  4GAL A;  1ND3 C;  3K4A A;  4OVE A;  1UXX X;  2WNU C;  4M3C A;  4P5Y A;  4E27 A;  3M70 A;  3M1H A;  2YDE A;  1GAN A;  2J1S A;  2VXR A;  3T4V A;  4GMP 3;  5FDB A;  2VBB A;  4CEW C;  2QZ3 A;  1QIQ A;  1AR8 3;  5C7G A;  2YB7 A;  5F1R A;  1XND A;  3G6J B;  1V00 A;  3DL3 A;  1G9C A;  2B46 X;  2JG9 C;  4HKW A;  1UQX A;  2YRO A;  4KBZ A;  3WDT A;  4XFA A;  3ZM8 A;  4CEY B;  2OT7 A;  3FWE A;  2O8Q A;  5BY5 A;  1KIT A;  1LEM A;  1XBF A;  5IJR A;  4LUM A;  3AKQ A;  3MIH A;  2BZD A;  3BAL A;  3I2K A;  5DZG A;  3ECQ A;  3VZO A;  5EHD A;  2BYV E;  1KFX L;  1GP5 A;  2QFE A;  1COV 3;  1CON A;  2C9K A;  1OBN A;  4QWN A;  2P1B A;  4NWV A;  4GB3 1;  2ZS6 B;  2LRP A;  2JE7 A;  4NAO A;  1L7L A;  4XTM A;  2FDI A;  5C5T A;  2ZEZ A;  2BUK A;  3AMM A;  1AJK A;  1CX4 A;  2G19 A;  4CDU A;  1UZ0 A;  4YGB A;  1UIJ A;  4N53 C;  3OPW A;  4CCM A;  1ST8 A;  2GNT A;  1KD7 A;  2OPK A;  3OYW A;  3J7L A;  3OBR A;  1MR5 A;  3PLQ A;  5D8A C;  3S5Q A;  4M00 A;  1B35 A;  2CAU A;  2RS5 2;  4K21 A;  4M01 A;  2IXJ A;  1WWY A;  1CZT A;  2K2S A;  4KH9 A;  1JZ3 A;  4ZZ8 A;  1BEV 3;  1UW8 A;  4P9J A;  4EQV A;  4LO7 A;  1WD4 A;  5DAW A;  3ZN6 B;  4IV3 A;  5CG9 A;  3RWK X;  4NRP A;  2FZ2 A;  3URF A;  2DDU A;  3OEB A;  1F15 A;  2YYO A;  3WR0 A;  2GC2 A;  1W6N B;  4IE0 A;  1DYP A;  1NCR B;  4Q0Q A;  1AYN 2;  4Y1U A;  3ZYB A;  1RTV A;  3E5X A;  4N43 B;  4YW2 A;  2BNM A;  3AZV A;  4PF1 A;  4XQW A;  4NHL A;  3DEM A;  4NO4 A;  4Q27 A;  3ZKY A;  1NCQ C;  4ASL A;  2XJP A;  2A5Z A;  2EIB A;  1HV1 A;  2PHR A;  3ETP A;  3GZU C;  4FOY A;  5FMD A;  4JDM A;  3HQU A;  2ZEW A;  3NAP C;  4XYX A;  1WBL A;  3ETQ A;  5IT6 A;  2RS1 2;  1QJY 2;  3N35 A;  5IVC A;  2ZGR A;  5A7N A;  1LU2 A;  5EJ1 B;  4DXZ A;  5BNN C;  4IES A;  2JX9 A;  3N9L A;  1VIW B;  4JVA A;  3CNA A;  4XJU A;  5FOJ B;  4PHZ A;  3QH7 A;  3AL6 A;  4QD2 A;  3LEM A;  5FK8 A;  5FZH A;  3WOG A;  4Z1V A;  2JJ6 A;  1SCS A;  2DTY A;  3ZFG C;  5ABJ C;  2WS9 3;  1SLI A;  3DYP A;  5APA A;  3WDX A;  2ZJC A;  5L9V A;  3IDC B;  3POF A;  1URX A;  1AHS A;  3EMR