2FDRA

Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
222
structure length
222
Chain Sequence
GFDLIIFDCDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVESEASIPLSASLLDKSEKLLDMRLERDVKIIDGVKFALSRLTTPRCICSNSSSHRLDMMLTKVGLKPYFAPHIYSAKDLGADRVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYPSHADRLTDAGAETVISRMQDLPAVIAAMAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hydrolases/phosphatases-like fold protein from Agrobacterium tumefaciens str. C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 68
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2fdrA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2fdrA01
2YY6A 5A3QA 5AW1A 5ALGA 2B8EA 2ZBGA 2I55A 3RF6A 2BDUA 3S6JA 5ALUA 4HGRA 3FPBA 2WFAA 2OA0A 5AI8A 3ZX4A 3MN1A 5AVVA 1NNLA 2Q4RA 4F71A 5AHXA 5AVWA 2FDRA 2P9JA 3K1ZA 3FGOA 3L0YA 2P27A 2HI0A 2YN4A 2MU2A 1Q92A 1CQZA 3NAMA 5AI9A 5AI5A 3SD7A 2WHEA 2NO4A 5AM5A 5AVXA 4QQFA 1RLOA 1EK1A 4UM7A 1U02A 2YMLA 3OCYA 5ALVA 2ZXEA 3IJ5A 3SKXA 1L7PA 4UMVA 2OBBA 5ALXA 4UARA 5ALIA 5ALQA 4C4TA 3A1DA 1K1EA 3HLTA 1NF2A 5AKEA 1U2SA 2PKEA 5AM3A 3QXGA 1RMYA 1RPZA 2O9JA 3A3YA 4KX3A 1ZD5A 4RESA 3L8HA 4AS3A 3UM9A 2PQ0A 3GYGA 4UAUA 1S8OA 4EELA 4XPZA 3UMCA 3QYPA 2AGVA 5AM2A 5AK3A 1Z4NA 2ZBEA 2GHTA 2ZG6A 3QUBA 1EK2A 5AW9A 3QU5A 4BX0A 4G9BA 1RLTA 4BYGA 5JJBA 3WK9A 1L7NA 4XQ0A 2NYVA 2GFHA 5ALKA 5AK4A 2C8KA 2ZBFA 1F5SA 3KZXA 2FPWA 4YIHA 2ODAA 5IT4A 3N5KA 4EZEA 1U7OA 1YS9A 3ZI4A 2G07A 2RARA 4Y2UA 2WF5A 3QNMA 1L8OA 2VKQA 4JDPA 4YH1A 5AVUA 2BY4A 4CF5A 2JAOA 2B8JA 2I6XA 3QGMA 2YJ6A 5ALMA 2C4NA 2G0AA 2R8YA 4BNDA 4NWIA 2D2VA 1U7PA 4AP9A 4IFTA 1J97A 3OCWA 4HGPA 3OPXA 1Z4PX 2FPUA 2YMMA 3EWIA 3L8FA 5ALPA 4Y2JA 3WKEA 5AKLA 1NRWA 4F72A 4YCMA 5AESA 4QJBA 1RKUA 1ZD3A 4BX3A 1QYIA 2I34A 2HF7A 3BWVA 4PNHA 3U7HB 4CF4A 2JAUA 3PCTA 2WF9A 1YMQA 5AKXA 4J2TA 4Y2VA 4DFDA 2R8XA 5ALOA 3KBBA 4BX2A 5AI0A 3KC2A 4AS2A 5AVSA 4NV0A 2W43A 5AW6A 3KOOA 5ALRA 4IG4A 1YV9A 2FUEA 4HGOA 2EARA 1TA0A 4UU1A 1Z4LA 1ZOLA 1J8DA 2WF7A 3QU9A 2YMPA 3QX7A 4Y3UA 4EENA 4Y2XA 3ZVLA 4FFDA 3I1YA 1Z4JA 3WK5A 3L8GA 3N07A 2BDEA 1YNSA 4Y2TA 5AKYA 3L0BA 2G08A 2HF2A 5ALSA 2MU1A 3QUCA 5AKZA 3ET4A 1VJ5A 1Z4MA 2EATA 2RAVA 1L7MA 1WR8A 2OM6A 3KDPA 3ZTYA 3OTQA 4L6AA 2ZBDA 1Z5GA 3ZTWA 1SWWA 3PDWA 3UMGA 1X42A 4FYPA 3WKAA 1RMTA 2Q4TA 1SU4A 4UASA 3R9KA 4HGQA 5AW5A 1RMQA 3PGLA 5AVRA 2B0CA 1T5TA 3OCZA 5AIAA 3D6JA 3N8GA 2WM8A 1RKVA 5AM1A 3ZWDA 3ZX5A 2G09A 3ZVMA 3A1CA 3QUQA 2CFSA 1TJ5A 2JAWA 2B30A 1FEZA 1Z4IA 5AK5A 4ZEWA 5AW3A 2R8EA 3RFUA 1LVHA 1XVIA 1Z4QA 4XE5A 4UMFA 2DQSA 1XPJA 3ZWKA 4OD0A 3L0CA 3EF1A 2YBDA 3BA6A 4MWOA 5AM0A 4BBJA 3M9LA 4KX5A 3DDHA 1ZJJA 1QQ7A 3MMZA 3N1UA 1Z88A 3PGVA 1Y8AA 1L7OA 2G1AA 4YGYA 3FM9A 1ZD2P 4C4RA 4HGNA 4CE6A 1LTQA 5FP0A 3W5DA 1N8NA 2HO4A 4CNQA 5ALNA 1VJRA 2X4DA 3AR6A 5AK6A 2Q5EA 3W5AA 1RQLA 4EEKA 2EAUA 2AH5A 1RLMA 3NRJA 4H1WA 5AVQA 2CN1A 5AKHA 3UMBA 4UM5A 3QU7A 3SLRA 5AKIA 4I9GA 3OCUA 1RKQA 3WGVA 2FI1A 3J7TA 3AR4A 3W5BA 4KNWA 1ZRNA 3I28A 1Q91A 2WF6A 2FPXA 3NIWA 2CFTA 1TJ3A 4Y2SA 3AR2A 4OCZA 2IOFK 4BNDB 3DAOA 4UMDA 2HEGA 2FUCA 5IT0A 3AR3A 2FPSA 3CNHA 3QUTA 1ZD4A 2FEAA 5ALFA 1WPGA 4HYTA 3FZQA 5AKJA 3ED5A 4NFLA 3R09A 2QLTA 1O03A 3NANA 4BKMA 4UATA 3KD3A 3SHQA 2ZOSA 3I6BA 4OFZA 2O2XA 4FE3A 3AR5A 1RRCA 2IOFA 5ALLA 2QYHA 3MC1A 3ZVNA 3A1EA 1O08A 4UMEA 4EX7A 2CFRA 5ALHA 4YCNA 3ESRA 4JB3A 4OHFA 2YJ4A 4UAVA 4KYTA 2HSZA 4Y2QA 4MUMA 2JGAA 2I7DA 1T5SA 1ZRMA 3U7FB 4O8CA 2G80A 5AVZA 4I9FA 3B9RA 5AW4A 3DNPA 3EPRA 4ZEXA 1YJ5A 3OCVA 4RETA 2AMYA 3B9BA 5AW8A 2HOQA 4DW8A 1TJ4A 5AVYA 1U2TA 3NUQA 3N28A 1Z4OA 4Y2YA 1XP5A 3AR8A 3SKYA 3L1UA 4KNVA 5AW2A 2MSNA 2G06A 1SWVA 2B1RA 3L1VA 5ALEA 2YJ5A 1QQ6A 3ZW7A 2I54A 3TLMA 2IYEA 3NALA 4G63A 1RQNA 2FPRA 3SF0A 2IOHA 2W11A 4B6JA 3WK7A 3WGUA 3U26A 4HAIA 3M1YA 3ESQA 3W5CA 4J03A 3OCXA 3F9RA 4Y2PA 3QLEA 5A3RA 3R4CA 1VFPA 1WZCA 5AW7A 3SMVA 4L6CA 2WF8A 5AI6A 2B82A 3EF0A 5ALTA 3I76A 3E58A 3QU4A 2R8ZA 5ALDA 3WK6A 2C88A 4E88A 5E0OA 3U19A 1MH9A 4BEVA 3B8EA 1YDFA 2YFYA 4L57A 2B1QA 4EX6A 2NO5A 2YMQA 3L8EA 3E84A 1CR6A 1RDFA 4NAVA 3U13A 2HCFA 4ZEVA 2AUTA 1T9ZA 1L8LA 2GHQA 3FVVA 4GXTA 5ALZA 3WKDA 3E81A 3QU2A 3AR9A 2IA5A 1IWOA 2I33A 2JARA 2RB5A 5ALYA 1RC8A 5AM4A 1N9KA 2RBKA 3VAYA 5AKGA 1WVIA 2HHLA 3IB6A 4Y2RA 5AKKA 5AICA 3U7EB 1ZS9A 5ALWA 2P69A 4GIBA 2GO7A 4NABA 5AI4A 2OYCA 3DV9A 1QQ5A 1L6RA 3ZU6A 1S2OA 3WKCA 4DWOA 1PW5A 5ALJA 2C9MA 5A3SA 1JUDA 4XOUA 1KYTA 5T41A 3IRUA 3U7GA 4UW9A 1Z4KA 1Z5UA 4CF3A 4UU0A 3CZ4A 3NASA 4DCCA 2YJ3A 3AR7A 3P96A 2PR7A 3WK8A 2C8LA 3E8MA 2P11A 4YCLA 4C4SA 3MPOA 3L5KA 2HDOA 3HYCA 5AVTA 1QH9A 4BEWA 5AIBA 5IS2A 2GMWA 4KN8A 2HX1A 3ONNA 2W4MA 3WKBA 1AQ6A 3L7YA 3ZUPA 3WK4A 1TE2A 5AW0A 4YIKA 3FPSA 3ET5A
