2FDMA

Crystal structure of the ternary complex of signalling glycoprotein frm sheep (sps-40)with hexasaccharide (nag6) and peptide trp-pro-trp at 3.0a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the ternary complex of signalling glycoprotein frm sheep (SPS-40) with hexasaccharide (NAG6) and peptide Trp-Pro-Trp at 3.0A resolution
rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2fdmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fdmA01
3MUZ1 4J3XA 3WY1A 3D5HA 2X05A 1VBUA 1U2YA 1MW3A 1IV8A 4H41A 4WKFA 4CCDA 1PX8A 4WKHA 1QI5A 1R7OA 2BNJA 4H8UA 4UQCA 1W1VA 1E4NA 2XSAA 1TE1A 2GJXB 3WQWA 1VEPA 3APGA 1TG7A 1V6WA 3A6OA 1C8XA 1DWHM 2VUYA 1KWGA 3WNMA 1KR0A 1JZ3A 1J0ZA 1JZ6A 1VEOA 4M80A 4QP0A 3VNYA 3VGDA 3WF2A 2XHYA 3ZSSA 3NSNA 1WAWA 3K8LA 2V3DA 4X0NA 4AYSA 3OBAA 2XFFA 2ZXQA 5JBFA 2YKKA 1NWSA 1UKTA 2X2YA 3W38A 1KGUA 2OSXA 4U33A 3L2LA 3GDBA 4JKMA 1VFUA 4H7VA 2V3GA 2XVKA 3BCDA 1UD5A 4UFHA 4BCEA 5E0CA 1JYXA 1W1YA 3SUSA 4L4OA 4V27A 3ARWA 3AIRA 1WDPA 2CKRA 2WHJA 1V03A 2RGMA 2ZWYA 1E6NA 5IFTA 1TUXA 1NOFA 1BFNA 4HOWA 1UR1A 2PWEA 4W7WA 3THCA 1F4AA 1JF5A 1HJUA 5BCAA 5AY7A 4W86A 1WZLA 5A2AA 1UKSA 3MMDA 1W1PA 1HP5A 1X6NA 1UG6A 5A94A 1OINA 1XH2A 4MAZA 2GDUA 1UKPA 2QMJA 4W87A 2WLZA 1BGAA 3A47A 4X9YA 1YHTA 4UFLA 3WD1A 4JZ5A 2Y4SA 4MAVA 1GOOA 1K9DA 3VDCA 2WMIA 4U3AA 2WC7A 3UG3A 3CHFA 2J7BA 3VIIA 3WFLA 3UETA 3FAXA 3ARSA 3L4XA 5A3HA 2D24A 3FXYA 1UR0A 1HJXA 2JALA 5A6MA 5DFAA 2J8FA 3AMCA 1QI3A 1R87A 5M3WA 4P8XA 5E0FA 4QFUA 4HZ6A 1W9VA 2W91A 1U33A 3BAJA 4PMYA 3WUFA 4BZYA 3AYSA 1LL4A 2QPSA 2J8GA 1UWTA 3FNDA 4HU8A 3O6AA 1WDRA 3VKKA 4TVCA 5GNYA 1CLXA 1ISYA 2GJXA 1W3KA 3VIHA 3T2QA 3EDDA 4M24A 1JFXA 3CLWA 3WL1A 3CBWA 2VNCA 4HA1A 2XJ7A 3VOCA 1AQHA 3EMQA 2VZTA 1LF1A 3WBEA 3ZM8A 3W81A 4JKKA 4UQEA 3GH4A 1HJSA 1M04A 3SUUA 3VO0A 5BXSA 3OIHA 1BG9A 3FHAA 1CLVA 3RM9A 4F79A 3GBDA 2ZX5A 3AZSA 3HMCA 4D6IA 4CN6A 4J7RA 1E0VA 4URIA 3PTQA 4NRSA 3OLEA 3UR7A 1G5AA 4KH2A 2EPOA 3J7HA 2E0PA 1NOWA 1EO5A 3ZMRA 1ODUA 4HZ7A 2PWHA 3VIPA 4UOJA 2VRQA 1NWRA 4P8WA 4XUYA 1V6YA 2J7EA 2EPMX 5A8PA 4F66A 4MNLA 3VIFA 3K1DA 2WWCA 4AD4A 4UZUA 3RJXA 2PWGA 5A2CA 1KWKA 1D2KA 3L2MA 5DF0A 4OOUA 1V3JA 5A8QA 2CBVA 5CPTA 3RMEA 1XYFA 3CZGA 5D8ZA 5FOOA 3N04A 4CD7A 4HP5A 2HVMA 5LA2A 2OSWA 3N12A 2C7FA 2PWDA 4UTFA 1H09A 2WW5A 1WDQA 1WCGA 5AC4A 4FMVA 1BF2A 2MANA 3T08A 1E0WA 4QLKA 1HN1A 5FL0A 5I3DA 2DDXA 3B9DA 1NM9A 4H8VA 3MO4A 2A3BA 2WSKA 4IM4A 2XVNA 4Z2GA 4PTXA 4YHGA 3AXIA 2YLAA 3OZOA 1JI2A 1GHRA 4W8BA 2V3EA 1MWOA 1FH9A 2XGIA 3K8MA 6A3HA 3T2OA 1B31A 3ARQA 4AZGA 3NUKA 4QAWA 2W4XA 3EDJA 4PYSA 5GNZA 1RPKA 3AIQA 2YDQA 4BS0A 2WK2A 3ECQA 1E40A 5A8NA 1PZ2A 4CD5A 5AYIA 1C91A 2BY2A 1QHZA 4D6DA 3CHDA 2O9PA 4DM1A 4Y7EA 4AIOA 1EQPA 1EIBA 3VILA 3ZR5A 2WCSA 2UWFA 1US3A 3VU2A 4AZ5A 3TTSA 3AXHA 3MUY1 3N11A 2EPNA 5A1AA 3F4VA 2D23A 2WNWA 2WANA 1HKIA 2YL9A 3AICA 4DUXA 4PMUA 4D6HA 1HIZA 4AZBA 4LXFA 3WMBA 1VEMA 5JUVA 4BQ2A 1CWYA 3MKKA 5F7UA 4W7VA 1JIBA 1VJZA 2BHUA 2ZUTA 1G94A 4TUFA 3N15A 2DEPA 3WDQA 1VFOA 2CHOA 1BTCA 3K4DA 1XYZA 1GOKA 3WQ5A 1GQLA 2B31A 1KCKA 2DSKA 4CD8A 4BA0A 1NWUA 1DWFM 2FHFA 4WSKA 2YLLA 3TTYA 2VR4A 1J0YA 4QCEA 1CXLA 2WYSA 3NCOA 2E9LA 1E5NA 1Z32X 3GXFA 4D1IA 1AVAA 1JAKA 3N13A 2VJXA 3GYCA 1KBKA 4GQQA 1P6WA 4B15A 2VX4A 1VIWA 3U57A 4ACZB 3VGBA 4W8LA 3RM8A 1MQQA 4PMVA 2NSXA 4K68A 2C8NA 2CETA 4DWSD 4B3KA 2WVTA 4MB3A 1R7AA 1UQYA 3PZIA 3SIMA 4PSRA 3CZKA 3ZJ8A 1XV8A 5C71A 1G01A 2GDVA 4PUDA 1HF6A 1GOMA 3EMCA 4PCSA 3PZVA 2JFEX 4D6FA 5CSUA 2RGLA 1MW2A 3MSDA 1E55A 2VZVA 1F4HA 4PRWA 1K6AA 3AMDA 4XB3A 1Q4NX 2D2OA 1E70M 4GI8A 4ACYA 4W5UA 1HVXA 2CHNA 4QDMA 4MJ2A 2ZX6A 5CPQA 1UR4A 2F61A 4TTGA 4D1JA 1J0IA 1NARA 4IPNB 1CGVA 2DT0A 1KR1A 4W89A 3WD3A 3QHOA 3WNOA 3N17A 5CPSA 1VAHA 1QNPA 5CQ1A 4RE3A 1M03A 5D9NA 4ZE5A 1H41A 2YBUA 3ZO9A 1KB3A 5GPRA 1GOIA 2J78A 3WEOA 4YN5A 1W9XA 3WD2A 1UUQA 5KZ6A 1ZB5A 4E8CA 3T09A 1BVZA 5ABHA 3WBAA 4MPKA 4U3CA 2FHBA 1KXQA 3SCPA 1ZBWA 3AZRA 2ZWZA 2VRJA 1E6RA 1E43A 2XVGA 3CZEA 5GQBA 3ARZA 1LQ0A 4DWSB 2DPEA 3WQ4A 4CVUA 2WMFA 3MMWA 1V0NA 4NF7A 3K46A 4PMOA 4PTVA 1UD6A 2E9BA 4M82A 1H1NA 4F8XA 2W61A 1J0KA 3QGVA 4UQDA 1OB0A 1R86A 1TFVA 1FFQA 1UQZA 2ZXAA 4ATLA 3AISA 1UWUA 2VI0A 4JFTA 3RIKA 3WELA 5A2BA 2Y2WA 3LMYA 3WDPP 1E6PA 5EMYA 2Y8VA 2X0YA 3BLPX 2D0FA 4PN2A 1C8QA 1JI1A 2VMFA 3WDRA 1KXHA 4ACZA 1E4IA 2XUCA 4EK7A 2GK1B 2BFGA 1E4LA 1UH3A 2VQUA 1C90A 3BXWA 3N1AA 4V28A 2X0HA 1QPKA 1ZS2A 2ZXBA 1QW9A 3AZTA 1VENA 3KE0A 6CGTA 3CGTA 1CXEA 4CU8A 2PC8A 3AIWA 4UCFA 1PEZA 4D6GA 1W3LA 1V6UA 1QW8A 1VF8A 3SCVA 2WCAA 2WHMA 3WD0A 3MANA 3ZJ6A 4GIAA 3W6MA 4ZXLA 3TONA 2VCAA 3HU7A 1N82A 1W3JA 3VGHA 4QCFA 1HXJA 4P8VA 4OBRA 3NIYA 2DQXA 2NT0A 4OKDA 2DSVA 2F8QA 1J9YA 3CUFA 5FD0A 1BQCA 1E73M 2GUYA 1I1XA 4B3LA 4AD3A 1O6IA 5C8BB 5JIPA 4AEFA 3PN8A 2YJQA 3AHZA 3MS8A 2WBKA 2CXGA 3VMOA 1OM0A 5EB8A 1WPCA 3ZOAA 3GXDA 4IUGA 3WUEA 1WZAA 5CXPA 4AIUA 4NI3A 3GH5A 2WMHA 2WPGA 1NQ6A 5BXPA 4PBGA 1UR9A 5E70A 1CDGA 4UNIA 4D72A 3WEMA 1V0KA 1VB9A 3VMPA 1CXFA 1CTNA 2PB1A 4YHEA 3AIVA 4DWSA 2ZX7A 4P8UA 1DEDA 1KXTA 3G6MA 1HJQA 3WDJA 1GHSA 4RE2A 2J74A 2ZUMA 5A6BD 2IUZA 4F9DA 1GVIA 3N9KA 2GSJA 4JFSA 3OGVA 4S3JA 1H0IA 2YOCA 4A3YA 4TVUA 8CGTA 3AIEA 1KGXA 2XFRA 4KGLA 1FFRA 1OGSA 4TVDA 2QHAA 2XWEA 1CIUA 1QNSA 1AQMA 1GJUA 3MV11 4UQ9A 2ZUWA 1LG2A 3WIJA 4Z2IA 2VT0A 3GXIA 7TAAA 2NT1A 1MFUA 3DYOA 1LWJA 1W1TA 5I23A 1CNVA 2G41A 2GK1A 1CGYA 4AWEA 5I2UA 2ESCA 1OT1A 1LG1A 4AD1A 4N42A 1LL6A 3PZTA 4HA3A 3ZT6A 4E8DA 2W66A 1OCQA 5ABEA 2J7DA 4WF7A 2JE8A 4ZEPA 3EBVA 3LPGA 3ARPA 3CPUA 1GW1A 4GI6A 5TD4A 1FH8A 5BROA 2BY1A 3SCRA 3UESA 5DO8A 2WZEA 2G3IA 4BQ3A 4WJXA 1PX3A 4JAWA 3VM5A 4HTYA 3TA9A 3SCUA 2FGLA 3CZLA 3FAWA 3GNPA 3CHCA 3ZIZA 3NYDA 2F2HA 4HMEA 3VIGA 3WMSA 2BVDA 3VTRA 1FA2A 2J79A 3VUPA 1HL9A 5LA1A 4P7OA 1QI0A 4A3HA 1UWRA 1ISWA 1FHLA 1V0MA 3BAYA 2BS9A 1WP6A 3WN6A 4HOZA 3L4TA 3TOPA 3II1A 7A3HA 2JEPA 4WKAA 4ATWA 3SCTA 4HMCA 2GJRA 4HU0A 1ZJAA 1C7SA 4PSPA 4Z2KA 4AZ6A 4GZJA 1XSJA 2YBTA 2VX6A 3VDBA 2WMGA 4JCLA 3IK2A 4LGXA 2C0HA 4AZIA 1G9HA 1ZBKA 1UH4A 4A4AA 1TVPA 5FCZA 3WQVA 3AHVA 1JYWA 2WC3A 3VD9A 3ZJKA 4BF7A 3I3BA 3SCSA 5EBAA 3L4ZA 3SEPA 4R5EA 3IJ8A 5A6KA 4WLCA 4PCTA 4U2YA 3DYPA 1CYGA 1XD1A 3TTOA 4CN4A 4DM2A 2XPKA 2OWXA 1W2VA 3HJEA 5BYWA 1RD6A 3PTKA 3DC0A 1OSEA 3W37A 3VIOA 2J7CA 1B3YA 4LYRA 3RCNA 1YQ2A 4U2ZA 2OYMA 1J0JA 1CXIA 4MDOA 2VCCA 2CKSA 2XYLA 3VM7A 1W3HA 2D20A 2VR5A 2O92A 4RE4A 5CG0A 1ISVA 1HX0A 3CZ8A 1JDCA 5HPCA 3UG4A 3WH8A 1TA3B 2PWFA 5CGTA 3KWXA 4NZCA 5DMYA 1QI4A 3U7BA 2YA2A 3AIUA 2X8RA 1JL8A 3KL5A 3AMKA 1S46A 1HJVA 4C7DA 4DUWA 1A3HA 1OT2A 2CPUA 1E56A 3B9EA 2VURA 3PZQA 2X1IA 4GZIA 2YA0A 1PIGA 5IDIA 3M46A 2WXDM 3CH9A 1DTUA 4JFWA 2ZUVA 1GOWA 3A4WA 2VZSA 3CMGA 2CBUA 1H3GA 4NSBA 5A6BA 1EDQA 4W93A 2ZE0A 4MB5A 3GZAA 2CNCA 1KFWA 3MUIA 4JL2A 1ZBVA 2VRKA 5A95A 4PMRA 1JYVA 4TTUA 3W0KA 3VPLA 3AHTA 1JXJA 1NP2A 1V6VA 1UZ1A 2OLHA 1FP9A 1OGGA 3W24A 4FLOA 1MVYA 4IPLA 4AZCB 4D71A 1B3VA 1BYBA 2W63A 3MU7A 4JHZA 3AIBA 5E6YA 2JF7A 1GNXA 4U5KA 4E4PA 5JH8A 2DT2A 3WQ6A 2WVVB 3IANA 4ML4A 3AJ7A 1CXKA 1CZ1A 4PMQA 5LA0A 2EO7A 3WUGA 5D4YA 3DECA 3B8SA 4JFVA 2WMJA 4AEEA 4CUCA 1JZ5A 4PMZA 4HPHA 3F5JA 3VDAA 1JG9A 4H04A 1EHAA 2J75A 3A3HA 5IHRA 1LJYA 5CJ5A 3WF4A 1IT0A 2ZOXA 1R8LA 1OIMA 2A3EA 3T0AA 3AYRA 1ESWA 2IXVA 3L4WA 4TX8A 5E9AA 3SUWA 2PI6A 1MYRA 5DT7A 3WH7A 4EE9A 4XZBA 3FHQA 3RJYA 3KL3A 1KQZA 5CLTA 1OWQA 1M7XA 4CKQA 3OA5A 3BCFA 3DHPA 3KEHA 4GO9A 4PMXA 3GNRA 3M7SA 5I6SA 2WHKA 1TA3A 4J3WA 1H0GA 5FL1A 4X0VA 5I79A 4CVWA 5A6JA 1SYTA 1EOKA 4FLRA 2ZX8A 3I3EA 3LPOA 4M1RA 2V3FA 3PZ9A 3W25A 3LPFA 1KXVA 3T0DA 3U7VA 3CUJA 5E09A 2QLYA 4EAMA 1CGUA 2ZX9A 1QVBA 1XSIA 4Q7NA 2D3NA 3BAIA 1BAGA 3NSXA 1KBBA 3OLDA 3BLKA 2CERA 4QLJA 4H2CA 1BGGA 4KWUA 3MSGA 2D22A 1HT6A 4KMQA 1UD2A 3DHUA 1JD7A 1DWAM 2AMGA 4XX6A 1MXGA 2CCRA 2DGAA 4MDPA 2Q8XA 1DHKA 2QF8A 3OLGA 4Z2HA 1G1YA 1E1EA 2A3AA 3ARXA 1QNOA 1K9TA 4AZCA 4XZWA 4WSJA 2BV9A 4FLQA 3CUHA 1RP9A 3DYMA 2JEQA 1B30A 2WVVA 2CBJA 4UFMA 3IAPA 3PZNA 4TOQA 1ECEA 4Q22A 3QHMA 4J3SA 4OIFA 2YL6A 3KZSA 5I5RA 1R85A 4DUVA 1H5VA 4PMNA 4AW7A 1HKKA 2OWCA 3GBEA 4UFKA 5ABGA 1XSKA 2V5CA 1CEOA 1PAMA 4CD4A 3ZR6A 1BLIA 2ZUNA 1JZ7A 3M07A 3WDHA 5D8WA 3B9AA 1QOXA 1C3FA 4C7GA 2JF6A 3BAXA 4MB4A 4UFIA 5AC5A 1UR2A 4OBSA 3L4YA 5JBDA 1EXPA 2UY2A 4OUEA 1WDSA 2W92A 2XIBA 2XM1A 1E6XM 1GQJA 4MNMA 2BXZA 5HPOA 3ARUA 2FHCA 3T0BA 3EDEA 3RDKA 2PBGA 3EDKA 2J7HA 3FW6A 2XG9A 3W82A 3MUAA 1MFVA 3E1F1 2QMKA 1UD8A 1JNEA 2A3CA 4GKLA 2EPLX 4GO8A 4CD6A 1H11A 3T2PA 4GPNA 3VDHA 1M53A 4ZXOA 4P7NA 3SCOA 1UD4A 4ZE4A 1WZKA 1E6SM 1NP0A 3F5LA 1HKMA 3WNLA 4MTVA 1V3KA 4LPCA 1O7AA 2G4FA 3CUIA 3PBGA 5A6LA 2DIJA 5BRQA 4GQRA 1IZJA 1JZ8A 2DIEA 3HN3A 8A3HA 1EOMA 4AD0A 1JYNA 3WH6A 2DSUA 3WD4A 1TCMA 1E6QM 5CSYA 1WB0A 3W28A 1W9UA 1FOBA 3VD5A 3RO8A 4JL1A 1K9FA 1UWSA 3ARVA 1ISXA 4JKLA 4M29A 4QLLA 1FHDA 1EO7A 5I24A 1D3CA 3PZOA 3RILA 1WNOA 3POHA 3VNZA 2UY4A 1GUVA 3SUTA 2O9OA 1W91A 2YA1A 5HOSA 3NDYA 3VGFA 1RH9A 3AI0A 1C93A 5BXRA 1WE5A 3PHAA 2J7FA 2DT1A 2D0GA 2WLYA 3THDA 3U5UA 3GNOA 5GNXA 1HL8A 1OD0A 3QHNA 5BRPA 1V3HA 3VINA 3MMUA 1BYCA 1W9PA 2CITA 2IXUA 1V6XA 3GXMA 1GQKA 5DT5A 1TMQA 3WENA 3VVGA 2Y8KA 1JDAA 2VQTA 1HNYA 3W27A 3UR8A 1B90A 4L4PA 4YPJA 1V3MA 1ITCA 3EDFA 1UKQA 3K8KA 1Y7VA 3VGGA 1GPFA 3WF1A 5JIWA 4LQ1A 2FGZA 2QPUA 1E3ZA 2WHLA 1MQPA 2FH6A 3NJ3A 4KRUA 3TP4A 2Z1KA 3AMGA 1J18A 2D1ZA 4GINA 4HMDA 3VIJA 1G0CA 3ALGA 3AS3A 2ZICA 1J12A 1LWHA 2GVYA 2PF0A 1E3XA 1Q6CA 2VX7A 4LX4A 1UA7A 1XCWA 4DWSC 2WVSA 1D7FA 3OB8A 5IXEA 3EMZA 4AC1X 3SURA 4Z2LA 2Y5EA 3WKZA 2V5DA 2VTFA 1BHGA 4W88A 1TZ7A 3WF0A 1ITXA 2VO5A 1Q6FA 1ISZA 1RP8A 2XVLA 5D9MA 3CUGA 4BQ5A 4J27A 3ARYA 2V38A 3BSHA 3VX0A 5HBFA 2G3MA 1IZKA 2WZIA 2E40A 1PBGA 3OG2A 1XGZA 4JIEA 2E8ZA 2D0HA 3EYPA 1KCLA 1HJWA 2J47A 3CO4A 4KGJA 5A69A 1GONA 1XD0A 2VVSA 5A6AA 4HPGA 3VD7A 1V0LA 6TAAA 3UERA 4OJYA 4PUEA 4AXNA 4PMDA 2VZUA 1B3WA 3WNNA 1JGIA 1JNDA 4MB1A 4UFJA 3ZQ9A 1DWGM 2CESA 3AFBA 4P7QA 5BXTA 1E15A 3W4RA 2O9TA 4AIEA 1C8YA 3W53A 2E4TA 3BSGA 5A8MA 2W67A 1QI2A 2ZXDA 2WM0A 3WQ8A 1BYDA 4FK9A 2AAAA 1B3XA 3LPPA 1QBAA 3ALFA 3PZMA 1X6LA 2NW0A 3I3DA 5EFDA 4TX6A 1ODZA 5HDRA 3AS0A 3BAKA 4KRTA 2BVTA 3ARRA 3UG5A 4D6JA 2DSZA 4HOXA 