A;  3KHC A;  2ZGL A;  2R0F A;  4HKO A;  4Q4V 2;  4FPG A;  3VBO A;  2WZR 3;  4IEV A;  3JB4 C;  4NN0 A;  3HBK A;  4R4Z A;  1SEF A;  4HBN A;  3BU0 A;  2GAL A;  1JYT A;  2CYF A;  2OQ7 A;  2ZHL A;  3NJX A;  4B4R A;  4RFT 0;  4MGY E;  2VCM A;  2QKD A;  4P9Y A;  4FTS A;  1RUC 1;  3MIG A;  2WQ8 A;  5F3I A;  5J7M A;  1QJY 3;  4IV1 B;  4QQL A;  1OLR A;  3DKQ A;  3W5M A;  2BGP A;  2H0V A;  4QX2 A;  2Y6L A;  5EXO A;  1H30 A;  5CIR A;  3M8L A;  1QJX 3;  2YBS A;  4RD7 A;  2KD7 A;  1QJZ A;  5CKN A;  2ZGO A;  3LCP A;  3QBQ A;  1NA1 B;  3FFQ A;  3VDA A;  3VBU B;  5KXE A;  3VKM A;  4E4S A;  3H42 B;  5FP3 A;  4IEU A;  1QNY A;  4E2Q A;  1WMD A;  3NST A;  4YG0 A;  3T3Y A;  4B3N A;  3O12 A;  2RS3 2;  5FLJ A;  3O7O A;  1RUG 2;  1QNW A;  2RR1 2;  2JIJ A;  1W6M B;  3KSC A;  5IUQ A;  5I93 A;  5GZE A;  5KWR A;  5FY4 A;  1WLD A;  5B2G B;  1S0E A;  3WCR A;  3SQO A;  1H8T B;  1YFU A;  4URT A;  1TNR A;  3WT3 A;  1E5S A;  1VBB 3;  2EXH A;  3ILN A;  4HZF A;  3P6B A;  2JD4 A;  4YZ3 A;  1UYX A;  3INA A;  4DXS A;  4CCE A;  2XJQ A;  3RI9 A;  2D93 A;  3Q8B A;  4A6S A;  1QXJ A;  2J7M A;  4RHV 2;  2VQA A;  1EAH 1;  2DCT A;  1HRI 3;  4FTB A;  5F5C A;  4YM3 A;  5KC6 A;  2UWC A;  1CGP A;  2A6W A;  1H6X A;  1UX7 A;  2W52 A;  3U10 A;  1W8Z A;  2Z79 A;  2FCT A;  2XHK A;  3VZJ A;  1SAC A;  1AXZ A;  5EYX A;  1PO2 1;  4R4X A;  1S0G A;  3WCS A;  1OC1 A;  1OLQ A;  1OPM A;  1RMU 1;  2J1T A;  2O14 A;  1RUG 3;  4Q8K A;  2VL4 A;  3JBG 2;  1W2A X;  1VBA 2;  2V4A A;  3KV9 A;  3MBW A;  2BNN A;  1KEX A;  2LRO A;  3KCY A;  1HQN A;  1SDD B;  3WF0 A;  2YBP A;  2WT2 A;  2NZ9 A;  3WF3 A;  1Y9M A;  4G4F A;  4R9D A;  3PNA A;  4IGP A;  3J8F 2;  2XWB B;  5FP7 A;  3OBZ A;  4AHX A;  4I3P A;  5FQ0 A;  4R9A A;  3K51 A;  4W50 A;  5CFD A;  2IXK A;  3NV2 A;  1SFN A;  4C91 A;  4H2A A;  2P2K A;  2DUQ A;  1GQP A;  4LBK A;  2JDK A;  4QKD A;  2VY0 A;  1FMD 1;  4JKL A;  4TN7 A;  4Q4Y 3;  3WUD A;  4ASM B;  4JGZ C;  5DQ0 A;  4DXR A;  5EFU A;  1EP0 A;  5K9Y A;  2VMH A;  1BK1 A;  1X33 A;  3WG4 A;  5LAT A;  4AYU A;  3D3A A;  3AZZ A;  2W1Q A;  3CF6 E;  1AYM 3;  5JIU A;  3RRD A;  3LF7 A;  2R6Q A;  4L0P A;  5FUN A;  1A34 A;  1YHF A;  2YFU A;  1H9P A;  1OVS A;  3A4U A;  4Y20 B;  5J1X A;  4AVS A;  2A3W A;  4X8N A;  1PNG A;  5F6L B;  4BIF A;  3I8T A;  3MPP G;  3V0B B;  4RN5 A;  4NHM A;  3ZFF B;  1ULO A;  1MPX A;  1AR7 2;  2RJ2 A;  4AFC A;  1O3T A;  1T2X A;  4E8C A;  4AHZ A;  2A73 B;  3KF3 A;  4R9B A;  2R30 A;  1DGR N;  2PHX A;  3U4S A;  1V6N A;  3U75 A;  1PIV 2;  3D82 A;  3LOI A;  4N8M A;  1PK6 A;  4QX8 A;  1CZS A;  4XAB A;  5LB6 A;  2D6K A;  2HWB 3;  5SV8 A;  2BRT A;  1PM4 A;  4RS5 C;  4CDQ C;  1VP6 A;  5IVE A;  3NNL A;  1W99 A;  2WLP A;  4QGN A;  3T0D A;  5FZ4 A;  1QGL A;  1HB1 A;  4V1P A;  3N9M A;  5A32 A;  4Y24 A;  3I59 B;  1US2 A;  5A7O A;  4D6S A;  4OQ9 A;  3CZJ A;  1S2K A;  2YY1 A;  2WO2 A;  3ELN A;  4P9X A;  5HCF A;  5LZ6 A;  3ZDS A;  4AI0 A;  5DUW A;  2VNG A;  2ES3 A;  4ES8 A;  2CGN A;  5KC5 A;  4YW6 A;  2Y38 A;  2J1V A;  4I0B A;  1VR3 A;  1S0C A;  1SLA A;  4GKX A;  1O6U A;  1AR7 3;  3VBH C;  1DU3 D;  3OF1 A;  4CP0 A;  1K5M A;  2HH9 A;  4P9G A;  1D4M 1;  4XF4 A;  4CTE A;  4QB1 A;  2P5B A;  4IGQ A;  4BCU A;  4UBH A;  4CP1 A;  1PIV 3;  4XXA A;  5B4N A;  1XSR A;  2W39 A;  4NR1 A;  4CYD A;  2DCJ A;  2PLV 2;  1C3H A;  2Z5W A;  3A21 A;  4E4Z A;  1OFS A;  1WW4 A;  2I74 A;  1REF A;  1LUL A;  1NZC A;  1BJQ A;  4MAD A;  4YVS C;  1GV9 A;  4LBJ A;  1UN1 A;  4QKF A;  2AH2 A;  5LWB A;  3IN9 A;  3H3U A;  5FP8 A;  1CIW A;  3WDY A;  3ZPY A;  5JZG A;  1LOA A;  5C5U A;  2YZ4 A;  1DLC A;  2A7A A;  2R04 1;  3E6B A;  1H4H A;  3FLR A;  2QZ2 A;  1I5Z A;  1JUI A;  2CDO A;  3LEI A;  4HVQ A;  5ACA 1;  4YM1 A;  1ZX5 A;  4XF9 A;  3KGZ A;  3V65 A;  2EIC A;  4JGY B;  1O3S A;  4NRQ A;  4XZP A;  3ABZ A;  4BE3 A;  1W9F A;  3MID A;  2CL2 A;  1RIR A;  4IET A;  2P37 A;  1RHI 2;  5DAB A;  2MEV 3;  2XON A;  1VBC 1;  1CQ9 A;  1UCX A;  2NQY A;  4RA0 A;  3R4U A;  2XVK A;  4KL1 A;  3TOJ A;  4ERO A;  5JPM B;  2W46 A;  1YJL A;  5FOB B;  4WZF A;  4UT5 A;  4CEY A;  2J1E A;  1ULP A;  1H0B A;  2DVB A;  2GC1 A;  3LGR