2FDRA

Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
222
structure length
222
Chain Sequence
GFDLIIFDCDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVESEASIPLSASLLDKSEKLLDMRLERDVKIIDGVKFALSRLTTPRCICSNSSSHRLDMMLTKVGLKPYFAPHIYSAKDLGADRVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYPSHADRLTDAGAETVISRMQDLPAVIAAMAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of hydrolases/phosphatases-like fold protein from Agrobacterium tumefaciens str. C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 68
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2fdrA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2fdrA01
1U02A 3WK8A 4UM7A 5AHXA 2P11A 2B1QA 1N8NA 1VJ5A 1Z4PX 4YGYA 3IRUA 4UMFA 3MMZA 5AKKA 3IB6A 5FP0A 2AMYA 5AM4A 3A3YA 2OBBA 5ALJA 4DW8A 5ALZA 4IFTA 5ALQA 3OCYA 5ALLA 3FGOA 3SKYA 5ALRA 2I34A 3K1ZA 4HYTA 4RESA 3OCWA 4F72A 4F71A 1RLMA 3OPXA 2Q4RA 4BKMA 4Y2RA 1TJ4A 2ODAA 3WKCA 5AKXA 2PKEA 3CZ4A 5ALDA 4I9GA 5ALWA 3W5AA 4I9FA 5AI9A 4HGQA 1RKVA 3EF0A 1SWVA 4MUMA 4DFDA 5AIAA 1Z88A 4UM5A 3SMVA 3NANA 2FI1A 1TJ5A 4YCMA 1ZRMA 2G80A 3ZX5A 2I7DA 4NFLA 1QQ7A 5AW0A 2WFAA 1RMQA 1T5TA 4E88A 3ESRA 2MU2A 3F9RA 4O8CA 1NRWA 1KYTA 1Z4JA 3ZU6A 4Y2XA 3M1YA 5AK3A 3B9RA 3WK9A 3U7GA 4UW9A 4C4SA 2GO7A 2BY4A 3AR7A 3VAYA 3PGVA 4UU0A 2IOHA 3ET4A 2ZG6A 4NAVA 4YIHA 2IOFA 5AI5A 2BDEA 1ZS9A 2R8EA 3L1VA 3FM9A 4YH1A 1Z4NA 2EATA 3N07A 3UM9A 3ZUPA 4JB3A 2HSZA 3WKBA 5AM2A 2JAUA 5E0OA 1YS9A 3DDHA 2JGAA 5T41A 3R4CA 1MH9A 2Q5EA 3ET5A 3PGLA 3L8HA 4Y3UA 5AW3A 2FDRA 4UASA 3W5BA 3FZQA 2YMLA 5AKGA 1VFPA 4EENA 5ALOA 1WZCA 3AR6A 3N1UA 2JARA 1PW5A 2FPRA 3N5KA 2R8ZA 1L7PA 4CF5A 2P9JA 2OYCA 1Z4QA 2C4NA 5AM0A 4BBJA 3EPRA 5AKYA 4EX6A 1VJRA 1RPZA 3QLEA 5AI6A 2G1AA 3WGVA 1ZD4A 3I6BA 4RETA 4HGOA 4UATA 3RF6A 4BNDB 1NF2A 3L0YA 2IOFK 2AH5A 1WPGA 3B9BA 3PDWA 4YCLA 3D6JA 4B6JA 3QUQA 4AS3A 3I28A 3AR5A 5AVXA 3ED5A 5JJBA 3WK5A 1Z4OA 2FPSA 3SD7A 4EZEA 4G9BA 3L5KA 4C4RA 1ZD2P 2PR7A 4G63A 1QQ6A 2HCFA 4UAVA 1U7PA 3M9LA 2AGVA 3ESQA 5IT0A 3FVVA 1EK1A 1RDFA 4Y2JA 4GIBA 3W5CA 4OHFA 1QH9A 3CNHA 5ALKA 4AS2A 1SU4A 2FUCA 4BNDA 3U19A 3QU7A 1Z4LA 3TLMA 5AW8A 2IYEA 1J8DA 5AM3A 3MC1A 4Y2UA 1J97A 3L0CA 4XOUA 3U13A 3OCXA 5AI4A 3OCVA 5AKHA 2Q4TA 3L0BA 5AI8A 4QQFA 5ALMA 1CQZA 1RC8A 5A3QA 5ALPA 5AKIA 2B82A 3NRJA 3KD3A 2B8EA 2RARA 2YJ3A 2I6XA 2I33A 3NIWA 3ZWKA 4FYPA 3L8EA 3FPSA 5AVUA 2GHQA 2HDOA 2G07A 4Y2QA 3MPOA 4YCNA 4EX7A 3I1YA 1Z5GA 2IA5A 3DAOA 2WF8A 4Y2VA 2EARA 1ZRNA 1QYIA 2C8KA 2ZBGA 1ZJJA 1FEZA 3B8EA 4ZEXA 3SHQA 5AK6A 3E8MA 3QUTA 3P96A 3GYGA 3QYPA 4L6AA 2GMWA 3E81A 1LVHA 5ALFA 1L7NA 2P69A 2B1RA 2WF6A 2ZBEA 4NWIA 5ALUA 1EK2A 5AKLA 3HLTA 3SKXA 2QLTA 1TE2A 3WK4A 3QU5A 1SWWA 5ALGA 3BWVA 3KZXA 2I55A 3L1UA 3QGMA 3A1EA 1YJ5A 3QUBA 1ZD5A 2YBDA 4OFZA 1U2SA 2OM6A 5ALNA 4ZEVA 4Y2TA 4IG4A 5AW6A 4BX0A 4NV0A 3HYCA 2RB5A 4EEKA 4BEVA 5AVZA 1AQ6A 4GXTA 1T5SA 3R09A 2HX1A 4QJBA 4CF3A 2C8LA 3OTQA 5AW4A 1YV9A 1L8LA 1S8OA 1ZD3A 4H1WA 2HOQA 2R8YA 2FUEA 1Q91A 4Y2YA 1CR6A 2WF9A 3R9KA 5ALVA 2WHEA 3AR8A 4BEWA 3NALA 3E58A 2FEAA 3IJ5A 3L7YA 1XPJA 2C88A 3L8FA 1K1EA 4OD0A 1Z4KA 2W43A 2RAVA 3OCUA 2ZOSA 2CFTA 1RRCA 2HO4A 1O08A 2OA0A 3RFUA 2RBKA 3UMCA 4KX3A 2NYVA 2G09A 2GFHA 3W5DA 3N8GA 3ZWDA 4KNWA 5AVVA 1O03A 1YMQA 3PCTA 2WF7A 1RLOA 5AK4A 3KDPA 4UMEA 1WR8A 3ZTYA 4AP9A 5A3RA 2ZBDA 1JUDA 3WKAA 3ZX4A 2B0CA 5AKJA 4BYGA 4Y2PA 5AK5A 2O9JA 3SF0A 1L7OA 3QXGA 2W11A 3KOOA 3DNPA 3NUQA 1Z5UA 2C9MA 2B30A 2HF2A 2YJ6A 4L57A 3DV9A 2WF5A 4Y2SA 4UMDA 4KYTA 1QQ5A 3ZVMA 4EELA 1IWOA 1Z4IA 3BA6A 2YJ4A 2NO5A 1L8OA 1XP5A 5ALHA 1RKUA 2FPWA 5AW5A 3UMGA 1RKQA 2WM8A 1RLTA 3ZTWA 5AVYA 5AKZA 2AUTA 2JAOA 4HAIA 1NNLA 3QU2A 1RMYA 3WKDA 5ALSA 4NABA 2G06A 5AICA 2EAUA 1N9KA 2YY6A 3FPBA 4BX3A 5AVRA 5AIBA 4XE5A 3AR9A 4KX5A 4CF4A 3A1CA 4UMVA 5ALEA 4UAUA 3WGUA 3E84A 4BX2A 3U7FB 4C4TA 2GHTA 4HGRA 2G08A 2DQSA 4PNHA 3OCZA 5AVTA 3QU9A 1Y8AA 4JDPA 4UARA 5ALTA 1WVIA 3AR3A 3S6JA 5AW1A 2MU1A 1Q92A 3QU4A 2YJ5A 5IS2A 4DWOA 4YIKA 1RMTA 3U7HB 1RQLA 2YN4A 2I54A 2ZBFA 3UMBA 4MWOA 1F5SA 5AM1A 2G0AA 3SLRA 3KBBA 2YMMA 3AR4A 1S2OA 1T9ZA 3KC2A 3WK7A 2PQ0A 5AESA 5AW7A 2QYHA 4HGNA 1TJ3A 4FFDA 3WKEA 3J7TA 3L8GA 3MN1A 5AI0A 3WK6A 3A1DA 3ONNA 3I76A 4KNVA 4HGPA 2B8JA 2P27A 4J2TA 5ALXA 2D2VA 5AM5A 3QX7A 4UU1A 5AW9A 5ALYA 4DCCA 3N28A 2CFSA 3ZW7A 5AKEA 2VKQA 1ZOLA 2BDUA 1LTQA 2YMPA 4OCZA 1TA0A 2MSNA 3EF1A 3ZI4A 1U2TA 2YMQA 2HHLA 2R8XA 5IT4A 2ZXEA 2HI0A 1U7OA 2X4DA 3NASA 3QNMA 2FPUA 4L6CA 1XVIA 5AW2A 3ZVNA 1RQNA 1X42A 5A3SA 2CFRA 2HEGA 2CN1A 5AVQA 5ALIA 3NAMA 1Z4MA 3QUCA 4CE6A 4ZEWA 3ZVLA 2FPXA 2W4MA 1L6RA 5AVSA 5AVWA 3AR2A 3U26A 4FE3A 2JAWA 2YFYA 2HF7A 3U7EB 2NO4A 4XPZA 4XQ0A 1L7MA 3EWIA 2O2XA 4KN8A 1YDFA 4J03A 4CNQA 1YNSA
chains in the Genus database with same CATH superfamily
