2FDQA

Crystal structure of acbp from armadillo harderian gland
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
86
structure length
86
Chain Sequence
b'SQAEFDKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNQLKGTSKEDAMKSYIDKVEELKKKYGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding protein
publication title Structure of armadillo ACBP: a new member of the acyl-CoA-binding protein family.
pubmed doi rcsb
molecule tags Transport protein
total genus 33
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2fdqA00
2WH5A 4P7IA 2D2QA 3AU5A 1MIZB 1MIXA 1MK7B 2J0MA 3PVLA 2HRJA 2I1KA 2COPA 1SGHA 2J0JA 2HE7A 1ST7A 1J19A 3U8ZA 3EPYA 1H4RA 3ZDTA 3QIJA 2EMTA 2I1JA 2AL6A 4ZRJA 3X23A 4HDQA 2FDQA 4ZRIA 2CQUA 2CB8A 1ISNA 1HB6A 1NI2A 2D10A 2FJ9A 3PZDA 4NY0A 4EKUA 5IJMA 2AEHA 2ABDA 2ZPYA 1Y19B 3G9WA 4YL8A 4ZRKA 1HB8A 1MK9B 2LBBA 1GC6A 1NTIA 2J0KA 3WA0A 3IVFA 1GG3A 3U7DA 4CYEA 2EMSA 4HDOA 3AU4A 1NVLA 1EF1A 2D11A 1E5WA 2YVCA 3BINA 1GC7A 1ACAA 3FP5A 4DXAB 2RQ1A 3FLVA 4F7GA 1HBKA
chains in the Genus database with same CATH superfamily
2DIKA 3AU5A 1MIXA 5JVLA 2I1KA 3EPYA 4ZRJA 1JDEA 2CB8A 2FJ9A 3PZDA 2AEHA 3IVFA 3U7DA 4JKCA 1E5WA 1GGOA 1HBKA 4P7IA 1KC7A 2J0MA 1MK7B 1VBHA 3PVLA 2COPA 4ILJA 2HE7A 3SBTA 3ZDTA 3QIJA 3X23A 2X0SA 4HDQA 4JK7A 1NI2A 4NY0A 5IJMA 2ZPYA 3G9WA 4YL8A 4ZRKA 4JK9A 2LBBA 1NTIA 4JK8A 2EMSA 1DIKA 4JKFA 1NVLA 1EF1A 3E9PA 4ILGB 3E9LA 4F7GA 4JKAA 3U8ZA 3E66A 1MIZB 2HRJA 1SGHA 2J0JA 1ST7A 1J19A 1H4RA 4JKHA 2FDQA 4ZRIA 2CQUA 1HB6A 4TKNA 4JKGB 1Y19B 1HB8A 1GG3A 2D11A 2YVCA 2RQ1A 3FLVA 2WH5A 2D2QA 3ENBA 3SBGA 4JKGA 4ILHA 2EMTA 2I1JA 2AL6A 1ISNA 2D10A 4EKUA 2ABDA 1MK9B 1VBGA 1GC6A 3WA0A 2J0KA 4GXBA 4JKBA 4CYEA 4HDOA 3AU4A 2R82A 4JKEA 3BINA 1GC7A 1KBLA 3FP5A 1ACAA 4DXAB 3E9OA 4JKDA
chains in the Genus database with same CATH topology
2DIKA 3AU5A 1MIXA 5JVLA 2I1KA 3EPYA 4ZRJA 1JDEA 2CB8A 2FJ9A 3PZDA 2AEHA 3IVFA 3U7DA 4JKCA 1E5WA 1GGOA 1HBKA 4P7IA 1KC7A 2J0MA 1MK7B 1VBHA 3PVLA 2COPA 4ILJA 2HE7A 3SBTA 3ZDTA 3QIJA 3X23A 2X0SA 4HDQA 4JK7A 1NI2A 4NY0A 5IJMA 2ZPYA 3G9WA 4YL8A 4ZRKA 4JK9A 2LBBA 1NTIA 4JK8A 2EMSA 1DIKA 4JKFA 1NVLA 1EF1A 3E9PA 4ILGB 3E9LA 4F7GA 4JKAA 3U8ZA 3E66A 1MIZB 2HRJA 1SGHA 2J0JA 1ST7A 1J19A 1H4RA 4JKHA 2FDQA 4ZRIA 2CQUA 1HB6A 4TKNA 4JKGB 1Y19B 1HB8A 1GG3A 2D11A 2YVCA 2RQ1A 3FLVA 2WH5A 2D2QA 3ENBA 3SBGA 4JKGA 4ILHA 2EMTA 2I1JA 2AL6A 1ISNA 2D10A 4EKUA 2ABDA 1MK9B 1VBGA 1GC6A 3WA0A 2J0KA 4GXBA 4JKBA 4CYEA 4HDOA 3AU4A 2R82A 4JKEA 3BINA 1GC7A 1KBLA 3FP5A 1ACAA 4DXAB 3E9OA 4JKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WH5 A;  4P7I A;  2D2Q A;  3AU5 A;  1MIZ B;  1MIX A;  1MK7 B;  2J0M A;  3PVL A;  2HRJ A;  2I1K A;  2COP A;  1SGH A;  2J0J A;  2HE7 A;  1ST7 A;  1J19 A;  3U8Z A;  3EPY A;  1H4R A;  