chains in the Genus database with same CATH superfamily
2XUQA 4V2IA 3OZ7A 4M1KA 2ZIAA 1MFPA 4I4TA 1XZEA 2QJFA 1ATZA 3D4LA 3PR3A 4DRXA 3O47A 1SVMA 3KUDA 4XGQA 3OWHA 3PQEA 2Q5CA 3N7AA 4PLZA 5EKUA 4F1JA 1SZCA 1E9SA 3TGLA 3K9CA 1TLTA 1GNPA 4Y2HA 5A9SB 5JWRA 3HDGA 4WNAA 4EY4A 4R0NA 5BN3B 1A8UA 2FEOA 5KSZA 2OUIA 3S2FA 3W7VA 1EFPB 1I1OA 2P4HX 2JKVA 4WXMA 4R9RA 4XIIA 2IPNA 2Y2VA 2XB9A 3LT5A 1JWBB 1V9PA 3SJAA 3NEJA 1R15A 4P33A 4F4ZA 1CDEA 2A84A 2YHUA 3KYDA 1P1JA 3VPAA 3DAGA 5IDWA 1NP3A 3I61A 1HZZA 2A9JA 3NFYA 4KR3A 2RHWA 2RGAA 4KL8S 4Z1MD 5FADA 3U80A 4H3HB 4M0PA 1V2HE 4HLQB 3THSA 2K89A 3SD7A 3P4XA 4MI1A 3ZWVA 1M1YA 1OSNA 4LS3A 4W7SA 2KE7A 5AVKA 1V5WA 4RQ3A 1ZGZA 2HT6A 2VTVA 4GPD1 2FH5B 4C7OB 2V6BA 4NIMA 1Z5NA 3DJYA 1U8XX 3IJ5A 3QE0A 2WC1A 1D9DA 3GNQA 4R05A 4O3MA 1RBMA 5HSGA 1IJFA 1HURA 1RRPA 1F0MA 3BS7A 3E35A 4UARA 2LW7A 1O94C 4WY8A 4Z8XA 4EY5A 5FPKA 3CM0A 3H2BA 1M72A 3TAQA 4IZ6A 1KJ9A 2QN7A 2PV0A 4LJ9A 5L9AA 4UHJA 1DEAA 5KFYA 1RXEA 2CYAA 1KSPA 1T8EA 2YIMA 3F5QA 3OIUA 2RHFA 2Y0SC 3FKJA 4IF6A 2X0DA 1ABEA 4UPEA 1DQNA 4YQWA 1GP2A 1E5QA 2OFFA 3K0FA 4A10A 1F48A 1HLFA 4NENA 3UXNA 1GSAA 2OG1A 1CFZA 2CHFA 3BORA 3F78A 4NXZA 1Z0DA 4US8A 3NT4A 3AV0B 4U4AA 1P0QA 5KPDA 1SKMA 4MDFA 3K0CA 1GZ5A 1FFHA 4PHGA 1G5PA 1VSVA 5A4MS 2YHIA 1H0HA 2PZEA 3BMOA 2D4AA 3D6VA 1VL0A 2WYWA 3N70A 2VPPA 3DDZX 3Q1LA 4ISCA 1XZNA 4WLEA 4QSHA 3OQNA 3AUKA 1ZIYA 3ZIAD 2JI7A 5GPBA 3KX2A 3G8CA 3PHGA 2HQBA 4Z54A 4P0QA 4DFPA 1GUDA 1E6KA 1NJSA 3HNRA 4MS4B 4TPKA 3GCWA 3VV3A 1G5HA 1H4TA 2K87A 4R8UA 3TD9A 5CVEA 1PWHA 1ZIOA 2HHHB 5M3BA 2AVNA 3U1BA 2SECE 4CIXA 1HFKA 1SUAA 3BQ7A 3IO5A 3GRUA 1Y1KE 3JU3A 2VNJA 1GZVA 1THGA 3KEQA 5JMTA 1I0IA 1KH1A 2Y0PA 1NW8A 3RUEA 2LPMA 4XQ0A 1YB4A 3HUUA 1HQCA 5CB4A 4ACOA 2F2AB 2H7CA 4D5EA 1MT0A 4D25A 4BLPA 3EIEA 1P4JA 2A59A 2E5SA 1ULUA 2CCGA 3K2BA 4DDWA 5J4HA 3NX4A 3JV7A 4ZI2A 3SIRA 1KDPA 1P19A 1Z62A 4C8NA 2BMVA 2QL5A 3K09A 3IV9A 1JU9A 4X3OA 2DXIA 5L3SA 1OC4A 5F23A 4K9DA 3CKYA 5BSWA 2ET6A 1JYEA 1R9MA 1U5BA 1HDCA 3MLBA 4NPCA 2AI2A 2OGUA 5IT9A 4KO1S 3MWLA 2Z8YM 4BJ1A 3BQTA 4AP9A 5J0SA 3FPFA 3TB6A 3OCWA 4E33A 3HEAA 2W98A 3WA6A 1FP4A 3EDRA 4IO1A 4QRHA 2A2ZA 1PNOA 5B2ZA 2Q4BA 1E20A 4QICA 2B78A 4G86A 1Q17A 4GQIA 2OZKA 3AM9A 5L4LA 2GFIA 4J9RA 1O9GA 3WV5A 3ZHYA 2CXOA 3A6ZA 2IU4A 1XZJA 3BWVA 2KJQA 1E4OA 3ND8A 3D7SA 4QO7A 4B4KA 1DKRA 1T4GA 2J6UA 1JIVA 1NYQA 7ICFA 2DQYA 2XD9A 3E70C 3OM8A 1SUCA 1AO0A 4K6KA 4QNLA 1JQKA 1DAPA 1PIWA 4NV3A 5BR8B 4ZT4A 3U0BA 4DMLA 4PX5A 1GKIA 2XB4A 3C14C 4PPFA 1G16A 4IJ6A 2FR1A 4B9TA 5C46F 5J2CA 3DF9A 2XYVA 4Q0MA 1AM4D 4FFWA 4MTLA 1UBUS 4X84A 1KDVA 2CUNA 2YDXA 4GM0A 2WAXA 3RSGA 1LPBB 3S29A 4B3JA 4XIGS 5LM3A 1KJZA 3RRMA 1I3CA 3GP8A 1U0OC 3D8SA 1JFTA 4OG2A 3NVMB 2IYVA 3TQQA 4L74A 3ZKWB 4NICA 5CDYA 3K5WA 4D97A 2EZXA 5JAQA 3UFBA 2CZCA 3R9XA 4R0MA 4DW8A 3VSEA 4GFJA 2RSLA 3FYUB 5FLYA 4G97A 1JJ7A 1FUEA 3DAYA 3N07A 1LDBA 4LYFA 1V11A 4MHSA 4EP1A 3IG5A 1X6IA 4KQHA 3L0BA 3D5EA 1X1DA 2RI0A 2BGRA 5HR7A 2NX2A 4IOKA 2OSBA 3GQCA 4MS1A 1DBQA 1NASA 2PSHA 2EWWA 1Y5RA 2IUFA 1M2VA 3IJPA 3TTTA 1CDDA 2FFAA 3I9MA 3RS4A 4B32A 3I5XA 3PUIA 3D02A 1ZQGA 3R6TA 3RYCA 5JI3E 1YS7A 3IHWA 3QEMA 4OXYA 1SWWA 1BSVA 1KW4A 1A04A 1COWD 2CMFA 3V46A 3UMGA 1E58A 1L4HA 3PW2A 1R0BA 3CBGA 4NFSA 3RU9A 2VHVA 1RMTA 4CT0A 1SU4A 1KKLA 1D8YA 2DJ5A 4YPOA 2WP8J 4PYRA 4JX9A 1TKBA 3BIWA 5KNLA 2MA1A 3L7BA 3NHJA 2ZSEA 1ISMA 3LLUA 5E1OA 1QB8A 1YH3A 1NJZA 1LSUA 3JQAD 4OAOA 2Q5FA 2E4VA 4UUNA 3CNQS 7AT1A 3IERA 1X1QA 4M0DA 5FB3A 3T5PA 2F1RA 5F76A 4MV5A 2AK3A 2XQKA 1U4BA 1DAGA 1SUEA 5SY4A 1NX9A 1N34B 4QODA 4YMSA 3HUDA 1JG4A 3AJ8A 2JANA 4FX5A 1NJ1A 4M76B 1KVRA 1B76A 3QUQA 5A0LA 1LD3A 3BQNB 3FGNA 5G40A 3V32A 1L3SA 4PINA 4J9KA 2CLFB 1GG5A 4RJIA 2W6ID 1BA2A 1JN0A 2Z9DA 3OKAA 3R5HA 4X61A 4DNOA 3VBEA 4ZTUB 1UIMA 3PTZA 2W70A 4BGVA 1P7WA 3GEEA 3O8LA 2YXPX 4GXIA 4PZ9A 4PFKA 5FCDA 5HBGA 1H3FA 1LVHA 4B2IA 5HHIA 1AH2A 1C80A 1NXVA 1E1NA 2EW1A 2YJZA 2DQSA 2WAMA 5JH7F 1SZJG 1QF6A 3EQ8A 2FMUA 1Y3HA 3WFJA 5HOQA 1JNXX 1EX6A 3OJCA 1KMIY 1DAFA 3G8DA 5DLYA 3ZY3A 3NHRA 1MEJA 4UDXX 3PQ3A 5JJIA 1V1MB 1V6SA 2XB8A 5D6NA 3RWBA 1NA5A 4MINA 1Y8RA 