A;  1GUI A;  4WM8 B;  2X5I B;  3PIG A;  4LXL A;  3T1L A;  1NY7 2;  5H9P A;  1GZ9 A;  4KMQ A;  5FMC A;  3BTZ A;  2GC0 A;  3BTA A;  5CEH A;  4PI0 A;  3C3V A;  3N7M A;  4RSU A;  1OF3 A;  5FZE A;  4H7M A;  2ZAC A;  4EZ4 A;  1BMV 1;  5GZF A;  4FFG A;  4XUP A;  1F5J A;  1QH6 A;  2P3I A;  4AXO A;  1DGR A;  1LRH A;  3ZFE A;  3WNO A;  1VBD 3;  2QQL A;  3ZN5 A;  5EPA A;  3FUQ A;  1QOT A;  3GCX A;  5FMO S;  2XWJ B;  1PNF A;  1GNH A;  1UY3 A;  4Q8L A;  2RV9 A;  2HWE 1;  1UXZ A;  2JIG A;  4LE3 A;  5FZ6 A;  3ZXE A;  2VZO A;  3IKW A;  1XNA A;  3ZOI A;  1O3R A;  3BPS A;  5A7W B;  3JD7 1;  3OTF A;  3MYX A;  4M0N A;  5A70 A;  5DAQ A;  1HJF A;  3MIB A;  4W8J A;  3ZN6 A;  3VZM A;  1OQD A;  1C57 A;  2UYB A;  2XUM A;  1M4W A;  5SV5 A;  2EA7 A;  2SLI A;  4M3C B;  5C6C A;  4KNC A;  1AVB A;  1W6N A;  4XAC A;  1MZF A;  4NIA A;  1NCR A;  3VBS B;  1XOY A;  3N9N A;  2PQS A;  4I0A A;  3L2Y A;  2K9Z A;  3CJI A;  5LBE A;  5A80 A;  3R0R A;  3ZXL A;  5LEJ A;  1OH4 A;  1ZZB A;  5F5Q A;  1GZW B;  1AR6 1;  2P3J A;  4XBQ A;  5IVV A;  2ZX4 A;  4ATF A;  3MLK A;  4MYE A;  1W6Q A;  4NII A;  1CPN A;  1NAE A;  4QHO A;  4Z92 B;  1VRH 3;  4GB3 2;  2AEZ A;  2XL7 A;  3KT7 A;  1JYV A;  4YW7 A;  3MUY 1;  1AUY A;  1ODM A;  2R1D A;  3KF5 A;  1O91 A;  2O0O A;  2WSV A;  1AR9 1;  2PAK A;  3WSO A;  1UY0 A;  4OZO A;  2P6C A;  5EP9 A;  4MGK E;  3CEW A;  1GYK A;  1R1Z A;  4GZ9 A;  4ZPI A;  3WQ7 A;  5E16 A;  4YWA A;  5C8C C;  4XET A;  1GOH A;  1YYN A;  1FXZ A;  5A7P A;  4AED C;  1ZNP A;  3DKW A;  2E32 A;  3AZX A;  5EJ3 A;  4EWD A;  2VJX A;  2LM3 A;  5CYY A;  1ZRR A;  4AFD A;  1QJU 3;  2ZOE B;  1NZI A;  3NL1 A;  3H8O A;  3OYW B;  5BNO A;  4QM9 A;  3LAG A;  5E6H A;  1WA4 A;  3CJX A;  4X8P A;  3TEX A;  4GA9 A;  1JOP A;  1MAC A;  2PHL A;  1OMI A;  4XCA A;  3PVB B;  1LR5 A;  1QHD A;  2VR4 A;  3OGS A;  3B69 A;  2EVX A;  1CIY A;  4Q29 A;  4ARY A;  2ID4 A;  1YUD A;  4D0Q A;  1WW7 A;  1O3Q A;  3PIJ A;  4K1Z A;  3LDR A;  3N4M A;  2UY8 A;  4GWI A;  4N7U A;  4Y5T A;  3ACG A;  3LFM A;  5I0U A;  3VBU A;  1FOD 3;  3UGG