2FDMA

Crystal structure of the ternary complex of signalling glycoprotein frm sheep (sps-40)with hexasaccharide (nag6) and peptide trp-pro-trp at 3.0a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the ternary complex of signalling glycoprotein frm sheep (SPS-40) with hexasaccharide (NAG6) and peptide Trp-Pro-Trp at 3.0A resolution
rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2fdmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fdmA01
7TAAA 2QMKA 4E2OA 3W37A 2XSBA 3G6LA 3CBWA 5E6ZA 3SCTA 3ZQ9A 1CECA 4V2XA 2EJ1A 2YL9A 3VPLA 2J8GA 1OT2A 1VAHA 3L2LA 3GM8A 1UD5A 3AIBA 4CVWA 1HP5A 1U33A 3GYCA 3IAPA 3VDAA 4ATLA 3AS0A 3DYMA 1M53A 3W4RA 3UETA 1R7AA 3W82A 1OGBA 4MDPA 3OGRA 4AD4A 4GI9A 4DUWA 3QHMA 1KXVA 3W28A 4V28A 2G3NA 3BAYA 3CLWA 1W1TA 3PBGA 1E3ZA 2FH8A 2PB1A 4HU0A 1W2PA 2WMIB 4QP0A 4ACZB 3TA9A 1XC6A 1XSIA 2ZIDA 5CQ1A 2J74A 4JKKA 2ZUNA 2ZXAA 1V3HA 2QMJA 3N1AA 2CPUA 4P7RA 3WY1A 4RL3A 1JFHA 3N11A 3SUUA 2IUZA 3VDBA 1C8XA 1B90A 2FHFA 4PMQA 1ISVA 1QVBA 1KFWA 3LMYA 4BQ5A 1E72M 4JHOA 5A1AA 3ZSSA 3T2OA 3CMGA 4UZSA 2BXZA 3W26A 1NWTA 1CLXA 4JFUA 2ESCA 3EDKA 4DUVA 5ABEA 3W24A 2WKGA 5E6YA 2WBKA 5A6JA 1FH8A 1JIBA 5M03A 2X05A 2D22A 1V6UA 3PZOA 4DWSA 2DH2A 4HPGA 1J10A 1WZLA 3UG4A 3MV11 1NWUA 3ZJ8A 1EOMA 2ZE0A 4X9YA 3VIGA 2WMGA 2WSKA 3VDCA 3FN9A 3HMCA 3AIVA 5D8ZA 4WIWA 5BRPA 4NZCA 1J01A 3UEQA 2W67A 3RJXA 1KQYA 1MW1A 3L2MA 2O92A 1BF2A 1X6NA 4UQAA 3WMCA 1E4MM 4MDOA 3WQ6A 2VNCA 3NUKA 2BVYA 1E6SM 4ZXLA 5GQBA 1UR0A 4PTMA 2OYMA 3THCA 4IPNB 4HMDA 2DT0A 5E0CA 3NSMA 1HL9A 1UH4A 3SUVA 4JIEA 1HP4A 4TTGA 1JDAA 5D9MA 1EH9A 1SR0A 5IHSA 1BPLB 3NDZA 3DHPA 1GQIA 3ARXA 4OBSA 2BNJA 1C92A 3VIJA 2G4FA 4AEEA 1D7FA 2JE8A 1KR1A 3AMCA 3IANA 1QI3A 1TZ7A 1HIZA 1JAEA 1KXTA 1WZAA 3UG5A 2XGBA 1EIBA 3FAXA 5IHRA 1W3HA 1D3CA 3ZJ7A 3KL0A 4U2YA 1IT0A 3AXXA 4AZ7A 1JZ7A 4JFVA 2YKKA 4CD5A 1V0MA 1TA3B 3WD3A 3VU2A 5F7UA 2VRKA 3WNPA 1CNVA 1ZBWA 3PZVA 3RO8A 3KE0A 1JNDA 4M56A 3QR3A 4W8AA 4CN6A 4URIA 2GVYA 4CVUA 4XV0A 3NSNA 1TCMA 1OM0A 1UKTA 4BZYA 4CCEA 1JG9A 3W6MA 1JF5A 4GKLA 3ZIZA 4MJ2A 1UWIA 1ISZA 5I5RA 2WB5A 2XG9A 1WNOA 1EOKA 2RGLA 1Y7VA 5BRQA 2FGLA 3AOFA 2ZUSA 1SFSA 5BXSA 3M6DA 2D23A 4H41A 5FIPA 2D20A 1GJUA 4FK9A 2EO7A 5HOSA 1ODUA 1HT6A 2NT0A 2J4GA 4J3TA 2VZSA 4AD1A 5CGMA 3VGDA 1PZ3A 1H1NA 1JYWA 5E09A 1MVYA 2BY3A 3WN6A 3SURA 4YHGA 1CEOA 2C7FA 3WD0A 2J79A 4D1JA 3WUEA 3WNLA 5AC4A 3DYPA 3F5KA 1XV8A 3MUZ1 3CHDA 4CU7A 1GQLA 1QNPA 3WL0A 1CXEA 4PMRA 1GHSA 3VM5A 2QPSA 1V6YA 3BH4A 1UQZA 2J25A 1OGGA 1QBBA 1C7SA 2D2OA 1KWGA 2V3GA 1KXHA 2VCBA 1RH9A 2WW5A 2GK1B 2ZXQA 5A6SA 1V08A 3VM7A 1RD6A 2VX5A 2V3DA 1OGSA 2XWDA 1L0PA 4U3AA 1VBRA 2C8NA 5A8MA 3U5YA 1NOWA 4UQCA 1DWHM 1LL7A 2FH6A 4U5IA 1HN1A 2XGIA 2Y24A 3IAQA 5E0FA 1UWQA 1ZL1A 5IDIA 2WWDA 4WSJA 1Q6EA 1RP9A 1CZ1A 2ZICA 4HA3A 2WMJA 4H8UA 5ABFB 1BYDA 3FW6A 4AZIA 3L4YA 3NIYA 1WAWA 2CESA 3ALFA 3NJ3A 3ZT6A 3WBAA 4MTVA 4W89A 1GHRA 3W6LA 1GOMA 2DSKA 2YLAA 1E70M 3MS8A 2WBGA 1JAKA 1J11A 1MQQA 4GO9A 4AMCA 3THDA 2BHZA 2WHKA 1NP0A 4PMZA 3PZGA 1CDGA 4KMQA 3VGGA 4OIFA 4AZ6A 1E3XA 1KBBA 1GZJA 3VIIA 1US2A 1PBGA 3PTMA 2W66A 1JZ4A 3KL5A 2XTKA 3PZIA 3BAJA 3PN8A 1W9UA 2ZUVA 3WEZA 2VX4A 1MFUA 1B3WA 4PCSA 4V27A 1CWYA 3ZR6A 5D4YA 2YA2A 3WF0A 4GQQA 4OKDA 5I6SA 1EXPA 1UG6A 2X2YA 4ATDA 3AHVA 3AIQA 3PHAA 1UA3A 2G3JA 1CYGA 1JI2A 2XIIA 5LA2A 4OJYA 1GONA 4EKJA 1UR4A 1GJWA 4CU6A 4J3VA 3FHQA 2WCGA 3GH7A 2QLYA 1U2YA 4PYSA 1V3JA 3CHFA 1E1EA 4HA1A 3UR8A 2WVVA 2GFTA 2C0HA 1KBKA 2PBOA 2A3HA 3CUFA 3L4UA 5A8NA 1HJWA 4GZIA 1WZKA 4GPNA 3CHEA 1TR1A 3CGTA 1DWGM 3UCQA 4PUEA 1VF8A 1E43A 1GOIA 2J7FA 3RM9A 2XPKA 2XUCA 2CKRA 4MNLA 3WNKA 3AS2A 2CIPA 4PMVA 1MXGA 2J7HA 2NT1A 4QLJA 4CD4A 2D24A 2YA1A 1JDDA 3ALGA 1WPCA 5CXPA 1WKYA 4D6DA 1OIFA 2TAAA 4YHEA 3VD7A 3QHOA 3GBDA 3AXHA 1H41A 1M04A 2BY1A 4BQ4A 4AZHA 2CXGA 1JZ5A 2BS9A 5CSUA 1UKPA 2WSPA 1DWJM 4AD0A 3F5JA 4AZCB 2WCAA 4MPKA 4GINA 4QDMA 5I23A 1UD8A 4TOQA 1K9DA 2ZX7A 3W81A 3ZM8A 2O9PA 3OG2A 1MQPA 1US3A 3AMGA 4J28A 2VO5A 1W1VA 5DF0A 1PAMA 3QOMA 1J0IA 3ZSTA 4MB5A 1PJ9A 4PMYA 5BXPA 3WDPP 3W25A 3AQUA 2W62A 1GVYA 3O2LA 3WMBA 2VCAA 2E3ZA 5C8BB 2CBVA 1V3KA 3KZSA 4M80A 4PCTA 1BFNA 3WDJA 3CZEA 2ZXDA 8A3HA 4D6CA 1GCYA 4RE3A 4TVCA 1E4IA 4XB3A 2DT3A 1CGVA 4W88A 1GOKA 5FCZA 2VC9A 1QNQA 5ABHA 3VIHA 1UZ4A 4AISA 1CXLA 3SCOA 1WP6A 2YDSA 4CCCA 1WB0A 4QAWA 3WD1A 5A3HA 2JEPA 4L4OA 4CD8A 2EBNA 1E6RA 3TONA 1V3LA 2WYSA 2D3LA 1OINA 5D9NA 3SUTA 3AFBA 1HJQA 1B9ZA 4NF7A 4XX6A 2WZIA 2E9BA 2J47A 3NDYA 1FOBA 1UWTA 3JUGA 2X1IA 1H3GA 2WMFA 1W3JA 3WMSA 3W38A 3SUSA 1V02A 3EDEA 2J75A 4Z2KA 3EMQA 1AVAA 3OA5A 4HA4A 2NW0A 4WKFA 4JAWA 4W8LA 4J3WA 1UKSA 1FA2A 2MANA 1UD3A 3L4ZA 2ZWZA 1U30A 2VOTA 3CUGA 4AWEA 1GW1A 2OSYA 3WQVA 3AHYA 3GNPA 4JCMA 3K1DA 1ODZA 2VQTA 4RE2A 5E9AA 3NSXA 1TG7A 2WVUA 3AS3A 3B8SA 3N18A 4A3YA 4GI8A 3SUWA 1W3KA 3WDIA 1UWSA 1EQPA 2J78A 3CH9A 4GI6A 4H7VA 2WPGA 5HXMA 1RPKA 4UQEA 4QFUA 1NOFA 1J18A 1NWRA 1KGWA 4IUGA 3DC0A 1Z32X 2OWXA 3AIRA 3OZPA 3B9AA 3WH9A 3TOPA 4WLCA 3PZ9A 5BCAA 3B9EA 2E40A 2J77A 2D3NA 4Z2LA 2CBUA 2XFFA 2WM0A 2PWGA 4PEEA 4ZENA 3KL3A 