2FDQA

Crystal structure of acbp from armadillo harderian gland
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNQLKGTSKEDAMKSYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding protein
publication title Structure of armadillo ACBP: a new member of the acyl-CoA-binding protein family.
pubmed doi rcsb
molecule tags Transport protein
total genus 33
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2fdqA00
4CYEA 1MK9B 3ZDTA 1J19A 4YL8A 2J0MA 4P7IA 2D2QA 3AU5A 2AEHA 2D11A 2WH5A 2CB8A 1H4RA 2CQUA 2D10A 2YVCA 3IVFA 2COPA 3EPYA 1NI2A 1MIZB 2J0KA 3G9WA 2ABDA 3PVLA 1GG3A 3FP5A 4ZRKA 2I1KA 1HB6A 2EMSA 2HRJA 1NVLA 1HB8A 2LBBA 2ZPYA 3X23A 5IJMA 1ACAA 4ZRIA 1EF1A 1MK7B 3FLVA 3QIJA 4EKUA 4HDQA 2FDQA 2HE7A 1ISNA 2AL6A 2RQ1A 3AU4A 1SGHA 1Y19B 4NY0A 1MIXA 2EMTA 2I1JA 4DXAB 4ZRJA 2FJ9A 1E5WA 1ST7A 1NTIA 3U7DA 1HBKA 3PZDA 4F7GA 1GC6A 2J0JA 3BINA 4HDOA 3U8ZA 1GC7A 3WA0A
chains in the Genus database with same CATH superfamily
4CYEA 4ILGB 4ILHA 1GGOA 3G9WA 3PVLA 4JKDA 4ZRKA 2EMSA 1NVLA 1HB8A 4JK8A 2EMTA 2I1JA 4DXAB 2FJ9A 1ST7A 1NTIA 1GC6A 3WA0A 1GC7A 3E9LA 1J19A 1VBGA 4JKGA 2D10A 1JDEA 2YVCA 3E9PA 3EPYA 1MIZB 4JKBA 4JK9A 4TKNA 2HRJA 2X0SA 4GXBA 1KC7A 4ZRIA 4EKUA 4ILJA 2AL6A 3U8ZA 1MIXA 4JKAA 1HBKA 2J0JA 2R82A 3PZDA 4JKHA 1VBHA 4JKFA 1DIKA 3E66A 4YL8A 2J0MA 2D2QA 3AU5A 4JKEA 2D11A 4JKCA 3SBTA 5JVLA 2COPA 2J0KA 2DIKA 2I1KA 5IJMA 1ACAA 3SBGA 3FLVA 3QIJA 4HDQA 4JKGB 2FDQA 1ISNA 4P7IA 2RQ1A 3AU4A 1Y19B 4NY0A 1E5WA 4F7GA 4HDOA 3BINA 1MK9B 3ZDTA 2AEHA 2WH5A 2CB8A 1H4RA 2CQUA 3IVFA 1NI2A 2ABDA 1GG3A 3FP5A 1HB6A 4JK7A 2LBBA 2ZPYA 3X23A 1EF1A 1MK7B 1KBLA 2HE7A 3ENBA 1SGHA 3E9OA 4ZRJA 3U7DA
chains in the Genus database with same CATH topology
4CYEA 4ILGB 4ILHA 1GGOA 3G9WA 3PVLA 4JKDA 4ZRKA 2EMSA 1NVLA 1HB8A 4JK8A 2EMTA 2I1JA 4DXAB 2FJ9A 1ST7A 1NTIA 1GC6A 3WA0A 1GC7A 3E9LA 1J19A 1VBGA 4JKGA 2D10A 1JDEA 2YVCA 3E9PA 3EPYA 1MIZB 4JKBA 4JK9A 4TKNA 2HRJA 2X0SA 4GXBA 1KC7A 4ZRIA 4EKUA 4ILJA 2AL6A 3U8ZA 1MIXA 4JKAA 1HBKA 2J0JA 2R82A 3PZDA 4JKHA 1VBHA 4JKFA 1DIKA 3E66A 4YL8A 2J0MA 2D2QA 3AU5A 4JKEA 2D11A 4JKCA 3SBTA 5JVLA 2COPA 2J0KA 2DIKA 2I1KA 5IJMA 1ACAA 3SBGA 3FLVA 3QIJA 4HDQA 4JKGB 2FDQA 1ISNA 4P7IA 2RQ1A 3AU4A 1Y19B 4NY0A 1E5WA 4F7GA 4HDOA 3BINA 1MK9B 3ZDTA 2AEHA 2WH5A 2CB8A 1H4RA 2CQUA 3IVFA 1NI2A 2ABDA 1GG3A 3FP5A 1HB6A 4JK7A 2LBBA 2ZPYA 3X23A 1EF1A 1MK7B 1KBLA 2HE7A 3ENBA 1SGHA 3E9OA 4ZRJA 3U7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYE A;  1MK9 B;  3ZDT A;  1J19 A;  4YL8 A;  2J0M A;  4P7I A;  2D2Q A;  3AU5 A;  2AEH A;  2D11 A;  2WH5 A;  2CB8 A;  1H4R A;  2CQU A;  2D10 A;  2YVC A;  3IVF A;  2COP A;  3EPY A;  1NI2 A;  1MIZ B;  2J0K A;  3G9W A;  2ABD A;  3PVL A;  1GG3 