1BU8A 2XH8A 3DR5A 1LI7A 1N2GA 2BMAA 1JIIA 3ETEA 4JN6B 1J90A 3MINB 5JXWA 4K4IA 5BWMA 3GDOA 4QQKA 3QVGA 4F72A 3LQ4A 4EUNA 4KK3A 1WNFA 4HT3B 3DCNA 3LX8A 3IR5A 4FYHA 1DAHA 2JVIA 1KI3A 2QRMA 1JKIA 4JI3B 1N62A 4IMPA 5IJWA 1XC7A 4GP7A 3Q3VA 8ICFA 3A1TA 1ND5A 3GLFE 5JZ9A 2JFXA 4N1AA 1NRIA 5D7BA 5JTIA 2HQRA 3CSSA 2JLCA 1DINA 2XKAA 4KPGA 2O4UX 2IHNA 4RUAA 1DX4A 2QE7D 4DLXA 2KFNA 1L5WA 3UJ8A 1C0PA 3PSHA 1FC0A 2YN2A 3MT0A 1CR1A 3JD3A 2JFWA 3QMVA 1QHGA 1W5FA 1Z4QA 4S12A 4DIEA 3EPRA 3MMNA 3F97A 4ZICA 3W9SA 1VMDA 4KLUA 3OM8A 3I6BA 3VGJA 4DLEA 3AL3A 2WT4A 2WYHA 4N3NA 2XBLA 1F9EA 3EJ6A 4RK1A 2IGBA 1ESEA 3GD7A 3WGZA 4TKZA 4AVYA 4EUFA 3MDAA 4RIIA 4R1MA 1VDVA 1FFSA 4V1CI 3C8UA 5JH7B 3WLRA 5FUWA 1N48A 2JCGA 2HY7A 3DAYA 4QQFA 1O89A 3MS4A 1WWVA 2VNSA 3OLZA 2A9FA 4II2A 1JU4A 1P9LA 3KFUF 1ECJA 2AOTA 1YZLA 1FYEA 1AHHA 1A9SA 3BBPA 1QUEA 4M38A 2A9RA 4F1JA 1M1YA 1KIFA 4YI5A 1YVRA 4DQQA 4PEVA 4H7JA 1XKXA 1N9GB 1G4UR 4OU4A 2ORWA 3ANMA 2EOAA 1XJ5A 3K2BA 4U9UA 1H6DA 5JAZA 3BCSA 3D4OA 4Z86A 2XMSA 3NVVA 5ER6A 4WOPA 1A3CA 2BPOA 2XCRB 2WILA 1Q0LA 4RK7A 3VJKA 5IJ0A 1F2TA 4I50A 5AJYA 2ZIXA 2EBFX 4IIUA 1TT5B 4OB6A 3EISA 1BWSA 1FW6A 3R3HA 2QNIA 3OH8A 4BO8A 2C61A 1NZBA 1SAYA 2CVQA 3QKSA 3KOZA 3F6EX 4LBZA 4S35A 4ZALA 2BKLA 5C7OO 4QRHA 1DRVA 1CRPA 1YK0A 1H9CA 1DAFA 2P6OA 1I3NA 1AM4D 2PMWB 3RC1A 2RCNA 4HFRA 4RULA 1CJTC 1ZFNA 1HDIA 3DL7A 1G8YA 4PYKA 4RIEA 4KODA 4IGKA 3T1NA 2BFCB 1FDUA 5A4MS 4CUJA 2PCJA 3EUFA 2HU5A 3EGIA 3AJEA 4J3JA 5BW5A 1XUOA 3BMCB 5JAUA 4BFWA 2Q0SA 2XUPA 2CXNA 2XVAA 1P3Y1 4XWTA 1EGAA 4PGMA 1UBNA 1TX4B 4M7WA 3IEPA 4MITA 1JDSA 3FZNA 1Q0QA 3RT7A 4AF7A 5CJ7A 3T95A 1WLYA 2O19A 4H31A 4C3VA 2Q27A 3H9CA 1VG0B 3A1DA 1JROA 3HCEA 3MYRA 4UUNA 3CLRD 1PQYA 2I91A 4KP7A 4Z51A 1UJ2A 1JHQA 3M5DA 2OCEA 1GNQA 4HLCA 5AHKA 3TSWA 4LYFA 4EITA 4YUYA 4NEHB 4AYBF 3QSYA 4KR0A 4EHNA 3C5FA 2XI9A 4I2JA 3VPDA 1PVOA 5JLJA 5CEHA 4LV6A 1KMHA 1XYVA 3T9AA 2GF2A 1B76A 2HTFA 3PY8A 2MJLA 5T5QA 2ACVA 1E9BA 2A1TS 1PGJA 2ORYA 4UQLA 1R4NA 5KNBH 2YFYA 4WOKA 2XQGA 5LWQA 3WWZA 3N05A 2WKQA 4RWEA 2DT8A 4LDJA 1EG2A 1N0WA 1AMNA 1JDNA 1U11A 3U4QA 3BD6A 1L1EA 2BUAA 2WMDA 4GWGA 3PGKA 1GTZA 4OF4A 2PGJA 2RE8A 2A1TR 2QE7A 4JI6B 1U2PA 1YCGA 2IZ7A 3IVAA 1MC4A 3UWOA 1XU9A 4HWRA 1WUKS 4EGFA 3Q72A 4P93A 2PZFA 1KL9A 2EBWA 2NUAA 2A0WA 4OQZA 4YASA 2QRZA 2HLPA 2PD4A 2B9VA 5U9CA 2C83A 1QFYA 2FQXA 3RUEA 3X2SA 3VM6A 3JWPA 1OIVA 4MZXA 2Y92A 1I7PA 1SB8A 3S55A 1PYGA 4C21A 1SBZA 2Z58A 3HP4A 4WKOA 4XDYA 5K0ZA 2FEPA 3DLPX 3I39X 2EDCA 1P4GA 1VFPA 3RVDA 5LC1A 2ZSKA 5CM9C 4Z3KA 3GN2A 4RYDA 5EVJA 3ZK8A 3QLVC 3EOAI 1TMKA 2QRGA 3Q1KA 1L5QA 3ZPXA 4OO3A 4C0SA 5K0SA 3ZJVA 3MRTA 4CL0A 2GNOA 2VCYA 3HO6A 1XAHA 4MQBA 4WY8A 3FPHA 2EF1A 3L4PA 1LNZA 3GMIA 1FNDA 1NK4A 3RRHA 4Y0VA 1J8MF 5FXMA 3C3KA 4HXFB 5FLYA 4QUKA 2XVYA 4PLCA 5C8YB 4KLNA 4DR3B 1WKCA 3GT3A 1Y1QA 1Z39A 1QZTA 4GOKA 1C1XA 1HEUA 2FUG1 9ICRA 2HSWA 3GUZA 2XCTB 2AYXA 1I7QB 2OWOA 3Q9LA 4MIKA 1NJSA 5KOHA 1C8LA 2ZBGA 4BKOA 3QUTA 4CEIB 2UVPB 3UT0A 2XTAA 1Q83A 1P44A 3AF2A 1CY6A 1ODKA 1ZVJA 1P2VA 5FWNA 3AF1A 2W8KA 2WNIA 4JJFA 2EFGA 3LZDA 1KEWA 4I36A 1NVGA 1E2PA 3C5WP 2ZT8A 2D00A 3UHAA 3OAAA 5JROA 5CHYA 4ZT2A 4YALA 3OT5A 3MGVA 2ZJ5A 5KFIA 1IPFA 3V55A 3UV6A 1EZ1A 3TQQA 3RH5A 4Y6OA 2JGEA 3NDPA 3LDGA 3FPAA 5JSKA 3E58A 4A5SA 3PEWA 4G1MB 4UTNA 4ED6A 4EUEA 5JPIA 4FNAA 2JCXA 1ZOOA 4UZSA 3U3JA 2NVBA 3DM5A 3FCCA 2QENA 3DZKA 1OC2A 5B7NA 2DFTA 3NNNA 3N86A 4KBFA 5F2EA 3O2QB 3R0VA 1TT7A 4IUDS 1GGHA 4M88A 3AEUA 3GWGA 4ED1A 3A1NA 3ITKA 2GZSA 5LA6B 1XRPA 4IDNA 2ZETA 5JUMA 4HAIA 2RDMA 3IE1A 4JVSB 2JBHA 3RFCA 4Y1EA 4HS4A 4AUMA 1Z34A 4RD2A 1D2NA 4IRCA 3SGLA 2AOUA 3N8HA 4EB6B 2LYHA 3K1JA 1PYOA 4I5IA 1AF4A 1EVJA 3T52A 1SV0C 2BM1A 3KHKA 2WU1A 5BV2P 4LZGA 3NDRA 4CMEC 1PK7A 3U80A 1HDCA 4I3HA 1YF3A 4BMXA 2J85A 3ZBTA 4RLSA 1WV0A 3B13B 4J9VA 1A9XB 1M33A 4CKEB 1NP3A 3QVMA 1H65A 2L0XA 3PFIA 3KEOA 3PL5A 1ADBA 1C0LA 1E1RA 4IIJF 4AG3A 1F38A 2ZATA 3LWDA 3VO9A 3ZI4A 3MJHA 3DKPA 5AUQA 4EHIA 4G0YA 1ZESA 4KI0A 4ZH4A 4F97A 1IY2A 4JLKA 2KOBA 2DLNA 3E2MA 2AB0A 3VKGA 2WKPA 2WLTA 3IVCA 3G59A 1DGQA 1E77A 4TRMA 2CDNA 2J87A 4FZJA 5JTTA 1J24A 5CLGA 5H80A 4MKGA 4ESHA 4FFOA 5DBCA 4UOEA 2G1PA 3QQ5A 1FNBA 1J23A 2PBLA 2P77A 2VCHA 5NULA 5L3VA 3P0RA 3GL9A 1UH5A 4AICA 3OPXA 1YS6A 4OP1A 3ZYCA 4RH3A 3MB5A 4YQZA 1O8CA 5JHGB 9ICMA 4F0JA 1FP7A 2QMOA 1CQJB 4C4OA 3LJKA 2Q5OA 1HC7A 1ZHOA 1U8TA 1ZMXA 2PFQA 2IOFA 4LJYA 3OU6A 4D99A 2HMUA 2RRDA 2C22A 4TKUA 5ERYA 4BJQA 1GQQA 3ICPA 1KZ9A 3E1GA 4FOTA 3QVXA 4KVAA 3UWKA 5ARDA 5K0NA 3NZEA 4L76A 4YJ2F 2BFBB 4MS1B 3DV0A 4TWAA 3T7KA 3FLBA 1XJQA 4KLMA 4YP7A 5E38A 2EV9A 3NVZA 4M86A 3TO5A 3ZDDA 1MX9A 2Y1WA 3ZE0B 4GQAA 1KSFX 4BRZA 1AK2A 1GPH1 4K6OA 4BAUA 3ND8A 4D7AA 5HMLA 1TEXA 4UJ3A 1WU8A 2XMRA 1L5OA 2W71A 3K9HA 3HZRA 3Q8RB 1ZIXA 4OHRA 1IQ0A 1NW9B 4ZGWA 4P4TA 1L4KA 2IXAA 1PEKE 5T4EA 4X3OA 3ETCA 3JASB 5A0TA 5EWGA 1R1DA 1VIYA 2O8NA 5EQTA 1YRLA 2O20A 4XRGA 3C45A 3L0BA 4P2HA 4M9XA 1ZQLA 5A3QA 1JIJA 5K09A 3CLRC 3RTEA 3LXRA 5DSZA 3I1YA 4RVOA 3T3GA 1LPBB 4EEYA 3EBPA 1II0A 2XNDD 4X1YA 2AMLA 2WWXA 4C7MA 4RNOA 4QEDA 3QGMA 2X5OA 3MBYA 5HS4A 5U4XA 4OLAA 3GQCA 3D7MA 1FDVA 3IXQA 4OA8A 1X92A 1OTYA 1XRRA 2C1XA 4WBXC 5IMBA 3HRIA 2A14A 1IM4A 1LQUA 2V7BA 3HBMA 4J0CA 4X97A 2NAFA 3ZUGA 2R5WA 2PX3A 5UKDA 3H5TA 4ENTA 1RRCA 2WSLA 5J2CA 4KX3A 3RAGA 4YDQA 5GTIU 1S0NA 2GAFA 3SLKA 3EC7A 1NDHA 5EQDA 1QP7A 4KACA 5K8JB 4MQFA 1JUDA 4K1LA 5H8WA 2X2PA 4EY4A 4NQZA 4GPD1 3C29A 3KXKA 