A;  5IAT A;  2PHF A;  4M3C F;  1BYH A;  1JYN A;  2R06 1;  1ZYB A;  1ZA7 A;  4CUB A;  1X8E A;  4EYU A;  4IGO A;  1HQW A;  5LY1 A;  4QB6 A;  1W6M A;  1SLB A;  4LBQ B;  3TWI A;  4UFL A;  1N3Q A;  4MXV A;  2FDH A;  1H8T A;  3OSD A;  3PUH A;  2FDF A;  2VNR A;  2ARC A;  4QU1 A;  4Q5O A;  3ROU A;  2Z2S B;  3AVS A;  4OUL A;  3ES1 A;  4Y1Y A;  1ZBA 1;  5D8A B;  2WWU A;  3CL1 A;  4M3C E;  3MV1 1;  5F3C A;  3HAG A;  4LBQ D;  4XFI A;  2GP5 A;  2VQU A;  3SXW A;  1JYW A;  1UY1 A;  4DXT A;  4AK3 A;  1HW5 A;  3S6P A;  4B7E A;  1G9D A;  4LO8 A;  2CV6 A;  2FCU A;  2W87 A;  4XIO A;  3V0A A;  2WZE A;  3OGJ A;  5FO8 B;  4GKY A;  1RUC 2;  4JTO A;  2D43 A;  3M3C A;  3AP4 A;  2C1F A;  1RVF 3;  4OI2 A;  2QQV A;  1WKY A;  1HB4 A;  1K42 A;  4AR2 A;  2NM1 A;  3WG3 A;  4ATE A;  4CUC A;  1JYI A;  1G86 A;  2E7T A;  3VHP A;  5I0S A;  1JZ4 A;  3THC A;  2R07 1;  4UWD A;  1CJP A;  1PVX A;  1YQC A;  2IVI B;  1F2N A;  2ZGU A;  5FZG A;  4IEY A;  3M3O A;  4ZU5 A;  4BHP A;  4UW4 A;  4AVV A;  3W5N A;  5BNQ A;  2VZ1 A;  3I3B A;  3NAP B;  4NRM A;  1GR3 A;  1AL2 1;  3DPR C;  4Q4X 1;  1RUF 1;  5FPL A;  1WGP A;  3B00 A;  4BDV B;  5BNN B;  2BW8 A;  2RMU 1;  5HV4 A;  1RUI 3;  5FPX A;  4BJ0 A;  1RUJ 1;  1NLS A;  1QQP 1;  3ZN4 A;  2VEC A;  2OX0 A;  2YUE A;  1RED A;  4MV2 A;  5T55 A;  3HMY A;  4YZ1 A;  5JOX A;  1KXG A;  1FAY A;  4GWJ A;  1SZB A;  3SCH A;  1RUC 3;  3QOP A;  1TMF 1;  4ZY9 A;  2E6V A;  1W04 A;  1MS3 A;  2WWS A;  2OII A;  5HCH A;  2G9Z A;  1EAH 2;  1S0B A;  1F35 A;  1N1V A;  1TME 1;  4JKK A;  1MVQ A;  2VCC A;  1DYK A;  4LE4 A;  2VUA A;  3AP6 A;  2CGO A;  1G8W A;  5JR7 B;  1PMI A;  4FPY A;  1Z0H A;  2P3K A;  4Y20 A;  1ULC A;  2B9U A;  4J25 A;  3V0B A;  1QOO A;  1QEX A;  1YEW A;  4S2F A;  3H50 A;  3AFG A;  1PO2 2;  5A3O A;  4A3X A;  1RMU 2;  4JTN A;  1LOF A;  2ZAA A;  1JOB A;  4Y1V A;  4AI9 A;  4DMI A;  1X7N A;  2GAU A;  2E33 A;  4OYU A;  3TN9 3;  1E5R A;  2ZZJ A;  3AP9 A;  1Z7S 1;  2J1A A;  5ISL A;  4MUV A;  4OMC A;  4K3U A;  4DUX A;  4FTE A;  3HQX A;  1SFP A;  1AXK A;  2VTX J;  4AHY