2C8VA 4CCHA 3P7MA 1E8DA 4KLSA 3DKRA 3RRHA 3R0XA 5GVSA 1KO7A 3FVTA 1X7ZA 3MJ4A 4HDNA 4KKXB 2G1AA 1N2CA 4HZIA 3WRWA 2BH2A 2B37A 1W93A 2EGGA 3N2IA 1PR3A 5GONF 4JQYA 3VR6H 3T15A 1J09A 2UVPA 2C0PA 3EXIA 4OIMA 4JZYA 4ZO7A 4EA7A 4ITRC 5I4BA 2GN6A 1VLZA 2JFOA 3IBSA 3K5PA 2IDZA 3UJPA 2A0XA 4HBGA 3WTBA 2QP3A 4G0UA 2IYNA 3JYOA 2IU3A 5B37A 5K3FB 1YGYA 2QUJA 4EW6A 1LSSA 4NLBA 4IHQA 3DXFA 2VDLB 5FUBA 4JUIA 3FR8A 4I9NA 3A1NA 1U2DA 1NUUA 5HIMA 3WOHA 1O94A 4TT3D 5KYWA 2BGJA 2XWQA 2A3VA 3FVWA 3T5DA 3RU7A 4FM9A 1K4YA 2VUHB 3NIWA 2WF6A 2ZWVA 1KJNA 1FMTA 2BEWB 3F6RA 2ZIVB 1WEHA 2XMQA 1Y33E 1VE3A 5A0FA 1ZNWA 5TPZD 4JJGA 3WP0A 1EXMA 2QJRA 2CDRA 4UDYX 4WN3A 1YZYA 2FPSA 1ITZA 3I0MA 1JA1A 1MB3A 4V0RA 3I9LA 1LB2B 3BREA 4GI7A 3ZWQA 3OIWA 1UMDA 2VF7A 1XA4A 1J2RA 3SGLA 5I8WA 3LECA 4C0AC 3IKLA 4B81A 2W5UA 4YAKA 4BRSA 3MINB 3R09A 5BR7A 3TNYA 3TSZA 1KJIA 4AJKA 5IDVA 4D56A 3ZBPA 2JA1A 5DBGA 5DISB 4IEIA 2Y0DA 3GCZA 2TRSB 5EKXA 3TW0A 3GUCA 2G7ZA 4AB1A 2BFCB 5IJWA 1JEQA 2QQFA 5KT3A 5DDYA 4AW9A 4F4DA 3WJ1A 2PV7A 4TN5A 2G1PA 4BX9A 4I4NA 3MUNA 1RQPA 4J0DA 5KYVA 3ORRA 4OH1A 4U2DA 3TZ6A 2GHRA 3NNDA 3SZGA 1WU8A 2XF8A 1NVAA 2AFHB 2OHHA 3FJYA 2Y1FA 4DA4A 2O2IA 3QELA 5F1KA 2AIRA 1M6NA 1R8SA 3GLHE 1J8QA 3OZFA 1WUDA 4ZZ3A 5BV8A 3L7DA 2SKCA 3DKPA 3UKOA 4DYDA 3U1TA 3S5UA 3ITKA 4UHHA 4CQMB 2LE0A 2VK4A 1RSZA 1Z34A 3UG7A 1RAHA 1A9XA 1I2AA 5F9MA 2W2KA 3LXMA 4LSMA 1AV7A 1U3GA 2Z2KA 3KEMA 9ICFA 4WNYA 3AUYA 3GJRA 2HMXA 4ECSA 2G80A 2ZSUA 1PUIA 2AR7A 2JFYA 3VM6A 4BQRA 5AW4A 1IXSB 2DPJA 1IOVA 3B3JA 4O59O 2HOFA 4NPAA 3GEHA 3D8HA 1TJ4A 1XFAA 3BWCA 1TQ6A 5CK5A 3H9GA 4NL9A 5MFPA 1EXDA 1Y80A 4M1EA 1XQWA 4M83A 4TS1A 2FE4A 3JXEA 1O1YA 4CKWA 1JEYA 1DKNA 4R54A 4TXMA 2P9FA 2WBLC 3BXFA 4UNNA 3SS8A 2IELA 3RVOA 4DSUA 3QKUA 1XTJA 4PQYA 1LDMA 2BP7A 3ZJYA 4RTMA 3PA8A 2XJ9A 3EMBA 3LHSA 1WUTA 2AOVA 2H2AA 4GBJA 4IDEA 1UP7A 1G55A 2FQYA 4KRYA 3AKCA 4QUEA 3RLIA 3ZNPA 5IJXA 1NLUA 1YUNA 1RQNA 3O1JC 4XEHA 3EXG1 2MYNA 2Q9AA 8ICCA 4QJ3A 4FPXA 2O20A 1OH7A 1DC8A 1NK4A 2AEJA 3SXUA 5JQGF 1L5KA 4HB3A 2WDZA 5BVGB 2OAEA 1KKMA 2WDPA 2HU7A 2WQZA 1QH1B 5ICCA 2X77A 1X19A 1N5RA 2PLNA 2BH9A 1WXHA 5ITZA 4F4UA 2X42A 4HDMA 1ZM7A 3MRTA 3OESA 1HTBA 2C2YA 1G8SA 5H2FU 3O74A 4IZHA 2R8ZA 1PT5A 3EVZA 4M1ZA 1YZVA 1JT2A 3GDOA 3IEPA 4WKPA 4YXFA 3IV6A 4M89A 2C3MA 3KR1A 3HV2A 4GXNA 1W4LA 4Q7EA 4DLEA 3L8CA 3QMMA 4RFVA 1XTIA 1WBDA 3VNUA 2YMQA 3CV3A 5BUQA 4P7FA 1IIRA 4BMYA 5G0WA 4OIFA 7MDHA 2ATLA 1BFKA 1T9ZA 1NV8A 1XS9D 1PFVA 5EESA 5J47A 3AHEA 1UC4B 1WCYA 4MRMB 3ANTA 2TS1A 3P9CA 4A1OA 3OOSA 4ZAFA 3TEMA 4A2WA 3BGVA 3MS2A 2R7KA 3BCUA 1OZHA 1RXUA 2BKUA 4IS7A 3VR1A 1GGMA 3RJJA 3SXPA 1A2KC 5LZ2A 2W6PA 1Z8HA 2XPCA 2L42A 1I51A 3X1YA 2I62A 1SOWA 5EXTA 1C4OA 1W36D 4CEIA 2AQIA 3CN7A 1X9GA 3ETJA 4AUNA 1U0BB 4IEFB 5AKKA 4YA6A 1QORA 2PMDA 3T3GA 4XDZA 2A0WA 4G1CA 5FYDA 2O4UX 4C04A 2E3TA 1WIWA 3TZKA 1ZUNB 4RD4A 2FHPA 2GO7A 1TT5B 2C4MA 5JCZA 2MMGA 4DLLA 3P0FA 1ZBQA 4O1MA 2GJAA 2R1VB 3V8QA 3ZWYA 5HQ3B 1P4AA 1K1QA 2VIXA 1T2UA 1VJDA 3AT1A 2AQHA 2Q5LA 3CUTA 5AVJA 5EIEA 3N4MB 1KFCB 1PW5A 3WQSB 1DARA 4AMVA 1Y1LA 2H18A 3ON5A 3IUPA 4KDCA 3ABIA 4C4AA 1PUJA 2C9MA 2Z08A 3MM4A 3BE6A 3VZBA 1JHPA 1WEKA 1LKYB 1OGYA 2YHSA 1TD1A 1XMXA 3DD1A 5DW3A 3AU2A 2E5FA 4L5IA 4R71A 4JLAA 3WDMA 1MW9X 2AJLI 1Q84A 3DH0A 3K32A 4LYJA 5AP9A 4C3VA 3TL6A 4ZCMA 2ZR7A 3URKA 4B6SA 3NV9A 4WECA 4BBAA 2G9RA 4KB5A 1P2GA 4OB8A 3F2CA 4QDZA 3TWOA 1TU0A 2EHJA 1GGFA 3BBLA 1TO1E 5EHZA 2C2EA 3UMMA 2WB1C 1BW9B 3WLTA 5A04A 3WK8A 2A0KA 3IDAA 2ZULA 2OGWA 3A2MA 4NG5A 3BWEA 2XY5A 1IHDA 1SBQA 3WMGA 4AYBF 4M9GA 4KI7A 4X97A 2ECPA 4NNJA 1TQDA 2VJBA 1VBFA 3KFXA 4H35A 1ZETA 1CQIA 3C29A 1WQ4A 2FSSA 4HAYA 2XODA 4IOMA 4MUYA 2GMWA 7ICPA 3HJCA 5E2IA 4DQXA 3NU1A 8ICFA 3P27A 4QXQA 1QVVA 2YHBA 4MYHA 3T1QA 4Z0TA 3UO8B 2P2ZA 3HXOA 5IHPA 3W1WA 1J2JA 4HUJA 3RJMA 3V7YA 3G0IA 1ODSA 5JWHA 3W5HA 3JARA 3SSAA 4EUSA 3NTOA 2AFVA 2VIIA 3BE4A 2Q1XA 2WYVA 3FSJX 2MUTA 1LZKA 2HA0A 1NBWB 3A3PA 3LBIA 4G0YA 9ICVA 4LECA 4CR6A 5BN1A 2QX7A 4XFDA 1QKKA 2ONYA 2L2QA 2R6AA 4QE3A 4GOMD 3ZWMA 2PKXA 4UD2A 4P58A 4PHCA 2ZWOA 1LJ8A 1SPXA 2GEJA 2CVQA 3HO8A 3MN1A 3DTVD 4KGZA 2KZ3A 2E5WA 1X1EA 2OO5C 1NTRA 3N2YA 5E3JA 2GD1O 4PX3A 1VPTA 4U2KA 4JJFA 3I2HA 1J8FA 5JYBA 1GDHA 3PKJA 1YI0A 1FIQA 1R4ZA 2CVZA 2O7QA 3LYLA 5BYKA 1F9EA 1XGKA 2R6ZA 5BWNA 1Z5VA 2FDRA 3PXXA 4X00A 2HU5A 4Y6RA 1ZMBA 5CDFE 4DXDA 4A6EA 1QK4A 1Z6GA 1WNFA 3JVIA 4O4IF 1KVQA 4DLWA 3RVSA 