3ZDT A;  3QIJ A;  2EMT A;  2I1J A;  2AL6 A;  4ZRJ A;  3X23 A;  4HDQ A;  2FDQ A;  4ZRI A;  2CQU A;  2CB8 A;  1ISN A;  1HB6 A;  1NI2 A;  2D10 A;  2FJ9 A;  3PZD A;  4NY0 A;  4EKU A;  5IJM A;  2AEH A;  2ABD A;  2ZPY A;  1Y19 B;  3G9W A;  4YL8 A;  4ZRK A;  1HB8 A;  1MK9 B;  2LBB A;  1GC6 A;  1NTI A;  2J0K A;  3WA0 A;  3IVF A;  1GG3 A;  3U7D A;  4CYE A;  2EMS A;  4HDO A;  3AU4 A;  1NVL A;  1EF1 A;  2D11 A;  1E5W A;  2YVC A;  3BIN A;  1GC7 A;  1ACA A;  3FP5 A;  4DXA B;  2RQ1 A;  3FLV A;  4F7G A;  1HBK A; 
#chains in the Genus database with same CATH topology
 2DIK A;  3AU5 A;  1MIX A;  5JVL A;  2I1K A;  3EPY A;  4ZRJ A;  1JDE A;  2CB8 A;  2FJ9 A;  3PZD A;  2AEH A;  3IVF A;  3U7D A;  4JKC A;  1E5W A;  1GGO A;  1HBK A;  4P7I A;  1KC7 A;  2J0M A;  1MK7 B;  1VBH A;  3PVL A;  2COP A;  4ILJ A;  2HE7 A;  3SBT A;  3ZDT A;  3QIJ A;  3X23 A;  2X0S A;  4HDQ A;  4JK7 A;  1NI2 A;  4NY0 A;  5IJM A;  2ZPY A;  3G9W A;  4YL8 A;  4ZRK A;  4JK9 A;  2LBB A;  1NTI A;  4JK8 A;  2EMS A;  1DIK A;  4JKF A;  1NVL A;  1EF1 A;  3E9P A;  4ILG B;  3E9L A;  4F7G A;  4JKA A;  3U8Z A;  3E66 A;  1MIZ B;  2HRJ A;  1SGH A;  2J0J A;  1ST7 A;  1J19 A;  1H4R A;  4JKH A;  2FDQ A;  4ZRI A;  2CQU A;  1HB6 A;  4TKN A;  4JKG B;  1Y19 B;  1HB8 A;  1GG3 A;  2D11 A;  2YVC A;  2RQ1 A;  3FLV A;  2WH5 A;  2D2Q A;  3ENB A;  3SBG A;  4JKG A;  4ILH A;  2EMT A;  2I1J A;  2AL6 A;  1ISN A;  2D10 A;  4EKU A;  2ABD A;  1MK9 B;  1VBG A;  1GC6 A;  3WA0 A;  2J0K A;  4GXB A;  4JKB A;  4CYE A;  4HDO A;  3AU4 A;  2R82 A;  4JKE A;  3BIN A;  1GC7 A;  1KBL A;  3FP5 A;  1ACA A;  4DXA B;  3E9O A;  4JKD A; 
#chains in the Genus database with same CATH homology
 2DIK A;  3AU5 A;  1MIX A;  5JVL A;  2I1K A;  3EPY A;  4ZRJ A;  1JDE A;  2CB8 A;  2FJ9 A;  3PZD A;  2AEH A;  3IVF A;  3U7D A;  4JKC A;  1E5W A;  1GGO A;  1HBK A;  4P7I A;  1KC7 A;  2J0M A;  1MK7 B;  1VBH A;  3PVL A;  2COP A;  4ILJ A;  2HE7 A;  3SBT A;  3ZDT A;  3QIJ A;  3X23 A;  2X0S A;  4HDQ A;  4JK7 A;  1NI2 A;  4NY0 A;  5IJM A;  2ZPY A;  3G9W A;  4YL8 A;  4ZRK A;  4JK9 A;  2LBB A;  1NTI A;  4JK8 A;  2EMS A;  1DIK A;  4JKF A;  1NVL A;  1EF1 A;  3E9P A;  4ILG B;  3E9L A;  4F7G A;  4JKA A;  3U8Z A;  3E66 A;  1MIZ B;  2HRJ A;  1SGH A;  2J0J A;  1ST7 A;  1J19 A;  1H4R A;  4JKH A;  2FDQ A;  4ZRI A;  2CQU A;  1HB6 A;  4TKN A;  4JKG B;  1Y19 B;  1HB8 A;  1GG3 A;  2D11 A;  2YVC A;  2RQ1 A;  3FLV A;  2WH5 A;  2D2Q A;  3ENB A;  3SBG A;  4JKG A;  4ILH A;  2EMT A;  2I1J A;  2AL6 A;  1ISN A;  2D10 A;  4EKU A;  2ABD A;  1MK9 B;  1VBG A;  1GC6 A;  3WA0 A;  2J0K A;  4GXB A;  4JKB A;  4CYE A;  4HDO A;  3AU4 A;  2R82 A;  4JKE A;  3BIN A;  1GC7 A;  1KBL A;  3FP5 A;  1ACA A;  4DXA B;  3E9O A;  4JKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...