5CGMA 2YDSA 3VD3A 5M5DA 5CZKA 2Z1SA 5HNNA 4PTMA 4CCEA 3VD4A 1CECA 2AOSA 3W29A 1E4MM 5ECUA 2DH3A 3VGEA 2ZUSA 3BC9A 3G6LA 1NOUA 3L4UA 3WNPA 1UR8A 1DWJM 4JCMA 2BXYA 1KGWA 5ABFB 1BYAA 1XC6A 1E5JA 3PZGA 3WH9A 2FDMA 1DP0A 3S2CA 2QV4A 5CLWA 1HP4A 4PEEA 1XH0A 1W9DM 5AYBA 3CHEA 2ZUUA 2OYKA 1M01A 5BWFA 1QNQA 1FH7A 1B0IA 1VFFA 3PTMA 4CGTA 4JHOA 1XRVA 3AROA 3AQUA 2E8YA 1VBRA 4ZENA 4CN1A 4B9YA 1SMAA 3QOKA 3OGSA 1XH1A 3ZSTA 2BHYA 1B1YA 1UD3A 1MW1A 5A6SA 1JAEA 1H4PA 1WKYA 3ZJ7A 1OGBA 2XFYA 2XWDA 5IHSA 2W5FA 4MNKA 1XHGA 3IJ7A 1NWTA 3AXXA 2VZOA 3BMWA 2D3LA 1E1FA 5C70A 4FLSA 2DH2A 3W6LA 3POCA 2JIEA 1LLOA 1E71M 2VVNA 4AD5A 4ATDA 2EEXA 2WSPA 3ARTA 3SCWA 4CU7A 3F5KA 5EFFA 5D9PA 1TR1A 2WB5A 1V02E 2UY3A 3VIKA 1ZU8A 2BY3A 3MV01 1QBBA 4ZFMA 4B9ZA 3AOFA 3SCNA 2UY5A 3WEZA 3WUBA 4AISA 1WZMA 2XM2A 1UKOA 2O9RA 3GTNA 2WVUA 1E0XA 1A47A 5DEZA 4UOZA 1L0PA 3CIVA 4W8AA 9CGTA 2CBIA 2E9MA 1GQIA 4R27A 4U5IA 1MXDA 3OLIA 4OOZA 2YL5A 5A8OA 3NDZA 1HKJA 3BAWA 2CYGA 1MQRA 4C7FA 1VFMA 2FH8A 1E9LA 1X1NA 5I77A 1UWQA 1ZJBA 1AMYA 1SFSA 1OD8A 3UCQA 3VIMA 3BGAA 3WFZA 4UZSA 1BPLB 1EDGA 2VOTA 3N18A 1V3IA 3AS2A 3AS1A 5IFPA 3KL0A 1J11A 1EDTA 3AMLA 1J01A 4E2OA 4UOQA 4AZHA 4UR9A 1PJ9A 1SMDA 5M17A 1DWIM 5ABFA 3GH7A 4J28A 1C7TA 4W7UA 1BG4A 1JFHA 4RL3A 3WNKA 1BSIA 2G3NA 3BH4A 4GI9A 3WF3A 4WIWA 2A3HA 4OZOA 2GFTA 1B2YA 2XTKA 1GCYA 5D9OA 3IAQA 4UQAA 1PX4A 1Q6EA 4P7LA 2EJ1A 2WMKA 1MW0A 1L8NA 3S6TA 1GZJA 5FIPA 4S3KA 3CTTA 1WO2A 1C92A 2XGBA 1BVNP 1H49A 2EBNA 4GZEA 1VRXA 1EH9A 1UZ4A 1H2JA 4FF5A 1CGTA 3JUGA 1CPUA 1XCXA 3WDIA 3A4XA 2HISA 1ZL1A 2XIIA 1JF6A 1U30A 3GM8A 5E6ZA 2WZHA 2JIWA 4MJ4A 4BQ4A 1FP8A 2VL4A 2WBGA 2VCBA 1KQYA 4EKJA 3CMJA 2WCGA 4LYPA 1I1WA 2WC4A 1GOQA 4M8UA 4M56A 1UHVA 2WKLA 2X09A 1V08A 7CGTA 3WSUA 3K4AA 2XSBA 1VJSA 4AY1A 4P7RA 3AHXA 2CEQA 2BVYA 4JFUA 3WL0A 3O2LA 3BMVA 5I0DA 2TAAA 1CBGA 1W2PA 1JXKA 2J7GA 1PZ3A 3SUVA 4TXEA 4XV0A 1GORA 4AMCA 4W85A 2YL8A 2WAGA 3M6DA 3WMCA 1ZBCA 1CGWA 1E6ZA 4M81A 2Y24A 2DT3A 3QR3A 4D6CA 1I75A 2XVPA 4MADA 4F9JA 3QOMA 2CIPA 4AZ7A 5JBEA 4U31A 2OYLA 3ZT7A 4UQBA 1TVNA 1V02A 3WH5A 4H8HA 4Z2JA 4V2XA 3OGRA 4J3TA 1PPIA 3W26A 2W62A 5LYRA 3RM4A 3FN9A 4PTWA 4HA4A 3AHYA 2EPKX 4D6EA 1CXHA 2OWWA 5M03A 1W9BM 1UA3A 2DSWA 4N0RA 3NSMA 2PBOA 2VX5A 1K9EA 1CGXA 1SR0A 4W84A 1OIFA 1UYQA 3OZPA 5KEZA 4EANA 1AQ0A 3TTQA 2EQDA 2OSYA 3ZT5A 1J10A 4MNJA 1HVQA 3U5YA 1EGZA 2J25A 3UEQA 2J62A 1EA9C 1JZ2A 3L4VA 5I78A 1UH2A 2G8ZA 4J3VA 4NRRA 1NH6A 4AD2A 4IISA 1QHOA 2YDRA 3RPMA 1LL7A 3VMNA 3D3AA 2E3ZA 1GJWA 1E72M 1UWIA 4WK9A 1EQCA 3PZUA 1Q6DA 2G3JA 3A4AA 4CCCA 2BHZA 4CU6A 2J4GA 4GXPA 1UOKA 4LYQA 1OBAA 2ZIDA 2YIHA 2GJPA 1QNRA 1EHNA 1QHPA 1J0HA 1JD9A 1V3LA 5FKYA 4B16A 1JDDA 1B9ZA 1PIFA 1JZ4A 4W5ZA 2WMIB 2VC9A 1B3ZA 3VX1A 1US2A 1W32A 1Q6GA 1GVYA 2WKGA 1CENA 2EXOA 3FY1A 2BY0A 3CZJA 3O9NA 5HXMA 3SCQA 4J3UA 4HZ8A 2J77A 3IJ9A 2WWDA
chains in the Genus database with same CATH superfamily
3E2RA 5B7ZA 4NYYA 5D04C 4GACA 4DN1A 4HNVA 3RXZA 5IDZA 1IV8A 4GK8A 4CCDA 4WKHA 2BNJA 1R7OA 1W1VA 4QROA 4Q8PA 1TE1A 4C1NB 2MLXA 2BBFA 4O28A 1TG7A 3EA3A 2QCCA 1KWGA 3P61A 3WNMA 1KR0A 5SWUA 4FNUA 4XO6A 2YR1A 1JZ6A 2NVCA 1B4EA 3VNYA 2Z2BA 1TV3A 3QPEA 3NSNA 5LHEA 1QPFA 4GNVA 4QEHA 3OBAA 3GDLA 2XFFA 3IVSA 1RY8A 2OZTA 3W38A 2YCKX 1VFUA 1OC5A 4K37A 4DJFA 3E6EA 3VNJA 1M5WA 1JYXA 3E0FA 2MPHA 3SECA 2NVDA 4XVEA 3CT2A 1M6JA 1V03A 1E6NA 1NOFA 4PB3A 1UR1A 3ZLHA 4O1FA 1ZAHA 3T42A 5BCAA 4QJ3B 3CTLA 5AY7A 1FKDA 5A2AA 2Q71A 2Y78A 1R46A 1X6NA 1MUCA 4A05A 4DYJA 2GL5A 2GDUA 3NOYA 3H54A 4UFLA 4IIEA 1DJQA 3WD1A 3ZVIA 1XR2A 3M7WA 4DHGA 2JBMA 2QPXA 4DELA 4MAVA 2Y88A 1N8FA 4BKNA 1K4GA 3W7IA 2Y5SA 3UETA 1VPYA 1J8VA 3AJXA 5A3HA 1FDZA 1Q6QA 5LNVA 2J8FA 3G1XA 5HWNA 3AMCA 1UUOA 3M43A 1R87A 5M3WA 5DIUA 3WK0A 1PYMA 3FYOA 3SDOA 4BZYA 4F40A 3MHGA 1I0DA 2QPSA 5D2YA 1W6TA 1UWTA 2YPIA 1DHPA 2QDHA 3BJFA 3LV5A 4UB9A 2QCFA 1ME9A 2GJXA 1K8YA 5AFDA 2PDYA 1I2PA 2D73A 3GU9A 3THAA 1JFXA 3CLWA 1KTNA 3W87A 1J6OA 3VNMA 2OX1A 2IPJA 1LF1A 2XIQA 3BOXA 1ZK6A 4QQ3A 3W81A 4UQEA 2NQHA 4ZOCA 2ZQVA 2PP3A 3IV3A 4DUOA 3MDWA 3VO0A 3OIHA 1UASA 5HKGA 4F79A 2RDTA 3AZSA 2MF9A 4I8DA 3DEQA 4H9ZA 4J7RA 2QUMA 1S38A 1G5AA 5LNSA 1K8XA 3J7HA 1H62A 5LNRA 3P84A 1B54A 4AIBA 3VIPA 3DZ1A 3I10A 4P8WA 4HYWA 1G6CA 2EPMX 4JTTA 1S39A 3M5YA 3RJXA 1Z69A 3CV1A 2J88A 1AD1A 2ZA3A 1VBJA 3AWOA 2A21A 1TPB1 4Q7IA 3W7JA 1F3TA 3VNKA 1OFBA 3VZZA 5MHBA 3URNA 2Y70A 2PWDA 2GYIA 1XBZA 3RK8A 5DRCA 1KM5A 1GG1A 4QLKA 1HN1A 1A4MA 5FL0A 3TW6A 1DQXA 4GRSA 3ABZA 3B9DA 1NM9A 1O66A 1TTIA 4PGLA 3EWUA 3UGRA 1EIXA 4RPQA 1XQKA 5D38A 2DZBA 1K70A 3W2LA 3OZOA 4AWSA 1EYEA 3F03K 4NJKA 3GG8A 5FF0A 2V3EA 1I2QA 4HNNA 4XD3A 1OK4A 3GSMA 3GG1A 4UTWA 1B3OA 1E1CB 5LIWX 3MI3A 4X2PA 2FPYA 3L0GA 1RPKA 2YDQA 3ECQA 3NM3A 4IMCA 4HKPA 4QIUA 1TIMA 2IPGA 3HO8A 4MIMA 5BWAA 3IVUA 3N6HA 1QHZA 4D6DA 2VC6A 2O9PA 2Z28A 3IV8A 4HPJA 5AC7A 4QDPA 5AHNA 4QHRA 3VU2A 1BKFA 1PTGA 3AXHA 3D3FA 3MUY1 3GS6A 4QM1A 2CLLA 2ZRUA 4GYFA 3KXQA 1PSCA 5H8MA 1OYAA 2YL9A 4UTTA 4J9JA 3M4HA 4Y9OA 4DBWA 4AZBA 1P7TB 1PTAA 4LXFA 4PL1A 2DUZA 3O5JA 3E9AA 1SSGA 1XGDA 4W7VA 