4QCEA 1O7AA 3HN3A 3T08A 2XVNA 1VEMA 2GJXA 3ARWA 2X0HA 2ZXBA 1PIFA 2BHUA 2QV4A 3VIOA 2VRQA 3OGVA 2X0YA 3BAXA 3AHZA 3WDRA 3SCQA 3GDBA 1H49A 3WELA 1A47A 1JYNA 2DDXA 2J7BA 1RP8A 3PZMA 1E0VA 2WCSA 4X0NA 1LL6A 1FHLA 4WF7A 5A6KA 4LX4A 3RIKA 4A3HA 4AY1A 4AC1X 4W5UA 3FXYA 3LPPA 4CN1A 2CCRA 2W61A 5HBFA 4MNJA 3BC9A 1BVNP 2VZUA 2F61A 1J12A 3ZJKA 1BHGA 2W5FA 3MV01 1TMQA 1K9TA 3SCPA 4LGXA 1CXFA 2E9MA 5HDRA 2YA0A 1GQKA 2DSZA 1ZB5A 2AAAA 1WDSA 1NQ6A 5DT7A 6TAAA 1E1FA 1W2VA 1LWJA 4GO8A 3WH6A 1J9YA 1WO2A 5D9OA 4ATWA 2YBUA 4D6GA 1EDQA 3WNMA 3CUIA 1BVZA 1V0KA 3LPGA 3OGSA 4AIEA 3QHNA 1EO7A 2XYLA 3CTTA 2UY2A 1DHKA 5KZ6A 3VDHA 3CZGA 1G1YA 5JIPA 1EDGA 3WUFA 1QI0A 3WDHA 4TUFA 1W9PA 3TTQA 2NSXA 4FLSA 3WEMA 2OWWA 3AROA 2VURA 1R85A 4AD5A 3BLKA 1ESWA 3BSGA 2EEXA 2VZTA 2XSAA 1VBUA 2Y5EA 1G01A 4DM2A 5GPRA 4GZEA 4TXEA 2DEPA 3BMWA 1Q6GA 1ZBVA 2V38A 3L4WA 4C7GA 3MSDA 2JEQA 3VGEA 3WQWA 1LF1A 2ZX9A 3ZJ6A 1V0LA 4W7UA 4IISA 4CU8A 4EK7A 1GORA 4CN4A 4D6JA 3MANA 3D3AA 2D0FA 1PIGA 4EANA 3RMEA 1KQZA 4YPJA 4BA0A 4JZ5A 3CZJA 5JBDA 1LJYA 1O6IA 2WZEA 3VKKA 3A3HA 4PTVA 2DSWA 1ISXA 1DEDA 3SCVA 3VD5A 4AD2A 1VFOA 1JZ2A 1VENA 4DUXA 3GXDA 4ZEPA 3ZMRA 2XWEA 5EFFA 5TD4A 4Z2JA 5GNYA 2A3AA 3QGVA 5ECUA 1E4NA 3VGFA 3ZO9A 1FH7A 1H0GA 1C93A 2BXYA 3CO4A 1EDTA 1AQMA 1JI1A 1HJXA 4PMXA 3E1F1 3WF2A 2WWCA 3OIHA 4JCLA 4EAMA 3DHUA 4HMEA 1M03A 3ZT5A 2F8QA 2QHAA 3NYDA 2W91A 4UFMA 4CD6A 1BQCA 3AXIA 3VUPA 2JALA 4CGTA 2VMFA 1IZJA 4W5ZA 3AZRA 4UFIA 5CLTA 1HKJA 3T0AA 3L4XA 2XVLA 4D6EA 5EB8A 2VJXA 1CIUA 4R5EA 1B31A 4OBRA 3AZTA 1QNOA 4NRRA 3M7SA 4D72A 5M17A 4PMOA 3CPUA 1DWFM 3VMPA 4PTWA 4PN2A 4IM4A 3S6TA 5JIWA 1LG1A 5I79A 1KCLA 1V3IA 1KXQA 1SMDA 1VIWA 4HTYA 1Q6DA 2E8YA 1S46A 2UWFA 4FLOA 1TVNA 5IFPA 4Q7NA 6A3HA 2EPMX 1ECEA 3MU7A 1JL8A 2WVVB 1MW2A 2DT2A 3TTSA 1BGAA 2V5CA 5BYWA 1EHAA 4ZFMA 1QI5A 3TTOA 4U3CA 2FDMA 4PTXA 4PMUA 3AJ7A 1UD4A 3AHXA 2CKSA 1H0IA 2CITA 1NWSA 1HX0A 5CPTA 1E73M 3GXIA 2XM1A 5DEZA 3K8LA 3WH7A 5E70A 5LA0A 4QLKA 4Q22A 1IZKA 5BROA 3FHAA 4OOZA 1BAGA 1UR1A 3I3BA 3AS1A 9CGTA 4OZOA 5FL1A 4TX8A 1QHOA 3CMJA 1LG2A 3S2CA 2VUYA 4P8UA 1TA3A 3T2QA 1JFXA 4D6HA 4AZGA 4P7OA 3EBVA 1HF6A 1XYZA 4F8XA 2WHMA 4QCFA 3OB8A 1E56A 3RM4A 4UFHA 3GBEA 3IJ7A 1UHVA 5IFTA 1E6XM 3U7VA 3WF3A 4U5KA 5I3DA 1QOXA 3PZUA 2XFYA 1QNSA 1TFVA 4KRUA 2XIBA 4PMDA 3OLDA 4P7LA 1UYQA 2OSWA 2HVMA 3GTNA 2PI6A 2PF0A 5JBFA 4KRTA 2BVDA 3CUHA 3KWXA 4UFJA 1JF6A 1UWUA 1XCXA 4QLLA 5AYIA 1JZ6A 5I0DA 3WL1A 2GSJA 3WQ5A 5A6MA 2OYLA 3OLGA 1WE5A 5HPCA 4P8VA 1I1WA 3AYSA 3VD3A 1UH2A 1B30A 4YN5A 1MYRA 1GVIA 1JZ3A 1F4HA 4W87A 2OLHA 2WXDM 4XZWA 4S3KA 3SCWA 1UR9A 3RPMA 1D2KA 3BMVA 2DT1A 4HU8A 4IPLA 4B3LA 5IXEA 4MJ4A 1TUXA 4KGJA 1H11A 4W7VA 3VIKA 3VMOA 4MNKA 1BGGA 2J7DA 1XH1A 2GK1A 3TTYA 2VI0A 3UG3A 1E40A 4JKLA 2JF7A 2WC4A 4MNMA 1EHNA 1FH9A 2WMHA 2ZUTA 4MADA 4WKAA 4WJXA 1CGYA 3EYPA 1AQ0A 4M82A 4AXNA 1QI2A 3OZOA 2UY4A 3I3EA 1ISYA 1OSEA 3MMWA 1DWAM 1VEOA 3N13A 1A3HA 2BFGA 3WD2A 1Q6FA 2VX7A 1JD7A 3PZQA 1QW9A 3WUBA 3EMCA 2WC7A 1CGWA 1V02E 1C91A 5A8QA 4D71A 1W9DM 1H4PA 2ZX5A 1E0XA 3J7HA 2WKLA 2BY0A 3WKZA 1CXIA 2D0GA 2VVSA 2VVNA 1WDPA 2J62A 4PSPA 1KGXA 1JD9A 4C7DA 4CCDA 3ARQA 3IJ9A 1B0IA 3FAWA 5JBEA 2ZX6A 1KCKA 3KEHA 2FHCA 4BF7A 3OLIA 1MFVA 1ITCA 4C7FA 3LPOA 4J27A 1OCQA 2CHOA 4W85A 4U31A 1OB0A 4GZJA 1FP9A 5LA1A 1EO5A 4UOJA 1BG9A 1JXJA 4J3XA 3AMDA 1DP0A 4HOZA 4MB3A 2VL4A 4DWSC 1YHTA 1J0JA 4N42A 2XVPA 1ZBKA 1C8YA 1JYXA 3WDQA 2J7GA 5C70A 2PWFA 2Y8KA 2GJXB 4H8VA 4HZ8A 1JGIA 3K8KA 3VTRA 5GNXA 2XVGA 1B3VA 1CBGA 2CYGA 4NSBA 3F5LA 2ZWYA 2VCCA 4KH2A 3CUJA 1ZJAA 2FGZA 3L4VA 5CGTA 1UA7A 2G3MA 1ITXA 1G94A 1PZ2A 1J0ZA 4PSRA 4U2ZA 3WQ4A 2QPUA 1XH0A 4PUDA 5CSYA 2F2HA 1WCGA 5EFDA 1W9BM 3UR7A 1MWOA 3AMKA 2YL6A 4AZ5A 1WZMA 1GOQA 4ZXOA 1R86A 3AIEA 4DWSB 1XSJA 3ZOAA 4ZE4A 2EPOA 1V03A 1GOOA 4W86A 3VNYA 1XSKA 1W91A 2WK2A 3OLEA 1M01A 4Z2GA 1IV8A 2V5DA 1G9HA 1QBAA 2UY3A 2UY5A 4P7QA 1CTNA 4UOZA 1NARA 3K4DA 3QOKA 3DECA 2W4XA 4M8UA 2O9OA 1J0HA 1V6VA 3EDFA 4S3JA 1H09A 2XM2A 5A6BD 4AZBA 4Z2HA 3B9DA 2YOCA 1HJUA 5I77A 3VO0A 3BGAA 2CHNA 1BG4A 4AZCA 2J7CA 1CGXA 3L4TA 5D8WA 4LYQA 3CZ8A 3CZLA 3ZT7A 1HNYA 5JH8A 1LWHA 1FHDA 1DWIM 3GNOA 3RCNA 2YL8A 3VGBA 2PWHA 3VILA 2WLZA 5BXTA 1UQYA 3W27A 1H2JA 1UD2A 3WFZA 1UR2A 2Y2WA 1LL4A 1NP2A 1MXDA 3K4AA 3T2PA 4LXFA 4UNIA 2PC8A 3N04A 1LQ0A 3U5UA 3AHTA 5BWFA 3II1A 2VQUA 2CETA 4P8XA 1TE1A 3WH5A 2DSVA 2DIJA 2EPLX 2DPEA 2VR5A 3ARVA 4JFSA 1BYBA 2WLYA 2WHLA 1CXHA 3MUY1 1W1YA 1B2YA 5CLWA 3POHA 2CBIA 3AISA 1E15A 3HJEA 3EMZA 4UCFA 1HJVA 1HJSA 4NRSA 1UKOA 3CHCA 1E5NA 1E71M 1QNRA 2ZUUA 4HP5A 5I78A 3A47A 4LYPA 2Z1KA 1G5AA 3OBAA 1XH2A 2OSXA 4DM1A 3G6MA 2O9RA 2W92A 3GZAA 1J0KA 4F9JA 1XCWA 5A2BA 1E0WA 3MSGA 3VNZA 3GXFA 2V3EA 2E4TA 2RGMA 3WFLA 2XHYA 2J7EA 4AYSA 3T0DA 4KWUA 3PTQA 3WH8A 1V0NA 3ARSA 3D5HA 5LYRA 7A3HA 1JZ8A 3GNRA 2ZOXA 1NOUA 2EQDA 2EXOA 1UOKA 2XJ7A 2X09A 3VINA 1E55A 4F9DA 3CIVA 4H8HA 1W3LA 1BYAA 1BYCA 1B1YA 4M81A 3WEOA 1K9EA 1VJSA 4HZ7A 1C90A 3N9KA 4TVDA 3BAIA 4HMCA 3T0BA 2BV9A 5DT5A 1QW8A 1UWRA 1W9VA 1E4LA 4DWSD 4L4PA 3EDJA 2GJRA 3SEPA 3ARZA 4HOXA 4UZUA 4HPHA 