1CQZA 3E3MA 1D5CA 3NEPX 4NHOA 2M0NA 5C51B 2JJQA 3ZY5A 4BUZA 5I7AA 2JBAB 2RAUA 5LDHA 5F9NA 4X41A 4E5VA 5LVAA 1LNQA 1OLUA 4DFJA 4TSKA 4B8YA 1NVVQ 1YFJA 1AKMA 3B12A 3HBFA 4I1YA 4GRIA 2A6PA 3EEFA 3K31A 5TV2A 2RGUA 3S4YA 5J2KA 3N59A 1XE3A 1UBNA 1HEUA 4YDHB 3ROGA 3GIDA 2QMUA 4EI2A 4EO4A 2JCXA 5K3EA 4PN7A 4C4TA 5K9ZA 4YHBA 5L40A 2J46A 3PNYA 3VJKA 1A1VA 1OH6A 4X1YA 4C88A 5CIQA 1M1XB 1B7GO 1JR3A 1EBUA 1EG7A 2FLWA 3T1VA 4URUR 4RNDB 5EC8A 1VI2A 3NTUA 1Z13A 4ENPA 4H7PA 2X58A 1E66A 1U65A 1GKLA 2POCA 1BAPA 4W8OA 4W5RA 1XQ6A 3AEQA 4CEHA 4PGQA 3VH4A 2VL7A 3HKBB 4ZQIA 3GRVA 4JVMA 4ND7A 1ZN7A 1UM9A 2E37A 2P2CA 4DCMA 3F96A 4KNYA 4XUDA 1H2AS 4FJ0A 1OUMA 4RQ7A 1G8YA 5NLLA 3I53A 1QK3A 2AUNA 4I5DA 1S02A 1VA4A 2YVAA 1NI4B 1OIVA 2YRWA 4QYWA 2REBA 4WBSA 5FTNA 4F3YA 2KICA 3OPYI 4RZQA 3USCS 2PCLA 3WLHA 1GQFA 3TQSA 1VP9A 5AD1A 2NTVA 1SVKA 2BDPA 4R4JA 3KO8A 3E4CA 3N53A 1CJCA 721PA 2A94A 1SOUA 1XU4A 3Q8PB 1U8ZA 1O89A 2OUKA 1UFVA 3E9CA 4JBIA 1LDYA 2OBMA 4BIIA 1DAEA 5CD9A 3JQ7A 1ZVVA 1F8XA 4IUYA 2QORA 3DV2A 4NU0A 4XQCA 3LWDA 1Q21A 1WSDA 1PVDA 5IARA 3RJHA 1XO1A 4DMMA 2ZJ1A 3WK9A 2APJA 3KDSE 5IUKC 3TVDA 1T1EA 3H4DA 4E0DA 2QT9A 3VNAA 2YW2A 1Y63A 1LJLA 2HNAA 4JUFA 2D5BA 3IKVA 1ONSA 2B2CA 1F5SA 4Z4QA 1YB1A 3N74A 3TMYA 2ODAA 1XNSA 4CIAA 2CGEA 2WD7A 5LFAA 3NDIA 4EZEA 1EUCB 1VGRA 4M86A 2WA1A 3HCWA 3KB8A 1O3YA 2HKIA 4WEQA 3DMHA 4R1QA 3L3FX 3N7PD 2ZU0C 1E1LA 3F6PA 1FTWA 2AJ8A 4GBED 4XZ3A 1DG9A 1VJCA 4IL5A 1FLNA 3FI9A 3FTCA 3VU8A 1B8PA 1V96A 1VJ1A 4HEA1 4NZ9A 1ZGGA 2XDQB 1T9GS 2OZVA 3CG4A 3H3JA 4R2WA 3W1VA 1YZ6A 3T1HB 3REQA 4J0KA 4L4UA 5EP2A 1W0CA 1QHXA 2X4LA 1BMFA 3VH2A 9ICNA 1SVIA 1FFVA 2FPUA 5EZQA 5DM4A 4ZVNA 3K9QO 1UCFA 4O5OA 4QPPA 1T8SA 2ZXUA 3UMRA 2YYSA 1HYHA 4N82A 2ZJ3A 1V3UA 2A5FA 2C5BA 5EIBD 4FC6A 3CE9A 3UXOA 4LOAA 1JSCA 3GPCA 3LCMA 4H1UA 5FUYA 3ASYA 3B3FA 3W2FA 3N8HA 1G8HA 4QG7A 4RJTA 3A6FA 3R3JA 1A7KA 5K3SA 3WGLA 1N2CE 1W8DA 1YMQA 4FXOA 4C21A 2HYIC 5AKXA 4KK3A 4P84A 1W7AA 5KFZA 1ZOIA 4DFDA 2IV2X 3GV5B 2R8HA 1OLOA 1ZHHA 3LGSA 3KC2A 1V11B 2ETVA 3NTXA 5CGZA 3WLEA 2PT5A 1QV7A 2C7QA 3E18A 1RADA 2C4TA 3G5LA 4DWIA 3OZEA 3I2GA 2Z2ZA 3QKSA 4C4YA 4Z6KA 1D2GA 1K8QA 2B8TA 3GAZA 1H2XA 3I37X 1GPWB 4UU1A 5A6VA 5KG7A 5CH3A 4J9QA 2DERA 3STTA 1GNLA 3M9OB 4CPDA 3KV3O 4JB8A 4M53A 4QOHA 1ZBDA 3SAFA 1PWXA 2H4ZA 2Z5GA 3QOYA 5KT4A 4Y3UA 2WIAA 4IG9A 3C43A 3QEMB 3WMRA 1P0IA 3AONB 3ZK8A 4HN2A 5F1OA 4F5DA 2HJSA 3L8GA 2XBMA 3IP5A 5KL8B 5KJEA 2BV3A 3IMKA 5HJ7A 3MR6A 5KG5A 3M6AA 4D4JA 2G08A 3ROKA 1V8ZA 4MKFA 4MICA 1QG0A 4PHAA 3C45A 1OW3B 4AJNA 1U2GC 1D3AA 1TW3A 1WPQA 2O0MA 3I9V1 4FGKA 1DMSA 4X6XA 4A8JA 4WA7A 2EFCB 1QGUB 3HJNA 3HG7A 4WASA 4TOIA 1COWA 1QSLA 4GHWA 3STWA 4BVEA 2ASDA 3S5JA 5FLXA 3ZIAA 2Z1MA 3HY4A 5T14A 1ZQQA 3PO5A 1JKMA 3A70A 2D2IA 2G1UA 3L4EA 4FYPA 2TMYA 3HCCA 4GPIB 4J4TA 1ZPDA 2NU9A 4WZZA 5IUJC 1RHMA 3NTQA 4M1QA 3BE8A 4FHGA 1NF8A 5LR6A 2AUMA 4R8LA 3LC1O 4WHMA 5IBRA 5JO9A 5IIKA 3RYHA 3ZVRA 1B14A 2QX6A 4BLWA 1BEZA 2VDWB 3GCDA 4BQPA 5KQPA 2LYHA 2B35A 3Q98A 3TX6A 2CLCX 5KSOA 3BZUA 4FHFA 4A0RA 4FWBA 3R8CA 1F6BA 2C9OA 4R40A 5TMEA 4C7OA 3GIIA 4NEHB 1VHJA 2QX4A 2K8CB 2D5IA 3EVCA 1Y42X 4ZHQA 5L1MA 3NETA 2FGKA 1RAIA 6REQB 4J16C 3BFKA 1X1SA 4XWOA 1MO3A 3G79A 4FX2A 2OXEA 3RVDA 1EFKA 4XRHA 4EWLA 2ACWA 1LC0A 3MIIA 4OBWA 1IPEA 3V6HA 4DF8A 1U0JA 3GA0A 5EMJA 3ZCSA 4BYMA 1KAGA 1CUYA 3Q7SA 3B3AA 4Y8VA 2DKFA 3VUFA 4UAYA 3AFIA 3F3YA 4MEAA 4MIOA 2YBDA 3KZCA 5LXTB 1Y7TA 3WQQA 1RE0A 5JC8A 5T8KA 4ZEOA 4C03A 3SWWA 2IIPA 2BISA 4XTCS 1M5UA 3W7BA 4AD8A 4YXWA 5EUQB 1BYUA 2PAAA 4H27A 2QB0B 3PO4A 4ZQCB 3NJ4A 4FS2A 3OSPA 1JGTA 5K3FA 1EHIA 1HWYA 2P79A 3ETRA 1K68A 1JIQA 4W5OA 4QZBA 1B6SA 2C2XA 4PO3X 4C43A 1BE0A 3A3NA 1NFQA 1DADA 2CXRA 3HPRA 4CLXA 5DKFA 5K8VA 4O4LB 3TQHA 3U09A 4TYQA 1VI5A 2H1HA 1CUGA 1J42A 1G7TA 3AB7A 3E23A 4XFKA 1HFWA 3S70A 2ZIWA 4I0WB 1T9KA 5BNWA 3NVZA 2RHJA 3P9KA 4K0KB 3NAQA 1W34A 5FTJA 3TAXA 2BBOA 4ZYLA 3BYZA 1FRZA 1M6YA 1U1IA 2BGIA 5TQ2A 4AY3A 2H2DA 1W1WA 2ZRNA 2ZU6A 4X1IA 4NYMQ 1PT8A 1TCUA 3B48A 1GUZA 3TBHA 3SQNA 5A0VA 1XHEA 1T9AA 3PI6A 4HXYA 4C29A 4CXMA 1ZN8A 3T3NA 2NSHA 1SO8A 2EZYA 1DQSA 5K3CA 2PEYA 3WZMA 1X66A 3M83A 5IX8A 1Q50A 4HDRA 4OYHA 3ZR4B 1NXWA 3AUSA 3CINA 1RKXA 3I6QA 3W5BA 2VP2A 2RD2A 1G60A 6GPBA 2FETA 4QXOA 1NURA 4MQLA 1CE8A 1E2EA 1A27A 1P60A 3MSXA 1MENA 4YCAA 5A3VA 3RVJA 3AFMA 2DPHA 2EF1A 2I8CA 5AK0A 2FUCA 1DT3A 5IT0A 1NU8A 3B7GA 3W8RA 1ZCJA 5KWVA 2Q7XA 