2MA1A 1TQDA 5KFQA 4NSNA 4U6PA 2PJUA 4JL5A 3H1PA 1M1YE 3HA7A 1NVXQ 1LKZA 5LB2A 1ML3A 3PQ2A 5C53B 8GPBA 4TGLA 4QYIA 1RJDA 4BATA 2P0EA 4HAWA 1UT5A 1PQPA 3SYLA 3ROXA 5C51B 3NHZA 1G5TA 1URPA 1ZK3A 1VSUA 3S6JA 4FFMA 3VPSA 2FJ6A 3PHLA 1KDTA 1Y7HA 3EVBA 3LUBA 2X5KO 1VI2A 2BGTA 1MCZA 1AO0A 1TM2A 1T1IA 5CFNA 1RWMA 4X94A 2N46A 3KWJA 1E6EA 1QS0B 4RHUA 2EGGA 5ALYA 3A9RA 4I0WB 4D25A 2GETA 2OAP1 2QTLA 5E7JA 5L7TA 1XRLA 3Q1LA 1YKFA 5DHRA 4YUVA 1QDLB 3AO0B 1RQNA 2R48A 5K99A 1RQXA 4BJHB 4TMFA 1L6RA 1X66A 4Q82A 1XTQA 2A8YA 2COEA 1IG0A 2ZTVA 1L4NA 3T5CA 4F85A 4L0DA 1XDUA 5T64A 4L3VA 1Q14A 4K6CA 3U7QB 2Z2JA 2XECA 3HCAA 3RBEA 2CVPA 3RAQA 1ZD1A 4B9MA 4ZP1A 5J47A 4TT3D 3AF5A 1IVYA 4LJ4A 3ZHVA 4IINA 3RHSA 1U8ZA 5ENVA 2GJ4A 2X2EA 3T1HB 2CD7A 1N2CB 4DY4A 4E07A 3K1TA 2VH5R 2WAMA 1I9CA 2ZQ5A 4IQVA 1H0KA 1NW5A 2PSFA 3MWYW 4ZPXA 4YHBA 1GADO 3NR2A 1OXSC 4DA9A 1H2BA 2O3UA 2EKZA 1W52X 5C5EA 3PL1A 3BHJA 2IW1A 2FZCA 4IJUA 4U8HA 4FHZA 2BDPA 1O0SA 4KXWA 3M5WA 4PCLA 2AT1A 1Z1BA 3LUJA 2BIFA 1JA9A 4GOND 3D5QA 1S3IA 1KETA 3ZU2A 3AXSA 4TL6A 4MGYR 4XYBA 2VA2A 3R4CA 1UPCA 1K0UA 4IEEA 4RH0A 4R84A 4YN3A 1BMDA 1KRXA 4GOOD 1NMXA 2JARA 9ICJA 1KYWA 3ES9A 2WB1C 2ZJ3A 2RD2A 3E48A 1S7GA 5K4HA 4QU8A 2J4FA 2J7KA 1LX7A 4A8EA 4HDSA 3H5OA 1F60A 3BTVA 4QPPA 4FYWA 2WIBA 3DEAA 5BUQA 1KDRA 2GBFA 5J2HA 1R27A 5BR7A 4H6XA 2PX2A 2AGVA 2GLTA 3H3XA 1C9EA 2C20A 5B12A 3RYCA 3KZCA 5KFCA 4MPRA 4X90A 2XCOA 2RHGB 3CTPA 1DOAA 2I8AA 4YWHA 1JQJC 3MEQA 4OQLA 1QHSA 1P0IA 3OHPA 4CBVA 2OE2A 4TVOA 2O8CB 3ED1A 2J3EA 4RQMA 1R12A 4LF4B 1PNTA 2YV2A 4UHBA 3NIWA 3L8EA 2VQ6A 2BZ0A 1KRHA 3M6IA 4EX7A 1KJYA 4JI8B 1JAZA 1XVLA 1UWKA 3RVLA 4Q4LA 1FDRA 3SQOA 1KOGA 3KQKA 2PGIA 4R54A 3E81A 4IJQA 3CR3C 2H3QA 2C95A 4AYWA 1U3VA 3HVIA 3DDSA 1X8KA 4HDRA 3LO8A 4EVQA 1G8MA 2QZ9A 3RVSA 4PSAA 3DMRA 5F35A 4X66B 1YFJA 4J0FA 5AJXA 1RRFA 4AMUA 5JFTA 3Q7EA 1I24A 3KM0A 1F0KA 4NMMA 1NLMA 4F2DA 3MD0A 5FNVA 1Q91A 3PR4A 1XVUA 1Y9AA 4BWFB 3WNDA 1L3BA 2JIOA 4Y6QA 1I4DD 2FQ1A 3F5QA 5K3OA 3PNMA 1T3QA 1LSUA 3ENNA 1Z0DA 1T1RA 1WQ1R 4E4TA 4LVNA 4I2DA 2JBAB 1HE8B 4P31A 4PZUA 5IXYA 3BS5A 1U5CA 5IJ9B 3MAGA 3ZKAA 1K7XB 5DBEX 1IWOA 3LECA 4CMHA 2XMZA 4DLBA 5EINA 3D43A 1MX1A 3AERA 1KWKA 1AKMA 2Y0EA 4TMXA 2A0YA 1WXDA 3C6YA 2EAUA 1W88A 4AB1A 1UJ6A 4JBGA 1XTZA 2HWWA 4ZVSA 1ORVA 3PHGA 4ZTZB 3X1DA 3V4VB 2W00A 3G6VA 2D8MA 1CJKC 5KPDA 3EPIA 1YU6A 3S7ZA 3PT5A 2HJ9A 3KYJB 4TYQA 3LVQE 3K9WA 4LOJA 4XM0A 1SCAA 1KVUA 4KIUA 3OE4A 4TV8B 1SJ9A 4RD4A 5C1BA 4YLGA 5CDTA 1KJWA 4D57A 4KRYA 2OH2A 3K6JA 2CL6X 1NZPA 3Q8SB 2CRXA 4GC6A 3EZFA 5D5QA 3K71B 1S3SA 3DL4A 1OILA 5DT2A 3NH9A 1A88A 3PCXA 3UYKA 4TL7A 4TT3A 5EJ9A 3IELA 5CNIA 2GD2A 3B6KA 2ENWA 2W7TA 4MKIA 4S1NA 2NSLA 3TVTA 5JEEA 2NLOA 5IMSA 4A23A 3AI2A 2AG0A 3GRFA 3GV0A 1L1QA 3ZVLA 2X9VA 1B4DA 2ATVA 3SOZA 2F59A 4OHXA 4O5CA 1QLWA 3PPVA 3RIEA 2Q1WA 5HS6A 4YY3B 2KKVA 3H2ZA 1BVSA 3NT5A 1X1AA 2FMPA 3M6XA 1JT9A 4HQFA 4AYXA 1JQEA 5DM0A 4A8TA 4Q66C 1Z6TA 3WZLA 1W30A 4MW4A 1PGQA 1F17A 5J9FA 1CB7A 1X8LA 1N6NA 4DPLA 4ARZB 4HLUA 4M9JA 2B78A 1A2QA 4PYIA 3MJCA 2FPPB 3AC0A 5C52B 1PFVA 4Y6GB 2VDRB 3G2JA 3OJCA 1OE0A 1UL1X 3KSZO 4PR0A 3KYBA 3L4EA 4ED3A 2DKOA 4H3HB 1LB1B 1Z5PA 4ZOLA 3W79A 1OWPA 3UB3A 4I2IA 2P5TB 1KI9A 3OHAA 3MG9A 3GFOA 3C97A 1YJXA 1G8FA 3TZEA 2PKQO 4BQSA 3G6YA 3RFAA 3MHPA 5DHQA 4YYEA 4B40A 1T29A 4BQPA 2GKOA 1QPBA 1Q77A 2C4NA 3K32A 2OR3A 5G1PA 3GCZA 2GLUA 2Y0DA 2QTNA 1FNMA 3FOBA 3I5AA 3GW8A 2GESA 4QDJA 1L0BA 1RWBA 2V4UA 4XYEA 3FYTA 1L5YA 4WJKB 2X3FA 5KX5F 1MC1A 5KTKA 1IEWA 5SY4A 3H9QA 5TQ2B 3ZGOA 5KFWA 1V3UA 1GPAA 3L4SO 1ND6A 1VGRA 2Q4TA 4JYCA 3ZZNA 1CP2A 3PHCA 1KBQA 4R7GA 4ZJPA 1TZKA 3N4MB 3WJAA 2NOAA 2X22A 4GM1A 2XBUA 2XT6A 4CPDA 4JVMA 2WPNA 1U6KA 1VE7A 1XQ1A 4IICA 1X1CA 4WFQA 2XADA 3VDMA 1PJZA 4ZEXA 3MFIA 4BX9C 3JVIA 4KQHA 3ROGA 4ZC8A 3WK4A 5A2QA 3WBBA 3ZBQA 4X00A 2DLCX 4QO7A 5LQUA 4Q4HB 3ZJUA 2QV0A 2QPLA 3REQA 4CR7A 4EQ6A 3L7LA 3LBIA 1A9ZA 1FMLA 1QRTA 4HG2A 2H4JA 3FFTA 5BOMA 1J70A 1REQB 1H93A 1W59A 3A3OA 2F90A 3OPYI 4JJEA 2YHAA 3N0XA 2YL2A 3PR5B 1W36D 3WB2A 4NOMA 1ZCAA 2ZOSA 4WNAA 1CNMA 1A76A 1ED1A 3E1KA 2A58A 1GD1O 1H8ED 3ZXUB 4OUKX 3NAQA 3SSMA 1I4WA 3SR6A 4ICIA 4WZAA 1B2LA 4M8IA 3N6XA 3MWFA 3LK7A 3SZLA 1R18A 3AM5A 1H5NA 4PLWA 1JSRA 5LP6A 5AW5A 5D3MB 4IZ6A 4Z9FA 4C06A 3T7JA 1DXQA 3LH5A 3JPPA 4QBIA 8ICYA 1B23P 3WLEA 4HB3A 1VBMA 1Z62A 2RGGA 1KDOA 4CF6A 1CXZA 3VDQA 2A3VA 4EZBA 4ZOEA 2BFNA 4KBYA 3B2EA 4D43A 4EKNB 5AJZA 2BZGA 4DS3A 3AR3A 3LQQA 4MR7B 4HX9A 1YQGA 3HPOA 3QK7A 4DLAA 1X8JA 1NXPA 4UBCA 1ZGZA 1Y8RA 4LXIA 2FZVA 1BC5A 3KLPX 2XCQA 5FTKA 3WKEA 4YCSA 4MTLA 2E55A 2IIQA 1P75A 1CE8A 1E2LA 2H1LA 1PUJA 2P27A 2OXEA 1UAYA 5JIBA 1V8FA 1KIAA 1I3OA 3UXEA 3WP0A 1YRBA 3K0AB 4TX1A 4HNAB 3IP8A 3P9IA 1BGVA 2Z3WA 2PUHA 2CN1A 3RJ5A 5KFFA 4KYUA 3SSOA 4TYNA 2XWPA 1JKJB 2Q2WA 2XI4A 2O57A 3K0SA 1DIHA 1VPVA 3PTAA 1NJXA 1YIOA 4LNHA 4MIYA 2EX1A 2OCXA 1NJ6A 4NMHA 4ZI2A 3V8MA 3HDQA 2DQ4A 5ADWA 2NSHA 4RIHA 2H1FA 2ZE8A 4HAXA 3PWTA 1EVLA 5HRCA 1JYSA 1HYGA 4ON9A 1J2MA 4R2KA 4LJ9A 4EY6A 2NV0A 2XLBA 1PSWA 5KWVA 4F4ZA 2ZBQA 3FNQA 3PRHA 1OXXK 4QXRA 5C1OA 4MW1A 5SZJA 1F8XA 