1VJZA 2DIEA 3WIJA 4B9YA 5CPSA 1QHPA 3O6AA 4FLQA 2Q8XA 1PEZA 3AMLA 4E8CA 5CJ5A 1P6WA 3GXMA 1OIMA 5DO8A 1FP8A 2WMIA 4ACZA 1VB9A 3M46A 1E5JA 1HL8A 4HOWA 1M7XA 4FLRA 2QF8A 1SYTA 4W7WA 4FF5A 4BQ2A 3N17A 2B31A 5EBAA 5FKYA 5M5DA 4AIOA 3MUAA 3TP4A 3U57A 2XFRA 1CGTA 3GH5A 5EMYA 4F79A 2AMGA 1GOWA 1CGUA 5AYBA 4B9ZA 3AYRA 3BSHA 3I3DA 4MB4A 3UESA 4A4AA 4WK9A 2G3IA 1KB3A 5JUVA 4UQBA 2WC3A 1I75A 1UD6A 3BCFA 1G0CA 4U33A 4W93A 1TVPA 1UZ1A 3T09A 4EE9A 1PX3A 1JNEA 4FMVA 1MW3A 4R27A 4F66A 1E6QM 4LPCA 3K8MA 3WBEA 3A4WA 5FD0A 4NI3A 3A4XA 4MAZA 4KGLA 1V6XA 2YLLA 4D6IA 4D1IA 4PMNA 3VX1A 1GPFA 1XGZA 3WSUA 2A3BA 4J7RA 1LLOA 3POCA 4AW7A 1E6PA 3IK2A 4AIUA 3WD4A 2FHBA 6CGTA 2Z1SA 4JL1A 3ARPA 2D0HA 2PWEA 3ZR5A 3ARRA 1HVQA 2G41A 5HPOA 3VVGA 4X0VA 2WHJA 5DFAA 4MB1A 5FL0A 3AZSA 1ISWA 3VOCA 8CGTA 2HISA 2WVSA 3N15A 3MO4A 1AMYA 1C7TA 3AI0A 1VEPA 3RJYA 4Y7EA 1JDCA 2PBGA 3AIUA 2CERA 4GQRA 4JHZA 2BVTA 1J0YA 1SMAA 3M07A 1V3MA 3VIPA 1F4AA 3WUGA 4M29A 1W9XA 1GQJA 1QPKA 4BQ3A 3PTKA 1BLIA 1CENA 2O9TA 1QI4A 2WVTA 3A4AA 4UQ9A 4AD3A 1C8QA 3W53A 5C71A 4XZBA 1OT1A 1XD1A 1KWKA 3VIFA 1E6ZA 1XRVA 1HXJA 4UFKA 5CPQA 4B15A 4TVUA 2YDQA 1R7OA 5A2AA 3ECQA 3VMNA 2DQXA 2VTFA 3VD4A 3BLPX 4BS0A 4ML4A 3ARYA 4WKHA 1C3FA 3APGA 3PZTA 1K6AA 1X6LA 7CGTA 1X1NA 2JFEX 2ZX8A 2D1ZA 1KGUA 1E6NA 2VT0A 2WAGA 1I1XA 1WDRA 1E9LA 1KR0A 3AIWA 4M24A 3BXWA 3BCDA 4E4PA 2XVKA 2A3EA 1UH3A 4OOUA 4Z2IA 2G8ZA 1OBAA 3W29A 4GXPA 1VFUA 1B3ZA 1XD0A 2CEQA 2A3CA 5ABGA 3RILA 1VFMA 1JYVA 4WSKA 5I24A 1HKKA 1GNXA 4J3SA 5D9PA 2X8RA 2VX6A 4UQDA 4CUCA 1Q4NX 3IJ8A 2WNWA 1OWQA 4LYRA 3RDKA 5BXRA 3F4VA 2OWCA 5A94A 1XYFA 4UTFA 1EQCA 2EPNA 5A69A 1N82A 1GUVA 4MAVA 3U7BA 4JKMA 4ZE5A 2DSUA 2VZVA 3A6OA 2DGAA 2BY2A 5AY7A 3EDDA 1FFRA 2ZUMA 5M3WA 2VR4A 5A95A 1NM9A 5A2CA 1ZU8A 1BSIA 3CZKA 2VZOA 1PX8A 4RE4A 4B16A 1CPUA 2J8FA 3O9NA 3VIMA 1ZBCA 3MKKA 5AC5A 5DMYA 1R8LA 5FOOA 3VGHA 1MQRA 2V3FA 2EPKX 4D6FA 5A8OA 3DYOA 4UFLA 2E9LA 4H2CA 4HZ6A 3GH4A 3RM8A 1FFQA 2JIWA 3LPFA 3ARTA 2GJPA 5ABFA 4XUYA 1DTUA 2CBJA 1UR8A 3WF4A 1EGZA 2WANA 1B3XA 1NH6A 2IXVA 3BAKA 4P7NA 4CD7A 5A6LA 1W32A 4W84A 2YL5A 4JFWA 2DH3A 3N12A 1YQ2A 4TTUA 4JL2A 1UKQA 4TX6A 2GUYA 1ZJBA 4UR9A 3SCRA 3WF1A 3WNNA 2ZUWA 1B3YA 4PBGA 2IXUA 1HKIA 1K9FA 1OD8A 2WZHA 3ARUA 4E8DA 1ZS2A 5I2UA 1UUQA 3WQ8A 2BHYA 3SCSA 1H5VA 4M1RA 3MMDA 2E8ZA 5KEZA 1L8NA 1BTCA 1CXKA 4K68A 3MMUA 1AQHA 1MW0A 3SCUA 5A8PA 1V6WA 1VRXA 4J3UA 5CG0A 2E0PA 3NCOA 4H04A 3WNOA 2YIHA 3AICA 4JFTA 4PRWA 3PZNA 2WMKA 3HU7A 4ACYA 2CNCA 4P8WA 3SIMA 4W8BA 3K46A 2OYKA 2PWDA 2VRJA 2Y8VA 4UOQA 2YDRA 4OUEA 3W0KA 4B3KA 1EA9C 1W1PA 1CLVA 2Y4SA 2JIEA 1PX4A 1QHZA 1PPIA 3FNDA 4LQ1A 1OD0A 3VD9A 5A6BA 2YBTA 1R87A 2YJQA 1HKMA 1JXKA 2JF6A 4GIAA 4CKQA 1Q6CA 5GNZA 1VFFA 3VX0A 3BAWA 2W63A 4BCEA 3FY1A 3MUIA 4AEFA 5CZKA 4N0RA 5HNNA 1XHGA 2GDUA 5A6AA 2GDVA 3UERA 3SCNA 1HVXA 1WDQA 3WENA 2AOSA
chains in the Genus database with same CATH superfamily
4E2OA 1YIXA 3ZVHB 4KS0A 3UPWA 1EP3A 5G1YA 1F74A 2QJHA 3NO5A 4F4RA 3GKAA 2V68A 4WOQA 4V2XA 2POTA 2YL9A 1W26A 3L2LA 4KKXA 3TYUA 5CBJA 4G9PA 1JPDX 3OHIA 3S42A 3GYCA 3VDAA 4ATLA 2GDQA 5GJNA 1YW1A 3C52A 3DYMA 1MRQA 1GQNA 2QCEA 1YRRA 3UETA 4AVNA 2OZ8A 4RZBA 4RV8A 2ATMA 1HFBA 4DUWA 3QHMA 2ATSA 2C1HA 3N4AA 4FNTA 1FWBC 4V28A 2HXTA 1UWAA 3CLWA 1W1TA 1IR1A 2FH8A 2PB1A 3DKLA 3MSYA 3M4HA 4HU0A 3M0LA 1S2UA 4KESA 2NX1A 3TA9A 4Y6GA 3SR7A 2ZIDA 2A85A 4BHYA 4ZQOA 2YW4A 1XRSA 3PRDA 4GYJA 3IRSA 1V3HA 7ODCA 3N1AA 1C9HA 1L6YA 2CPUA 4P7RA 3WY1A 4RL3A 2HVNA 3COTA 1IWBA 3N11A 4A8NA 3SUUA 4YMZA 3EKZA 2PDIA 3O3RA 4PMQA 1QVBA 3LMYA 1E72M 4O0KA 3URBA 5MF5A 4KWVA 3T2OA 2YYUA 3IV8A 4NILA 1E0UA 1F7BA 2WBKA 4J9JA 2OTDA 3FDGA 1F3TA 3KUMA 2XSXA 3W70A 1JIBA 1OY0A 2X05A 5H6HA 3UA4A 1P7TB 2DH2A 1PCKA 4HPGA 5CC6A 3ITGA 3WLLA 1WZLA 1N7KA 3OYXA 2LJ4A 4ZQNA 4GNJA 2NQLA 3B0XA 2QJMA 4H6KA 1OABA 3STCA 4O4WA 5D8ZA 5HJLA 2O55A 1J01A 2NX9A 3UEQA 3KAIA 5EU9A 5HQEA 5KZMA 1XRTA 4M3PA 2CLPA 2O92A 3WMCA 3SW6A 4MDOA 2VNCA 1TMLA 1P0EA 5DBUA 1IXQA 5GQBA 2PURA 4O0ZA 3VFCA 2MPHA 1WAUA 4EXQA 3PUDA 2KE0A 4MKVA 2C19A 4KPLA 1XYAA 5E0CA 3NSMA 3EWUA 1GK8A 3RG6A 4B5NA 4GNVA 4JNZA 1E9ZB 3ZXWA 1QZ2A 1QASA 1AD1A 3MW7A 4QXIA 5IHSA 1SR0A 3DHPA 3G3DA 3V1HA 3L5MA 3WFAA 5K9CA 1XDLA 2ASHA 3BG3A 1L2QA 1TZ7A 4FHAA 2HRWA 5G1TA 1GKQA 2PCQA 3VNMA 5IHRA 1D3CA 1DBTA 3NNTA 3ZJ7A 4U2YA 3R8RA 4ODNA 4FIRA 1H7PA 4JICA 3WD3A 4JN7A 3DFQA 4HK7A 1IWPA 1O95A 4C60A 3WNPA 3V4BA 1MEWA 3PZVA 3RO8A 1YTEA 4CN6A 3WQFA 5L6UA 4XV0A 3NSNA 1TCMA 4C90A 3M5ZA 1OM0A 3O5KA 1RSCA 3LG3A 4CCEA 3W6MA 2V81A 4GKLA 1XLCA 1W3IA 3O07A 3QY7A 2F2KA 4PUKA 5I5RA 3W2UA 2WB5A 4L5ZA 4O1AA 1EOKA 4MLRA 2ZUSA 4WXYA 4H41A 2KI3A 4LNCA 5FIPA 1Q45A 2D20A 1GJUA 1BTMA 3WYZA 1ODUA 1HT6A 2J4GA 2VZSA 4AD1A 3VGDA 1PZ3A 4A6GA 1MVYA 1XLFA 1CEOA 3WD0A 2WJEA 3KABA 1WXZA 4D1JA 3E2RA 4YTUA 1GQLA 4O13A 5HJYA 1QNPA 2IQTA 3WL0A 3W1PA 1AL7A 3STFA 5BOOA 1I8JA 2YR1A 4M5PA 3LA4A 2FKEA 4OT7A 1XLGA 1B6CA 1C7SA 4ZMGA 2VCBA 4RZ5A 4PUUA 2GK1B 3WJYA 2OT1A 1RD6A 2VX5A 4MM1A 1OGSA 1VYRA 1L0PA 3S9IA 3QV8A 2C13A 2C8NA 4O10A 1LL7A 2ISWA 2GGGA 3IARA 5E0FA 3W7MA 