4P5UA 2I14A 4I5RA 1YEYA 2DEPA 3WDQA 1VFOA 3R11A 1BTCA 3B8IA 3R58A 3K4DA 2MNRA 1XYZA 3WQ5A 1F6KA 3S47A 2DSKA 2VGGA 2PGEA 4BA0A 2FHFA 2YLLA 3GXNA 4L6HA 3TTYA 2VR4A 4JQAA 2NXIA 1XRSA 3NCOA 5DBTA 3GU2A 4UTKA 1HW6A 1XYAA 3GYCA 4B15A 5H1WA 3PJWA 1VIWA 2XP8A 4WUIA 3U57A 1FVPA 3T40A 4MWAD 3W02A 3NDOA 4KQZA 3PC0A 2PLMA 1QCWA 4W9PA 4Y8FA 2NQ9A 2WVTA 4MB3A 1UQYA 3VXGA 4U4MA 3ZJ8A 1XV8A 3K13A 1GVQA 1SM9A 4PUDA 4IZGA 3CUZA 3EMCA 4EACA 3AWNA 1YYAA 4PCSA 3T1GA 2RGLA 4JTGA 1MW2A 3NO1A 5E0KA 3LEPA 5K9CA 2CLOA 4GCXA 4XB3A 1HFBA 1L2QA 1QPQA 4KQNA 4W5UA 3TCEA 1SW7A 4MWAE 3BLFA 1Q2SA 1KM2A 1O4UA 1GVOA 5CPQA 1UR4A 5CZSA 1QPOA 2ZQ0A 4EPKA 4FXSA 5A5WA 1J0IA 4IPNB 2J27A 3WJYA 2FIQA 2HXUA 5G5IA 3WD3A 1TWDA 3FDGA 2FPTA 3PBUA 2V5LA 1M03A 4IFOA 5D9NA 4QDWA 1FKWA 2YBUA 3ZO9A 5GPRA 4KEZA 4C6BA 2YZ5A 4H83A 3URAA 1F3WA 4ODNA 3NL5A 1GVRA 1ZB5A 2VDIA 3T81A 1ZFJA 3S3GA 4DBEA 2ZWZA 3DH7A 2VRJA 4OFCA 1V51A 1LQ0A 3TYCA 3MMWA 3O0FA 3FSTA 2QKFA 2OXNA 2PWVA 2J13A 4DYEA 1EZWA 4ZPWR 2K8IA 1T41A 3WQDA 4GXWA 4M82A 3UYCA 1QK2A 3MCOA 1XLBA 1XCFA 4O1EA 4F8XA 3F2CA 3EX6A 3A13A 4UQDA 1OB0A 4IP4A 1RK5A 3EKGA 3W3OA 3E38A 4JFTA 1E44A 2VI0A 3AO0A 3O5OA 4RPPA 1GVFA 3WDPP 4Q8WA 3UQBA 3QN3A 5HA7A 4IFRA 2X0YA 3BLPX 1F07A 3ITTA 1KO0A 3R10A 3TSDA 3GWQA 4LANA 4W9TA 1Q8JA 1KXHA 3AXKA 4JFIA 1PO9A 1OEPA 2ACRA 5AOUA 1E4LA 2AQVA 4US5D 3IWPA 1UH3A 3IS4A 1C90A 3N1AA 5FA5A 3WQCA 1RA0A 3KE0A 1DQUA 1WAUA 1PZ1A 2QIWA 3CPRA 3BGJA 2PC8A 4IJCA 3W7NA 3AIWA 4UCFA 3S83A 3DESA 3SSJA 3AYVA 4ALDA 4WQ6A 3B0PA 2QDGA 2DW7A 3HGOA 3A9IA 3LY0A 2ZZ1A 4PBFA 3HU7A 1N82A 1HXJA 4R7OA 4XAZA 3NIYA 1V7AA 2GLKA 2DSVA 1J9YA 3P8JA 1BQCA 3O5KA 2FVLA 3ES7A 4B3LA 1TRDA 1O6IA 3CYVA 2CXGA 3RO6A 3ZOAA 3GXDA 1WZAA 5CXPA 1HO4A 5AC8A 2CLMA 3WEMA 4JTRA 2FKEA 1JQVA 1NF7A 3GVGA 4DWSA 3C0JA 2ZX7A 2J6VA 1RJQA 3HG3A 2ZFAA 1NFGA 4XAPA 4I90A 3UZZA 1BRLA 4RE2A 4MPQA 4DJDC 2CLFA 3OGVA 3TMQA 2O4QA 1JPIA 4TVUA 2E6FA 2XFRA 1X1ZA 1O5KA 1FFRA 4TVDA 3NEVA 4PB5A 2QHAA 3BQ5A 1CIUA 2HPIA 1AQMA 3MV11 1T99A 3CM4A 1LG2A 5EMJA 1OC7A 2R8WA 5BW6A 5I02A 4HK5A 2NT1A 1MFUA 4DPPA 3KABA 1CNVA 3KADA 2PDWA 4HK6A 1A3WA 1LL6A 4HA3A 2W66A 1YMYA 5ABEA 4S3EA 4UCGA 4WF7A 4Z1CA 3VCNA 2JE8A 3EBVA 3LPGA 3BG5A 3CIXA 4MM1A 1PS9A 3NL6A 4HTYA 3SCUA 4HHMA 3CZLA 3FAWA 3GNPA 3CHCA 4LWWA 1JCXA 2BVDA 1GRJA 3KP1A 4H9YA 2BGQA 3RR1A 4B5XA 1MSSA 2J79A 1FXQA 3M5VA 3PPHA 2XN1A 1QPRA 3O15A 4DBSA 1UWRA 3H2OA 3BAYA 3V0UA 4WR3A 4IGMA 3TOPA 3II1A 3V5FA 1Q2RA 5H6HA 1H1ZA 2QYGA 4ATWA 1XPYA 3VFCA 2QVHA 1KCXA 3DKLA 4AZ6A 4GZJA 1JVWA 4ML9A 3VDBA 5J04A 1SZFA 3RLUA 1JCMP 3HPAA 4H6QA 1PKNA 3VZXA 1ZBKA 1IZCA 1UH4A 1KFLA 4Z1AA 1W1B1 2OTDA 4JFKA 2VD9A 1VFSA 4MY1A 1DJHA 4DAIA 3WLTA 3SW6A 4BF7A 2H8XA 4B5NA 3EXRA 3SBFA 3DU0A 2XGZA 2PZNA 3TTOA 2HK1A 3UZWA 4DM2A 2XPKA 2OWXA 4MFDA 4XAFA 3DFNA 3VIOA 3TUUA 2I1OA 1YQ2A 3NQDA 3S4TA 3GLCA 1J0JA 3NM1A 3TQKA 4MDOA 1LOSA 1N2VA 4LSBA 4RE4A 3EA2A 5CG0A 4AHQA 4Z08A 5KSWA 3CGMA 4KERA 4QE5A 3KWXA 4NZCA 3BVJA 3PG9A 1BSLA 3NO5A 2X8RA 3JW7A 1VCVA 4G7EA 3TW9A 4IIBA 4Y8EA 1HJVA 2ZQSA 3G1DA 1OT2A 1A3XA 2CPUA 1E56A 5CSRA 1GYNA 4IL2A 3VNIA 2R9RA 4GZIA 2FZBA 2V2HA 5D2XA 1FHUA 3USBA 3M46A 2WXDM 3H6OA 3FA5A 3GR8A 2F2DA 2VZSA 1S3TC 5T8GA 2GUBA 3GZAA 1Y0EA 3MUIA 3IARA 2VRKA 3TKFA 1JYVA 4TTUA 3VPLA 1AL8A 2PDNA 3NNTA 3W7KA 2E5CA 2OLHA 1OGGA 1Y65A 4HHHA 3IIOA 5XINA 2HWGA 4GIVA 3EPNA 1G4SA 4GJJA 3RX3A 1NDWA 3IANA 4ML4A 1KV8A 3AJ7A 3V5CA 3NGFA 1MO0A 4PMQA 5D4YA 3DECA 1F05A 3SZ8A 3VDAA 3UWWA 3OZMA 4H04A 4HJFA 4E6MA 2VFDA 4L72B 5CJ5A 4IL0A 1IT0A 2OT1A 3SN1A 2ZOXA 3VOHA 4AF0B 3N2BA 1OIMA 1XYLA 4AVFA 1S5VA 3LZ3A 2PDBA 4KIRA 5E9AA 3OW1A 5JXQA 2PV1A 3O1NA 1F8IA 2NV1A 3WH7A 4EE9A 4XZBA 3KL3A 5CLTA 2HE5A 1M7XA 4CKQA 1UIPA 3DHPA 4GO9A 4PMXA 1FKKA 3GNRA 3M7SA 2WHKA 3TCZA 4LUYA 4FX7A 3BZJA 4FPSA 1IXNA 4RZ5A 4CQ8A 3CWHA 1TREA 3FKKA 1SYTA 4IIFA 3ZXWA 5K9XA 4AC7C 3W25A 4DRJA 3CUJA 3U7VA 3N4EA 4IFKB 2QLYA 4ODKA 4EAMA 4IMAA 5AB3A 1XSIA 3BAIA 1SZRA 3E12A 5I09A 2B4GA 3OLDA 4ODOA 3BLKA 4QLJA 1RQBA 4ICMA 2XZ7A 1BGGA 3H24A 1PKYA 5LGXA 4H9XA 3UXAA 5CZTA 3KTSA 4BF8A 2D22A 2Z1WA 5HWJA 1HT6A 4XX6A 4AFYA 3R8HA 5LHFA 4F0RA 4WY0B 4I9MA 4MDPA 5C54A 2QF8A 3OLGA 2DZSA 2A3AA 2J66A 2Z6JA 1QNOA 3URQA 3D0CA 3S1VA 2R6OA 5I07A 3CUHA 3STFA 1N8IA 1RP9A 1K8ZA 5KETA 2JEQA 3ITXA 2WVVA 2CBJA 4UFMA 3PZNA 4TOQA 4S38A 3B3DA 4UUIA 1ECEA 4Q22A 4DZHA 2YL6A 3V5OA 4I6VA 4UTMA 4AW7A 4PB4A 5C2GA 8XIAA 1HKKA 3G0SA 3GBEA 4WHBA 5ABGA 1CEOA 1PAMA 2Y0FA 1XBXA 1Y5VA 3RPDA 2ZUNA 1JZ7A 2YCEA 3TTEA 4B92A 1QOXA 4WOZA 5LXEA 1N8WA 2JF6A 3BAXA 4YU1A 2P88A 4W9OA 3IJLA 3PJUA 5JBDA 3DI0A 2DVUA 3I7QA 4BI6A 1JNSA 3MDYB 4MNMA 3EWXA 1J4IA 5FEXA 2XP5A 2BXZA 5HPOA 2PODA 4YLWA 4E0CA 1POJA 3DX5A 2VM8A 1PCWA 2PRHA 5HNUA 1MFVA 4Y9PA 4XZHA 2QMKA 3LXBA 2ZYFA 2RDWA 3KTXA 4YVXA 5CC5A 1NJJA 2UZ9A 2V68A 4GO8A 1H11A 2PDKA 3LHVA 4KCTA 1UD4A 2ZADA 4ZE4A 2C6QA 4HBKA 3F5LA 3QSTA 4FSAA 4LPCA 2C13A 1AH4A 1A5KC 3T55A 5BRQA 4DX3A 1IZJA 1JZ8A 1AH0A 4EF9A 1EOMA 2F4EA 1W5MA 1FKHA 3N19B 1G4PA 3GU1A 4G1NA 5AKQA 3GQYA 4IPJA 2LJ4A 1K9FA 1UWSA 1XFCA 2VOMA 1FCUA 3PPCA 4X22A 1F6PA 4JKLA 