4D9BA 4P3YA 3BZKA 4LXQA 3RIMA 5C0OE 3HCBA 4RS4A 4HNGA 4CKXA 4PIMA 3CRRA 2J5XA 4O3RA 4LOKA 2FA9A 3MA0A 4H15A 4CDNA 4MQ4A 2YHSA 4H7HA 5KHLB 1KEPA 2IP4A 5KJEA 1P6QA 4MRPA 3FZQA 3FNIA 3PJRA 3E35A 4JP3A 1Z7WA 4Q4AB 5F52A 4Z4CA 1G98A 3KBOA 2C8VA 2OYCA 3RAFC 3DZ8A 4P32A 5J2IA 1NOKA 3WLKX 3INNA 3SIWA 4PZLA 4AJ9A 1NI5A 3T9BA 1JQLB 5CT6A 4QBHA 3ZEAA 2WU4A 1GQOA 2NO6A 1I7LA 3GEBA 4GR9A 1BG6A 4EGJA 1SRRA 2BGUA 2I03A 5FI3A 3O6VA 3ASUA 1M7GA 4BO5A 3TZLA 4UQGA 4AX8A 2WYVA 5AW8A 2X1HA 5EVCA 2I3BA 1KZGB 3UY4A 5LP6C 4OGFA 5ALPA 2BPCA 2AXQA 3ZVKA 2HSDA 3FCAA 2OZLB 5SY6A 4Z6KA 1I3LA 4NG4A 3M9MB 2CD9A 3L7AA 3THVA 4OK5A 2NZVG 3B36A 2AN9A 4D6XA 1Z35A 1QFSA 1BPDA 4KH1A 5TQVA 1FFDA 1EDDA 2HRZA 4EDFA 4WOCA 3RT1A 4MJ3A 2H5IA 1TECE 4MKRA 2JIDA 1EK6A 4UVEA 3U9LA 4BX0A 2XQVA 5IANA 3PNYA 4LV5B 2QQEA 3JYOA 3LT1A 2KZZA 2H1WA 1QAMA 4CTKA 2A5FA 3KWLA 4BPBA 3B51X 1T24A 3FDZA 2NTYC 3TR5A 3QPBA 1P4AA 1CLEA 1JH9A 2E18A 1R3UA 1RBMA 3LP5A 4ZYZA 2QAGC 2NSDA 2MAXA 3H0KA 4JT9A 4JLDA 3MRSA 4QHSA 3V1KA 2W54A 3QWIA 1SBIA 1O87A 3HFRA 1G6KA 3P2EA 5LQCA 5A3RA 4JKYA 5EKSA 5LU9A 3KOOA 1C30A 3GB9A 5LUBA 2XUGA 5JARA 2HNBA 1NPDA 1SIBE 1XWLA 1E4YA 4KOEC 3RVJA 2UV8A 1LZKA 1Q7CA 3GFVA 1BQ3A 2P0AA 4ZYTA 5JVDA 2CV0A 4E7PA 5TMPA 1E2IA 5HFNA 3FNEA 3GAMA 2K7ZA 2ESRA 4ATNA 5HKLA 3C6QA 3T4UA 1BFKA 3I1FA 1TQHA 1ZI6A 3A1CA 2NO7A 4IDHA 3HNRA 5IINA 4A1FA 4TUYA 2PWAA 4X1IA 1TEZA 5A9SA 1OVMA 4JGBA 1WCIA 4IFBA 4F3RA 3LYUA 1WXWA 5P8WA 2QLMA 1L8AA 2C03A 1UJ5A 5E6SA 4RD0A 1CDDA 4CL2A 2AEEA 2DFLA 1WV1A 3H9GA 3ZJYA 3BS7A 5AI0A 4L6IA 1BMTA 3G9ZA 3AYXB 4N0EA 3P2JA 4DB4A 1ULZA 4YXJA 1QSSA 4PPQA 4JMLA 4FDLA 3F3YA 2EBHX 3NQ41 3VQTA 1D9DA 1IN8A 3AF3A 2PWPA 3HP7A 3BN3A 1EFTA 3RLIA 4FZLA 5HIJA 3GAAA 9ICFA 3D7KA 3ORYA 5B58T 1UXKA 5KCMA 1X42A 2W2MA 3BJMA 2BQ3A 3OD1A 2EHJA 2W4MA 3ZWCA 2PNJA 1ZJZA 2G4LA 3R3WA 3BX1A 2TECE 3EWNA 3I2JA 1EFLA 2P90A 1SXHA 3HN6A 4HB0A 1PV1A 2PFOA 1FVFA 3GUUA 3C5CA 3JYLA 2DH6A 5ALZA 4M37A 1AGPA 4WAUA 4QL3A 4CQJA 4R0VA 2Z9BA 2EX0A 5CGQB 1IB0A 1XJCA 3SQLA 1K7FB 4ZVQA 1RQGA 5DYIA 1LDYA 4ZVLA 4DADA 1E32A 4Q16A 4B82A 1IEQA 5IAAA 4OOEA 3TW4A 4AP6A 2VHUA 4ABYA 2WRZA 4N76A 1W36C 1VLLA 4ETWA 3UCFA 2J1LA 4G5SA 4FX2A 2VC2B 3CSUA 5FBWB 3ZCRA 3MELA 4EGCB 4EYGA 1IIBA 3O3OB 2R8RA 1XEFA 3DLTA 3UFXA 1XZKA 3UUEA 3EEYA 1KFDA 1USUA 1VZ2A 3FCOA 1YJQA 4G0VA 1OLOA 1ACMA 5JQGA 1W34A 4WERA 2IOQA 3HMQA 3EUB2 2GFQA 3N8DA 1WP4A 3SEQA 2JASA 1OI7A 4JLBA 1I51A 1BKYA 3NT2A 1U8UA 2EZXA 1XTIA 5JFOA 2PCLA 3GZNB 4O5OA 1DADA 2XNHA 1GGMA 1IBRA 2GPTA 3AEQB 4E5UA 3KSRA 3AW9A 4YRLA 3EA0A 4TSFD 2H7YA 1MGOA 3ASYA 2IQ5A 4PPNA 2GA8A 4LBWA 5J2TA 1KJZA 2PXIA 2FUCA 2RGWA 4MQLA 2Y9UA 4G5GA 5FWAA 3VSAA 3C5GA 1ZQQA 3WIDA 2ST1A 1ZINA 4WUVA 1DCMA 3MLBA 4GX2A 1E0DA 2G72A 2R97A 4LK2A 5BV7A 2GMWA 2R4UA 4HR7A 1NBEA 4I55B 5KCZA 3UT5A 5KFOA 4DR6B 1QIJA 2VZ9A 2IZZA 4Y2GA 1PSDA 3PHIA 4PX5A 1UQUA 3TQCA 3MS7A 3ZV4A 3B0YA 3R9KA 1PDWA 3R2JA 2C5LA 1KDYA 1IVSA 5FTNA 4YG2A 3GG2A 5TNXA 2BPFA 1SCIA 2ZU6A 3A1UA 1EXDA 1XROA 5HSGA 2R5NA 3KHGA 2WJ6A 2BHRA 4DPKA 2QUZA 3ZCSA 3UMCA 3W2HA 5AVVA 4BIMA 5M7EA 4WIAA 2DKZA 3K1AB 3ZTYA 2JD1A 3QW4B 2W2XA 5LXTB 4PHFA 2OTCA 3D8NA 4E33A 4EO7A 2XODA 4L8WB 1QIFA 3VI3B 4DC1A 4ZCMA 4GHWA 2GGSA 3QE0A 2PRKA 1TW2A 1G8KA 2I78A 2GX6A 2I2FA 1NOMA 4XA8A 1UCVA 4LK3A 3ORQA 1K97A 1NBIA 2P2CA 5BR8B 4BNYA 2WP0A 4AMVA 4XFJA 4RSHA 3A9CA 4GH5A 4D46A 4Z4GA 1MDBA 3U7HB 1K2VN 3MYYA 1IZ0A 5F3WB 2YMMA 1CD5A 2QYHA 3FBTA 2Q3JA 1KJQA 3QPCA 3PNSA 4PZDA 2PLNA 5JSQA 2UYHA 1GZ7A 4DLWA 4MI3A 4UU1A 2IDJA 5MN4A 4ETNA 4HQRA 4ZT7A 3GJ0A 2DVMA 5IWAB 1DBWA 5FBZA 4JA0A 1OXBB 3A0UA 4N4AA 4BUZA 2H2FA 5FYQA 3V2IA 4P98A 1YVUA 4WZAE 3WHIA 3PFBA 3SYMA 1XV5A 4EA7A 4QGHA 3OUTA 1W96A 1X40A 2PS3A 4IMRA 3SLGA 1OUMA 3KE8A 3CBQA 4CEJB 5DNYB 1I1QB 3VTZA 3K9NA 4L78A 4HQOA 5J4YA 5T67A 3FHLA 3P0FA 1WAMA 3IE0A 1MT0A 3SKYA 3A9WA 2J9GA 2OFOA 1YZFA 2AL7A 4Q1BA 1QFMA 3G9UA 3S2YA 4B71A 2IK8A 1CJUC 5IFKA 4NFLA 1P33A 3OJLA 1QQBA 2IU0A 2HDHA 5JC1A 1EK0A 4NE7A 1Y42X 4LXGA 1RYBA 4UBLA 1JHUA 4QZHA 4M0PA 2ILVA 4DCUA 1LBHA 3ZWVA 3ND9A 1KY2A 4CKYA 1P1BA 1H2FA 1CS0B 5I9BA 3I92A 4TSFA 4NBUA 2Y1EA 3AM4A 4F4DA 3CS3A 4L1KA 5L9AA 1QTRA 3PGLA 3LPCA 3GVPA 2QR5A 5KT7A 5EZYB 3T4PA 1Q5PA 3G13A 4FM9A 1NVMB 4BN4A 2GN2A 3ZJ5A 2W7PA 2J67A 2O2IA 3PMNA 2FR1A 1KKXA 1Z5ZA 3KPUA 2IMWP 1DBPA 5HNKA 4GQBA 4TMZA 1GPMA 3RAXA 1KQPA 1RCTE 3B38A 4QFMA 3DHWC 3P0EA 1EYZA 2GYVA 3OAAD 4YUWA 2ODPA 1T26A 2I4NA 2JRCA 1U4NA 1GQRA 3U0BA 4DLZA 2DPXA 4GC5A 3N8IA 3VUFA 2ISSD 3MLEA 2Y6UA 1G41A 5CYPA 3F6BX 2QBYB 4TLMB 3RH0A 1VHWA 2OWDA 2JGKA 2WIDA 4FYPA 2XNKA 2HRQA 3P7MA 2HFKA 4EG5A 4OQYA 1EIZA 1NURA 4F4YA 1SN7A 3O4HA 4AWXA 5AQ1A 3PSTA 1E94E 3KS9A 5LMZA 1HZZA 2WHXA 4LE2A 1YKSA 3CVWA 3HI6A 4NCKA 1HDGO 1Q46A 5BVGB 3UJ9A 5EQJB 5FV7A 1JXLA 4NYMQ 3RFVA 4IPTA 2O5EA 5LYJF 2AQ8A 2KB0A 4MAFA 4Y2HA 4O0IA 1AQLA 3RB8A 5LQJA 2BVNA 2O2CA 4NNPA 1SD1A 4EJFA 2C2YA 4D5GA 1JJVA 8AT1A 1LI4A 3SXUB 4B32A 3JPWA 3B78A 1X2EA 1T9CA 1XYYA 1VKRA 1UJMA 3RRMA 1YZNA 2BTOA 3NC4A 5K0JA 4JGGA 3EGDB 2WI8A 3T5TA 2HQBA 4ZV7A 3FHCB 4JLPA 4ARVA 3WMWA 1I2BA 3HLYA 4EELA 3LXUX 4R3UC 1S2DA 