2QR6A 4Z08A 2RURA 2NV1A 3STGA 3UPBA 1Q6EA 4HNVA 4WQ6A 1R3YA 2Q6ZA 5TAOA 3CQJA 2FGBA 3WLKX 3UQNA 3LGDA 3KAHA 1BYDA 1NDZA 4IIEA 3SGZA 3W7EA 2Y8UA 5M2FX 3NIYA 4HHHA 5K4ZA 3ALFA 3ZT6A 3WBAA 4W89A 3TYBA 3S9YA 3N19B 5C5YA 1CDGA 4IF2A 4R7WA 4Q7BA 3O0KA 1DJZA 2FMOA 3RF9A 1JZ4A 3R12A 3PN8A 3HQ1A 4FN2A 2ZUVA 4WCJA 1XDMA 1B3WA 2PGEA 4V27A 5D4YA 2YA2A 1P0BA 3WF0A 3O8AA 2CLIA 4MGVA 4ATDA 3AHVA 3AIQA 4QEHA 5CPMA 2XIIA 3UI4A 1TPUA 1GONA 2VFDA 2ZRYA 1RA5A 1UP0A 4BR1A 3E5PA 3SQLA 1KM6A 3I7SA 2GVEA 3KOFA 2QVHA 2WVVA 4UWMA 1KBKA 2PBOA 2A3HA 1HJWA 3D47A 4GY0A 3T9PA 2ZA1A 3W1RA 3CHEA 1DWGM 3UCQA 1VF8A 1W5NA 3KBVA 3M41A 3QJAA 4MUPA 4FS9A 2J7FA 3RM9A 1IXNA 3H23A 3VZZA 3W02A 1LRNA 4K6AA 4PMVA 4DYKA 5HWCA 3DFYA 4NZ4A 4CD4A 4H9XA 3KBMA 3UZXA 4S2BA 2FZDA 2R14A 3VD7A 3QHOA 2PAJA 1FUYA 4BQ4A 4ZPVR 2GVGA 3LRLA 4KWSA 4YS1A 4W4QA 2CXGA 2WOQA 1JZ5A 4S38A 1PKNA 4PB3A 2OODA 2WCAA 6ALDA 4ZZ9A 3CASA 4QDMA 3MJYA 1A3XA 1S5NA 2VO5A 3LLFA 3S1UA 3T4WA 1VFTA 1PAMA 4Q3MA 1BL4A 1J0IA 1A5MC 3M0JA 1PJ9A 4MB5A 2W62A 4IX0A 2VCAA 3G24A 2P4VA 4PB4A 2X41A 4IPJA 3G3MA 3WDJA 5C9ZA 3CZEA 4QR6A 1QW7A 1CGVA 5JQ9A 4W88A 3PWGA 1DOSA 2Q8ZA 4XVEA 1A5UA 1A5CA 1ZCOA 4QRNA 2YZRA 3OYZA 5DCBA 1I60A 4CCCA 4WDTA 3EZ4A 4JTTA 2GOKA 4L4OA 2J8TA 2EBNA 4JXCA 5J8LA 3N3MA 4YVVA 1V3LA 1OINA 4TV5A 4TV6A 2QZRA 3SUTA 3SB0A 1HJQA 1B9ZA 1OVDA 2P0OA 4NF7A 2O4MA 4DRJA 3ANUA 4A8RA 2E9BA 2J47A 3EB3A 4DJEA 3JUGA 4ASTA 2C79A 1H3GA 1KRMA 3WMSA 3W38A 4ODLA 4HJWA 1V02A 2E67A 3YPIA 2ZDRA 4ML9A 5HWMA 1AVAA 2PA6A 4JAWA 1O5QA 2X30A 4NNAA 4LAXA 3CUGA 2ZZ3A 3GXNA 3QPZA 4DROA 4IFKB 1KLZA 2VQTA 3A12A 4GIYA 1XLHA 3L66A 3AS3A 3KDNA 5T9CE 3VAWA 1MDRA 4QE1A 3NZ1A 3NOEA 1UWSA 2R82A 1EQPA 2J78A 4Z1DA 3RGTA 4H7VA 3KM8A 3WQPA 3BL3A 3G1VA 2PTZA 4MJMA 1U5JA 2R8WA 3UJRA 4IUGA 4WLCA 3PZ9A 2CWNA 1B3OA 4HD5A 1XIBA 4ZENA 3KL3A 4QCEA 5AECA 2YCIX 3HN3A 4NUWA 1VEMA 2ZXBA 5LXEA 1PIFA 1R9HA 2FMNA 2X0YA 3BAXA 2CFFA 1ME9A 1H49A 2BZNA 1UIOA 3CJPA 1LYXA 3S6OA 1FWRA 3GW3A 2PZ0A 1LL6A 5A6KA 4HPXA 4LX4A 3PVFA 2KR7A 2DZUA 5BOFA 5FEWA 1W5PA 3DEQA 3LPPA 2FB2A 2Z7KA 4CQCA 2CCRA 2W61A 4W9QA 3FJNA 3LS9A 4CLMA 4ODPA 4MNJA 3BQ6A 2E7FA 3DN5A 1J12A 4NJKA 1QOPA 1BHGA 3GVVA 1TMQA 4J1OA 4GIEA 2NXGA 2YA0A 2DZAA 2HS6A 1GQKA 2XINA 4ZO9A 1ZB5A 4HSOA 1QO2A 1WDSA 4LUYA 4LW7A 2N87A 1C9DA 2Q02A 3EX4A 3G1DA 4EPKA 3WMLA 1EDQA 1V0KA 1OFPA 3OGSA 4AIEA 1TV4A 2VDGA 3LNMA 3LHZA 3QHNA 6TIMA 3S47A 2UY2A 4QTGA 5JIPA 1EDGA 2PWVA 1V7YA 2FVMA 5CJMA 1RPXA 1DTNA 1W9PA 4QG9A 1K6WA 2TRSA 2NQJA 2NSXA 4YLWA 4POCA 3AROA 1R85A 4AD5A 3R89A 3NQVA 2FVKA 3UA3A 1VBUA 4DPPA 4GI4A 4DM2A 4H9TA 1HKWA 3LLXA 4GZEA 4TXEA 4CNSA 3GNDA 2J6VA 2DEPA 5FJPA 3MCNA 4NHVA 3MSDA 3LHTA 5C54A 3ABSA 3WQWA 4GIRA 2VP8A 2IMRA 5HATA 1FD9A 3VFLA 4W7UA 1PINA 4RKAA 4XD6A 3CB3A 4D6JA 1P5QA 1PIGA 5AVNA 4YTRA 1OCNA 3RMEA 4YPJA 4BA0A 1Y8BA 1EP1A 4QBXA 4Q8WA 5EY5A 1D7HA 2WZEA 3A3HA 3SCVA 4AD2A 1FWIC 1OHLA 4KEUA 4E4UA 4E3VA 5CAKA 4HYRA 1T8QA 3OEXA 3QV6A 2WQPA 3U4FA 2A3AA 2QXWA 4MFEA 1PXGA 4JYFA 1EJSC 5AHIA 2E25A 4PR4A 2W3ZA 1C93A 2BXYA 3HQPA 3W7CA 3E74A 1J79A 1E1CB 4P61A 4PMXA 2WWCA 2ABBA 1IEXA 1PYFA 2YX0A 4HMEA 2F8QA 4IL2A 2YB4A 3W7QA 2QHAA 3NYDA 4JTLA 1G4EA 2QGYA 3WLNA 2W91A 4CD6A 4OUIA 3N34A 3AXIA 3VUPA 4J4KA 4CGTA 1IEIA 1OADA 4W5ZA 3AZRA 3NR0A 4UFIA 4ODKA 1NFGA 4HTBA 1RY0A 3PBUA 4AIBA 1KTNA 4GMEA 3DBNA 4TR9A 4C1KA 1FWNA 4D6EA 1NAL1 1X1ZA 3WLJA 2VJXA 2G96A 1CIUA 4R5EA 1B31A 4O14A 3GRIA 4LFYA 3EB4A 1MI3A 2CLFA 5M17A 2LLEA 3CPUA 4IM4A 6PTDA 1KCLA 4XO6A 2RUCA 4GG9A 1V3IA 1ADOA 1F07A 1SMDA 2ON3A 3QKZA 1VIWA 1A3WA 1Q6DA 3EPMA 4HTYA 3T8QA 4HVXA 2UWFA 4E6MA 1TVNA 3B8VA 3WLMA 4DBWA 5IFPA 3GFXA 1Q6QA 4IMEA 4ZTYA 3MU7A 4ZOEA 4U28A 4XZHA 1BGAA 2DV0A 1EHAA 3NQBA 2UZ5A 2XP8A 2ACRA 4BJHA 3TTOA 1FKWA 2FDMA 4G1NA 4PTXA 5DMLA 3AJ7A 2I16A 3GXIA 3PPGA 4BI6A 3K8LA 3WH7A 1DJIA 4NASA 1LROA 3PF3A 4OOZA 4C6KA 4ICNA 3I3BA 5EYWA 5LHFA 5I3KA 1EF2A 1QHOA 1TA3A 1JFXA 5D33A 4AZGA 4YCPA 3EBVA 3OB8A 3NQ8A 3CQIA 1E56A 3ONCA 5CKSA 2VUNA 1GVEA 3IJ7A 4DUOA 4US5D 2QDGA 4FPSA 4EXAA 1TJ2A 5CAHA 2WNZA 2XFYA 2VYOA 1D8WA 2XIBA 1UYQA 1FWAC 4LVGA 3L23A 5I7GA 2ZDSA 5EKYA 3GR7A 3H70A 3HB9A 3KWXA 3L7RA 3TW9A 1K8CA 4Z1YA 5CCZA 1JZ6A 3WQ5A 3BCJA 3XISA 2OJPA 4O1FA 3P8JA 3PBVA 3F4NA 4JY9A 3BDKA 1I1WA 3DCPA 5XIAA 3AYSA 1PDYA 4JIRA 1B30A 4S23A 5KSWA 4MY8A 1F4HA 2YPIA 3OP2A 3SCWA 3CT2A 1UR9A 4IPLA 4WR3A 3VIKA 2W9MA 1KLYA 6XIMA 3UG3A 3P0XA 3IVUA 4JKLA 3KTXA 1RA0A 3CQHA 2WC4A 2DW7A 4HHMA 3K13A 1FDYA 4EWJA 4ROPA 1Z48A 2BGNE 1CGYA 4AXNA 2GWNA 5GVJA 1MZRA 4MKNA 3FYOA 1V4YA 5HMEA 3OG3A 1OYBA 2Z7GA 1QPOA 3IUDA 2DP3A 2BFGA 2ISFA 3N2CA 1CGWA 1V02E 3FGCA 1C91A 3A5VA 5FF3A 3EB2A 2ZX5A 3R0UA 4GOAA 3W1QA 4RCXA 3EWZA 4PSPA 1GRJA 3LEPA 4XZ9A 2L2SA 4V15A 5JBEA 2ZX6A 4BF7A 3CS2A 5H91A 1ITCA 4C7FA 3LPOA 4IPXA 4J27A 2PDYA 1TVLA 4W85A 4B5SA 4XKMA 3TMLA 5LA1A 1EO5A 2OG9A 3O5DA 3TROA 1DP0A 4M19A 1G6CA 4HOZA 5FJJA 4DWSC 3SFWA 3FVDA 4N42A 3WLHA 2G95A 1ZBKA 4NXSA 1Q6UA 3IUIA 3P14A 2Z1XA 4QNWA 1DQWA 4MJZA 3STEA 2XVGA 2QCLA 2ZBTA 1QJWA 2IW0A 3NQCA 4PC8A 4L1WA 3F5LA 1PKYA 2X42A 1NMVA 4DXKA 2RQSA 3LD5A 