2P8CA 5K4XA 4FXRA 4M29A 3WLOA 1JPDX 4LYKA 2KFWA 1D3CA 4UR8A 2DG3A 1GUVA 4UTHA 4NU7A 2V81A 4PUKA 3NDYA 4C90A 2JZVA 5BXRA 3UQIA 1WE5A 4C6IA 3PHAA 2DT1A 3S6DA 4A21A 5GNXA 2B81A 1X6UA 1PUDA 3VINA 1YNPA 3MMUA 4C91A 3T4CA 6TIMA 1RQEA 1BYCA 2A79A 1W9PA 3UVIA 3GXMA 1GQKA 1UBSA 1YTEA 3FA3A 4JIRA 3WENA 3VVGA 3WH0A 4M6VA 4LRTA 1HNYA 1QPNA 1XLCA 3GW0A 2YB1A 3VGGA 1GPFA 3UVAA 4AYGA 2QCMA 3D6NA 1ME7A 4HHLA 3MSYA 4LQ1A 1RJRA 5E9XA 1E3ZA 4HSOA 1JPHA 2DP3A 2WJEA 4DROA 5AVHA 4A22A 3TP4A 3H53A 4NVTA 4UTIA 3VIJA 3W2MA 1LUCB 1Q45A 3CT7A 3VA8A 1IWBA 2I5IA 4K1GA 1E3XA 2EF9A 4LX4A 4GYJA 1Q7QA 3QR0A 3LM3A 3EMZA 3I6RA 4GVIA 1GWJA 2YB4A 4IXHA 2D69A 3AAMA 1CB2A 3VCCA 4GIEA 2OGYA 2V5DA 3MHUA 3WF0A 1XL9A 1KM0A 3PVFA 4I9TA 1M65A 4LJ3A 2XVLA 3L21A 2ODOA 4J27A 3ARYA 3PRAA 3BSHA 4C1KA 1IZKA 4A8RA 4DO5A 3UW6A 2E40A 3N14A 4JEQA 3BARA 1RLDA 1XGZA 1UZHA 2VGIA 2V0TA 1UBPC 3CO4A 4HYVA 1XD0A 2VVSA 1DYSA 1NDYA 1THFD 3UERA 4OJYA 4AXNA 3C0SA 3LNPA 2QCDB 4X61A 4B4HA 3IVTA 4C65A 1XLLA 2O9TA 1IQ8A 1C8YA 2IQTA 3BSGA 4C6CA 4DLMA 3HPZA 5HWCA 5B7YA 2ISFA 2XH2A 1U5HA 3KBJA 2WM0A 1AJ2A 1X98A 2PGWA 3PZMA 2FB3A 1XBVA 2ZRWA 5LNWA 4TX6A 3G1FA 4KRTA 2BVTA 3ARRA 1YTKA 2PPGA 4D6JA 2GOUA 3GRIA 2OEMA 3VD3A 1I45A 5HK4A 4OBTA 4LEQA 3R1ZA 2QUUA 1RD5A 1V5XA 1RXOB 2AOSA 2FZDA 2QUVA 1E4MM 3LHZA 3MC5A 2RUSA 3TC6A 2DH3A 3UPBA 2PEVA 2ZUSA 3BC9A 3MA8A 3G6LA 3OZYA 1ROTA 4JCMA 4IPIA 2BXYA 4IF2A 1KGWA 3T0TA 2AKZA 1SJDA 2WZTA 2FDMA 3SGZA 1RHCA 3EB3A 2XP9A 3QC3A 5BWFA 1QNQA 1B0IA 3KS5A 4GUJA 3UWVA 3NVDA 2OGJA 2NLYA 4JHOA 5CAKA 3L12A 3QF0A 3QLLA 1NFPA 3QOKA 1XH1A 5KZMA 1W8GA 1UD3A 3G1AA 5A6SA 1FJDA 3ZJ7A 2XWDA 2XFYA 2XPAA 2W5FA 3OBEA 3IJ7A 3BL3A 4QEEA 4CNPA 1M1BA 3GD6A 1E1FA 3DUGA 3QW3A 5LIKX 3UQAA 2F9RA 1E71M 2ZRXA 1Q3NA 1K4HA 1KRBC 2R82A 2WSPA 1V77A 3ARTA 2ZZ2A 3SCWA 4CU7A 3F5KA 1S2TA 5EFFA 3VOGA 3U6WA 2UY3A 4S3AA 3W7RA 2I5QA 1XLEA 1QBBA 4ZQOA 1EJWC 3B04A 4B9ZA 1U83A 3AOFA 3CAWA 2UY5A 1OFPA 1XLDA 2Z2AA 3B40A 4O1BA 1WZMA 1UKOA 3SM0A 4X63A 2WVUA 1BEUA 2FZNA 2ANUA 2OO0A 1EA0A 2E9MA 4U5IA 4OOZA 1Q63A 3NDZA 3B9NA 3HMJG 1D3GA 3TROA 2CYGA 5BRBA 4NZ3A 3H55A 4C7FA 3FJ6A 1X1NA 5TBOA 2FVMA 4NJGA 3YPIA 2QEZA 1AMYA 4ZCWA 1SFSA 4Q8UA 2REQA 1WQ5A 4KS0A 4HA0A 4RDZA 3ES8A 4G7FA 3UGVA 1EDGA 3CMFA 1VLWA 4GA8A 4YVVA 4AMAA 3FCPA 4TW6A 3A12A 4E2OA 3G24A 4OE7A 4R9OA 4QIBA 4UOQA 2G3FA 1EB3A 1DXFA 4UR9A 4XSMA 3GNDA 5F2MA 1SMDA 3P62A 2HK0A 3QPYA 2FTPA 2RJGA 1JFHA 3WNKA 3O3RA 1ECQA 4HJWA 2RDUA 4GI9A 3U9IA 3WF3A 4WIWA 4OZOA 3LCIA 2FTWA 4NZ1A 5D9OA 3IIPA 3L23A 1PX4A 1Q6EA 2ZE3A 4LCRA 5EL1A 1LCOA 4K1WA 1ALDA 1L8NA 1PKLA 1QO5A 2OQYA 4NAFA 3LBMA 2XGBA 1C92A 5CBIA 5I3JA 3M0KA 2CLHA 1H49A 4I8YA 3ZLGA 4GZEA 5D33A 4E3VA 2PPNA 3N25A 5G4HC 4FF5A 1CPUA 2HISA 4ZSUA 1GVEA 1W3TA 1UUMA 4WGXA 3EKLA 4OV9A 1QMLA 1U30A 2PU1A 3CS2A 3VE9A 4E3TA 2Z2UA 1FP8A 3QY7A 4PRTA 2VCBA 3CMJA 2V6AA 1IEQA 4JTCA 3OOQA 3SJ3A 1DJNA 1XIMA 4JYFA 4RZBA 4OUIA 1YDVA 1D3HA 3XISA 5DXXA 1SVDA 2INZA 1SJAA 2CEQA 5FAGA 3TN3A 3QR1A 5I0DA 1FWHC 2TAAA 1W2PA 3LGDA 2BTMA 3LZ5A 2F21A 1VRDA 1J4EA 2ZZ4A 4ZBCA 4US6A 4W85A 1BVWA 1J2WA 3A22A 1ZBCA 4LRSA 1CGWA 2X1RA 4M81A 2B0MA 4HSHA 4QXIA 2Y24A 1F5ZA 1XGEA 4MADA 4D6CA 3W7GA 4DJEC 1US0A 3BJTA 1X1OA 1I2OA 4U31A 5BOEA 1JEZA 3O6CA 3WH5A 3W1AA 4Z2JA 4V2XA 2Y7GA 1VCGA 4H6RA 1PB0A 4JIPA 1GJPA 1RVKA 4Z42C 4XKYB 3MI2A 3EXSA 1Q6IA 4DO4A 3EX1A 4DWDA 1DL3A 2DORA 2G37A 2EPKX 3UF8A 3WBWA 3WQFA 1W9BM 1OFEA 2DSWA 2BB0A 3WLMA 2A4AA 1CGXA 4IHCA 4O4WA 5U4NA 4MMWA 4RNJA 4LNCA 3ZT5A 1EGZA 3ZVHA 2F84A 3UEQA 1EA9C 2KI3A 1EBGA 3L4VA 5I78A 4J3VA 4IMFA 4H9MA 4ITZA 2YDRA 1PXGA 3D3AA 2RJHA 3ITGA 2GSEA 1CT5A 2F38A 3NYZA 3TNBA 4MLRA 1Q6DA 1WV2A 3HGRA 2DW6A 4JQ1A 4CCCA 2QJIA 2JKEA 4UNKA 4LYQA 2O7SA 4H9VA 1Q4WA 2GJPA 2RFGA 1QNRA 3LCHA 1JD9A 4B16A 1LLWA 1TCOC 2PPOA 1UPPA 1DVJA 1UROA 2ZTKA 2YCLA 1REQB 1Q6GA 2MLYA 3ITCA 1CENA 2EXOA 3FY1A 1KBJA 2FZ8A 3IGXA 2WSQA 2OPJA 3WQGA 4DIPA 3GFZA 1KNWA 4AHOA 3O9NA 3QLDA 3F1QA 3G0XA 3QYQA 3RN6A 1VHNA 4J3UA 5E1QA 1QK0A 3MUZ1 4B5WA 1ELSA 1WYIA 3WY1A 3D5HA 3AU2A 3ITOA 2X05A 1U2YA 4M3PA 4WKFA 4DJDA 3PSWA 1QI5A 4H8UA 2EG6A 3WLKX 3TK7A 4YCOA 2EKCA 3K2GA 4YIWA 3TN6A 4DO7A 3APGA 1FAPA 4GGQA 4I9JA 2NQJA 3GR7A 1C8XA 1DWHM 2VUYA 2QS8A 3LENA 1J0ZA 4M80A 3WF2A 3VGDA 4Y90A 1F61A 1DV7A 5G4WA 4QNWA 1OCNA 3CEUA 3K8LA 4X0NA 4ENLA 3HM7A 2IW0A 1HKVA 2DFAA 5JBFA 3TYZA 1UKTA 4FAMA 1H1YA 2NZLA 2A1YA 1RZMA 7ODCA 2XVKA 3IGSA 4J5NA 5DRIA 4GIRA 2PCQA 1TMLA 1WDPA 4Q8OA 3B97A 4NZJA 2RGMA 2ZWYA 4ADSA 3L0KA 5IFTA 1BFNA 2Z29A 3UY8A 2AWGA 3H2NA 1F4AA 1JF5A 1E0TA 2VP8A 1TTPA 3BUVA 3MKCA 3O5RA 2VEKA 1JCYA 3DFYA 3GHSA 3F4NA 4KCUA 3UCCA 4CNOA 5CG7A 3UR5A 5A94A 1OINA 3N3TA 3L66A 2QMJA 4W87A 4ZFCA 2WM1A 1X8FA 3A47A 5F4XA 4N9CA 4C6OA 1T5AA 1GPWA 2Y4SA 3KACA 4QG8A 3REQB 1WX0A 4U3AA 5AZ0A 2WC7A 1YDNA 2J7BA 3NOEA 3CQHA 5FJUA 3AUJA 3M0ZA 3FAXA 3S2NA 4ZB5A 3L4XA 4FZIA 1MZRA 1KTBA 1FBAA 2PTDA 3EWWA 1DBTA 3LQGA 4LS0A 5F1VA 1ZY9A 1W9VA 3P6LA 4GUGA 1U33A 5DCDA 3AYSA 3BMXA 1LL4A 3LCXA 2XP7A 3BW2A 3O6AA 1WDRA 4TVCA 4UMCA 4EIVA 3VI2A 5GNYA 3CO8A 4HPNA 1ISYA 3VUSA 4C1NA 1OZQA 