2OBFA 4K6MA 1DC3A 2G5TA 4HYTA 3A36A 3L6OO 3FWPA 1XCPA 4IGKA 5IYZF 4V39A 2JGEA 2X2PA 4IIXA 4R65A 1VE1A 4G0MA 4WEOA 2GN8A 3H5NA 4HH4A 1DKUA 1Y1RA 1HC7A 3SN6A 1O03A 2DQKA 4DM7A 2UYHA 2NW6A 3AEXA 4U7FA 4UTVA 4GOLD 4JA0A 4MX8A 3ES9A 3LHDA 4F4YA 3EZ6A 1TKRA 2BUBA 4NJEA 5FHRA 2OB2A 3W9SA 3AQ4A 3QKWA 4KLHA 3IURA 1UJNA 3M7IA 3PICA 3DM9B 4JC4A 5FWXB 2V4UA 1PR9A 2VP5A 1L6IA 4WGFA 2QYHA 1CUUA 2PFKA 3H5VA 5J5AA 4BNKA 5DF1A 1XDUA 2W9AA 1DDGA 1I2CA 4PLFA 4XGNA 3S2IA 4YCNA 4BVHA 4EGCB 2WTUA 4DPMA 3GEIA 3FPAA 2O7SA 5CCDA 4P0TA 2FLPA 1QHHA 2AL7A 5AQEA 5G2OA 4BNZA 2B8WA 5FI1B 1KJQA 3EFOB 3GJ3A 4R1SA 3STUA 5JS7A 2XJ4A 3GRRA 5LU8A 4NBUA 2AG8A 2ZSJA 4XVQA 4Q9HA 1S4QA 3PHHA 4JZKA 1BDBA 3HN2A 3FYUA 2IUYA 3PNQA 3DNPA 3Q9UA 3TW6A 1GQYA 1YJ5A 1JJFA 2VZ9A 1QV6A 2A33A 2AS0A 1Q1BA 3OA2A 1L1RA 2HOQA 3PYLA 3R6WA 4G9GA 4F97A 3D54D 5AVYA 3E2PA 4YK7A 1B6TA 1JW9B 4HWOA 5BW5A 1IB6A 3GBVA 2R4TA 1E9FA 3ANSA 2K2WA 3WL5A 2ASJA 4DSLA 1SA0B 2VJMA 3IAFA 4XGIA 4WBNA 1REQA 4TS9A 1JIKA 1WF3A 5BSKA 1X8LA 1BXKA 4OUDA 2XY6A 4UFNA 2QGZA 5DGDA 3REGA 1LV5A 1U6KA 2FSIA 1T29A 2C3YA 4MJXA 3M49A 3PFFA 2D6FA 4O4JA 2X8WA 4QQKA 3K6SA 5ECYA 5FDFA 1IY1A 3W06A 3DPIA 2H07A 4OQEA 2OAQ1 4GLLA 2PFSA 3BKXA 4K4GA 5IM5A 4EJSC 3R41A 1FF9A 3HKDA 4BU1A 1RHQA 3CF6R 2R97A 3FLBA 4GM4A 1A96A 3GBPA 4UTRA 1EFCA 3U44A 1YDWA 2OCLA 2BGLA 1ZK1A 3ESQA 3QH4A 3DMTA 2X9QA 5EZ6B 2Y4NA 4PBRA 1H3EA 2NUBA 4FUTA 3LYSA 2QBYB 3VSCA 3RKUA 1A0PA 3FTDA 1NBIA 4PHDA 3I01M 5KOHA 5KOJB 7ABPA 1OXJA 2CXQA 2GNPA 3I6YA 1LTHR 2YOHA 1KGSA 2W6JD 1DDOA 3ENZA 1S9DA 1AS2A 3S68A 3WK6A 1LCIA 5TMDA 4B9AA 5A5EA 3UQ0A 5LMUB 2XRFA 1JPUA 2CXTA 2O2CA 3E82A 2WHQA 3RB8A 3BD9A 4C4ZA 5CLIA 1BMFD 2HR1A 1YDFA 3JQCA 5HXAA 3CR7A 3GZNA 3IKJA 4FHCA 4MMXB 4WZBB 4MQEB 1P73A 1CR6A 4H18A 1RRFA 1DRJA 1WMDA 1FQKA 2RONA 3T1NA 4BRWA 1ZQFA 1V6AA 3BSSA 3ILHA 4LMAA 5DCUA 1PGPA 3SLKA 5LQDA 1IM4A 1KNXA 3FVVA 3NC4A 4FDUA 4GXTA 4HDAA 4R1PA 1XCLA 3U4AA 4O3OA 3J7AC 4O02B 2B7LA 2I65A 5EHQA 3G5TA 1C1XA 2QT0A 4I3GA 2J3HA 1MRSA 2DFLA 1UPBA 2ZJ2A 3RS2A 2E82A 1E2DA 4I4TF 2DU8A 4KWHA 3PENA 4DHEA 3FRIA 2BFEB 5KEIA 4YB8A 2HB6A 2WUWE 3GIWA 1LQ2A 2VHCA 3OPYA 3EVEA 3K0EA 4KQIA 1EX1A 3DC2A 4B80A 4DLPA 4CMCA 3HYSA 5GGXA 4BXOA 3AI1A 3G13A 5A4FS 4L2IB 2A1IA 1GJRA 3C3MA 4AJJA 4A2QA 4EJ2A 1K08A 4Y7DA 5J3JA 1I3KA 1E79D 4NABA 3FZYA 3AQFA 4ZA2A 5GINE 1GAXA 3AHGA 1OX4A 2OM2A 2H3VA 3DV9A 4R2XA 2HA6A 3JASB 1MOPA 2CXHA 2GBCA 4EJFA 5JAPA 4ZP1A 1SCJA 4JGGA 4EPTA 3VKHA 1U31A 2Y2UA 4WXHA 1DX6A 1GUYA 4M0FA 4G8DA 4WI1A 3D4IA 1V38A 3G5MA 5A2GA 1JNYA 2GM3A 5EJFA 4C4XA 5H1YA 5U1PA 4LRYA 2W2MA 3EFHA 4YN3A 2RJ3A 2BZFA 2QQGA 2V3VA 4R2IA 4BNNA 3H42B 2REOA 5B6IA 4EHJA 2CV1A 5CHEA 3IRUA 2EVWX 3MMPA 3QUSA 3F6EX 3AJ9A 2IKSA 3LCVB 4AM8A 2YOGA 2WILA 5JZBA 2GQ0A 1BVHA 2HIAA 1R9JA 2Q3MA 3TADC 3D3NA 4LC9A 4MXDA 3DMRA 1L7XA 3A2NA 3I05A 4UHKA 2YVLA 1YVPA 4NAHA 2IHTA 3DOOA 4P7JA 4KPYA 1U7UA 4LKOA 2OD2A 5E4JA 3WDLA 5HKKA 4GNKA 5BPFA 4M0CA 5C8YB 3NH9A 4AJ9A 1D2CA 5ABPA 5J0RA 1TAUA 1OIXA 2ZWPA 3JD2A 5JS1A 2D3WA 3LQKA 1NUHA 3TW8A 5CDGA 3SY8A 1PCXA 3U49A 1SHZA 1TK5A 2GK6A 4FQ7A 4JFAA 2WD9A 521PA 2C92A 1Q1ZA 4L5BA 1TE2A 4BNTA 5AW0A 3OLCX 4EJMA 5EE9A 4PRKA 3C5GA 5EWLA 3HEMA 3V7WA 1K89A 3TCXB 2WPNA 3I8OA 5AW1A 1MABA 3DLTA 3RJFA 2WMDA 4D4HA 4NS4A 1H4QA 2E85A 3RC1A 4Y30A 2E5LB 1RTTA 2PYDA 3A4IA 1T6BY 2CLOB 4ZYYA 2CLSA 4MRAA 4BFVA 4ICIA 1XTSA 4MV9A 2JFZA 5MN6A 2WHYA 3QIAA 3R7BA 4BC1A 3PT5A 1QRTA 1I0ZA 1EFRA 3VJLA 1NI3A 2PJRA 2ERYA 4KE9A 2KKPA 5JD3A 4ARUA 1QH8B 1SKQA 2ZTLA 4BO4A 1AKEA 4C7JA 2VKTA 5B7NA 5JCOC 4KFCA 1A9SA 1WCV1 1XPOA 2JEOA 1M0SA 2AE2A 3CRZA 4P5DA 3N2NA 2XZOA 1JKXA 2ZEJA 3CLHA 3KR2A 3RVLA 4FFLA 3TLEA 4AU1A 5IYZA 1SQSA 5AUPB 1S3FA 1OIWA 7ICLA 1CUWA 1N9GB 1NV9A 2H4XA 1C1HA 1EUDA 1CR0A 2DPYA 2WU3A 2YIDA 3K16A 5AI5A 2FLLA 2WHEA 1B2RA 3EGCA 3L9WA 4NESA 4DZTA 3QUAA 1TZKA 4K4HA 3ZGOA 1ZQDA 3KOYA 2AHOA 2JS7A 3NDRA 4LDAA 1DJMA 4Y98A 3P9IA 4PL2A 1CPYA 1XWWA 3L41A 4BMNA 1FUKA 2AT1A 2KBFA 2R65A 2XECA 2YXDA 3EYZA 2X3FA 5H9WA 3BL6A 3THYA 4MPDA 3EPLA 1IPFA 1QPGA 3RUFA 4BMDA 3A27A 1U28C 4JIGA 5HKBA 3ZD6A 2OV8A 2NUAB 3DLIA 4F4KA 1RWXA 4Q4JA 4JJEA 4PX2A 2Z58A 2JIDA 4PSDA 4YO7A 5IMBA 1JDTA 1K7YA 5ARCA 3ENVA 1IXYA 1OXVA 2M1ZA 1I80A 2JH7A 1UFRA 2NZ8A 1TVMA 3BJMA 4LY9A 5AMXA 2PS1A 4H60A 3ILXA 4CM1A 1ORRA 4XLLA 4H1TA 3OQBA 1B22A 3NRBA 2ZROA 2BCJQ 1EB9A 4EAAA 5BW6B 2X9GA 1JPNA 3GYGA 1YE8A 2DAPA 1YCDA 3CT6A 1OBOA 3HY6A 