1UA7A 2G3MA 1G94A 4PSRA 4U2ZA 2NVCA 1XH0A 4PTNA 2ZZ6A 5EFDA 3VA8A 1MWOA 1YE6A 3AMKA 4B2DA 1J6YA 2YL6A 1GOQA 4QZVB 4DZ5A 4N9BA 3AIEA 4AF0A 3ZOAA 2OGJA 3JR2A 3S1GA 4N4PA 1XIDA 1AH4A 2NV9A 4B4HA 1M01A 4Z2GA 4GXMA 4PBEA 3KOYA 3P62A 3WQCA 4O50A 4M8UA 2O9OA 3EDFA 2VEMA 1SU5A 2FB3A 2GSHA 1XIMA 4AZBA 4Z2HA 1HJUA 5I77A 2CHNA 3N4FA 2CLKA 5DLCA 3DH7A 3B9NA 3DFOA 4G6CA 2DIKA 1HNYA 1TB3A 1LWHA 1DWIM 3RCNA 4B5UA 2HE8A 2Y2WA 1BWLA 1LL4A 2PFHA 1VHNA 3T2PA 4LXFA 3H2EA 4UNIA 2VGFA 2VEIA 3N04A 3TR2A 3UWQA 2OOGA 4FA3A 3MY9A 5BWFA 3II1A 2FDSA 5AC7A 5HAOA 4DZ3A 2EPLX 3U2OA 2VEKA 3ARVA 4JFSA 4JYSA 1BYBA 1CXHA 1XBYA 4EPDC 3AISA 1H61A 4RJEA 1E15A 3HJEA 3N9SA 5E1QA 2AQWA 3BWWA 3T4CA 2I5IA 3CHCA 1E71M 2ZUUA 3OODA 4HP5A 3GE7A 2Z1KA 3NEVA 2QCDA 3NQAA 4JD4A 4K3ZA 4XO7A 3O5EA 2J27A 1W6TA 3TAKA 4OTKA 4J2PA 2ZZ2A 3CWHA 3WFLA 2XHYA 4E4FA 2JKPA 2WSYA 2I5QA 3WH8A 4L3NA 1TJ1A 4L6DA 1JCLA 5BRBA 3QZ6A 4DLFA 1S5VA 3S5YA 3GNRA 3V5OA 5HW7A 2NX3A 3ZVHA 3O5GA 1E55A 4IOTA 3GTYX 1W3LA 1BYAA 2OO0A 2OLSA 1YE4A 3PS7A 3WEOA 1K9EA 2GJLA 1XLKA 3M0KA 3KBNA 4LBRA 2QUMA 1W1B1 4NX0A 5L9FA 1XIGA 3P61A 3T0BA 1XM3A 2BV9A 5DT5A 4AY7A 1UWRA 2Z4GA 1QUMA 2F84A 1E4LA 2GL5A 3W7OA 2PP1A 4JN8A 3PRAA 5AHFA 4E0CA 3GIQA 4GNKB 1Z42A 4GUFA 3ARZA 2PGRA 1FWGC 4HPHA 4O1DA 3O63A 4FLQA 4NAEA 3O5LA 1NFBA 3BLLA 3O6DA 3O16A 2WJFA 1RD5A 4NX5A 3TJ4A 4QSFA 1R3WA 1TRIA 1SYTA 3W22A 2JK2A 1GKPA 3IHZA 4GIVA 4BQ2A 1RAKA 4L1XA 1KD0A 3MUAA 2QKFA 3KLLA 2AMGA 3ZWTA 4B9ZA 3AYRA 1KM2A 4MB4A 3UESA 4A4AA 5GJPA 2WKJA 4WK9A 2PF8A 1ALDA 2G3IA 4R0XA 4ZQPA 6REQB 4TYOA 2PV2A 1NEYA 3PUGA 4XZNX 4KF1A 4W93A 1PX3A 3ORWA 3F03K 3R10A 4FMVA 3G2GA 4F66A 4GZ7A 1B4EA 4M51A 1XIFA 3PBMA 3TUUA 3UY7A 3UP8A 5U4NA 1V6XA 1W3NA 2YLLA 1U5VA 1XGZA 4J7RA 2BDQA 5EMLA 4Q8NA 4TX9A 3IK2A 1XF0A 2ITKA 2Z1SA 3G8EA 4NVTA 4JYEA 2PWEA 4LAOA 4PULA 3ARRA 4LF1A 1WBHA 1FKXA 3QW3A 1UMLA 3RLVA 3WQDA 2J13A 8CGTA 1DVJA 1SO4A 4DRKA 1OZMA 3MYPA 1VCGA 1AMYA 4HN8A 4F0HA 1VEPA 5T26A 3M5YA 4Y7EA 3TCZA 4HN4A 3H2CA 4QEEA 1SO3A 2PBGA 2BVTA 1J0YA 3S5NA 3BGJA 3A4JA 3GVWA 2RDWA 1JNSA 2PD5A 3NFUA 1AW5A 3Q37A 3ABQA 3W53A 4Q4PA 1F6PA 1IGSA 1TTJA 4XZBA 1OT1A 1TREA 3NGJA 4Q8OA 2XPBA 4OBTA 1HXJA 3SQSA 4B15A 2PLCA 4GBUA 1W17A 3UWZA 3ECQA 4F2UA 2BG5A 1TO3A 3E0VA 2GYIA 3VD4A 4ODOA 3ERPA 3WK2A 3W7RA 4LAUA 4ML4A 4WKHA 3PZTA 4YWIA 5K9XA 3LGEA 4E5TA 7CGTA 1X1NA 2JFEX 1W8GA 3KTSA 1LLWA 2ZX8A 5K9DA 4MWAB 1DHPA 1LBMA 3EOEA 1TKKA 4C6OA 3S2LA 5C7VA 1I1XA 3VI2A 5IDZA 1KKOA 1E9LA 3MHGA 4JFIA 1AODA 1KR0A 5HNUA 3AIWA 1UROA 3I65A 4W9TA 4WY0B 2W0UA 3N2MA 5DXYA 4C6DA 3HPSA 5ABGA 2KFWA 1VFMA 1JYVA 1UC4A 2GWGA 3GLCA 3DZ1A 4WSKA 1L6WA 5I24A 1JR1A 3VNKA 1HKKA 1GNXA 1QMLA 2VX6A 1UASA 1Q4NX 3IJ8A 4LJ3A 3GNXA 4NL1A 3F4VA 2OWCA 3VK5A 3R1ZA 4DF0A 2VM8A 3TTEA 2C18A 2EPNA 3NAVA 5A69A 1LLZA 1YBQB 5LIKX 3E38A 2G4JA 4LAKA 4RR4A 4PCFA 2A7NA 2DSUA 3DUGA 5AB3A 1OFQA 4M6UA 4H9UA 3QZEA 3GS6A 3L68A 4MOZA 2VR4A 1WA3A 1XR2A 2AGTA 1PS9A 1W37A 4CQBA 2VZOA 3QEZA 3UU0A 4ERGA 5H1WA 3W7PA 3GG8A 5I00A 3O9NA 3VE9A 4M1BA 4Q4SA 2Z6JA 1R8LA 3VGHA 3DFTA 1YATA 1MQRA 2EPKX 3DIPA 2AKZA 1YNYA 1X1OA 3NQMA 3V5CA 3RM8A 3GU1A 1TJ0A 4ES4A 3O5FA 1HO1A 2FZ9A 4TMBA 3NL6A 3ARTA 3NQ2A 2HXUA 2Q3RA 3RX3A 1PHQA 4XUYA 1FWCC 2I57A 1ZPTA 4DRSA 3WZ0E 3UBPC 2RAGA 5H8MA 4CD7A 4P7NA 1SFLA 2YL5A 1MZHA 4JL2A 2Q09A 1UKQA 3FSUA 1G4TA 5HNTA 2QT3A 1YTDA 1A7XA 1VLWA 4JDBA 4UR9A 1F9CA 1XW8A 3WNNA 4UBPC 3SQMA 4GQGA 3W00A 2IXUA 1DIEA 3ARUA 1ZS2A 5I2UA 3EA1A 3FJLA 2BHYA 2ONEA 3R43A 5FJRA 2QEZA 1L8NA 4D8AA 5A6TC 3QPEA 1VPXA 3HGOA 4J40A 1K8ZA 1SPQA 7TIMA 1MW0A 2ZTJA 4DXXA 4FP1A 3SCUA 3FSTA 4REQB 1VRXA 5CG0A 5BU9A 4H04A 2CC0A 3MO7A 2YIHA 4JFTA 1I2OA 3PZNA 1QOQA 3HU7A 3DI0A 3SIMA 1ME8A 2HBXA 4ICCX 2H8XA 3MP4A 5HW6A 1UCWA 1UPMB 3ONBA 4A8LA 3SSJA 4B3KA 4R53A 1EA9C 2XP5A 3G1AA 4B91A 1PX4A 3V0UA 4MUZA 7REQB 1H7XA 3FNDA 3QY6A 1R87A 2YCLB 2WNNA 3BJSA 3PWIA 2JF6A 4GIAA 3RO6A 5GNZA 3VX0A 1D7IA 1QO5A 1K3UA 3ANYA 3NZRA 1AL8A 1XHGA 2GDVA 3GG7A 4V33A 3SCNA 4YXGA 2V82A 1AJ2A 2E1DA 2HE5A 1DL3A 2XSBA 2JGQA 3TQPA 5E6ZA 3LXCA 2A1YA 3SCTA 2YXOA 1CECA 2EJ1A 2J8GA 1VAHA 2I7GA 4XBSA 3CNYA 1HP5A 2YXXA 2VWSA 3IAPA 3ABRA 3TVAA 3AS0A 3P7YA 3HO8A 4H2HA 3U2CA 1M53A 3GTHA 3RNDA 3VKAA 3W82A 4GGQA 1OGBA 4KBXA 4AD4A 1C8VA 4BEUA 5C9RA 3OBKA 4Z0JA 1K8XA 1H60A 4O8RA 2ISVA 1PL9A 1RK6A 3B0VC 2G3NA 3BAYA 3DFHA 3W7LA 3RITA 1DIKA 3CYVA 3DAQA 4ACZB 1TPB1 4JX5A 1XC6A 4ZB0A 1XSIA 2QDDA 5CQ1A 5RUBA 2ZUNA 3F7JA 2ZXAA 3LY0A 5M1TA 3HURA 2QMJA 3KOZA 3CWNA 4IH3A 3TQKA 1X8CA 4TNSA 1R9XA 1LM1A 2IUZA 3BLEA 1PV8A 1C8XA 4IG2B 1B90A 2FHFA 1KFWA 4BQ5A 4GUJA 1X39A 4QX4A 1Q6HA 3B9OA 1Q6RA 3EIPA 1Y5WA 1ZRQA 3LMZA 5C9WA 3V16A 3W7KA 1SR9A 3RGCA 4O1BA 2VR2A 2G3FA 3W24A 2WKGA 3W87A 1EZWA 1IGWA 2D22A 2UV8G 1V6UA 4DWSA 3B8UA 4AB4A 2V5JA 3MV11 5FI8A 5I02A 4WDXA 5HINA 4X9YA 2GLKA 2WMGA 3VDCA 3FN9A 3AIVA 3QC0A 3G0XA 3CAQA 4PMJA 5I06A 2AGKA 1MUWA 3RJXA 3MJMA 3PR9A 1OEPA 1CI1A 4IFKA 4NJGA 3QGKC 3DG6A 1E6SM 3UCDA 5BOEA 4PTMA 1XUZA 1DE6A 1XL9A 3NQDA 4LH8A 3PULA 3PAOA 3HGRA 1RXOB 1HL9A 2IQDA 1J4IA 4XAPA 4Q4RA 4TTGA 3M0MA 5D9MA 1BPLB 