3SY1A 2QAFA 3QH2A 3DN5A 2NLIA 3VOCA 2V63A 3NG3A 3N2OA 5DELA 3R5EA 4JKKA 3W7LA 4NZ4A 1HJSA 1LYXA 4B5VA 3H9RB 1BG9A 3FHAA 1CLVA 3UJRA 4MGGA 2DVXA 1ROUA 5CAHA 2VWTA 4CN6A 3FFSA 3MYPA 1E0VA 3VAWA 4NRSA 3UR7A 2EPOA 3U2OA 3O5DA 2O56A 1AD4A 2FB2A 1ODUA 5FF2A 5GVJA 4HZ7A 1OFAA 4JTQA 4IT4A 2VRQA 2KR7A 1NWRA 3R8GA 1V6YA 2TYSA 4WY0F 3N73A 3K1DA 4XD5A 1M7PA 4R34A 5TF0A 1R0MA 1IXOA 1FWRA 2CBVA 3G5EA 4NG3A 4V15A 1OZMA 3RMEA 3QMTA 5T9CE 2VFGA 5FOOA 3R43A 4CD7A 4HP5A 1A5LC 2R1NA 3VKAA 3WLHA 2HVMA 5LA2A 1A5OC 2C7FA 2PURA 2VEMA 2QT3A 1WDQA 3T9PA 4MYAA 3E74A 3B7XA 1E0WA 3K30A 5I3DA 2DDXA 2W79A 4H8VA 2PCEA 1R47A 3MO4A 4RR4A 4MHBA 4Z1BA 4IM4A 2NWSA 2XVNA 4Z2GA 3AXIA 3EOSA 4FIQA 1FWWA 1JI2A 2HDJA 3LLDA 1P0NA 2XGIA 3K8MA 3KVMA 3T2OA 4RNHA 1B31A 1OF6A 1V6TA 3DFPA 4GD0A 2VCDA 1HGYA 4XBKA 2W4XA 3ITVA 2WQPA 3IJ6A 4Q6XA 4BS0A 1H50A 5HUPA 3STGA 2IPWA 2QJHA 2I16A 5A8NA 4W4QA 3Q67A 4CD5A 1DXEA 1LROA 1JNTA 3BPWA 4Q4PA 3CHDA 5EMKA 4KR0B 1EQPA 1QW7A 3ZR5A 2UWFA 1BXCA 3TTSA 3N11A 4IJBA 3BURA 3CNYA 1TMHA 4XBJA 4YTRA 1Z41A 4LAOA 2D23A 3GKFA 1J5TA 2WNWA 3NPUA 5HUOA 1C9DA 2R1KA 4LAXA 5JUVA 4BQ2A 1CWYA 5F7UA 1JIBA 3VC5A 1XG3A 3S2LA 1VJZA 1B9BA 1Q5MA 2BHUA 3O05A 4OV4A 5JH1A 4FO4A 3LDVA 2CHOA 1GQLA 4CD8A 1V7YA 1DWFM 1Z48A 4LFYA 4BY3A 1Z32X 3GXFA 4D1IA 4JEJA 1JAKA 3N13A 4HN4A 3OYXA 5TIMA 1JPKA 3RU8X 1S2VA 4GQQA 1P6WA 2VX4A 4N6EA 2DZAA 3W2KA 4ACZB 2OZ8A 3WLRA 1LOLA 3NWRA 5JH2A 3RM8A 4PMVA 3RG6A 3W22A 2C8NA 4HB7A 4DWSD 4HD5A 4B3KA 3T05A 1R7AA 3UD6A 4M6PA 3LM7A 3KBMA 2WNNA 3LI1A 2GVGA 1HF6A 2IPFA 2OVLA 3TX9A 3L2IA 3EGJA 1EJ7L 1F4HA 2NXHA 3E2SA 4ACYA 3I6CA 1HVXA 4FHAA 3NVTA 4LV9A 5AN7A 1K3UA 1E1CA 2ZX6A 2F61A 4O8AA 4D1JA 1FWJC 1GEHA 1VCFA 1CGVA 4QRNA 3GNNA 3GY1A 1FWNA 3EX2A 1VAHA 1QNPA 5CQ1A 1H41A 4GQBA 3KRBA 4S39A 2HEJA 1BF6A 3QYSA 4YN5A 1W9XA 2XINA 1UUQA 1XRTA 1P48A 1BVZA 5ABHA 3WBAA 5CGQA 1BQGA 4U3CA 4L4MA 2FHBA 4HTBA 1P7TA 4DZAA 4EF8A 2XVGA 3M0LA 4H9TA 3KAFA 3ARZA 3WMLA 3M5ZA 2DPEA 1TTJA 2WMFA 3GIYA 1V0NA 3NPVA 3K46A 4XZMX 4GISA 3DERA 2ISSA 3P5ZA 1QT1A 1UD6A 2PDGA 4MJZA 2W61A 4U86A 4D8AA 1TYGA 5FSEC 5XIMA 3KOFA 3KZ7A 4UR7A 1UQZA 4ATLA 1K03A 1L6FA 3W1RA 4LC8A 1S1RA 5A2BA 2EJAA 2NWRA 5KINA 2ZC1A 5HR6A 3DC8A 1YDOA 5HANA 2D0FA 4PN2A 1W3NA 4TX9A 6PTDA 4Y9MA 1JI1A 2VMFA 1SUXA 1E4IA 1L6SA 1KD0A 3GUWA 1G7VA 1DJWA 4EK7A 2GK1B 4UIOA 2VQUA 2VWSA 2H6RA 4QTGA 2FTYA 3AZTA 4KFNA 2BGNE 1CXEA 4E4FA 2XP4A 1PEZA 4O8RA 4DLFA 1W3LA 1J5SA 1V6UA 2WHMA 3BOFA 2Z27A 1IR2A 4K2SA 1FX6A 5HINA 4NAEB 4QCFA 2RQSA 4OBRA 3R7MA 2AL1A 3SQMA 4R7JA 2DQXA 4OKDA 4XKMA 4EXAA 3WLLA 3CUFA 1PIIA 2PSNA 2GUYA 1FKFA 1TO3A 2YBVA 5JIPA 1H60A 3TC7A 3AHZA 1R3SA 1PHWA 4MF4A 1M68A 4AVOA 5EB8A 3WUEA 1KM4A 4DZIA 1XW8A 4HQVA 4AIUA 4NI3A 3H2AA 3ABRA 3OVGA 3QQWA 1NQ6A 5BXPA 4GJIA 3KAHA 5E70A 2V5KA 4D72A 3VMPA 4UMAA 3QV7A 4DYKA 5CSSA 1VPQA 4AHPA 1AJ0A 3W1UA 3IIXA 1X7IA 4S23A 2PB1A 4JDYA 4YHEA 1DEDA 3C0LA 1UB3A 4GNJA 3W83A 3WDJA 1GHSA 5GJNA 1Z44A 3UPWA 4ODRA 3QKEA 3UR2A 2ZUMA 1FKLA 3OOBA 2GSJA 1MEIA 8CGTA 1WUEA 3TFCA 2XWEA 4O0QA 3P82A 5BNKA 4DRKA 2ZUWA 2VT0A 5J6EA 1JCNA 3GXIA 1VD6A 5HWBA 3DYOA 4M1BA 3V35A 1ZQ5A 2C14A 5AZ1A 2ZRVA 2E6YA 1GK8A 4JTJA 1G4EA 1CGYA 1K7EA 5I2UA 2ESCA 1OT1A 3PS7A 1IWPA 4KETA 2VELA 1BXNA 2E67A 3MJYA 2OR2A 4C5YA 1TTQA 1OFDA 4S3GA 4ZQPA 3FOKA 4A8LA 1GW1A 4GI6A 5TD4A 1FH8A 2BY1A 3LS9A 1A53A 2G3IA 2X7WA 4QE4A 1UCWA 4WJXA 4BF9A 2PDIA 3EOOA 4JAWA 3VM5A 2JKAA 3NAVA 4PEKA 4DZ3A 3NYDA 2F2HA 4ROPA 2EULA 3VTRA 4Q4KA 4AY8A 3VUPA 1RBAA 3M64A 2R24A 1HL9A 5LA1A 1YNQA 3PBWA 5AECA 3M9YA 4A3HA 3EWCA 4J3ZA 3PBVA 1YX1A 1WP6A 7PTDA 3L4TA 3MBDA 5I3HA 3ATZA 4A3RA 3VFLA 1LT7A 4M19A 4WKAA 3SCTA 5C7VA 4HMCA 2GGGA 1ZJAA 4PSPA 1Z42A 4GYPC 4ZOBA 3W7OA 2C0HA 3EIPA 4JGDA 4AZIA 4ZS6A 4A4AA 2AAMA 5FCZA 1CI1A 3H2EA 3PJTA 1VC4A 3AHVA 1JYWA 1TPWA 4IT6A 3B4UA 3SEPA 4R5EA 1TIWA 3M16A 3QY6A 4IWWA 4ZZ9A 4WLCA 3C52A 3DYPA 3A3WA 2YCIX 2QJGA 1TPC1 3HG2A 4CN4A 2FDSA 3C2OA 3INPA 3AC0A 4GHRA 4TU1A 3UXLA 3HJEA 1RD6A 3DC0A 4TMCA 4EP8C 2X1UA 7REQB 3ITLA 5I3GA 2OYMA 4ICCX 3LXCA 1HL2A 3VM7A 2VR5A 2O92A 3W86A 3NQAA 1NVMA 4F2UA 1HX0A 4C02B 3UG4A 1DOSA 4B91A 3PB0A 3O07A 5CPMA 1XG4A 2GJLA 3H4GA 1JL8A 5DY2A 4EPBC 4ADTA 1S46A 4JR5A 1SO6A 4DUWA 3IKGA 4I5UA 1JCJA 5EMMA 1MNSA 3B9EA 2VURA 2X1IA 1DIEA 4MJMA 1PIGA 4QJ4B 3LA4A 1YXDA 1XF0A 3MWCA 5FF3A 1GOWA 2ZUVA 3M0MA 3W2NA 3A4WA 3CMGA 3R0DA 1W31A 1SU5A 3WK1A 2CBUA 3NI6A 4E38A 5A6BA 2QR6A 4V33A 3LCLA 1EGVA 2DG9A 1KFWA 2CNCA 4JL2A 1RCOB 1ZBVA 1HXVA 3STCA 4WDWA 3SSZA 1BKSA 4BHYA 5IBXC 1UZ1A 2XFWA 1PTDA 2W9MA 4IPLA 2OOGA 2OZ0A 3SN0A 4D71A 4XIAA 1ZALA 3BWWA 3MU7A 2JF7A 1GNXA 4U5KA 2DT2A 4CEXC 3IRDA 3E96A 4JIHA 4F48A 1CZ1A 5LA0A 4YYFA 5E93A 2WMJA 1JZ5A 4PMZA 1WKDA 2ISWA 1VJIA 2OMAA 3IACA 3QBUA 5AHFA 4QS6A 2FYMA 3BZGA 2YSWA 5IHRA 3BCJA 2GVLA 2Q09A 4HCLA 2HQAA 1R8LA 1FKTA 4C6JA 1EF2A 1UZDA 3GHTA 1MZHA 4XAKA 3AYTA 3L4WA 4TX8A 3BG3A 4EVZA 3P0WA 2V8ZA 5DT7A 2V5BA 3FHQA 3RJYA 3H7RA 1KQZA 5IM51 3OA5A 3QXBA 1R6WA 1W5QA 1IEVA 1M5YA 4JN8A 3CGNA 3WO8A 5I79A 4FP1A 3T07A 5A6JA 2BLEA 4OTKA 3M44A 4NY2A 3VAVA 1ADOA 3I3EA 1O95A 3TE9A 