2MYPA 1E1RD 5HRAA 3SMQA 3WGHA 5DYGA 1Z7EA 2BCVA 3CUYA 3U40A 1DG9A 3M8RA 3U6BA 2HGZA 4L16A 3D7NA 2ZI9A 2ZTCA 1Z37A 3BFJA 3O4VA 4HNVA 1K1QA 2HK6A 4DAOA 3B82A 5KI6A 3IUJA 1RABA 5J2UB 3GH1A 2Z9DA 2ZUVA 3A4LA 1OB2A 4DSTA 2HWKA 3LZCA 3Q5EA 1GG9A 3QE9Y 3H13A 5LNK6 1NZDA 3HKEA 1QP0A 4WD3A 3OOEA 4P9NA 4TURA 2VDKB 3Q87B 5L9XA 1GU1A 3BXHA 5FD8A 3EW9A 2FMTA 4YUXA 4TWIA 1TM1E 2UUAB 3R6WA 1F8UA 2AFRA 4MW6A 3DH0A 2XZOA 3WLQA 1Z3EB 3MOIA 5G53C 1N3BA 1KI8A 5EJGA 3KJEA 1EVEA 1OX5A 4Q01A 1Z29A 3IT0A 1U45A 1E3DA 3R3XA 4CLHA 5HF5A 3ID6C 1OLUA 1GUBA 5GONF 3TR6A 3R7AA 2QVBA 4R2JA 5E79U 5EIXA 4CU2A 3L0OA 3PEVA 3HACA 2WBLC 3WX0A 1GNVA 1XEWX 1OFHA 4LYGA 2RJ3A 5JZOA 4F3TA 1MNAA 1K5HA 3BG5A 4ROSA 4UTPA 2P79A 2DFDA 4UQOA 4MJXA 4Q00A 3L92A 1DBVO 4JX8A 5L4NA 9ICKA 2J6CA 3OIVA 4MCAA 3O83A 2AEMA 2GCGA 3T3FA 2VA3A 5AM2A 3HN2A 3UGKA 3AP3A 4KWCA 4OJNA 2XR1A 4BV2A 3LC7O 3HGQA 4BL5A 3MTAA 1R9NA 1UK6A 3F5DA 4DQVA 4CF5A 1IHPA 1W94A 1ZWKA 2CB9A 3ONEA 1C8VB 1SQGA 4R2XA 2K2WA 3RBDA 5I7UA 1E3TA 4H27A 9GPBA 2GEKA 5KWJA 2XB6A 3E8SA 2HL6A 5DB4A 4BZQA 3WLTA 5J0PA 2O7RA 3PDWA 3VR6H 1OYWA 2XQFA 4E14A 5AXBA 1DUSA 5LFAA 3EMBA 3EGEA 2GOYA 4TXMA 3KE9A 5IT0A 1GZSA 3HYRA 1J0XO 1OHHD 4OHFA 2IEDA 1AY0A 4DGQA 3DBHB 4TV9A 2XW6A 1V7CA 5F9LA 4GXRA 4MKZA 4DFJA 4DHWA 4CKWB 1YDGA 2Q9BA 3RYIB 3QPUA 4K9SA 1T2DA 1WYGA 3EJWA 4OQDA 4PU0A 2Y0SF 1T5IA 3RWOA 3WL3A 2V3VA 1EA7A 3RF9A 5BT9A 2Q3LA 5GM1A 2A0UA 2C8KA 5B64A 3R8CA 5DCUA 1I4LD 2R11A 5KYYA 4D9NA 4IFEA 2ZQYA 3G79A 2VDLB 1KXJA 3CEPB 2CFOA 4RVUA 1ZD5A 2CUKA 2B2NA 3C1TA 5EXEA 2O8EB 2ANCA 2K4PA 3SVZA 1IZZA 1E2DA 4QWWA 5I4KA 3AILA 5EXPA 1W9MA 4XTCS 3O7MA 2C2GA 1VLMA 5LMNB 4C14A 3RYFA 4EY7A 2AE2A 1YQ9A 5BNIA 1JB9A 2OHFA 4HPWA 4Q7EA 2GSDA 3CPJB 5DYTA 3W5DA 2OD7A 2RH4A 4RQ4A 3DLIA 4NULA 4CG0A 1L5GB 2WV9A 4MQEB 1Q16A 1ZKDA 5BN3A 4MB6A 2EG5A 3PEEA 1H0HA 2E4WA 4L28A 2ONZA 4Y2SA 2WZQA 1CBUA 2GAOA 1VKHA 4YR0A 2IYZA 3O2NA 1EZ4A 2YCBA 4MF2A 4C5AA 1SOAA 1OUQA 4LWZA 3TLGA 1KFEB 1JEYB 4TYPA 5D7NA 2WJ4A 3MQ4A 3TEMA 3TFOA 2R84A 1RYSA 4NU0A 1RKBA 3NOQA 4V0MA 4E4YA 3G49A 2VT3A 4KNYA 4B2LA 5FBKA 4ECSA 1IJEA 5B3JA 4EWLA 4F6RA 1H2HA 1JR6A 3K72B 1A5AB 3A6LA 4QJ5A 4K9OA 4H35A 3LTNC 3HBAA 4A2PA 2QI9C 1I0LA 4EW1A 4OAQA 3SZUA 4L9WA 2ERXA 3FTPA 1BX0A 4FXOA 1DFIA 3SP1A 4JIGA 4M22A 3MUNA 4HWOA 2AQ0A 5JNTA 1PG5A 2GVDC 1JB1A 3IODA 1G7TA 4PSUA 3ZWBA 4H08A 1VPDA 2ZIUB 3VHRA 2L5YA 4M1EA 3MUOA 3U7EB 2NU9B 5CBPB 4DUYB 2YIDA 4P81A 4QDXA 3SPXA 3EVDA 3BDAA 4B2IA 5BOVA 3QEOA 4P0QA 4X64B 1D09A 4DN6A 2LYBA 1KFCB 3LZ6A 2Y99A 3SM9A 1N9ZA 5BPHA 1BPYA 3SHVA 2SCUA 1IXYA 3SHTA 4YJKA 4ZCQA 1VIVA 3OIYA 4DV0B 2R1UA 5DV9A 3M81A 3DB1A 1NK5A 4URWR 4YP3A 3ESRA 1XXLA 1T13A 1RYRA 1H4QA 2C7BA 1D4FA 3HXQA 4UHHA 2J32A 2RDIA 2HSJA 1U8YA 1QTIA 5A05A 2LE0A 4EGSA 2IHYA 4CXMA 5M04A 3UB2A 5FWDA 4IH4A 4FVTA 1PF7E 1XZCA 5EG5A 1M2VB 1SCJA 5L53A 3BZCA 4IGFA 1C7QA 1OHHA 1ZQWA 2X2OA 5J0UA 3FWZA 5A02A 4J0QA 2YVLA 3ZHYA 2R8ZA 3BAFA 1V47A 3A14A 1N60A 1ZI8A 4OXKA 4E94A 1LDMA 4LZZA 3LWMA 2HHJA 5BMOA 2H5XA 5J4VA 4BLRA 1SCUA 3C6KA 1K92A 4OOFA 1YB7A 2FK7A 2PFNA 1EFPA 4JI5B 3V8PA 5H9WA 1KQQA 3NXSA 2OCBA 4QOJA 3DDOA 1HOTA 2F9FA 2PD6A 1NYRA 2G17A 5E7MA 1CQXA 3U56A 3S2SA 3T9FA 3AEYA 4A73A 2FWMX 4JELA 4P7KA 2IYWA 1X77A 4D0GA 2YJ3A 1JQ3A 5IUJC 1EINA 3EGOA 2DHCA 1DEKA 1FEZA 5C18A 2OFFA 3U0VA 3P27A 4EECA 5GIPE 3P1JA 3ZH9B 4K6KA 1DAPA 4XSHA 2SICE 2X76A 5B3JC 4OHWA 2J08A 1FMTA 5EMJA 1XD2B 1U2SA 1T91A 2FPIB 1ZM7A 4INOA 3Q12A 1AQ6A 4M1TA 3HA5A 2BMWA 3ECSA 5K6AA 2OXCA 3UK0A 2PMZF 2F3RA 4B73A 2Z0MA 2ZITA 4DT1B 1NSYA 1ESZA 2NUTB 4RHTA 5MGNA 3M34A 5HGXA 1PK8A 3P9PA 3IJ5A 1Z5NA 5DSXA 2X13A 4MV9A 4J9LA 4HDQB 3OWHA 4NCAA 2QU7A 1H1DA 2JKVA 3JSXA 2QB5A 2R6GA 4GI1A 5DB6A 3L79A 2FLWA 3FWPA 4QELA 2CJYA 1N25A 3EY9A 1E9FA 1PT9A 5KTOA 3L8ZA 5F12A 5G1NA 2HGSA 3GEPA 3IT2A 2ZRKA 1VB3A 4DA0A 5GJWC 5DGXA 4Y6LA 3ER9A 1LLCA 4L3WA 1JRLA 3FR7A 4A6XA 3TI9A 5K9ZA 3DFMA 4QVKA 2QX6A 1XDBA 1SVOA 3P94A 1HMPA 3ND6A 4P36A 1KKLA 5K03A 1DRWA 2VAXA 1PL7A 4JYPA 4PPGA 1KPHA 3MGAA 4R1QA 1F4PA 4M53A 5TQ0A 1JRPA 3FYUB 4C87A 3RODA 3A1VA 4DG5A 1DZIA 4ITRC 1QYRA 4K9NA 2JFZA 4WZZA 2E37A 4ZAFA 1VRVA 3S29A 5C1PA 1R9GA 2XGOA 4OJKA 5B4UA 3JQGB 3VGPA 1S77D 3IPYA 3WWCA 1E5QA 1BE8A 1ZIYA 3IE2A 4JP2A 3CP8A 3EZ2A 1ZH4A 4ZHSA 4N3GA 3VH2A 1FXWF 3AOGA 1DBRA 4P92A 2P9BA 5E4FA 3N28A 2XJ9A 4GGPA 1L7EA 2CLSA 3EG5A 1ZIOA 4B33A 2J59A 3EYZA 2C4WA 5JWRA 2HA3A 4MR8A 3ERCA 3QSGA 2DPIA 1R6TA 1JPNA 4KLIA 2CFRA 3TXAA 4QKQA 3C7KA 5TXGA 1V8OA 2QW1A 3LDFA 2JGRA 1N1MA 2IHKA 1NN3A 1ICEA 2QXYA 1DDGA 1U02A 3IPXA 2OFXA 1U9YA 4RDXA 4ESEA 1GZ6A 4XWGA 4HXGA 2SKCA 3AHHA 5IT5A 3BD8A 3DYBA 3TFWA 3JQRA 2DF4B 4U5XA 1UWLA 2WUVA 1OWLA 1ZZGA 5LZ7A 1HFWA 2QPOA 4F5WA 4YCMA 2QKYA 3HWWA 3H4VA 4MLDA 4ZYLA 2QZ4A 5EFOA 1GAJA 5DRTA 4PAMA 1KK1A 2QUHA 1M0TA 4Q1CA 5AR1A 4WW0A 3ET4A 5JJCA 2AZDA 1X7GA 2Y0CA 1N5OX 2NT4A 4FSXA 3CLKA 4ZHQF 3KD2A 2VDQB 5KYUA 2QDKA 5H70A 2H00A 2RHJA 5DB8A 2AHOB 5F33A 3IULA 2XGGA 2IU6A 2WWFA 3RR7A 5HGJA 4PM4A 3KJHA 3NBQA 3KL2A 5AQEA 3DP9A 1N6KA 3W34A 5LQKA 4P4PA 2VOEA 4CRWB 4CN9A 2WTUA 3W9YA 1B7GO 4UUOA 2LMRA 4D8XA 4CN8A 