A;  3FP5 A;  4ZRK A;  2I1K A;  1HB6 A;  2EMS A;  2HRJ A;  1NVL A;  1HB8 A;  2LBB A;  2ZPY A;  3X23 A;  5IJM A;  1ACA A;  4ZRI A;  1EF1 A;  1MK7 B;  3FLV A;  3QIJ A;  4EKU A;  4HDQ A;  2FDQ A;  2HE7 A;  1ISN A;  2AL6 A;  2RQ1 A;  3AU4 A;  1SGH A;  1Y19 B;  4NY0 A;  1MIX A;  2EMT A;  2I1J A;  4DXA B;  4ZRJ A;  2FJ9 A;  1E5W A;  1ST7 A;  1NTI A;  3U7D A;  1HBK A;  3PZD A;  4F7G A;  1GC6 A;  2J0J A;  3BIN A;  4HDO A;  3U8Z A;  1GC7 A;  3WA0 A; 
#chains in the Genus database with same CATH topology
 4CYE A;  4ILG B;  4ILH A;  1GGO A;  3G9W A;  3PVL A;  4JKD A;  4ZRK A;  2EMS A;  1NVL A;  1HB8 A;  4JK8 A;  2EMT A;  2I1J A;  4DXA B;  2FJ9 A;  1ST7 A;  1NTI A;  1GC6 A;  3WA0 A;  1GC7 A;  3E9L A;  1J19 A;  1VBG A;  4JKG A;  2D10 A;  1JDE A;  2YVC A;  3E9P A;  3EPY A;  1MIZ B;  4JKB A;  4JK9 A;  4TKN A;  2HRJ A;  2X0S A;  4GXB A;  1KC7 A;  4ZRI A;  4EKU A;  4ILJ A;  2AL6 A;  3U8Z A;  1MIX A;  4JKA A;  1HBK A;  2J0J A;  2R82 A;  3PZD A;  4JKH A;  1VBH A;  4JKF A;  1DIK A;  3E66 A;  4YL8 A;  2J0M A;  2D2Q A;  3AU5 A;  4JKE A;  2D11 A;  4JKC A;  3SBT A;  5JVL A;  2COP A;  2J0K A;  2DIK A;  2I1K A;  5IJM A;  1ACA A;  3SBG A;  3FLV A;  3QIJ A;  4HDQ A;  4JKG B;  2FDQ A;  1ISN A;  4P7I A;  2RQ1 A;  3AU4 A;  1Y19 B;  4NY0 A;  1E5W A;  4F7G A;  4HDO A;  3BIN A;  1MK9 B;  3ZDT A;  2AEH A;  2WH5 A;  2CB8 A;  1H4R A;  2CQU A;  3IVF A;  1NI2 A;  2ABD A;  1GG3 A;  3FP5 A;  1HB6 A;  4JK7 A;  2LBB A;  2ZPY A;  3X23 A;  1EF1 A;  1MK7 B;  1KBL A;  2HE7 A;  3ENB A;  1SGH A;  3E9O A;  4ZRJ A;  3U7D A; 
#chains in the Genus database with same CATH homology
 4CYE A;  4ILG B;  4ILH A;  1GGO A;  3G9W A;  3PVL A;  4JKD A;  4ZRK A;  2EMS A;  1NVL A;  1HB8 A;  4JK8 A;  2EMT A;  2I1J A;  4DXA B;  2FJ9 A;  1ST7 A;  1NTI A;  1GC6 A;  3WA0 A;  1GC7 A;  3E9L A;  1J19 A;  1VBG A;  4JKG A;  2D10 A;  1JDE A;  2YVC A;  3E9P A;  3EPY A;  1MIZ B;  4JKB A;  4JK9 A;  4TKN A;  2HRJ A;  2X0S A;  4GXB A;  1KC7 A;  4ZRI A;  4EKU A;  4ILJ A;  2AL6 A;  3U8Z A;  1MIX A;  4JKA A;  1HBK A;  2J0J A;  2R82 A;  3PZD A;  4JKH A;  1VBH A;  4JKF A;  1DIK A;  3E66 A;  4YL8 A;  2J0M A;  2D2Q A;  3AU5 A;  4JKE A;  2D11 A;  4JKC A;  3SBT A;  5JVL A;  2COP A;  2J0K A;  2DIK A;  2I1K A;  5IJM A;  1ACA A;  3SBG A;  3FLV A;  3QIJ A;  4HDQ A;  4JKG B;  2FDQ A;  1ISN A;  4P7I A;  2RQ1 A;  3AU4 A;  1Y19 B;  4NY0 A;  1E5W A;  4F7G A;  4HDO A;  3BIN A;  1MK9 B;  3ZDT A;  2AEH A;  2WH5 A;  2CB8 A;  1H4R A;  2CQU A;  3IVF A;  1NI2 A;  2ABD A;  1GG3 A;  3FP5 A;  1HB6 A;  4JK7 A;  2LBB A;  2ZPY A;  3X23 A;  1EF1 A;  1MK7 B;  1KBL A;  2HE7 A;  3ENB A;  1SGH A;  3E9O A;  4ZRJ A;  3U7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...