A;  5FMB A;  3TAY A;  2G4I A;  5FY9 A;  3GJA A;  3NNG A;  2GNB A;  3AYC A;  1NUK A;  3T1M A;  1PHM A;  3LSE A;  3I59 A;  1WA6 X;  4FPE A;  4QHB A;  1FMD 2;  2WYS A;  3AYE A;  1DZQ A;  4P5H A;  3KS7 A;  1AX0 A;  2ZKN A;  3POB A;  4XC9 A;  5FY1 A;  3N7L A;  1UPI A;  5FQ0 B;  5CFD B;  4JZR A;  5CBL A;  3GDB A;  1PGS A;  4LLF A;  4LUK A;  3ITQ A;  1XSQ A;  3K77 A;  1PO2 3;  5EYY A;  1UMH A;  3ZYI B;  1RMU 3;  2J42 A;  4UF0 B;  4CCO A;  1W8W A;  4KU7 A;  4MGZ E;  2GU9 A;  3RGB A;  5I8Y A;  1W2O A;  2DTW A;  4O65 A;  1X8M A;  5FYB A;  3VBR A;  3WVJ A;  2BJS A;  1LOB A;  2CY6 A;  3HR9 A;  3IAP A;  1F5F A;  2A1X A;  1HN1 A;  1N3O A;  1DP0 A;  2GC3 A;  3QAC A;  3W20 A;  4PIY A;  4DB5 A;  1CES A;  1Q3E A;  3NNJ A;  3D6E A;  3C8X A;  4FOQ A;  3NJZ A;  1OOP C;  5FZ3 A;  3RNS A;  3PVE A;  5FY0 A;  3U07 A;  3ZSE A;  3D8C A;  5HCB A;  2IC1 A;  5FP4 A;  5CG8 A;  1D2S A;  4PDW A;  5JXI A;  4B4P A;  3ENR A;  5EQU A;  4AQ6 A;  4AVA A;  1J1T A;  1GWM A;  2HBU A;  2Y34 A;  4FPK A;  4AGG A;  5FYS A;  3EB7 A;  1GU3 A;  1N1T A;  1W9W A;  5A1F A;  3IDA A;  3WDW A;  5JUV A;  1VBE 1;  1HRV 3;  1ASJ 1;  2WWJ A;  4ZS2 A;  5DG2 A;  4IDZ A;  3VL8 A;  3NJV A;  2GDF A;  2AUY A;  3LEG A;  1WCS A;  1S0I A;  2WAA A;  4QQ2 A;  3UET A;  2C0Z A;  2EIG A;  2W08 A;  1PMH X;  3T4H B;  1OA2 A;  4FXK B;  3ZKU A;  4AEJ A;  4JGY A;  1TE1 B;  4AI8 A;  1ENX A;  5JR2 A;  3N9P A;  4LQR A;  2VUJ A;  4WM7 C;  1D2Q A;  4GMP 0;  3PVN A;  1NG0 A;  4FOV A;  5FZ9 A;  1IKQ A;  3MV0 1;  4DEQ A;  5BNP C;  3VD4 A;  2YU2 A;  4CU6 A;  3V56 A;  1D4M 2;  3PTR B;  4NJ4 A;  3A0K A;  3ILR A;  3LEK A;  4UAP A;  4WVZ A;  1U12 A;  2WT1 A;  3N9Q A;  1DGW X;  2NMN A;  3AK0 A;  1Q43 A;  4DZG A;  3WLU A;  2R16 A;  4DQA A;  2YHJ A;  4GIQ A;  2B9V A;  1DLL A;  2VG9 A;  3IWZ A;  3UGF A;  2G9G A;  1FT9 A;  2HWF 1;  4CDX C;  1FV2 A;  2VNO A;  4AI2 A;  2Y6G A;  5E88 A;  2E9Q A;  3RWN A;  3BTY A;  4BH9 A;  4V2V A;  1MEC 3;  1XU1 A;  1YIF A;  5F2W A;  5I8T A;  4QQO A;  4MZU A;  2B4K A;  4IE6 A;  1G6N A;  5LY2 A;  5JCT A;  3AZW