4I1IA 2IS2A 5HZHA 2P67A 2O8FA 3HM9A 3UUWA 5E1BA 4DM4A 1APBA 1EHIA 2YC2C 4RLFA 5LQMA 2XUOA 1XVAA 1IHYA 4DL2A 1NW8A 3GHHA 4NNJA 4O2BF 2P66A 2R7LA 3VYTB 4W9NA 3PMLA 4LGCA 1HM5A 1CQIB 1YI1A 3WQBA 4F2WA 2QTMA 2B94A 4U7CA 1NQVA 3N7AA 3E6AA 1KZ1A 3IA2A 1HRKA 1D2HA 4INZA 1PBNA 4GWLA 3ZIAA 3NCTA 4X95A 3OZGA 5LDDC 4MEYA 3L02A 2MSEB 4U7DA 2MRLA 5E9JA 2M9MA 4DV7B 3QY9A 3AKYA 1M10A 3KKZA 3H2YA 2K4IA 2FKAA 3OA2A 4JOQA 7AT1A 1JFFA 3JYHA 1RHMA 1ILWA 2W6ZA 3ICXA 1UZAA 3MFHA 4L74A 4G9GA 1TB4A 4BC0A 5FULA 2PJRA 2X4GA 1IM5A 5B5SA 3MUFA 2NUBA 2VHZA 3H83A 4YYZA 4HEA6 2GBIA 2EDUA 2WG1A 2VRCD 4GXIA 5KT6A 1TGVA 1JFTA 4K7JA 1FSSA 4B5LA 1LZLA 4U02A 1XMIA 3RFUA 2AMJA 1ABFA 1HKHA 4QLOA 4JUBA 3M6VA 4F60A 1YMQA 1JLSA 1YIDA 2FFJA 2IXEA 3GD5A 4JOCA 5CYOA 1RHQA 4II3A 3PC6A 4A8JB 2LBOA 2XJ4A 2XYPA 2FXVA 2C4MA 3KQOA 4PHHA 1NXQA 2OCKA 1XNHA 3IOCA 4X71A 2A7XA 1ZQXA 4LXUA 1U7HA 4N48A 2W90A 5FI1B 1L5VA 3NO4A 3ZN2A 5BXYA 4U2DA 5G4LA 3WV5A 2PLFA 3P9YA 4YAJA 1ODLA 4BGVA 3LDAA 3BZUA 1CUXA 3PA8A 4S1WA 4ECAA 5AVJA 3NOOA 4Q9LA 4A26A 2GYYA 1DTWA 3OEEA 3LIIA 3AUOA 2VHQA 3WLNA 3QTLA 3C4QA 3F8SA 1XZLA 4KXMA 4PNPA 5HM6A 4MYTA 2QX7A 2DY0A 4K2AA 5FA5A 3EFHA 3OOHA 3NDBB 1OI2A 4O25A 3II6X 4U9HS 2WFLA 5A7GA 3C6BA 4XB1A 1JZTA 3S81A 3UMYA 3SYZA 3ABQB 3B7WA 1AKRA 4CTNA 4X7RA 3IQZA 1YDHA 1GL6A 3O21A 1XCLA 5LWHA 4F3YA 3UANA 4ALIA 3RSHA 4CNQA 2RAUA 2C07A 1NK7A 2RGUA 2ZB7A 3MS2A 4LYDA 4V0ME 4JROA 5I7RA 3IRVA 4JNKA 3C1OA 1IXZA 3A6ZA 5JUWA 4G5FA 5J4KA 2WWWA 3GP8A 4I8XA 3ROQA 3EIUA 1EB8A 4HL6A 1T43A 4PGYA 5B37A 3QNWA 2HF9A 4X8HA 3Q85A 1MO5A 4BY9E 5MFPA 4TTIA 4GPIB 4MGHA 3R5HA 3QWFA 3PPYA 4ARAA 4RANA 3JPOA 3HU5A 4XM1A 2KE5A 4RNMA 1PJ3A 3TLBA 4W4TA 3PSPA 3ILSA 3UXYA 4XWAA 3JQCA 1EESA 2VHXA 3L1VA 2ZLBA 3UZUA 1T2VA 4JR2A 2YXBA 2HMAA 2AJTA 5CT4A 5SYNA 3TFQA 4R63A 1J22A 3KYDB 1UMCA 1PL0A 3WYDA 2Q5EA 4X8LA 5MN5A 4P4UA 2KM1A 3FVTA 1SKQA 4RVFA 4BMVA 3IUNA 1Y7PA 3H5NA 2E1RA 1J8QA 4NOKA 3GCGA 5J2GA 3D1LA 1YS1X 2AEJA 2ZUCA 1CWUA 1UOPA 2I3ZA 1N2SA 3ICQB 3B3GA 4B9SA 2LHTA 5IU6A 2J6HA 2Z7JA 4KE7A 3ZDAA 1WCLA 4UHDA 3HCCA 3V6LA 3HA3A 3TBFA 5DLFA 2C82A 1UC5B 1U7PA 2ZTEA 5J2BA 2HXSA 5LVAA 3Q3JB 2QTCA 4WH0A 3BRQA 4AO6A 2WLSA 4EBCA 3TD9A 1ZL2A 3DTYA 3MJDA 4ALKA 4L02A 4I99A 4EJSA 4XYGA 4IO1A 2UVRA 2YVQA 4Y2QA 4R0NA 2F4VB 1FUYB 2P3LA 5L6LB 4Y2VA 2VVTA 2LI6A 5KDLA 4HLUC 3CY6A 2VRCA 3KVVA 2WJJA 3ZC3A 5HDBB 4HUJA 2ZRAA 5MFZA 3GQBB 2FPGA 4MH0R 1RI4A 5IYZF 1Z36A 5C4GB 4YRPA 1N7HA 4PAGA 2C8LA 2R85A 3DZDA 3AK4A 5ED0A 3AFOA 1TM3E 3O47A 3HJUA 2R8YA 2YZKA 1KF0A 1M83A 4Z5XA 1ONNA 4UEJA 2BELA 3OQ6A 4BEWA 1UIRA 4D3YA 4KLSA 2P4EA 2PSDA 1Q74A 1D7AA 1JBKA 4BLTA 2WHYA 1JX6A 5EMMA 1ZQBA 1ZP6A 1P1JA 6NULA 1A2OA 3DXYA 3HB9A 3UA3A 4KLLA 1TD1A 3D8TA 1ESNA 4PAWA 1PFKA 5EKDA 3NAZA 3KQQA 3PCTA 3EN0A 3ZE7A 3ZXIA 2PFSA 2X0RA 3KAQA 1C81A 1ANKA 2JLXA 3PFNA 4Y6PA 4ALJA 4KITB 3NHJA 2B30A 3NU1A 4QXMA 2IYTA 3QLTA 2ZZMA 1EB9A 1KI6B 4J9OA 2IYLD 2E7ZA 1Z0SA 1TU3A 1ZD8A 3ZTWA 1OA0A 2NRXA 1CQWA 1DIAA 1RKXA 1UDRA 1IWBB 5JSZB 3WKDA 1XMQB 3NEPX 4ZQCB 3I8OA 1MN8A 1V9LA 3OWXA 5ALEA 4PNZA 4WA7A 5BNFA 2VJBA 3O03A 4I1YA 4L8GA 4PNHA 1FQWA 4Q0MA 5BNTA 3DEYX 2J8ZA 3R74A 1EUDA 2G0AA 5FJIA 3CWQA 5M5BA 4UHEA 3BM5A 2Q3EA 2BGNA 1HKUA 1CG6A 4WKGA 3CUKA 4TXJA 1LBSA 1ZHHA 2KEYA 4W8HA 2QL9A 5ITVA 5L3SB 3BAZA 4J43A 3ZI7A 2FX3A 1NHWA 1A8IA 2G1KA 1A9PA 4RSGA 5JDCA 4MS4B 4AJOA 4DMCA 1BW9A 1IN5A 4KQFA 2E1PA 2ZYIA 1RJGA 3AZQA 1BFDA 1X9XA 2VO1A 1G8SA 3NP7A 5BT8A 3KETA 1PJRA 3MBKA 3KPYA 3FG9A 3N0VA 2GAJA 2FP4B 4C0LA 3PPIA 1KP2A 5KFDA 5ALJA 4LRSB 1UHUA 1ZK1A 2A9PA 1A5BB 3AU2A 3LKBA 2J3MA 3I6ZA 1FP4A 1PR0A 1XAIA 4WZBE 2C9DA 1V4VA 5A6SB 2DMRA 5IAOA 4IDFA 1NW6A 2BI7A 2O1EA 4B47A 2QTVA 2AKAB 1JKFA 1ILEA 2KJ8A 1H94A 3LYSA 1KQNA 2ILTA 2DL0A 2DFNA 3GN1A 3WWPA 1YT5A 1LLQA 1Z6XA 4QOEA 2F8TA 2A67A 3R75A 4DQUA 2PLWA 4QZGA 4RTSA 1U3CA 5C0YA 2PX0A 3OLYA 2Y1XA 2ASEA 1UBEA 4HN9A 3SAHA 2C7OA 2J3JA 2GH1A 3H1GA 4MHTA 2G77B 4NCIA 4QW9A 1DIRA 2XXAB 4G4SO 2AYZA 2RK6A 5GVRA 4N47A 4H17A 1KP3A 2WPDD 3ETJA 5AHOA 5C7YA 1FNSA 4KSYA 3DVSX 3LBHA 4B4VA 4EX6A 3ESYA 2O8VA 2I4IA 3UATA 3HSSA 3NTVA 1M7BA 4DR2B 4UZFA 1RQRA 1DAEA 3P9XA 2VHJA 4PC3A 4Q45A 4AS3A 1G1AA 3VYSB 4L9RA 4CQMD 2OD2A 4PN7A 3I9KA 1G2IA 3F96A 1E79A 5DGDA 1NQXA 4G81A 2PT5A 4HC4A 1J9GA 3F71A 4CR8A 1RBQA 2V3WA 1T8EA 3HKZC 2NW6A 4XOUA 5DNAA 4QAQA 3TUJC 7ABPA 5E1OA 5EKXA 4A6PA 3AEVA 1PU2A 3L0ZA 5JY6A 3J81A 2RARA 2I6XA 4ZV9A 3VNUA 2A57A 4J9UE 1YE3A 3PE6A 1SZDA 4Z2YA 3AIKA 4EUKA 1M2HA 2TRSB 3F74A 1AS2A 5EZSA 3IQFA 2JA2A 2G1UA 2ZJFA 4JT2A 1OFUX 4W63A 4C2AA 1TKAA 3P9ZA 3L6RA 5JTUA 4P4SA 2WB2A 1USIA 5JMOA 1Z07A 1P1KA 5EHQA 4YAWA 2EZYA 2XA9A 1RC1A 4AKIA 4UXJA 3P4XA 1KJJA 4RHEA 1DO2A 1XQVA 3GLTA 3PHJA 3D0QA 3G85A 4II7A 4Q34A 3NBXX 4S1VA 2YDYA 4R8UA 1KKMA 3AFIA 1N4AA 1ECCA 1B43A 3AY6A 5EZ6B 1AT1A 2AE1A 2FZKA 3GIKA 5C7IO 3KALA 3PEYA 4CI9A 1AUOA 1XALA 2ZSAA 2GLXA 1FIQA 5ALHA 2A92A 1R0SA 4OHPA 5AICA 5FWYA 1WWUA 3IEIA 2WE8A 2ZYUX 3EB9A 4FZMA 1F4VA 1GRQA 3C74A 3RABA 3SQNA 3ZGYA 5AVTA 5KQSA 3VVLA 3OCCA 2FSSA 3IPRA 4KE6A 4PXSA 1D0VA 3QXJA 3ZGVA 2BUCA 5PNTA 4HDCA 3PNOA 2ZJ8A 3ISTA 