3ARXA 4MY9A 1GYMA 2BNJA 4HPNA 2G4FA 3KVLA 3JYMA 3G0UA 1KR1A 3AMCA 2GZXA 2O56A 4BF5A 2ZTKA 4UMCA 1XRFA 2XN0A 4MGGA 1KXTA 5CC5A 3F2DA 2JBMA 3OVQA 1XBVA 2XGBA 3FAXA 4E2DA 3S6DA 4RX0A 2UZ9A 3BE7A 4HYVA 3KL0A 5LKYA 4AZ7A 4CD5A 4ZL1A 3VU2A 1W0MA 1SW0A 1HXVA 2QUTA 2J9ZA 3QLDA 4W8AA 1YNPA 2XZ9A 4JTFA 3U0HA 3PFRA 3CAVA 4ZCWA 4BZYA 2B7OA 1U1UA 2ZC1A 5JXQA 4QDWA 4UB9A 5AFDA 4EPBC 2XG9A 2VGBA 2RGLA 3S5SA 5BRQA 4X3ZA 3A5FA 2E1WA 4HKPA 1H7RA 1ICQA 2Z0IA 2EO7A 1K1DA 3CK5A 1OFOA 1ZY9A 2NT0A 4J3TA 1ZQ5A 1JYWA 4TU1A 2BY3A 3QYQA 3SURA 4YHGA 2C7FA 1ZGDA 2Z29A 3WUEA 3WNLA 1XV8A 3MUZ1 3M5VA 4MWAC 3W6YA 4K36A 1FWHC 5C7HA 2QQ6A 2CU0A 3H7RA 4PMRA 1GHSA 2H9AB 2PV3A 3PFMA 1GZGA 3ZS4A 1WQ5A 4RNIA 1QK0A 1KXHA 2QDEA 1RH9A 4DIPA 2WW5A 1V08A 1FKGA 1XDJA 3FX4A 4CNUA 2V3DA 3GG1A 5CG7A 3ABXA 4BI5A 1P43A 4U3AA 3DX5A 3TLLA 2O0TA 3S9ZA 1K4HA 4PRTA 2QVNA 1NOWA 2FH6A 4U5IA 1HN1A 2XGIA 3IAQA 2PTWA 4M6VA 3UFYA 4JQ3A 1XLIA 4GE8A 2VCDA 3R0DA 1UWQA 5IDIA 4FI4A 1TWSA 2WWDA 4CQ8A 2FAPA 3LGGA 1SGJA 3LQLA 3CUZA 3QTGA 2WMJA 1KNWA 5ABFB 3FW6A 4N19A 1M3UA 3QVQA 1E1CA 3CPRA 2I1OA 1FBAA 3W6LA 4A2RA 4OFCA 3L2IA 2YLAA 2DSKA 3MS8A 1MQQA 4GO9A 1R2TA 3THDA 2BHZA 2WHKA 1N2VA 4PMZA 3LUTA 2RUSA 3VGGA 3T1GA 4AZ6A 1Y5XA 1E3XA 4RPPA 2ZR6A 3ICJA 4PZVA 1US2A 3VIIA 3IWPA 3GZ3A 3P5YA 1A5NC 4X60A 4WGHA 2K8IA 3PZIA 1W9UA 2FQIA 2HROA 5SWUA 4PCSA 2EHHA 4FX8A 4WY0F 4Q8UA 4OKDA 4C6BA 4Y9PA 5I6SA 3GDKA 3SJNA 3LV5A 4WDWA 2RJHA 2G3JA 1JI2A 1FJDA 5D05A 1V93A 4HNTA 1TQJA 4EKJA 1UR4A 4CU6A 4YNGA 3LI0A 2Y6ZA 3KAFA 3GH7A 2QLYA 5G2HA 1Q85A 1E1EA 3W07A 3VCNA 1WYIA 2C0HA 1TR1A 2DZSA 4QIBA 3SECA 4ALDA 5BMWA 2PTYA 1JQXA 3TU9A 2HEJA 3LERA 1M1BA 3WNKA 1O1ZA 3VNJA 3UZWA 2J88A 2L5HA 1SO5A 2J7HA 3O15A 1OX4B 2D24A 2IPWA 4C1NB 3M7WA 1JDDA 3ALGA 4GA8A 3A21A 4HBOA 2RFGA 1ME7A 1EJWC 4O4VA 1I2PA 3GBDA 2OQHA 2QCHA 3AXHA 4DPQA 3O0FA 3CL8A 1UKPA 4AD0A 3N2BA 2ZA2A 1LRQA 3QQ0A 5HQMA 4B5WA 1UD8A 2W27A 3ZM8A 3OG2A 1US3A 4J28A 1Y0EA 3QXBA 1EUAA 2OZ0A 1UP3A 4S3AA 1GTEA 4MMWA 2A6LA 3AQUA 3W25A 1QR7A 2DQWA 1EIXA 4PA8A 1J4EA 1YPFA 3S0CA 2E3ZA 5C8BB 1S5MA 3DGBA 2R1LA 4PFHA 5AHLA 1S5TA 4M80A 4L7ZA 3W7GA 1OF8A 1NDWA 1FCUA 8A3HA 3RK8A 4WGXA 1GCYA 4RE3A 1E4IA 2NSOA 2DT3A 3C0LA 5FCZA 2DVUA 3VIHA 1UZ4A 4XKYB 1CXLA 3QV9A 3SCOA 2YDSA 3PB2A 3FS2A 5A3HA 2JEPA 1QPRA 3W1TA 3AU2A 1M7JA 5HA7A 3EXRA 1DJGA 3NG3A 4XAGA 3O5PA 1MNSA 1Y65A 4QDPA 4QAIA 2X1IA 4O1CA 1FXPA 2WMFA 1HL2A 3UWEA 1T41A 5EMMA 3SUSA 1VHCA 5ABTA 2BBFA 3MZNA 3Q58A 2QAPA 5FF2A 4Q8QA 4WKFA 5AHEA 4C02B 1SZFA 1IF2A 2V5BA 4W8LA 4MFDA 4J3WA 1UUOA 2VGIA 1UKSA 1KM4A 1RV8A 3TE9A 3AC0A 3OBEA 2VOTA 4ADTA 3AHYA 4DO6A 4B4FA 4RDZA 4IP5A 1KC7A 1GVRA 4GCXA 4RE2A 3HFTA 1A4LA 2WVUA 2ZVRA 3L0KA 1FVPA 1YLVA 3OOQA 4JTHA 1CW2A 4HNUA 4GI8A 3UT0A 1DIDA 2Z1BA 3WDIA 2IS7A 3CH9A 4GI6A 4OHQA 5B80A 2WPGA 1LP6A 5ENLA 1RPKA 4FR6A 4U84A 1ZCCA 1J6PA 4O28A 2XIQA 1NWRA 1BSLA 3KVMA 4QQUA 1KM0A 2OWXA 3DC0A 3OZPA 1W8SA 2OKTA 2E40A 3C56A 4S3CA 1K4GA 4JTCA 4U4MA 2XFFA 4PEEA 3NVDA 3ARWA 2BTMA 4DN1A 4KFOA 3H9RB 4MZ1A 2VRQA 3RX2A 4NIRA 3SCQA 1JYNA 4GY7A 2DDXA 2A7PA 2J7BA 1B4KA 5DX7A 1E0VA 2WCSA 4H7ZA 4QT3A 2VD9A 3ZYZA 2DZBA 2ISDA 1GZ1A 1P1MA 3KRZA 1ZTVA 3HPXA 4ZSTA 5TIMA 2VZUA 3CV1A 2W5FA 1K9TA 5A8GA 2R9RA 5DT7A 3FJ6A 1E1FA 3WLSA 1OJXA 1J9YA 2YBUA 4D6GA 3CUIA 1KV8A 1BVZA 1IXOA 2A5HA 1J93A 1F73A 3M0ZA 1EO7A 1LUCB 1QI0A 5E5CA 3URAA 3R94A 4QM1A 4TUFA 3DFNA 4K7VA 2R1PA 1EEXA 2VURA 3RRXA 4J4OA 3JYJA 3GR4A 1S2AA 5HJXA 3O7UA 1LOLA 3BSGA 2VZTA 3H26A 4IZGA 1G01A 2PU1A 3H4XA 3EOUA 3L5LA 1UJPA 1VBJA 2WZMA 5JH1A 3VGEA 2BB0A 2ZX9A 2C15A 1V0LA 1O5KA 2VOMA 4IISA 4CU8A 2IPGA 1XLAA 3TV8A 3D3AA 1MUMA 4EANA 1KQZA 4JTRA 3CZJA 4DJDC 1MEIA 1ISXA 3VD5A 4DELA 1JZ2A 4DUXA 4AHOA 3M0VA 2XWEA 2OQLA 1YTKA 5EFFA 5TD4A 1ITUA 4Z2JA 5GNYA 2VC6A 4IQJA 2J66A 3E02A 5ECUA 3U4AA 1JULA 5LIUX 4JR5A 2FVLA 4KERA 1JCMP 1DXFA 1AQMA 3REQB 3QFWA 3KTCA 3FA5A 2ZRUA 4BY3A 4JCLA 3LHUA 1N8WA 3ZT5A 2TYSA 4L9ZA 5C6MA 5D2TA 3C8NA 4H9YA 4UFMA 2VEPA 1PDZA 4GISA 4BWLC 3T0AA 5DN1A 3OA3A 4UMBA 2XGZA 2QGHA 2OX1A 4Y8EA 1QT1A 1QNOA 2DORA 1JUKA 4FEZA 2ACSA 4D72A 3A13A 3OHMB 4PBFA 4DXVA 4A29A 3TMQA 2MLXA 3QSTA 4KR0B 4KWOA 4R34A 4JFJA 4XAFA 2E8YA 1S46A 4L1GA 4Q7NA 6A3HA 2EPMX 5J5DA 3OZMA 1FTXA 4R85A 4JTJA 2B0MA 3TTSA 3VCRA 1KFLA 5KZEA 4PFMA 2RH9A 5CZJA 2HQAA 2V5CA 5BYWA 1QI5A 2BASA 1XI3A 1D3GA 4HB7A 4PMUA 4IGSA 4DQWA 4PE8A 1NWSA 1E73M 1EKOA 3JU2A 2P88A 3P93A 3USBA 4GX9A 5LA0A 4ODMA 2HCVA 4QLKA 2ZRZA 3CEPA 4Q22A 5MKGB 3OW1A 3R7MA 3T6CA 1CB2A 1BAGA 6REQA 1HZYA 5FL1A 3GYEA 1F3WA 4P8UA 4D6HA 3AJXA 1AW2A 1HF6A 5F4WA 3I7RA 5D03A 3LTPA 1QCWA 1XYBA 1VLIA 1FDJA 2E77A 5IFTA 1X8FA 5I3DA 3C86A 4AEOA 4IPIA 3WCZA 1TPVA 2PLJA 4PMDA 2OSWA 2PI6A 2PF0A 5LIYX 1K7EA 5JBFA 3SFKA 3H21A 3CUHA 4EVZA 3O6CA 3UXAA 1VFHA 2C1IA 3G18A 4QLLA 4HYWA 4XWUA 5AYIA 5I0DA 1RLDA 4UTMA 2GSJA 1S2WA 4X22A 5A6MA 1WE5A 3GVQA 4B3ZA 3NM3A 3HTWA 2BGSA 4YN5A 1BD0A 3PB0A 1ZAIA 3M0XA 4S3KA 2GQ3A 1GVOA 1F8IA 1T0OA 4IFOA 5IXEA 1E0TA 4E2BA 4KGJA 1REQB 2PDLA 4W7VA 3LK6A 3VMOA 1XS2A 2BOEX 1BGGA 3ODKA 4KT2A 3KRBA 1I0BA 2E09A 2VI0A 5A5WA 3UG8A 