3GDMA 4C6LA 3E2VA 1NY1A 1RSCA 1YTDA 2M2AA 3IUIA 1QVBA 4DY1A 4MKNA 3NQVA 5CC7A 1T11A 3F4WA 4QSFA 2PGRA 3LUOA 2DJXA 3FKRA 4H2CA 4LV4A 4KWUA 2Y7EA 1DTNA 1AH3A 4KMQA 3DHUA 1JD7A 5LSMA 2V82A 1JJKA 1MXGA 2CCRA 4ZOAA 3O6DA 2Q8XA 4DJEA 1DHKA 1R30A 4NQ1A 4CQDA 3KOXA 2BV9A 1E9ZB 4BEUA 2BDQA 3M0XA 1AUSL 4IQDA 3NGJA 4N7QA 3LG3A 4JTLA 1ZENA 3N4FA 1GKRA 3VDGA 5H91A 2ISVA 3I7SA 3UXIA 5I5RA 4DUVA 3PAOA 1XIEA 4PMNA 4O18A 2XP3A 1S2UA 1WXJA 3W1LA 4DBUA 2P1FA 4FR1A 4RK8A 2V5CA 4CD4A 1IIHA 2Z7GA 5FF4A 4AF0A 3PJXA 4KWVA 4C7GA 3CQ0A 1LRQA 4GXMA 1H51A 3VYLA 3RX2A 5LZLA 4UFIA 1UR2A 4W9QA 1W1A1 3L4YA 6ALDA 1EXPA 1RJPA 1WDSA 2XIBA 4Q4RA 1P0BA 4NJHA 3LRMA 2Y62A 4B2DD 2FHCA 4GABA 4RJEA 1R3WA 2WO5A 2E25A 1TPDA 3RDKA 1IIGA 2YFOA 2J7HA 4P61A 3LTPA 3E1F1 5K7JA 1PINA 2A3CA 3PR9A 4GKLA 5KZDA 3RF9A 4IFKA 4IQJA 2Q3OA 3T2PA 1K7FA 1IWAA 3WK3A 1XP3A 4P7NA 3CHVA 5HMDA 3SQSA 2ATMA 1E6SM 1EYWA 3WNLA 2OLSA 4WDUA 2G4FA 3CUIA 4GQRA 5HQLA 2DIEA 3QEZA 1VR6A 4JQ3A 4PH6A 1JYNA 1I9CB 4WY0A 3WH6A 2DSUA 5CSYA 3PUDA 4HCHA 1FOBA 3RO8A 4GH3A 1FHVA 2CW6A 1TQXA 2PU0A 1R9XA 1MDRA 2ONEA 1TPFA 1NMVA 2C71A 4QLLA 2FJKA 2GSHA 4MZYA 5I24A 3PZOA 3N4AA 4NNCA 1W54A 3DG6A 1RH9A 2PDMA 4WXZA 1VYRA 3V36A 2FMNA 2J7FA 3ONBA 4ZL1A 3U5UA 3TMLA 3BDKA 5FEPA 3KP0A 3UNDA 3W7CA 2BG5A 1HL8A 5BMXA 1OD0A 2C3ZA 3EOEA 3FYPA 4GY0A 2ZA1A 1CX9A 3RNDA 5DT5A 1TMQA 2DY3A 4OECA 2Y8KA 4Y9NA 3W84A 2C1GA 4YPJA 4LNYA 1ITCA 3U2EA 1Y7VA 2V9DA 5JIWA 3MTWA 3HPFA 1IGSA 2WHLA 2BVWA 2ZR4A 5G1TA 4DB7A 1JCHB 1XLIA 1PL9A 4ZMGA 1EJVC 2Z1KA 3UJEA 2D1ZA 2NX3A 3TIMA 1G0CA 3WBYA 2ZQUA 5D37A 3AS3A 2FPVA 2AGTA 1OYCA 4AWTA 1TWWA 1XYMA 2PF0A 4K38A 1GEQA 1A7XA 1Q6CA 4RUBA 3P93A 2P3EA 1XCWA 3GK0A 4H8NA 2X0SA 2F23A 5IXEA 1F8AB 3OODA 3WJWA 3DGBA 3EWZA 3MBFA 1BKHA 1BHGA 1X39A 3M41A 5DLCA 3SJNA 1HO1A 3NZQA 1ITXA 2VO5A 5LIXX 2YZRA 2OQLA 1Q6FA 1ISZA 1VIZA 5HWMA 3H4XA 5D75A 1XICA 3QZ6A 1JCTA 2XN2A 4TV6A 2WZIA 3S2JA 4BJHA 1Q6OA 3WJSA 3GPKA 3TVAA 4EWJA 3OG2A 2QCNA 3R4IA 3BV4A 4Q8TA 2XN0A 1R3QA 2D0HA 8RUCA 1HJWA 3GXPA 2ASHA 2ZR5A 2HRWA 4DIAA 4HPGA 4IICA 3JR2A 1V0LA 1RR2A 4ZODA 4LVAA 5M1TA 1F76A 2ALDA 2QCLA 1F3EA 2RUQA 1JGIA 1WUFA 4MB1A 3AFBA 2CESA 5BXTA 4P7QA 4JTHA 3TXZA 1JVNA 4AIEA 2YXGA 4E8GA 5A8MA 2W67A 1TJ2A 4A6GA 3C2RA 1QI2A 1H7XA 3WQ8A 2X16A 4FK9A 2AAAA 3R13A 1QBAA 4HU4A 3ALFA 3WX7A 1KM6A 1OY0A 3TJIA 1X6LA 5EFDA 2N87A 2E7FA 4YTSA 5ENLA 4L61A 3GIPA 3S1UA 2BODX 4HOXA 3H7UA 2ZVIA 5FJJA 2PP1A 2YXOA 1IXQA 5KITA 1O5RA 1PVNA 2Z25A 4B4FA 3KVKA 3G8RA 3L9CA 3Q4DA 1CECA 3DFOA 2TPSA 4IGNA 3NQ6A 4LY4A 1EJUC 1X7FA 1QPLA 5D32A 1YPXA 1LUCA 9RUBA 1I2RA 3L4UA 4ZQMA 4TX0A 1UR8A 2GJNA 3P7YA 4ZVJA 4G2DA 4LF1A 4LAVA 1WDDA 4CNNA 3FJNA 1EEPA 4H00A 3IK4A 4O52A 1DP0A 4N9BA 2ZUUA 1D7IA 2OYKA 1TJ0A 3QTPA 1RLCL 1KLZA 2GVEA 2FFIA 1LZOA 1H7OA 2OB3A 1XRVA 3AROA 1AA1B 2E8YA 2W6RA 2CZEA 1SMAA 3OGSA 1GW9A 3UZ5A 2GQ3A 1ZCCA 5IHSA 4IPXA 1XHGA 3AXXA 3OQ8A 2VZOA 4PUUA 1I6NA 3NQBA 2D3LA 5C70A 3CB3A 3GFXA 3URBA 3POCA 3W9ZA 4AD5A 3FEQA 2EEXA 4REQB 1JQXA 1IGWA 4NP7A 2WB5A 4ADUA 5C5YA 3THQA 3VIKA 2QCDA 5FJRA 2RUCA 3GIQA 4RLIA 1JUEA 4ODLA 4R0XA 3TSMA 1E9YB 4GX8A 2O9RA 4N9EA 3O8AA 5DEZA 4UOZA 1L0PA 9CGTA 2A85A 3AALA 5DBUA 4S3BA 3L5LA 5A8OA 3W6YA 3W70A 2VGBA 4CEUC 1MQRA 2CC0A 1VFMA 2FH8A 1D7KA 3FYYA 3KOWA 4K8EA 1UWQA 4NL1A 2RDXA 5F4WA 3U3HA 2BP1A 1OFOA 2I56A 3EB2A 1KKOA 2VFFA 1OD8A 3BGAA 1EC9A 3PR2A 5FESA 3WFZA 4UZSA 1BPLB 1XLKA 1FKBA 3N18A 1V3IA 3AS2A 3AS1A 2RKXA 5IFPA 2QDDA 3KL0A 1UR3M 3MKVA 3N9RA 5BU6A 3TYEA 4PCFA 3C86A 4J2MA 3JYJA 1MI3A 1YATA 1P6BA 2PA6A 4HPXA 4K39A 4W7UA 5REQB 3SN4A 1BG4A 1B57A 4XZIA 2CU0A 2IQDA 2GFTA 2Z7KA 2XTKA 2YYUA 4L1XA 3OU8A 4C6DA 4NNRA 5AYXA 4OWGA 4P7LA 2EJ1A 1KFBA 2WMKA 1ZTVA 1PDYA 1TKKA 4GMEA 3FIGA 3KBVA 3IJQA 1A0DA 1ZCNA 5DMMA 1FDJA 1EC7A 4MZ8A 4DJDD 1BVNP 1SO3A 1POKA 1VRXA 4GY1A 3JZEA 3MZNA 1Q6LA 1CGTA 2ADAA 4BK9A 3HFYA 4H7CA 4PL2A 2ZRYA 3DBPA 2XIIA 3GM8A 5E6ZA 3H22A 1MRQA 4AQLA 1FWCC 1FRBA 1D8CA 2VL4A 4TMBA 1P5QA 3PANA 1KQYA 3LHUA 2P0IA 3GTHA 4QS5A 1YLVA 1UHVA 3LGGA 2PAJA 1V08A 3WFAA 2PV3A 4HU3A 2BZNA 3K4AA 3PRDA 3AU6A 3B06A 2BVYA 2C79A 2VN1A 2PDPA 3C4UA 4JFUA 3O2LA 4GQ0A 1CBGA 1LTDA 4RKAA 3FS2A 3SUVA 4EPEC 4TXEA 1ICQA 1ICPA 4K7VA 4Z0JA 4PZVA 3DFTA 2WAGA 3M6DA 4L3NA 3MYOA 4PODA 1I75A 2POZA 2G97A 4GNKB 5JBEA 4HGXA 3ZT7A 4UQBA 1HTIA 1V02A 2VHLA 4J3TA 3O5GA 2XU2A 2PP0A 3W26A 2GDQA 5CBJA 4Z17A 1MXSA 3S9YA 3BE7A 4X2RA 4HA4A 1EPVA 3PWAA 4H4IA 1F2JA 5A8GA 1CXHA 1J93A 5M03A 3CWOX 1GVSA 4O1AA 1UA3A 1RCQA 4N0RA 3NSMA 2VX5A 3PM6A 3OHIA 1XI3A 1SR0A 5C9WA 1OIFA 1UYQA 5KEZA 4EANA 1FQ0A 1AQ0A 3NQGA 3H2MA 1GG0A 2YGYA 4ZOEA 1HVQA 1XDLA 3TYDA 3EEGA 2DU2A 2J62A 1UH2A 1Z3NA 4HT3A 2NQ5A 3RX4A 4AD2A 2H3DA 4LUSB 3WLSA 4FALA 3CAQA 1W5OA 1LL7A 3T0CA 4O57A 5GJPA 3S5YA 4EX4A 1T8XA 1E72M 3LBCA 1UWIA 3RITA 2F6KA 2G3JA 3A4AA 3UU0A 5CC3A 3UJFA 1JRBA 3RLGA 1AW5A 1OBAA 3FLUA 4ZQNA 3A5FA 2R1MA 1BWLA 3BTNA 4Q8QA 4WDTA 4UTUA 1V3LA 5FKYA 1JDDA 4LVGA 1B9ZA 1G4TA 2WMIB 2VC9A 4GX9A 1B3ZA 1US2A 2VXNA 1GVYA 2WKGA 1W26A 3KS6A 3GG7A 3UWEA 3CZJA 2XP6A 3HJZA 4JNZA 4ASTA 1P4CA 1W8SA 3SCQA 2J77A 