A;  4KG8 A;  5F39 A;  3EHK A;  3SHR A;  2WII B;  2HEW F;  3UES A;  4PJY A;  1RUE 3;  1GQG A;  3OD4 A;  1UU6 A;  1KDK A;  2DCY A;  2R04 2;  1DFQ A;  4AAX A;  4CDQ B;  3VHR A;  1O8S A;  1BKZ A;  3LPG A;  5ACA 2;  2E26 A;  3WX5 A;  3ZSJ A;  5KHK A;  3BU7 A;  2QQM A;  4LKD A;  1YI7 A;  1XNK A;  4MHU A;  1CN1 A;  1UY4 A;  2I07 B;  3AL5 A;  1TZO A;  3K48 A;  4JKM A;  3LQC A;  5JZG B;  1ENS A;  1VBC 2;  4TLF A;  4QPG A;  1AX1 A;  1LNS A;  5JPN B;  1BBT 3;  2H6B A;  2JDY A;  5GM0 A;  3VBH B;  3PU3 A;  3VBS A;  3PHM A;  2DVA A;  2VOX A;  3KD4 A;  5CZK A;  1RUD 1;  5FZ7 A;  1AL0 G;  4H7L A;  5AC9 1;  5FPZ A;  4AEK A;  2XH6 A;  1CAW A;  4I09 A;  5DAX A;  4BQ4 A;  1GZW A;  4IER A;  4OHW A;  5DUX A;  1MVE A;  4ES9 A;  3TEW A;  1R1A 1;  2Q1Z B;  1BMV 2;  1PZ7 A;  4AAP A;  5DDJ 3;  1H1M A;  2B39 A;  3IPV A;  2WRA A;  2FD8 A;  2HKX A;  1WZX A;  3FBY A;  5ACA 3;  4LBL A;  1LGB A;  3M3Q A;  1S0J A;  1C1L A;  2C5D A;  4NPM A;  2XPJ A;  3FL7 A;  2IUW A;  2DUR A;  2BWA A;  2EAL A;  3IBM A;  5A3U A;  1N1Y A;  2HWC 1;  4Z07 A;  3I2D A;  2FQP A;  2FDK A;  1SFY A;  1HN0 A;  3I2H A;  4QB2 A;  1RB8 G;  5CA6 A;  2HWE 2;  1H4G A;  2Q8O A;  2WAO A; 
#chains in the Genus database with same CATH homology
 2FDG A;  4IE0 A;  3S5A A;  2FDH A;  3H8X A;  3O1M A;  3BTX A;  2FDF A;  4CXY A;  4QKD A;  3BTZ A;  3O1O A;  3S57 A;  4ZS3 A;  3RZK A;  4ZS2 A;  4IDZ A;  3H8R A;  4NID A;  3T4H B;  4IE5 A;  3BUC A;  3I3Q A;  3RZG A;  4NRO A;  3O1T A;  3RZM A;  3KHC A;  3BKZ A;  4NRM A;  3BU0 A;  4NJ4 A;  3BI3 A;  4O61 A;  4O7X A;  4ZHN A;  3RZJ A;  3BTY A;  3RZH A;  4NII A;  4QHO A;  4IE6 A;  3T4V A;  3O1P A;  4QKN A;  3T3Y A;  4CXX A;  4RFR B;  4NIG A;  4QKB A;  3RZL A;  3O1R A;  4OCT A;  3I2O A;  3BIE A;  4QKF A;  3H8O A;  3I49 A;  2FDI A;  4IE7 A;  4MGT A;  3O1V A;  4JHT A;  3O1S A;  3O1U A;  2FDJ A;  2FD8 A;  4NRQ A;  3KHB A;  4NPL A;  4NIH A;  4NPM A;  3LFM A;  3I3M A;  4IE4 A;  2IUW A;  5DAB A;  5F8P A;  2FDK A;  4CXW A;  4NRP A;  4MG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...