2Y85A 3E0LA 3I4KA 4MADA 1AQ0A 1BVWA 3EA3A 1U79A 1H50A 1OSEA 5F2MA 3S1XA 1VEOA 4L9XA 3KFTA 1Q6FA 4KQZA 2VX7A 4HCLA 1JD7A 1DKWA 2NQZA 2QPXA 4NZ5A 3PPHA 4MWAA 4DF1A 1JVWA 1XWYA 1Q5MA 3IGXA 4UMAA 2WKLA 2BY0A 1S2CA 1TJPA 4WY0A 5CZSA 3GW0A 3WLQA 4XTIA 3I6RA 4QSHA 3IJ9A 3IV3A 4ONVA 1BRLB 2FHCA 3OLIA 3PJWA 2YW3A 3UR5A 4FO4A 3GPKA 1OCQA 1UBSA 1LOSA 4Y9AA 3NPVA 3CL7A 4WEVX 4UOJA 3SGUA 4J3XA 1RLCL 3B8WA 3KBJA 3V75A 2VL4A 2Y63A 2VC7A 3WBWA 1YBQA 1JYXA 4TW7A 3R58A 3OO2A 1VGAA 1BKFA 2J7GA 3CQ0A 5C70A 2Y8KA 3BJFA 1I45A 3CT7A 4S3EA 2NUYA 2GJXB 4RW3A 3BTNA 5D04C 4OGZA 2PZNA 5I3JA 3TAOA 4NSBA 4DBUA 4K38A 1VPQA 3CQKA 2VCCA 4KH2A 3CUJA 2FGZA 3L4VA 5CGTA 3TZNA 2VDIA 4GX8A 2IKGA 3WQ4A 5CSYA 1W1ZA 1W9BM 3UR7A 4A21A 1TV3A 4DAIA 2DG3A 4QHRA 1NELA 5D2VA 1IXPA 1TSIA 4ZXOA 3O5MA 4S3GA 4DO4A 1R86A 3AUJA 3TC6A 4GYKA 2HDJA 4Q7IA 1WXYA 1GOOA 4W86A 3MMTA 4GGBA 2FPTA 3OLEA 4JIIX 4KCTA 3MTWA 1S2VA 1HTIA 3K4DA 3QOKA 2I56A 2NLYA 4AQLA 3IIZA 3GU0A 3PM6A 2OXNA 2XM2A 3KZPA 1EJTC 3B9DA 3C8FA 3D3FA 2YOCA 1GPWA 1NFPA 1I2QA 4AZCA 1H7WA 4QQ3A 5D8WA 2PDQA 3ZT7A 3WJWA 5PTDA 2DFAA 2EF9A 5K4XA 5IBXC 3W7DA 2YL8A 2OO6A 3VILA 2WLZA 1UQYA 3W27A 1H2JA 1KFCA 2FJKA 1RCQA 3L0NA 2X7VA 1MXDA 4DHGA 2XFWA 1LQ0A 4XD5A 2QUVA 3AHTA 1YDOA 2QS8A 4IIFA 4REQA 4ADUA 4ZB2A 4P8XA 3THUA 2VR5A 2FJUB 2WHLA 2V8ZA 5CLWA 4DT4A 4JDYA 4G8TA 1HJSA 4ZR8A 1X6UA 4I6KA 1E5NA 4XSLA 3TN3A 3GB6A 2EKGA 1QTWA 1O66A 3LX9A 2QCCA 3OBAA 1XH2A 2OFJA 2OSXA 4DM1A 7REQA 1FAPA 4G7EB 1XFCA 4C5ZA 1KRCC 3N9RA 4R33A 2QNEA 4DH0A 3VNZA 3GXFA 3DC8A 3RYSA 2V3EA 2E4TA 2WZTA 1N8IA 3N6JA 3B8IA 4AMAA 1POKA 4DRQA 2WO5A 3PTQA 1TZZA 1U1HA 5K2ZA 3NQ7A 1EA0A 3A3WA 1TRDA 2EXOA 4B5XA 2PRLA 2X09A 3VINA 1TPEA 2B7PA 2PODA 1E9YB 1WOAA 4M6QA 2DZTA 2ODOA 3MA8A 1VBGA 1SSGA 3APTA 1QFEA 4M81A 4ZOAA 3TJIA 1VJSA 3THAA 4GYFA 4RDWA 1UB3A 2GOUA 3APYA 4TVDA 4HMCA 2M1IA 3UWVA 3EWYA 3HQNA 3LUOA 3S1VA 3SN4A 2G0WA 3TW7A 1BWVA 5DMMA 3K1GA 3RFAA 4AHPA 3BOFA 4HOXA 4UZUA 3WK1A 2DIEA 4FXSA 1WUEA 3W9ZA 3O6AA 4G56A 3AMLA 3ISIX 4JTSA 3RX4A 5CPNA 1YKWA 2KZHA 4ACZA 4I9JA 1VB9A 4TQTA 5K3VA 3VC6A 4RK8A 5B7YA 3M46A 1E5JA 4AYGA 4FLRA 2QF8A 1BF6A 1S5WA 2OCZA 4UR7A 3DU0A 4FF5A 3MI3A 3B3DA 3N17A 2ZQTA 3S4TA 5EBAA 5AN7A 2XFRA 1CGTA 3V35A 3BSHA 3I3DA 4IG2A 3UVAA 3M47A 2KGJA 1OK6A 3T0TA 3GDLA 1KKRA 4XTDA 1G4PA 1E44A 3IJLA 3NRKA 1UZ1A 3T09A 5DIVA 2XIMA 5B8IC 1MW3A 3L5AA 2ZR4A 4LPCA 3WBEA 5FD0A 3A4XA 1XISA 2OOFA 4L80A 3HPAA 4IMCA 4PMNA 3S5OA 1QWKA 3BPWA 1NSJA 1UIPA 4ZO6A 4AIUA 3WD4A 2FHBA 1R30A 3GWQA 3QKEA 5HWJA 2D0HA 3UQIA 2A6NA 4XBKA 2PTDA 4B5VA 3ZLFA 4UTKA 5HPOA 4X0VA 2WHJA 1F40A 3NL3A 1ISWA 2V63A 2ZVIA 4GGHA 3UZYA 2DW6A 3MWCA 1FHVA 2HSAA 1A5AA 3QRHA 1YDVA 4FXJA 4C65A 4NY2A 1P48A 1SMAA 1V3MA 3VIPA 1E9IA 2DZWA 1W9XA 2X1SA 4O0QA 4BQ3A 3PTKA 4O2TA 2O9TA 2AKMA 2WVTA 2EAWA 1C8QA 4H9ZA 4Z17A 3TOYA 1XD1A 3VIFA 3HPFA 3WLTA 1A5BA 5AZ1A 4UFKA 5CPQA 1O94A 1P0NA 3S2NA 4FAMA 4ZPWR 3VAVA 1KO0A 2ANUA 2Z6IA 2XH0A 3VMNA 2MNTA 3MDWA 4LNYA 4LOCA 4GUGA 3E96A 4BS0A 2PN0A 3ARYA 3PNUA 3UXKA 3WLOA 3APGA 4S1FA 2DVXA 1EGVA 3B4UA 1X6LA 2IPJA 4RZ4A 2D1ZA 1I9CB 3KADA 1BEUA 1H7NA 1SW3A 3LCLA 3C0QA 1IIGA 3E0WA 3LDVA 3BXWA 3BCDA 3UZJA 3LCFA 4E4PA 2XVKA 2D73A 4MWAE 3RXZA 1UC5A 1ZCNA 3T0CA 3W29A 1WDWA 3M43A 1VFUA 3MUXA 4CNPA 3TXVA 2CEQA 3G1SA 5ECVA 3RILA 1XGDA 5BW6A 3AWOA 1YMYA 1XFBA 2ZRWA 5C2XA 4J3SA 4DJDA 3KHJA 5D9PA 3OJGA 1QXLA 4FX6M 1OWQA 4LYRA 2BXVA 1YADA 2Q8LA 3E12A 3UVIA 2B7QA 2PD9A 3M0HA 3U48A 4FF7A 1N82A 2NQ9A 4WX2A 1GUVA 3QPYA 2VELA 3U7BA 1TUFA 4ZE5A 2VZVA 5J04A 2FPYA 1U22A 2H9AA 2GQAA 3ENLA 3IGHX 1OG0A 5M3WA 2ZUMA 4DI9A 1W56A 5A95A 5A2CA 1X96A 1BSIA 3CZKA 3WK3A 4FX7A 2C1GA 1PX8A 2ZRVA 5MHBA 3H2AA 3VIMA 1Y0OA 5FJTA 3EXSA 3VOGA 4CNOA 4IIBA 3NPUA 4BWLA 5A8OA 3DYOA 4YTTA 4HARA 4UFLA 3BG5A 3SI9A 4H2CA 3L21A 4Q4OA 4BF9A 4HZ6A 3GH4A 1KBLA 1FFQA 2O4QA 3DBPA 1EPVA 1SSDA 1MXSA 2XH4A 1C29A 3GK0A 3SJ3A 5ABFA 1KCXA 1JPMA 1C9WA 2CBJA 1UR8A 4GXWA 1AG1O 3UJEA 3WF4A 4XAZA 1EGZA 1B3XA 3BAKA 1W32A 1J2WA 4JFWA 4TTUA 2GUYA 5HWNA 1RJRA 2LKNA 2ZUWA 4JQ4A 5DMNA 3EX2A 4E8DA 4QGCA 1UUQA 3C2OA 1DORA 4AWTA 2E8ZA 1BTCA 3IGSA 3IJIA 1CXKA 2SFPA 3MKVA 4XBJA 3FKKA 3WNOA 4FOJA 1CLKA 3AICA 4PRWA 4JY8A 3FXGA 4EPEC 1MO0A 5D2YA 3OTRA 3K46A 2OYKA 3VC5A 2PWDA 1TQXA 1IT7A 1M9HA 4OUEA 3W0KA 1B57A 4WVXA 2PU0A 3RHGA 4JEQA 1ZSXA 1ENUA 2VFHA 3ITCA 3UNDA 5FACA 3TKFA 2IQ0A 1V77A 5A6BA 1YNQA 3MVIA 3VKCA 2YJQA 1HKMA 2R1NA 2Y61A 1PB0A 1ONEA 4BCEA 4AEFA 1G67A 3C3UA 1PZ1A 4RNHA 3ELFA 4C1NA 3RRAA 5LNVA 3UERA 5CPOA 1WDQA 5HR7A 4H6QA 3U9IA 7TAAA 2QMKA 3NXLA 1EQ3A 3E2VA 2Y70A 4GYPC 3G6LA 3CBWA 3M9YA 1XYCA 2Y5SA 2ZR5A 1OT2A 1G7VA 3MUCA 3B4YA 1FRBA 5I3HA 4DJED 4H6RA 1F8MA 1ZHAA 3CO8A 1EBHA 1F76A 4DNHA 1F5ZA 3KP1A 3W4RA 1QWGA 4IJCA 1R7AA 3FOKA 1R38A 3NO1A 3OGRA 4GI9A 4LU0A 5DY3A 4JTDA 1KXVA 2FKPA 1D7KA 2J9XA 1O60A 2R6OA 3QSRA 3TJXA 2CW6A 3QQWA 5TQLA 4O53A 1R6WA 1W2PA 5JMUA 3SRDA 1MRAA 1EJVC 1H1YA 1WBJA 4FOUA 1DPMA 4XKYA 2J74A 4HNCA 4JKKA 4O1EA 3G1FA 2HJPA 3K2GA 2NUWA 3SRKA 1EFZA 1K03A 4IHCA 3VNDA 2A79A 2Q01A 3FA4A 1ISVA 4JHOA 3EKLA 3LZ5A 3L12A 4UZSA 