4F0LA 5EGRA 1O68A 4GQGA 2ZDSA 1QZ2A 3EA1A 4H41A 2C15A 3M0VA 1PX8A 2HXTA 4XSLA 4H9UA 4UQCA 2PC4A 4XKYA 5HNRA 2W3ZA 4JYSA 3A6OA 1N7KA 3MT1A 1JZ3A 3H4WA 4DEFA 1VEOA 1FWIC 1TJPA 1IEWA 4QP0A 1DQWA 1F9CA 3ZSSA 1R9HA 2J6XA 1WAWA 3PA7A 1AZ2A 1LRTA 1TX0A 3C0QA 2XZ9A 2WJDA 1KGUA 2OSXA 4U33A 3S5OA 3L2LA 3S42A 1XBYA 3N2CA 2V3GA 4MSPA 2CZ5A 3LGEA 1UD5A 5DXYA 1WXYA 4UFHA 5E0CA 4DPQA 1A49A 1W1YA 3SUSA 3ARWA 1K1DA 3AIRA 1KTCA 3R2GA 1TQJA 2XIJA 4Y9AA 2G96A 2WHJA 4GYKA 4FR6A 3UZYA 4WXYA 1TUXA 3WZ0E 4HOWA 5F2LA 3THCA 1TWZA 3G1RA 1EP3A 1HJUA 1Z7AA 3RRAA 3HZ3A 4S2CA 3CWNA 1HG3A 4W86A 3T7VA 3MMDA 2HSAA 1UG6A 2J24A 1KM3A 3UG8A 1XH2A 4ERIA 2PDLA 4NXKA 1BGAA 4X9YA 5EMLA 1YHTA 4JS3A 2VC5A 3TXVA 4IG2A 3FEMA 4FN2A 2E6DA 3JXVA 4HNOA 3SRFA 1T0OA 1UC4A 3BLLA 3VDCA 5HJXA 3C56A 3UG3A 3CHFA 1REQA 3KLKA 3WFLA 3CLMA 3KCEA 4AB4A 3Q37A 2JALA 5A6MA 5D09A 5DFAA 3UJ2A 4Y2WA 1QI3A 4IPPA 1Q6RA 4QFUA 1OX6A 3ABXA 4HZ6A 3GYEA 5IRPA 2W91A 3H23A 3BAJA 3B8DA 2J8GA 3PG8A 3FNDA 4HU8A 3VKKA 1CLXA 1OADA 3VIHA 3T2QA 3LCGA 3RAOA 3EDDA 4Y96A 4F2TA 4ZPVR 1CLKA 1H5YA 2VNCA 2XJ7A 3GG0A 2REQB 5HUAA 1J79A 1AQHA 3EMQA 2VZTA 4YTTA 3B8TA 2DZTA 3WBEA 4M7SA 4M6QA 3B0YA 3W7MA 4K7YA 3G1HA 3WLQA 3O0KA 4PC8A 2QCHA 2OKOA 2ZX5A 2KAUC 3CYJA 1XLAA 2EHHA 3PTQA 3OLEA 4O10A 2JGYA 4JTEA 4KH2A 2E0PA 3W01A 3ZMRA 4XAGA 1OABA 4UOJA 4HBEA 1IXPA 1JCLA 1VYSX 3E49A 1YXYA 4XUYA 4F66A 3L5MA 4MNLA 2Z24A 2WWCA 4R85A 4UZUA 3LOTA 5A2CA 1KWKA 1D2KA 5AHLA 1QO2A 1DE5A 1MMFA 1V3JA 2W0UA 5A8QA 4LAZA 2VD8A 1XYFA 3CZGA 5D8ZA 4ODQA 3HPSA 3WBXA 2H9AB 2QXWA 4LOCA 3W23A 2EPHA 3O06A 4XO7A 2B7PA 4R88A 5IBXA 1P43A 5EBUA 2C16A 1H09A 2WW5A 3GB6A 3REQA 4FMVA 2KGJA 3T08A 5G2WA 4XZNX 5BMWA 3UI4A 1ONRA 4BR1A 2A3BA 4MG4A 2WSKA 2QQ6A 3PTDA 2ICSA 1Y0OA 4PUWA 2YLAA 1TJ1A 4I5XA 1S3HA 2QJMA 1MWOA 1FH9A 2EG8A 4HHPA 1TV8A 3ARQA 1XIFA 5EA9A 3FSUA 2C0AA 3LHYA 3EDJA 1G69A 5GNZA 1EWDA 3GC2A 2WK2A 4DBDA 2WQDA 3H21A 3B0UX 3T8LA 2XDFA 1PZ2A 4NNAA 1XIJA 3L68A 1AW2A 5AYIA 3H26A 1OG0A 4Y7EA 1EIBA 3VILA 1ZNNA 4O13A 5FAJA 4JYDA 3GZ3A 5LNUA 3MWAA 2EPNA 3O6YX 1R9YA 1NSJA 2VEGA 4IGHA 3STEA 4JXCA 2QCGA 1W3IA 4PMUA 1HIZA 3WMBA 1VEMA 4QAIA 2J9YA 1ZRQA 3GW3A 3MVIA 3MKKA 3BSMA 2G50A 1S5TA 5FJTA 3LX9A 4WDXA 1G94A 2GWGA 4TUFA 3DFQA 4I3GA 3DFSA 1TELA 2EGZA 4I7VA 1YRRA 3NPXA 3U4AA 4AX6A 1NWUA 3LXAA 4WSKA 3BOLA 3VNDA 1J0YA 4QCEA 1CXLA 4LEFA 2WYSA 3S9IA 3STPA 3VKCA 2YXXA 1VBHA 2X7VA 4GH1A 1QWGA 4JTKA 3U4FA 2VJXA 3A5VA 5C0QA 1LOQA 2A3LA 3TYUA 1M7OA 1KBKA 3WG6A 2OFNA 2KZHA 1T6MA 3IKDA 1S2CA 3G0UA 4KEUA 1VPXA 5G2HA 4CNUA 4JX5A 1P0EA 3ELFA 2NSXA 4K68A 2CETA 4G50A 5T9BG 3SIMA 3W1TA 4PSRA 3LSCA 1G01A 4QJ5B 4N19A 1B5TA 4GE8A 5DMLA 3GAKA 3USZA 3PZVA 2JFEX 4D6FA 2P8BA 5CSUA 1IT7A 1UP2A 1OVDA 2VZVA 4PRWA 1DJZA 1K6AA 2D2OA 1E70M 2BASA 2PS2A 3TWBA 2YCLB 4YL2A 2CHNA 4QDMA 2Y1HA 4MJ2A 2PDFA 4TTGA 1NARA 2F6XA 1M7JA 3LLFA 1U1JA 4QBXA 2DT0A 4XD6A 1YNYA 1TZZA 4W89A 2HBXA 3WNOA 1YDYA 5CPSA 4LAUA 3DDMA 1LLZA 4RE3A 2OG9A 2YDAA 3MY9A 4DXVA 5ECVA 1KM1A 3V3WA 3LRLA 4LT9A 2QUTA 1KB3A 1R3VA 2ZCGA 1W1IE 4V1YA 3RGCA 4FNRA 2J78A 2P50A 2I57A 2YYTA 5D30A 3KHJA 3I6TA 5EY5A 2X42A 2ISDA 4WRHA 3T09A 2OU4A 4MPKA 4MKVA 4IMDA 4JX4A 3PWGA 3LYEA 3E0LA 1BWKA 1KXQA 1ZBWA 3AZRA 4MWAB 1E43A 2ACUA 1JUKA 5GQBA 3WQ4A 4CVUA 2C1IA 1KV5A 3OA3A 4NF7A 1M3UA 4QQUA 2QUNA 4PMOA 1ZLPA 4PTVA 1KT1A 2A6LA 4MUZA 1H1NA 4YMZA 2L2SA 3W75A 2M08A 3O5QA 3EWDA 1TFVA 6REQB 2GGIA 3QTGA 3U0HA 5G2IA 4L1GA 1E6PA 1JRCA 4ZR8A 5EMYA 4G5DA 3TAKA 2P3ZA 3NFUA 4J2PA 4FA3A 1B4KA 4C6KA 5BZAA 3UBPC 4JHMA 2NUYA 3WDRA 2E28A 4OHQA 4ACZA 1OJXA 3B03A 3S0CA 2ZC8A 3LBOA 1L6WA 3WQEA 5J8LA 4ZO9A 3K1GA 3BXWA 1QPKA 1ZS2A 2ZXBA 1VENA 3GDKA 3PFMA 3CGTA 6CGTA 3ZYZA 4CU8A 1EWEA 1H7WA 3TQVA 3FGCB 3HA1A 3DKJA 2PTWA 5HT1A 3SO7A 4O53A 1VF8A 3SCVA 3MANA 3WD0A 3W6MA 2XH7A 1VGAA 2WNQA 1PV8A 1R2RA 3VE7A 1W3JA 4MUPA 4P8VA 3NL2A 3WCZA 3JRKA 5DIVA 4H01A 4UXDA 2F8QA 4ILSA 1YW5A 1E73M 4IIDA 4AD3A 4U85A 5C8BB 1UC5A 3PN8A 2YJQA 2V69A 3B0XA 2WBKA 4GUIA 3VMOA 1OM0A 1WPCA 2GZXA 3DCPA 4WZHA 3TQPA 2F2KA 2WMHA 2WPGA 1XIDA 4PBGA 1CDGA 1VB9A 3N6JA 4QGCA 2HJPA 4PCNA 1Z89A 2ON3A 4DXXA 1KCZA 2I9UA 2UZ5A 3AIVA 4P8UA 1OK6A 1KXTA 4YVPA 3G6MA 3GO2A 1HJQA 2V5JA 3OJGA 5TAOA 4ZB2A 1A0EA 1A5NC 2PGFA 3L0NA 3UNTA 2R91A 1ITUA 5A6BD 1H0IA 2YOCA 3EX3A 4WD0A 4IIGA 3AIEA 3PAJA 4KGLA 2G4JA 4K8HA 2C1HA 2PPPA 4LVDA 1QNSA 4HNCA 2FJUB 2Z0IA 3TLQA 3CL6A 4Z2IA 1TPVA 2F6UA 1NELA 7TAAA 2FMOA 4KWSA 4GJ1A 4MKSA 2RURA 2G41A 5HAOA 1PE1A 2GQ9A 4JTFA 4K8GA 2GK1A 4LBRA 4AWEA 4L56A 3TA6A 3E5PA 3NQEA 4N42A 3ZT6A 3PZTA 1KRMA 4DAFA 4E8DA 4K3ZA 3ZR4A 3S5NA 1OCQA 3W2UA 2EAWA 3F2DA 3W73A 1SZEA 3ARPA 3CPUA 4Q33A 3C3NA 5BROA 4LUJA 1ITQA 1XQLA 1OCJA 1PX3A 4MY9A 2PTXA 2FGLA 1KKRA 4NAEA 3WMSA 2VFIA 4HMEA 3VIGA 3PPFA 3QVQA 4B90A 1FA2A 4DZ2A 2FGBA 3OYZA 1RBLA 3BLDA 2KE0A 1U5JA 4XIMA 5DCEA 1RPXA 1PWLA 2HNHA 3TOYA 1V0MA 3PUGA 2BS9A 4B2DA 4HOZA 1Y5WA 3MB9A 7A3HA 2JEPA 4NKCA 1EFZA 1X38A 1K02A 1TV7A 4C60A 3SRDA 6ENLA 3ZLFA 1C7SA 2PWUA 4Z2KA 4H7ZA 3LU2A 4LUIA 1XPGA 3T44A 3BMBA 2YBTA 2VX6A 1FKSA 3CEPA 2WMGA 1P5BA 3LLXA 2E68A 3G3DA 3BLEA