3F47A 4RE5A 2ATXA 2O6LA 4YRMA 3EG9B 1KK3A 2OVBA 3JQ9C 4MDHA 4YUXA 3KHUA 2J3QA 3OWXA 3QYPA 4R5MA 3KKPA 3RI3A 2AGVA 1S7GA 2W7PA 4HV4A 1Y4UA 1NRXA 2OPBA 4R64A 3NBMA 4PLPA 1V5IA 2SKEA 4BRUA 1Y3CE 3RS8A 4NZMA 2OD9A 4QWDA 1AMNA 1E1YA 3Q85A 2QRQA 1M5RA 3CLTD 4QPJC 2XLCA 2YNMA 3H9BA 3HR4A 3NIFB 2ZIEA 4HVTA 4E1AA 4OJNA 3KJNA 3K5IA 5HZGA 2GJKA 4ND6A 3NKLA 5CT8A 3EFEA 1M2WA 2KWIA 4CMGA 1EU1A 4HEHA 1QX4A 5AJYA 4EATA 3NR2A 1ZIPA 4PYJA 4ZMRA 1L7NA 2RBGA 2NYVA 1HLDA 4MJ3A 5ITWA 1N3BA 2QJWA 3HACA 1CRQA 1XTQA 4OFBA 4PWZA 3UJ9A 3L8DA 4LRTB 2J0UA 4KO3S 3R8XA 1R6AA 2C2OA 3T5MA 3ORYA 4EHHA 1YS9A 1MHPA 1UDWA 5H8WA 1CETA 3LOPA 2KW5A 4O3SA 2PL9A 3R3UA 5EFOA 3T1OA 4YJKA 2F77X 3LD9A 2CVHA 4JDPA 4XWYA 1W44A 3ZY4A 4AX4A 4CF5A 5L3QA 4DR2B 2BTOA 1RZVA 5FPPA 2JJ2A 4GL2A 1ESNA 3WO1A 5EHIA 3ZD8A 1KS2A 5EINA 2G0AA 2Q45A 2QUKA 3AJRA 2JGFA 4TLEA 2DKOA 4HZGA 2XXAA 2R8JA 1VB5A 2WAAA 3B6JA 4XJVA 5J0UA 3DDNA 4Q18A 3T5GA 3KJQA 2QQ0A 2IBTA 4Q4HA 1A2QA 3FDFA 2ZB3A 4OSEA 1JAZA 5FI3A 5LB4A 1AQIA 4YRZA 4CG2A 4QU8A 4UM9D 4F72A 2AZXA 3TE7A 4FKZA 4D2IA 2BHNA 1DC5A 1UDRA 4MIEA 2DH6A 4N0DA 4YJDA 5L7YA 2IZOA 1BWSA 3B82A 4JLKA 4OJYA 4RC9A 3ZE8A 4YUWA 5BWBA 3N3BC 3QFRA 3ZE0B 2N46A 2VRCD 2VTEA 3AVTA 1AKTA 1QIEA 3P2OA 1GL9B 4AY2A 4MGHA 4YMNA 4BX2A 2F43B 2GD0A 1ZKDA 2JFGA 2LKDA 3WAGA 3DHWC 2PKYX 2GERA 3QWIA 4CGZA 2HMVA 4MHVA 5K3BA 1Y4ZA 4GC5A 4RDCA 1GG8A 4I4LA 4FYJA 5G53C 2AFRA 2LDBA 2J4FA 2IUSA 2PZBA 3LRTA 3RH6A 5C8DA 1FXSA 4M1MA 1JI3A 3AUFA 2J4CA 1X13A 2C1EA 3A58B 1LBTA 2ZRLA 4NKRA 1PVQA 4WJKB 1IN7A 1M34E 1PJCA 5D46A 2NZJA 1NSTA 3M3PA 1NNUA 1UBKS 5KG6A 4I2VA 3VOBA 5F7OA 3CKLA 3C1TA 3MELA 1Q3UA 2CV0A 1O6CA 1PDWA 3L7AA 1DEKA 5CFQA 1Z4JA 1B2LA 3L1JA 2KZZA 2Y6UA 5ENDA 2FQXA 2NSLA 3TDKA 3IE1A 2PVSA 4LFAB 1XWFA 1OU4A 3G68A 1VLHA 3MYYA 2WIDA 3IJEB 3O9ZA 3ZU2A 2HF2A 3LPNA 3RIMA 5KNCA 4L0MA 4H7FA 1Z4MA 5GONA 3EWAA 4FO6A 3IT3A 4NDNE 4AJOA 3C39A 1KOLA 1E8NA 1E18A 1UBRS 1TVCA 3LHIA 4XJSA 4QDXA 5IDXA 1NAHA 1S0NA 1WSAA 4FZVA 1ZQEA 4DQQA 1SQ5A 1V2GA 2BMWA 1Z73A 2IYFA 2FZ4A 4YP5A 3ISVA 1Z5ZA 2D1TA 1K0UA 2R8PA 2Y68A 1WAMA 2VPQA 3A9CA 3TJZA 4D4IA 4DQDA 3T8YA 1L6NA 2HY7A 2KJ5A 5E7MA 3QLVA 3RSHA 3L6DA 1RWOA 5AXCA 2DFNA 3ERCA 4PYMA 3N3AC 3QVTA 1SCNE 4H0FA 5H3HA 4N48A 3UW1A 4BZXA 4OYRA 5HVNA 3RS5A 1QR2A 7ICKA 2XGPA 1IEXA 2K7ZA 3PX2A 2QI9C 4BP1A 3F9CA 4EL5A 4P32A 3WLAA 5KQMA 2X5NA 2CHEA 1EEXB 2DECA 3VSDA 5HUJA 3DMPA 4CKWB 4DB2A 4WK4B 1QV9A 4QNRA 2ZIUB 4P0QB 4DM4A 5K4GA 2IXBA 2HSWA 3A1CA 2CFSA 3ODPA 3U17A 2GLTA 3W05A 3UJNA 4KXWA 3B9JA 2HV9A 4Q44A 3D0KA 4LGMA 3E8SA 3JYNA 2H4FA 4KPFC 1FEZA 1ONOA 4MV4A 2ZLBA 1Z4IA 3B6EA 4PYOA 2PJUA 4I6EA 3BBPA 3DPUA 4JVNA 4CDRA 4B9EA 3NWEA 1XVIA 3MWDB 3U4DA 4ALKA 5CB4B 2KVCA 3Q8WA 1MDFA 4B33A 1GUAA 1NQOA 1T4BA 2AZMA 1G3MA 3UAVA 2GOLA 3HGMA 2NP7A 2GZMA 3SKXA 3WS7A 2P4QA 1E99A 4LAFA 1AKNA 4Z9AA 4BAGA 3KZNA 3QVGB 4A6XA 1M8KA 1ZUWA 3HJBA 3MGBA 5AHOA 4DCGA 1ADFA 1C3OA 3IT1A 1BJRE 1SXJB 3KLMX 2WJJA 1A7UA 1Y8AA 4J91A 5A9TA 2VJOA 1EZ4A 5CFZA 3O4HA 2C95A 2EERA 1OY1A 4Q48A 2WIJA 4UU8A 2R25B 4FOTA 2ID4A 1E7YA 3DEJA 4QYIA 1EJ2A 2WVHA 2ZUCA 1KDRA 1T8YA 1DPFA 3B2NA 4MVJE 3ICVA 4Q3BA 1SHKA 2YQEA 1JE0A 3CF4A 3PW7A 2X4DA 3AR6A 4GH5A 2C9DA 5FTKA 3DWEX 3K1AA 2VH5R 2W9CA 2I3GA 4UUOA 3AFNA 4B79A 2GDZA 1FLDA 2XNSA 5J23A 1JLKA 2VQSA 3EGVA 1GPYA 1ESEA 3QZUA 1RACA 3G9TA 3C8ZA 3PRHA 2PX0A 4UBMA 5F4ZA 4C3UA 4UTPA 4F4XA 1ID1A 1XJ0A 3ETLA 1UQVA 2J8ZA 2PRJA 2X8AA 2WB4A 3FETA 3M6LA 3OT1A 1DZIA 2G1JA 3JSAA 3MT7A 3PVCA 4LYYA 4DKJA 1C50A 3OIVA 5IC6A 3ZD9A 3H84A 4XTRA 4PC6A 2PM8A 2DQNB 4H7JA 4IRMA 1YK1A 4RUAA 4B3HA 4YV2A 3W8FA 2ZIFA 4ESOA 3BS4A 1YSCA 2H9IA 5IUNC 5K0JA 3OLVA 4JAVC 3ESYA 3HA5A 2HO5A 4S2UA 4I2IA 1YONA 2B20A 3FMIA 3REQB 3UPDA 4UMDA 3PGKA 4PQRA 3IUYA 2EFGA 3FZEA 2VUSA 2Y92A 1OLSB 2HWKA 1AE1A 4QWMA 4UOZA 1KMQA 1SBZA 1YRLA 3D1LA 1QG6A 1KY3A 3HJTA 1TYAE 1UXJA 1JG6A 2I87A 2ASEA 3GA7A 3ISJA 3WR5A 5BSEA 4BFUA 3AI2A 3NANA 4Q01A 4BP9A 1C9KA 2J0VA 3HCFA 3OCCA 3KD3A 2CF5A 1JMYA 2W58A 4BQEA 1Y6QA 2FOIA 2HMYB 3JQEA 3OM9A 4K6OA 3GVPA 4FE3A 1HDYA 4LQ4A 1GHTA 4ZOHC 3ZYZA 4IDAA 3GQVA 4F7DA 3JQAA 4V1CA 3ZN2A 3BT7A 2HN9A 4R63A 2HL6A 3INGA 1SU7A 4B2LA 3RC9A 3GP3A 4EF5A 2PK3A 4JC8A 2RKOA 5BOSA 4U63A 1DTWA 3I1JA 2QPOA 4IMIB 4IMPA 4B47A 2R8GA 5B3JA 3EASA 2HUPA 3MS4A 1QC5B 1M1NA 2SCUA 1W96A 4I8XA 2J6TA 1XZGA 4JLMA 5I9MA 2Z3VA 1O77A 3QKSB 2G1KA 2G9VA 3HLYA 1RZRD 2E48A 1YZ3A 1T36A 3M6IA 4TTSA 4C5CA 1FJGB 