2BXZA 4DYJA 1NWTA 1CLXA 4TO8A 3A3XA 1KFBA 4DUVA 3W1LA 5ABEA 4I5XA 3MHFA 3S83A 5A6JA 2OELA 1XLMA 4AC7C 1FH8A 4KW2A 5M03A 3PZOA 3E9AA 2ZCGA 1J10A 3V1PA 2CZVA 3UG4A 5HT1A 3ZJ8A 1EOMA 2ZE0A 3IKDA 2OEMA 3VIGA 1TWDA 3PANA 3V5FA 2GUBA 3TA6A 4WIWA 5BRPA 4NZCA 2W67A 2J9YA 1KTBA 5I3FA 2Z1VA 3M0YA 1MW1A 3L2MA 4Z1CA 1ZUAX 1BF2A 1X6NA 4UQAA 3LM3A 4PUWA 3H4WA 3EWXA 2BVYA 3H7UA 4H19A 1UR0A 1G69A 1D3HA 3KDOA 4P5UA 2ACQA 4HMDA 2NQ5A 4RV3A 2ZQVA 1UH4A 3SUVA 3ITOA 2BP1A 3U2EA 3JVAA 1JDAA 3GX9A 1EH9A 1GQIA 5HANA 4OBSA 4GJ1A 5I3IA 1D7FA 3FV9A 2FTYA 1PO9A 3IANA 1EYWA 3F2CA 1QI3A 1ZZMA 5EGRA 1VP5A 3MWAA 1PYMA 1WX0A 2Z26A 4IIHA 4R88A 2GVJA 3DENA 1IT0A 3AXXA 3BOXA 3R13A 4YYFA 1KW1A 4Q6JA 2ZZ4A 4ORMA 1V0MA 1TA3B 5HWBA 5LIWX 3O5RA 2G50A 3GU9A 1NIUA 2VRKA 2HNEA 5IBXA 1HUVA 1CNVA 4L72B 1AFSA 3KE0A 1XQKA 3QR3A 2P5NA 4URIA 1P1XA 2PUZA 3QR1A 1UKTA 3S8HA 1JG9A 3ZIZA 3LYEA 3LCXA 4MJ2A 5T8GA 3IEBA 4DB7A 3OIXA 1ISZA 3OOBA 1RJPA 1DXIA 3JZEA 3TIMA 1Y7VA 5G4HC 4ILSA 1SFSA 4DZ2A 4Z1BA 5BXSA 4MYAA 5B7ZA 1LUCA 4FK9A 5HOSA 4L9YA 4GUIA 4V1XA 5CGMA 2W79A 3LI1A 2HK0A 1Q7QA 2Y7GA 1OK4A 4Z42C 1THFD 5AC4A 3DYPA 3F5KA 1RQEA 3W7NA 1FWTA 2XN1A 1CXEA 1V6YA 1NMWA 3BH4A 1OCBA 4G50A 3C2RA 3FFSA 2J25A 1OGGA 1QBBA 2D2OA 1KWGA 1KBIA 4HJFA 2OEJA 3UXLA 2V3GA 4IXHA 3WX7A 2ZXQA 5A6SA 2PDMA 4JTUA 2XWDA 1RQBA 2QIWA 3KWSA 1R3SA 5TNVA 1NF0A 1XG4A 1VBRA 3B03A 4YL2A 1FCBA 3GSMA 3U5YA 4ROQA 3HMJG 3C0SA 1WV2A 5G5IA 3ABOA 3V3WA 2Y24A 8XIAA 2Y0FA 1CZ1A 3NPWA 2ZICA 2A2IA 4HA3A 4HCDA 2C71A 4NXKA 1WAWA 1TV5A 3REQA 3RMJA 1GHRA 2PDWA 3W2MA 3C61A 2WBGA 1JAKA 1J11A 1W3TA 1R47A 4AMCA 2Z1WA 4LY4A 1NP0A 2PLKA 4KMQA 1TWIA 4H1ZA 1KT1A 3ITLA 5D2XA 1KBBA 3R6IA 1TMHA 3EEZA 1PBGA 2R1MA 3PTMA 2W66A 1PKMA 2PPNA 3R25A 2XTKA 5GPGA 3NPXA 4HIBA 3WEZA 5FESA 4I8YA 3LM7A 5I98A 1Q63A 1CWYA 4LF2A 3ZR6A 4M7TA 4GQQA 3HM7A 3GO2A 3L67A 4N9EA 4X61A 2X2YA 1UG6A 4LWWA 2PPGA 1JNTA 3PHAA 5I09A 3HIJA 2F23A 2D9FA 1CYGA 5LA2A 3PG9A 4N6EA 3SY1A 4J3VA 2HBVA 4LCRA 5H2ZA 3BURA 1M68A 1U2YA 4PYSA 1V3JA 3CHFA 4HA1A 3UR8A 2GFTA 1IEVA 3CUFA 3L4UA 5A8NA 5JH2A 1DJXA 4GZIA 4GPNA 3CGTA 4PUEA 2KO7A 4UDMA 1E43A 1ZFJA 1L9WA 3D6NA 2XPKA 2XUCA 2IKJA 4PEKA 5BNKA 4MNLA 2HS8A 2CIPA 1TCDA 3C4UA 1MXGA 4IWWA 5CJNA 2NT1A 3EEGA 3LQGA 3VOJA 4QLJA 3CC1A 5MKGA 2YA1A 4G5DA 5CXPA 1WKYA 4D6DA 3NQFA 1S2TA 2PV1A 4YHEA 1J8VA 1H41A 1M04A 2BY1A 3NXFA 3AYTA 5KETA 5CSUA 2WSPA 3IJQA 4MPKA 1X38A 4DRPA 2BGQA 1Q6OA 3U8GA 1Q2SA 1FCVA 1K9DA 3TFCA 1O4UA 3LXAA 3KVJA 1MQPA 1SJBA 2BVWA 5DF0A 4ZPTR 5DITA 4JFMA 4J5NA 4GC4A 4HQVA 3EOSA 1QAPA 3NOYA 3QZAA 4RNFA 1K70A 1J5TA 3O2LA 3WMBA 5G2WA 1J4RA 2V2CA 2CBVA 1V3KA 2C0AA 1ZK6A 4EAYA 3KZSA 4PCTA 1BFNA 2GGHA 4C6LA 5DO2A 2ZXDA 3H24A 3FA3A 1EYMA 4D6CA 3S1WA 3N2XA 1VZWA 3N25A 4QE4A 5ABHA 4X9SA 4M7SA 2R91A 2Z24A 4PL2A 3TDFA 4RDYA 2MF9A 3WD1A 4CD8A 4YTSA 3TONA 2E6YA 2D3LA 3EX3A 3MP5A 4RUBA 5FAJA 1W5QA 1REQA 4ZBCA 5AYYA 5D9NA 4ODRA 4AAJA 3EWWA 2XZ7A 3O6YX 2Y7EA 4A2SA 1UWTA 3GHUA 1GVSA 4F0SA 3T42A 3UQBA 3G1XA 4KFNA 3W74A 1W3JA 3V0SA 3C3NA 4LV4A 1L6SA 4ERIA 1UPPA 3UNTA 3HG2A 2HZGA 3JRKA 4LS1A 4Z2KA 2NW0A 4KQNA 4E2VA 2PGWA 5CSSA 1EC8A 1XLEA 3GXTA 4XZMX 1U30A 2REQB 2FZMA 1K7FA 4AWEA 5DRIA 1VR6A 2OSYA 1ZJIA 4B2DD 3GNPA 2PCEA 1VPYA 3LTSA 1SJCA 1ODZA 1PTDA 2QUNA 4RXGA 1BRLA 3NSXA 1TG7A 1TTIA 1PHWA 1Q7ZA 1QPNA 3ZWSA 1GJPA 1UZDA 3GU2A 3B8SA 3N18A 4A3YA 3N2TA 3PJXA 4D8ZA 4IXXA 3SUWA 1W3KA 5EBUA 3E2SA 3KLKA 1KM5A 3QN3A 3IJDA 2C16A 1PTAA 4UQEA 4NAEB 4P2VA 1NOFA 2AL2B 3UQAA 2O7SA 1LORA 1KGWA 3RR1A 4GQBA 1Z32X 3B9AA 3TOPA 2Z27A 5BCAA 2J77A 2D3NA 5HMSA 2WM0A 1PUDA 4HSHA 3HGSA 1O7AA 1WKDA 2D69A 2XVNA 3C6CA 2GJXA 2P10A 1OFBA 3VIOA 3AAMA 1UUMA 1AUSL 5U7SA 2PP0A 3GDBA 3Q65A 3UXIA 2GQ8A 3FIGA 3PZMA 1OZQA 4AWSA 3OVPA 4X0NA 1GT8A 5DRCA 3LBMA 3CHVA 4JTKA 4WF7A 4C6FA 5D30A 4AY1A 3C0JA 4PRRA 3MP3A 4F40A 4HMNA 5HBFA 3TC3A 2YFNA 3P0WA 3G77A 3PK7A 1UZHA 2ZQSA 4CNNA 2GGEA 4LGXA 4GVIA 1CXFA 4GACA 2E9MA 3T55A 3CB8A 1GG1A 1RVKA 4LCQA 1NQ6A 6TAAA 5CC7A 5F1VA 1W2VA 1LWJA 4QG6A 2XH2A 3BGGA 5D9OA 2X1TA 1SJAA 4F2TA 1NVMA 3VDGA 3LPGA 1UW9A 1J2BA 1PIIA 4JTQA 1RUSA 2XYLA 3CTTA 3GQYA 1DHKA 2FTPA 4IJBA 2DG4A 1ZP3A 5KZ6A 1Z9AA 1ICPA 1DJYA 1G1YA 1XYLA 3CV7A 3WDHA 4Z0SA 3TN4A 3TTQA 1R9ZA 4HU3A 3P84A 2VENA 1GWJA 5HUAA 2OWWA 3STPA 2INZA 2ISSA 4PODA 2EEXA 2XSAA 4N6FA 3MDYB 4B90A 3VOHA 1L6GA 2X16A 2Y1HA 1Q6GA 1LZOA 2YBVA 1S1PA 3L4WA 4C7GA 4IQCA 1OYAA 3LRMA 2JEQA 4NQ1A 4GJIA 1NQKA 1T99A 2QCMA 4Q8PA 4XK2A 3SZ8A 3UF9A 3MANA 2PEVA 4BEQA 4GYPA 1H1ZA 1JQVA 3W85A 4G2DA 4B92A 1LJYA 4WOZA 1O6IA 2AQVA 4PTVA 1DEDA 4L56A 3S2MA 3USZA 3BW4A 1VENA 1ONWA 1HG3A 3GXDA 4XD3A 3A9BA 3NA8A 4GQ0A 3W72A 3LSBA 3EOLA 1R5YA 3H6OA 1UJQA 4G7EA 3UW6A 1IIHA 3TH6A 4X63A 4LT9A 1E4NA 4GUHA 3VGFA 3ZO9A 1FQ0A 3N29A 1K02A 1S39A 1A0DA 4NG3A 2RDUA 3C2YA 3E1F1 4UNKA 3NYZA 5CGQA 3M16A 4EP8C 4HNNA 4G1KA 1VRDA 3BSMA 3I7QA 3ES7A 2MNRA 3R79A 1P7TA 1BQCA 2JALA 2VMFA 1IZJA 1X7FA 4LUTB 5AZ0A 1XLLA 2Y62A 1IQ8A 1HKJA 3L4XA 2XVLA 1RBLA 3IIOA 3E0FA 2CLMA 4BKNA 1EGMA 1DJNA 4GFIA 5CEWA 2RDXA 4OBRA 4JX6A 4XUGA 4LYKA 4NRRA 3M7SA 2IF4A 3VMPA 4PTWA