5DJ5A 1S2OA 2YHUA 3K70D 1G5PA 4KGDA 1UXIA 2H1CA 4QATA 5CJJA 2QLFA 2X8JA 4GSLA 2XKJE 2N3ZA 5J4LA 1PDVA 1Y7IA 4IHKA 4HNHA 2XGPA 1QG6A 5T4BA 3TYXA 3ZW7A 4I27A 2P35A 3GU3A 2FN7A 1EXWA 5DEOA 2C5SA 2N0SA 4QYXA 4O1MA 4BGDA 1L4MA 1W1UA 2HAEA 1Y9ZA 1MW9X 4QOIA 1HNWB 3C8ZA 1Z4MA 1Q6YA 3E0XA 1BWQA 3GEDA 3FPGA 2ISPA 1I7SB 1R3DA 2CVOA 3THYA 3LUKA 3UA4A 3GA7A 4TRRA 5IHXA 3FJYA 3LBNA 5IJXA 1VJ0A 5CLQA 4BLQA 2QT9A 3D1JA 2LPMA 4EBFA 5K3EA 3GDHA 9ICBA 3CCFA 4IWYA 4NK4A 4KDCA 5DLYA 1FYWA 1WZUA 1RP1A 5ALDA 1U1IA 4LDRA 3SVLA 3ZWOA 1MA0A 1U65A 5FL3A 4B87A 1EX1A 2WPDA 3EGXB 1FU7A 1TCUA 3C3XA 3HN7A 3ZDYB 1SKYB 2AW3A 2YXEA 4F4IA 5GJBA 4OYHA 3JYNA 2R8EA 3TLXA 3ZUPA 1MDFA 1KP9A 1XTVA 1MXHA 3BXOA 4HKTA 3SYNA 4CQMA 3HI4A 3CB2A 1YRAA 1C9JA 5I7FA 2XD4A 2ZW9A 1LSJA 3M9WA 5TR9A 2JLZA 3S2ZA 1KJ9A 4Y30A 1K4KA 3VXKA 3EIHA 5EOVA 2VDWA 1GGFA 1YGYA 3N58A 3CKYA 2QRVA 3K5HA 3UK7A 5JMTA 2JEYA 3E53A 4NH0A 3AONB 4QTUB 1KH3A 1PR5A 2MDTA 3QUQA 1M8PA 3I5UA 1LKYB 4G9BA 5AK0A 1E2JA 2ZRQA 1UXOA 4G0UA 1F51E 3ISBA 5JMWA 3SF8A 2BR0A 2B8NA 5J5CA 1KY3A 4Q9NA 3I3SR 2BSXA 4FCCA 3RE1A 2GHRA 3R7WA 5D3QA 1Y6FA 3PUIA 3R41A 4NARA 2GUWA 3MJFA 2WT9A 5CA0A 1FRVA 2UYOA 2Y68A 3Q9UA 3T7RA 5B3LA 4RW0A 4KMRA 3T7EA 5MGBA 2IW3A 3QA3E 2YB1A 1Q2UA 4MQUA 1TE2A 2R2AA 1J0EA 4QPNA 5IVHA 2VH1A 2MYTA 4OFZA 4XI9A 4KFUA 5HG0A 3AVYA 4PO9A 2XZLA 1Y3DE 3FW1A 2NV2B 2J4CA 5JS8A 1I6WA 4GMHA 4D9GA 1FFAA 2D8CA 1Q7TA 4Q18A 5FUYA 2PZEA 3KQVA 2V5AA 1ZKMA 4DDWA 4F11A 3S27A 4C80A 3E22B 3HZHA 1E0KA 1E5XA 2FSHA 3GRZA 5DX1A 3W4KA 2UUCB 3Q3HA 3C39A 4ZVKA 3RI3A 2YWBA 1TJYA 5B57C 4U00A 4WDRA 4AXBA 5HTOA 3D4PA 5KTRA 4AMGA 1EE1A 1ZK2A 1I13A 4FGZA 1T4GA 3S28A 4DLGA 1OYVA 1D0IA 5HZKA 2M6SA 4TTRA 3BA6A 3FDXA 1E1NA 4MOWA 3IMCA 4IOMA 4C6RA 2JGDA 2PO7A 2PAFA 3PDIA 1BMQA 4A82A 4C9BA 4HNQA 5JT1A 4Z2AA 4WBNB 5JU6A 3B1JA 3E61A 4AD8A 3TK1A 4KIFA 1QAQA 4R8MA 2Y4OA 2DBZA 4G1BA 4AULA 3S1AA 3LOPA 1XNJA 4EKIA 2H3HA 4DA8A 4DNOA 3KG2A 5KFEA 1HO3A 2QD3A 4NYJQ 3NVAA 2D7JA 2G5GX 1B8UA 2FU5C 5A4JA 1AGXA 3MIZA 4HGPA 3VHXB 1Q0SA 3QOFA 3W2GA 4QFBA 3GEGA 4IQGA 121PA 4IXWA 3E9RA 3UHJA 3DBOB 1W4ZA 1A69A 1DEXA 3K05A 2IODA 4OX9B 3H6HA 3OQ1A 4AWBA 1BOOA 1F0MA 2GTPA 1PX0A 4Y1GA 1TM7E 1T1SA 1T6XA 1U5AA 5ALIA 4GECA 4WNIA 3L43A 3TZHA 1Z2EA 1E7MA 1FTYA 4YJFB 3PQ5A 2N1RA 4BU1A 4M7PA 4NBKA 3HB4X 1G291 4GICA 2O2DA 2Z4TA 3RTDA 3TE6A 1OV4A 4QQRA 5TE9A 4CV0A 1VL0A 2FW7A 3ND7A 1UM9A 1X1TA 1SBYA 4MYCA 2GZ2A 2PMBA 2WAQC 4AKEA 5KAPA 2BGKA 1GZVA 4QOFA 3M49A 3DVAA 1U7ZA 1GKKA 2PRJA 4HFJA 1WHSA 1DWPA 3S99A 1SZPA 2JMGA 2JJ2D 1QQ7A 3AWIA 3KOXA 4CKBB 4PSCA 5DCYA 1NRWA 3PR1A 4U0KA 1FSPA 1Y6RA 1SD2A 4TS1A 4GDMA 2R87A 5CD9A 4EJ0A 5CNJA 3WNBA 3A6PC 4JB0A 1M1NB 2GF9A 4KH0A 1MFZA 3AHJA 4HRAA 1E5LA 2X8LA 3QVWA 1FA9A 1RQ7A 3EIXA 4V1CA 4LRYA 1MH9A 3VYUB 3LC0A 3W2TA 2JGNA 1L5HB 3MCZA 1OIWA 1SG6A 1DKRA 3QMPA 1KU0A 2EJUA 4G41A 4ER3A 1KSGA 1TXGA 2PYDA 4FMDF 2GZDA 3HILA 3IP5A 3S2EA 4IAOA 1J99A 4D0RA 4BP1A 1DOHA 2DRIA 1S0MA 4ZK2A 3F53A 4TN1A 4HDOB 1GQSA 2IPLA 1U81A 2IU4A 1GO3F 4FBUA 2JK0A 1GT6A 2X86A 3W7BA 3SOPA 3NOXA 1UZNA 2EKBA 4FGLA 3BICA 3FTEA 5H1YA 3ISCA 3FUCA 1LNSA 2JB9A 3U19A 5D87A 2VBGA 4I08A 2CJPA 3K70C 3D2QA 1LI5A 3ZJ4A 3HRDD 4I19A 1EFVA 4NJOA 1HYQA 1ADCA 5KYVA 5DGAA 3ONDA 4H16A 4LTDA 2JZCA 3DC2A 3FRJA 5CR9A 1U94A 2FF7A 2QTTA 1Z5GA 4BXOB 3DAOA 4EMUA 3G0OA 2LRHA 4N03A 3L1JA 1ZM9A 3CGGA 1XL1A 1S8AA 3V34A 2Q5CA 3FVQA 2K87A 3JAKB 1MC5A 2YBDA 4XB2A 4LJ8A 4CG1A 3QWHA 3R76A 5EIAA 1MO3A 1RWVA 4LHXA 2HADA 4FLEA 4QGBA 4Z9AA 4IILA 5D01A 1YR3A 1C4KA 2Y76A 1SKSA 3RW9A 1CJSA 5KNBD 5BN5A 2F67A 2NYRA 2JI8A 1U2GA 4PSVA 3Q7PA 3L6UA 3LP8A 1B8VA 2BFEB 2Y71A 5A4KA 3C5VA 4A91A 2H4XA 3BWBA 3VU9A 1NKEA 3RJHA 4X91A 3TWOA 1NV9A 4C0XA 1C3OB 3TAQA 3UJHA 2F43B 5BSEA 2W11A 2Y1LA 5SYMA 3ASVA 2I80A 1I80A 3IFSA 3KCQA 2XC9A 1N1DA 4F3KA 3KT8A 1RKQA 3NGLA 1O94D 1T4CB 1JYFA 4Y9RA 3PGMA 4YRZA 4DC0A 2R60A 3IIIA 3NRWA 1THGA 2E82A 5IKXA 1P7PA 2DUNA 3HTXA 1IBSA 4CCSA 3U2QA 1PV4A 4MS3A 2D7CA 4M55A 1TI7A 5J23A 1Y98A 5DM2A 3R20A 4OMFG 2ZBFA 5FOSA 1CX9B 2I8CA 4O2AB 1TTQB 3GAZA 1UMKA 1NW7A 5LR6A 4H7PA 1DEHA 2ECOA 4RFSB 4TZKA 5CVJA 3V8EA 2WQ6A 1HZZC 4DQSA 1XR3A 5DN9A 4H6VA 4ZODA 4DCCA 2FF5A 1B6TA 2WJZB 4CM4A 5B5EU 3N2LA 3SAGA 4ZI7A 5KFUA 4KLOA 2AG6A 2J6BA 2VNKA 4C4YA 1EWRA 1Y63A 1ODTC 3PZPA 4YAGA 1KARA 2IF0A 2J7PD 3EEOA 3X1JA 4KYIB 3LQYA 4Q4JB 4XVQA 1JXMA 4WJZA 2JJ2A 3EQ7A 2QX9A 3E9CA 4BBAA 3WWEA 2OFWA 1X86B 5MN6A 4JK1A 2NRVA 3FETA 3OY2A 5AHXA 1OXUA 1HDYA 3DKIA 1J5XA 1WB4A 2KNJA 2PI4A 3GR6A 5FP0A 2GS9A 4QZBA 4M1QA 2FMXA 2W22A 4HH3C 4JITA 1HY3A 3BGVA 2ZAGA 3NHFA 3BWXA 2QARA 2OVBA 4R1SA 1P2BA 3ZZUA 1ZNQO 2EQYA 4H1HA 4ZIRA 1Z88A 2CBZA 1SXIA 1XRSB 1KQ3A 4IXMA 3DE6X 4HFNA 3DP7A 3B3AA 2I67A 3R3YA 2HRCA 1CKEA 4RNDB 4YQYA 4G56A 3GROA 3G68A 3KDAA 3A6KA 4YA6A 3ROTA 4GYYA 3B1WA 2JH1A 1U0GA 3ZHOA 1GG5A 4X65B 3IP1A 2ZT5A 3F8TA 2OBYA 5JZVA 2JGAA 2X4LA 2IH4A 3MWDB 1NIJA 2EW1A 1BN7A 4HUQB 4JVLA 1Y8QB 1JMSA 2CXUA 4I4NA 4QZVA 5G5GA 1RT9A 2ZAOA 1E4EB 4V0LA 2QT0A 2DBVO 4LF5B 3OZ7A 1D1TA 2PSJA 4NMWA 1BCSB 1LJ8A 2V4MA 2Z08A 1PZFA 2C78A 5AI6A 3C3MA 4MV8A 3U1BA 1U2GC 2R8KA 