3WBFA 2WVGA 5C9ZA 5L4NA 2ZJ4A 4OQ4A 1GL3A 4QDOA 2IPOA 5JC1A 3C6QA 3OT4A 2RI6A 3GFBA 2JVJA 3MUOA 3K6SB 4KV9A 1DU4A 1TYCA 4PGAA 2WFLB 4JI0B 1OZGA 4LQLA 2ZXFA 3OZDA 2Q4OA 7REQA 1SULA 4MULA 5G0VA 5KZMB 4JV1A 1DRGA 4B7CA 2KLBA 4GO1A 4IRXA 2KD1A 1XHLA 7ICGA 3QTLA 1RCTE 1WUKS 2Z5LA 4JB0A 4FFNA 2WTEA 2Y0EA 2MSNA 2GJSA 4KRFA 2Q9UA 4YJGA 4ED6A 1P7ZA 2EKQA 1VOTA 3RRBA 3RQIA 4HRYA 5K20A 3BDPA 4MWDA 2OK7A 1JEAA 3OQMA 4F5WA 4BFYA 5ALEA 1M6EX 1JLRA 1IAVA 2ORIA 5H3LA 1P31A 3ZW7A 4A6DA 3VPBA 1U0GA 2KHQA 1MQAA 2BR5A 3EYWA 1TCVA 3DBOB 3G2HA 2NRWA 3H2ZA 3HY3A 3OLQA 2LP4Y 3QA9A 3R20A 2W2PA 1A82A 1P2VA 2PGOA 3FSEA 3LVBA 3SF0A 4DIBA 3T1YB 5IK2A 3TL2A 1P62B 4NCBA 3EH2A 3C1AA 5ADHA 4L0CA 4DY6A 4F60A 5BQ3A 2HF9A 2PR2A 1SZDA 1J6UA 3INTA 1N2SA 4RVNA 5H70A 3PSPA 1UT6A 3OY7A 1F6WA 4X3CA 1IXKA 3C3PA 3TRIA 3SP1A 5CHGA 2OLEA 5FNZA 1WWUA 2ZYVX 3RW9A 3I76A 1H2YA 3IP8A 1DNPA 1PFGA 3FUVA 4MGYR 3IR5A 3VVMA 1M2OA 4YCSA 1I7DA 1FUIA 1W0KA 1G42A 1GPNA 3WMWA 3HV0A 4LFBB 4AMYA 1J24A 1Z19A 3CEJA 3U19A 4BEVA 1YB7A 4P4OA 2Q6TA 3GFGA 5JCOA 1BRMA 1QKJA 3TN7A 4A3SA 3S1SA 3CRRA 1W76A 3GJYA 3Q8LA 2DFKB 2I9PA 2Q9BA 2EDUA 1TNDA 2HA7A 3FDJA 2AUTA 3KVYA 3OPYB 3L6CA 3V1TC 3F98A 2GEKA 1JBQA 3AVVA 2RH9B 5CPBA 1GY8A 5ALZA 4NF2A 3E81A 4RLHA 2Q29A 4C0KA 3NWJA 4DADA 1JVNA 3Q3EA 1KSHA 1IWOA 4IXTA 1II8A 3W1EA 2EQYA 2GSDA 4OJPA 4CMBA 3GT7A 3MIZA 3FTEA 1VG8A 3H1BA 1JE1A 4KLDA 4ELTA 1R0LA 1YHNA 1ZWLA 4BQQA 1HT1E 4QZEA 4Y2RA 3LWLA 1V0JA 3FPJA 3OD5A 1MX3A 2V9WA 1N63A 1MQ9A 5FOTA 1Q2XA 5CX1B 3TVYA 3U48A 1S0UA 4ZZIA 1OZ0A 4J29A 4LXHA 3O1LA 1LXCA 1HEYA 4J6FA 4MVJD 2ID7A 2GWHA 1JG2A 5B36A 4RHUA 5BRJA 2F8TA 5EE1A 4DS4A 1JH8A 2NIPA 4CV0A 3K9WA 1H8HD 4CBVA 4HNQA 2FG5A 4AY4A 3PSFA 3HCDA 4BO3A 1S2OA 4GF5A 4MP3A 1X38A 4WFQA 4RQ4A 3MUFA 1JI7A 4PC3A 1NVXQ 2GKSA 4B48A 1LLCA 3L0SA 2ORVA 5F3WB 4TMFA 1TUBB 3GZTB 3KLPX 2R7MA 3EGEA 4KQCA 2WU8A 4HDQB 5CRIA 4XOUA 5KG3A 3ZCPA 5KB3A 4MAFA 1P0MA 4G1UC 5B1EA 1ZK4A 4O3QA 3MBKA 1RI1A 3HSSA 3A9SA 3NT5A 1WXFA 4RV4A 2AFHA 5DLDA 2C5AA 2O2JA 4PAQA 4JK1A 1D04A 3SAGA 1MDBA 1V5FA 4KH1A 4ZOLA 5D1NA 3TG2A 2VUUA 5D5QA 1YZQA 3MLEA 1R7RA 1CJUC 5KFWA 5CCBA 9ICTA 1Q7RA 1SD1A 1YB5A 3UICA 1WU7A 5D3ZA 2GOYA 5EXDA 5IVKA 2Q8PA 5GM2A 1IEQA 3FBGA 3IOMA 4MQBA 1LX7A 4I6GA 5I9SA 3M6MD 3RWOA 4PZPA 4UZEA 3SQMA 4YT8A 2QU7A 2WD8A 1KBZA 2HU8A 3AFGA 1LI7A 5JZSA 3QF4A 4JI4B 4QNMA 1I4OA 1JDZA 2IODA 3ALRA 2W93A 4UVGA 2QL6A 1PDOA 2IDJA 9ICLA 1C4KA 1LPAB 2QVYX 4QOEA 5CM2Z 2W4MA 4EUFA 4ERXA 5C5DA 3VSAA 2IPXA 2BBSA 2LM1A 4AL4A 1VDVA 1KQGA 2QNRA 1YBVA 4BS9A 4YRDA 2M9NA 2E9SA 3ZS8A 1O0CA 1R6BX 1K92A 4QHSA 5A3QA 4BMOB 2Z4TA 1EUYA 2MDTA 4FS8A 4GMXA 3QFSA 2OCEA 1T7PA 2ZSAA 1ZDMA 2ORYA 3FMPB 4K6HA 3UK0A 2ZB7A 1L5GB 1HH4A 4LJXA 1EXNA 1UKYA 1C2YA 1NW9B 2EAPA 1OXKB 1OAAA 1W8IA 2AG0A 2JGNA 3OQ1A 4YBRA 2NU9B 5DHTA 3ROZA 3UFXB 4HTFA 4AICA 2YL2A 3ZHTA 4QDUA 1R4NA 5CJJA 4CFYA 5J43A 1KKXA 2ZJ5A 4M4SA 2YQ4A 2FRDC 3CH7A 3ECCA 2YWFA 1M7BA 3B1ZA 3IHLA 4PICA 3K1RB 2NU8A 4JI3B 4C01A 4Z4CA 2HJGA 5KTNA 1DFIA 1UPFA 4WNIA 3LIIA 4IXNA 4N47A 2O7NA 3COZA 3H3FA 3WB2A 5HW0A 4EUEA 3FOFC 3PR2B 1W75A 2FXVA 4AFNA 4EG3A 5LYJF 3VYVA 4COOA 1E3QA 2CZQA 4PM4A 1EB8A 3JPYA 1RAGA 3OSNA 3NWPA 1UDAA 3KAJA 2WHRA 3OP1A 3DKIA 4G84A 1ZCAA 4UE3S 4DMUB 5HNKA 2DBZA 4BJ3A 1C81A 4F3TA 5LUAA 4X7BA 2UVVA 1M0WA 1BKSB 3SEIA 2R5FA 2VP0A 1E7WA 2XCSB 2Q3CA 1ZNXA 5G41A 1PEAA 3EEOA 1I7NA 1GGEA 1K8YB 3EGXB 4E6PA 2FE9A 1RCUA 1T2FA 4ZCPA 2C94A 2W8KA 5E38A 3OY2A 1DBVO 1UK9A 2FMXA 3KPWA 4A82A 4XEUA 3ASZA 1WDMA 1U0HC 1OD6A 2P7HA 3S2GA 4KQXA 4ZI3A 4ASUD 2QBYA 1JL3A 4GX0A 1ZMXA 2ZAYA 4L5JA 4QTTB 3RCBA 3UNXA 3OTOB 5H3CA 3ND5A 1IG6A 4WUVA 3O8DA 1U99A 3R74A 2RGNA 1X7DA 3CZMA 3HCRA 3D1VA 3R6GA 4BB0A 1F3OA 5DTIA 4P6VF 3DAFA 2ILVA 5C18A 3S99A 2YVUA 1KAOA 1HSOA 3KLBA 1XZLA 1QP4A 3AKDA 1QYCA 2XNDD 2XUAA 5JFOA 2XUPA 2QRZA 3ZV6A 4P3KA 5DIZA 3I92A 4B9MA 1PR1A 1IM5A 3U4CA 5LQKA 3U37A 2IY8A 1JTEA 3PV8A 3CXRA 4QECA 4JJ4A 3ZDEA 1JDJA 1A8PA 3N76A 1SBIA 1TCCA 3F6BX 2PLFA 3JZAA 4OI4A 3S1AA 5DT9A 4NAUA 3GP5A 5ADVA 2H3FA 4ACAA 2P62A 3VC2A 1PV4A 1XEFA 4U7GA 5KVAA 2A88A 3TRDA 5TXGA 1R1DA 1W5SA 2DQ4A 3HS3A 1NRJB 1RPNA 4OGFA 4O0IA 4ADSG 4DLXA 5KFBA 3V4PB 4ZAYA 5CWRA 5KFKA 3GV0A 4Y0AA 3X1ZA 3KZXA 1ZA1A 4GSYA 4G0VA 2O5CA 2O8DB 3CYFA 5KFEA 5LBTA 1GLNA 4XQ9A 1ADBA 2RGNC 4Y2UA 1G9SA 4EKIA 4QJ5A 2XUHA 2A0YA 2VKQA 3QNMA 1R0CA 4YP3A 4WH0A 4E5PA 5IFLA 1SVOA 1YAJA 3CX7A 3G49A 3ZY6A 4EIWA 