3L0YA 3LX6A 3RSGA 5HF8A 2OCDA 1WSWA 2VS1A 1HG0A 4KMUA 1WUDA 1WMSA 4TMKA 3WK5A 4ZJZA 2O23A 4XFKA 2R7KA 4DZTA 3V80A 1CUYA 3L0PA 4X7PA 1LV7A 5HKKD 1PUIA 4RELA 1QFJA 2X6TA 3GJRA 2HU8A 4XVUA 1L5KA 4NPAA 5K3FA 4A9AA 3BULA 3ISVA 5KNBA 3MCAA 9ICOA 3KTOA 1F7UA 5THQA 3L93A 1DPFA 5A5GA 4RKRA 1G5RA 3BMQA 1ZQEA 9ICXA 1FUUA 3EFOB 4ZRMA 3KKOA 4K8RB 2ZZKA 4NFSA 1CDEA 3UWPA 3R7SA 2EBUA 1BSVA 4G5RA 2QQ5A 2BMEA 1QK3A 5CBKA 5IVKA 2QV7A 5EMNA 2OP1A 2VUIB 4EUSA 2QXTA 4GOXA 4GYJA 3TW8A 2JZBA 2B1JA 2P6MA 2I7TA 1TCCA 4AI6A 4KIWA 4B2PA 1NVEA 2O1SA 1O94A 2QW0X 3HPRA 3LPDA 2BFDA 4X8OA 5IKOA 2WMOB 5AJWA 2XCSB 4I7EA 3SAJA 3N8GA 3N75A 4AKGA 3QBJA 4WL0A 2KI5A 2G5HB 1UDBA 2OV4A 1SZJG 1XZ8A 8ICVA 3F2DA 1P31A 3DM9B 4TMWA 4BECA 5EIFA 1E8NA 1Z5UA 1BE1A 4IIJA 4JQSA 4P7JA 2HA6A 3OWOA 2VR1A 3IQHX 1EA5A 2AJLI 4BWJA 3OTWA 5I9TA 4ZXFA 1WXEA 3JTEA 2H18A 1MU0A 5KOYA 4KIGA 3ABSB 4B2YA 3R9IA 4ZV4A 3WISA 4D1YA 4C05A 5DO9A 3PUVA 2B2CA 1VLQA 4X41A 1UPTA 3Q2OA 3QU9A 2I87A 4RK4A 2GO1A 2VQEB 3K35A 2J7PA 1CZNA 1C41A 3IHKA 4X92A 2AF4C 1IAVA 3JARB 1Z18A 1N2OA 1OKKD 4DMLA 8ICCA 2F3NA 5CAEA 2QAIA 1FTWA 2V9CA 5C37A 4CM3A 2P65A 4RTLA 4IKOA 3S68A 1BDMA 4GKJB 6ADHA 1IBMB 2ZE5A 3QFSA 1XWFA 4CZ2A 4ENRA 4BZXA 1YB2A 1S2LA 2RGYA 1NLYA 3TSAA 2CHEA 1X19A 1QCDA 2VSXA 3S3TA 2FSVA 2J5RA 2I7VA 4I6JA 2GWSA 1MH1A 1RE1A 3D5EA 3UMFA 8ATCA 3HB0A 3I34X 4WCFB 5CD1A 3K31A 1UJNA 1JTEA 1QRAA 3WK8A 4TM7A 1UZUA 2Z4SA 4DOMA 4YJ2A 4KK4A 2YV1A 2YWDA 1GT91 3H5LA 3ILYA 2ZUWA 1QORA 4YS6A 3UUGA 2WYOA 4F5YA 4PLGA 1QV7A 5L1JA 4P7GA 3GOHA 4ALLA 4MB2A 1WULS 4QTTB 2H63A 3CJRA 2OCIA 3EPLA 5F78A 5SV2A 2AFHE 1UEXC 4H7FA 4MLCA 1U6JA 1IEVA 1R15A 4L0CA 3MB8A 7ICPA 2WTEA 3V1NA 3CX3A 4UXIA 3A27A 4S05A 3ZY6A 4UUAA 3BQMB 3LPMA 2B6GA 1VCMA 4QWBA 1WJGA 1M6NA 2V7TA 4KV7A 1W49A 2CJWB 2E89A 4TRNA 3QVUA 2Q7OE 5AOBA 3FOEC 4Y1RB 1OXMA 5HKKA 3ZIAD 4PZCA 2IZ6A 4J1TA 1BWRA 2A59A 1MZVA 4AUKA 1FBNA 4EABA 1O94C 3V8BA 2CHQA 1YI8A 1FFXA 1R4AA 3C3PA 4BKPA 3CH7A 5D84A 4ID9A 4K0KB 1D4OA 2YY7A 4KHZA 1NHGA 4BVJA 4O4LF 5CH8A 1N78A 2OO7A 3QFRA 3HCPA 4G5OA 3VSDA 1XX6A 4G5QA 2VHVA 2W2KB 1XLTA 1XZDA 2PZAA 2V7WA 3CXRA 3J81k 3C1YA 2IXFA 2XUZA 3A4MA 4MWGA 1GA6A 3LE8A 1P0QA 2C54A 3H3FA 1ULBA 1PJ4A 1O6FA 2RHHA 2R7NA 2AC7A 1LU9A 2BGWA 3BIOA 2R8BA 2ZWMA 4YDHB 3PNVA 4N5IX 4O4JF 4XQGA 1E62A 1ZCBA 3IQXA 1MABA 4PF1A 4P0PB 4W9RA 3B8EA 1NLFA 2DR3A 3IP7A 3E5RA 1ZVVA 2H5JA 2FNAA 3VZBA 4WZBA 2C92A 1QG2A 3HYCA 2HRDA 3PTZA 4QHTA 4E32A 5JNVA 2GARA 4QJBA 1CEYA 4JLUA 2FUEA 2NV3A 4EPTA 4GYKA 3IV6A 1I5OA 3DE4X 2W9BA 1KHHA 2IYXA 2IV3A 3IQDB 1NN1A 3WXBA 3OEED 2FSVC 2NP7A 5LD2B 2BZSA 1AO3A 2ZJYA 4GBMA 9ICWA 3HDJA 4PLZA 5FCDA 1KDVA 1Q6ZA 4BQQA 1OKKA 3ZHRA 4HX5A 1V5EA 3AUXA 1NA5A 2C58A 4QRIA 1BTOA 5H9VA 3NHBA 4U1RA 4IH1A 4YAIA 1Q50A 1NVBA 1M3SA 4J3FA 3ITNA 2K4EA 1T34A 4F4JA 2OAEA 2IY7A 5DXJA 1BQ4A 2MMCA 3A1SA 1DAKA 3L46A 1W1IA 1CFJA 4FKZA 3V33A 3EGVA 2M2IA 4BX2A 4G09A 1GNSA 2HA4A 4C2BA 2OLEA 4BWVA 3FYHA 4O9MA 2IIBA 4C0QC 2ZT6A 2XDYA 4I29A 4IIFA 2Q28A 4JLWA 2D0DA 5IS2A 5A3JA 1UFKA 2XEDA 3R23A 3L6OO 4GRDA 1T94A 1HI9A 4I5EA 2KQUA 3SZOA 4B1FA 1S02A 3D0RA 5EZQA 4CDGA 4K6FA 4EA9A 3OJSA 1W44A 4I2HA 1HUZA 3LTEA 1K9SA 2RIRA 2HUNA 1HNNA 4DSFA 1QIEA 3I5MA 2H1RA 4RTKA 2YCLA 3JAWB 4FMCF 3UHFA 1LTQA 4GOMD 5K6AC 1QZ3A 2ATXA 5AH0A 5ES4B 1EJBA 3QNMA 1J9ZA 1PX2A 4BIIA 1NJWA 3GVIA 1BROA 3P9QA 4TYYA 3HLKA 2AWNA 3IH5A 2Q3CA 5IJAA 4CQLA 2ZSFA 3JZIA 2P62A 1QV9A 4IGEA 4JUFA 3BMNA 4NBSA 1NQAO 1IN4A 3P4YA 2Z4RA 5HQ3A 2QGFA 2ZUDA 2ODBA 3ICWA 5TY0A 5BVHB 4DL6A 1ATZA 1WDWB 3ANXA 3TSOA 1RYYA 5A9TA 1PJSA 4Y9SA 2CLMB 1Q3UA 4MWZA 3OC6A 1RWKA 1ZRMA 2GXUA 1GGJA 8ICTA 2PX5A 2XNJA 4D92A 4O5KA 3S0JA 1MFPA 3HM2A 1S0OA 1AGNA 4H59A 5KNDH 1XBTA 3EXFA 2P4HX 2BDEA 1GO2A 2POQX 2A1UB 5LMCA 4RM2A 2JAUA 2OBMA 4B46A 4JR0A 3TPCA 4OH1A 3D3EA 1SBHA 1DB3A 4C6TA 3QBEA 1HFJA 4LYAA 2PUAA 2FDRA 4PTLA 5H82A 1DPGA 4RHCA 4KMOB 1U90A 2HCTA 3H40A 3DSRA 2PMEA 2XWSA 4ECVA 4C7YA 2AI1A 5EWMB 1XNQB 1JEQA 1L5FA 3N74A 4NBVA 5BWOA 3DMHA 4R2MA 3W6OA 4CODB 3U60B 3E4CA 4GE0A 1TEVA 3O4GA 5FBQB 3FXAA 4KDRA 4EYKA 2DWUA 4E2WA 3RB6A 2G76A 2GQ0A 3B3QA 3AGPA 4UE3S 4J2OA 1BD4A 4RL6A 4L08A 3V48A 1X7XB 4LTMA 4HNRA 1YK1A 2NIPA 4YC7A 1IUOA 1YVPA 3PITA 3P0JA 4ED9A 3AJ9A 1AN9A 1KFTA 3WSVA 3V6KA 3HDVA 1NK9A 1SUDA 2Y77A 2OT3B 5IKPA 2H51A 3A6HA 5G40A 1RAFA 5B6IA 1P7YA 2A9KA 2OGWA 2Z04A 1QR2A 1L7NA 5E6RA 3HR7A 3DDNA 1Y4SA 5ALUA 2W9CA 5CW1A 4MA5A 5EXDA 1QSYA 1ZW6A 5CFOA 2PMKA 2CCKA 2E4XA 3L4KA 1T2FA 4O4IB 4P3PA 1PR6A 2E4AA 4L4RA 1L4FA 4C7BA 5CUQA 3GV8B 1YCHA 3NALA 4N40A 4IR1A 3TLCA 5FFFA 4D9IA 3VV2A 4CLRB 1G20A 4Q3DA 4DA4A 1RAEA 4FC6A 4QWEA 2WOJA 2QMHA 1G8GA 2VP6A 4IIEA 5DB7A 3V8NA 2VAMA 1YZ6A 4JOBA 5BMVF 5HUQA 5CWRA 1AVTA 4RWZA 3HZZA 4D74A 1Z8HA 1MB2A 4NOJA 2HF2A 1U0BB 2DWPA 4YJ3B 4W9NC 1KC3A 5COBA 1DOZA 3H75A 4UM9D 1DC6A 3I9LA 1SIWA 2O6HA 2YV5A 2JHGA 1M34A 2QRQA 3O74A 2HSEA 4LDQA 4LHZA 1VA4A 1ZH2A 4HGYA 3UQ2A 4XPIB 3EVGA 3F8WA 4HATA 4WESB 3H4MA 1H4SA 4RK0A 1XMOB 1LB2B 2PZBA 4ZMBA 4AFNA 4QVIA 3IUYA 4H7EA 2YN4A 3QFTA 3TSCA 3MNFA 1J25A 3K9CA 3OLVA 1DTEA 3T9CA 2H52A 1Q7BA 3DWIA 2L17A 1QF6A