2CK3A 1J39A 2VTBA 2AFIA 1GDTA 5LMNB 3DA8A 1TK3A 2EX1A 4P4SB 4QZGA 2YJTD 4X60A 2GF9A 3L0OA 4BE7B 2CB9A 2CPRA 4DA9A 2Q6LA 3JZIA 1B00A 1IZ0A 3IJRA 4Q9NA 3FZNA 3L7JA 4URVR 2EIXA 5KT5A 4YFVA 4NOJA 2GYWA 2A67A 1N5WA 2FUNB 3IG8A 2R1TB 1P2FA 4HZUA 2DB3A 4D0RA 4QQNA 2KFZA 1P5RA 3I3SR 3KPUA 1D9FA 1VE7A 5HBRA 1XZIA 1XDZA 3R7FA 5DULA 3LIPA 4XASA 1ZI8A 1ZGBA 1XRQA 2JRCA 3LPMA 4F8JA 2DHDA 2X5JO 4GMKA 3RBVA 4AJ4A 1ZD8A 1RI4A 3ZWPA 4L51A 5I7VA 4GKKB 5EIHA 3A4NA 2Z6QA 4F6LA 5JVDA 5HA5A 1A9PA 3SICE 3V2UA 4AYWA 4IR9A 4WK2B 4Z9BA 2E6UX 2W43A 4S2EA 1RRMA 4DIEA 8GPBA 3JQBA 3L0PA 2FUEA 2Y6VA 4M98A 1VI6A 5BMVA 5E6UA 5DNEA 1AZSC 3PYMA 1JIXA 5MN4A 3JPTA 2HHUA 1KJWA 3WC4A 1R0ZA 3KHTA 4D8YA 1XZQA 4YV0A 4O5KA 5F9HA 3E2IA 2VRNA 3RBZA 3ICQB 4Q3OA 4KFSA 5LQJA 1J8DA 1DZ3A 3B9PA 3B13B 4FFDA 1VPEA 4G5GA 4JN6B 3LUFA 4DBVO 4B8ZA 1ZM4A 3WK5A 1N33B 4B3XA 1H6CA 1N2BA 1G8JA 1HGXA 2ZTCA 1CR4A 1YC5A 3F4KA 3H5LA 3KXIA 4JC5A 1T3NA 4FEGA 4WFJA 3RU2A 3WYCA 3ZHVA 9GPBA 1I4WA 3D8TA 1EWYA 1YC2A 4BDSA 2PFQA 2MU1A 4Y1EA 2COKA 2GILA 2PSSA 3CLKA 3ET4A 4P34A 4BIMA 4NECA 1DFHA 1JT9A 1PR2A 1CEEA 3QEJA 1TM5E 2QTHA 3IAS6 2VO1A 1Z0JA 1JG1A 2QW8A 3QENA 2ZB8A 3MJSA 4QGBA 3ORHA 4BFXA 2JEJA 1ULAA 2KNJA 4C8LA 4L6AA 5EVCA 1TF7A 1I8TA 3ZTWA 1IZ7A 1BXRA 2X0RA 5EQDA 2M2IA 4EB0A 1I4DD 1XVLA 2ZDQA 4LHYA 2HUNA 4P1ZA 1ADGA 1SFRA 3A9RA 2F1HA 2EQ5A 4DOCA 3OQHA 3BHMA 5FUWA 3L02A 1QVRA 2G5PA 4G65A 3L46A 1V9LA 5KX5A 3R9KA 2B99A 3JAWA 3UPQA 1CY0A 3WQBA 1JA9A 4ENVA 2QSZA 3MOGA 2V1UA 1JHMA 2H8KA 2I4TA 3VR3D 2YCBA 3GMSA 3K9LA 3NVWA 4K9NA 4RHTA 3L43A 5HCUA 4RBNA 3ANLA 4X93A 5I5GA 2YR0A 4BEJA 2Z98A 1LA2A 4MW2A 4PC1A 1HTWA 3DT8A 3KVVA 4Q1DA 1L7EA 3DWFA 3VUEA 3D7LA 2Q2OA 5KKNB 2EAOA 1GTG1 3T9AA 1B3RA 1T2AA 1X1TA 2PT7A 3B70A 3TI9A 4DSAA 3ZK9A 3VR6A 2OGSA 2VEDA 4BE4A 1CRZA 3OHBA 4JWNA 3P2KA 4QBKA 4QU9A 2ZCUA 4KVGA 3HKEA 3GLHB 2Q2VA 3U7QB 5G0SA 4L75A 3ZU5A 3O2NA 2JLAA 3RBDA 2GEFA 2VHUA 1GAWA 1OPRA 1P2UA 2AFHE 2R1UA 3IVXA 1KVUA 3M2TA 1AQYA 3UWKA 2ARKA 3ZWKA 3QYAA 3C1UA 3IBTA 3QEOA 3KETA 3HILA 2R0QC 1YDEA 4E11A 1UWLA 4GVXA 1AUXA 1XD9A 3DDHA 2BMJA 4KBYA 1C30B 2CL0X 2XNDA 4KGDA 4URHA 1Z38A 4URYR 4B34A 5HKAA 1H9CA 2CHGA 3PD0A 2JVKA 5DYGA 2ECFA 2WYOA 4TRRA 5KT6A 4C7KA 4E21A 2Z1DA 4H3VA 1SEVA 4LI0A 3EBOA 3PGVA 5J40A 1ISHA 4TGLA 3QXJA 5FAKA 3BXZA 3VC7A 4YCCA 3V4VB 5BXYA 1NW7A 2NM0A 2O8CA 1PL7A 3LWMA 3KQTA 4GBGA 3DD5A 1NI5A 4RZUA 4S1WA 1YFKA 4O0LA 4RTRA 1LTQA 1G20A 1VCMA 3OEHD 1XPUA 3ZZ0A 5C1DA 3BWMA 1QIJA 1RYUA 2H65A 4MVXA 4KZKA 1MAVA 1ULTA 3BB3A 3HVRA 4H1WA 8ICJA 2RRDA 4N0EA 3V1LA 5JOQA 2M6LA 5GTHU 1X7WB 4REOA 1II9A 3UA4A 3AESA 4X62B 2POQX 3PVSA 2VT6A 2G67A 3KBOA 3E1GA 2YV2A 5AW3A 2ANBA 2NO0A 3JPQA 4U00A 3ADOA 3V7UA 1JZSA 5EE5B 2O8FA 3DFZA 3K70C 3SJBA 4CTOA 2GAFA 3MT9A 3TLAA 4E30A 1LJUA 5JG7A 1OREA 1X1BA 3GEPA 4G07A 5A3JA 5JRJA 3LVRE 3MTQA 5FWYA 4LA4A 3JYHA 5FA8A 3NBFA 3VQTA 3VYUB 1UK7A 2HCTA 2JLWA 1ZD4A 1Y4SA 1SKBA 4YWHA 3JPPA 2YN0A 4LZWA 4MCIA 4NQZA 4MUHA 3BM5A 1L2TA 2P9TA 1ZQYA 4B3IA 1G2IA 2NV0A 4JQOA 4OXQA 3IP7A 3ECSA 1WMAA 1J5PA 2JIPA 3GGPA 4KGXA 4MYTA 2QLTA 4QTXA 3GLFB 3AEYA 1USIA 4KODA 4UTXA 2HHQA 3LVFO 3F49S 3FNIA 4AURA 2O3TA 1NJGA 1JHOA 2X4IA 2XYGA 5TGZA 1AUQA 2PN1A 1TEZA 4ZV9A 1SL1A 3H6GA 4EITA 2C59A 4CMIB 4QM6A 3CIFA 2R62A 3JQGB 4YMGA 5EJEA 3WYGA 4A6PA 2HHCA 4ZVQA 2PI4A 4EI8A 1ND5A 1MA0A 2OENG 4LK3A 5BWMA 3CX6A 1XK7A 2C3UA 4A73A 3ESRA 4RZ2A 4D6XA 2JV3A 1U7ZA 1O4VA 2JKYA 1NL3A 3I73A 3QBVA 3RS9A 2LBOA 5JNWA 2B4YA 3EC2A 1U1GA 4RQBA 3RS3A 4UAVA 1JEEA 2PD6A 3GJXC 2HSZA 4DMFA 2C83A 4RIIA 4WXYB 1T43A 1CIPA 1ZSVA 3U3OA 1D2AA 4FYMA 2XMRA 4FHEA 3SFVA 1EFHA 3SS7X 2C1ZA 5HUQA 5I7UA 3RYHB 2JZBB 4L5CA 3NM6B 4NJOA 1FOEB 1U2RA 2AFIE 3L77A 1P6UA 4QEDA 4CLOA 5H68A 5LKRA 2WJ3A 1KSGA 1X7XA 1XRNA 3UAZA 4XW2A 3KKKA 3HNOA 3C5FA 4RUKA 5DTRA 3THWA 3N5CA 3PSIA 1HYGA 1RWMA 3HCAA 2DBYA 1PGJA 3MB8A 4G4SO 2IYAA 4DLAA 4UDOA 4F2HA 1G3IA 4KPUA 1E0AA 3E3NA 2BBWA 3FUWA 4DO9A 2C54A 1ORDA 3IP9A 2PXXA 5LA6B 2D5LA 1Q0RA 4YV7A 1Z28A 2B92A 2XOXA 2YJ5A 2N1RA 4DEZA 3LFTA 3NGLA 4TRNA 3G1TA 4YAJA 1TTHA 4RU9A 1RRVA 4ED7A 2NO1A 2P9BA 1YK0A 1M2OB 3KJZA 1FU8A 2YWEA 3AQEA 3NXKA 3PVZA 3ZDRA 4BWFB 1QAOA 5IT5A 1CF9A 4B6JA 1VHTA 3AIIA 3D9QX 4M0UA 4R9SA 1U63A 2GZ1A 3U62A 3WIEA 4HAIA 2GDJA 4FZRA 4TZ0A 4OGWA 5HZHA 1I33A 1RQXA 4QLAA 1K66A 2GR9A 2V65A 1AMOA 3BTOA 2WWFA 3REFA 1OHHD 4MOWA 3OQJA 3QLEA 4KCGA 3RR8A 2P7IA 3EA4A 3KKOA 4MVYA 1VFPA 1KR2A 5CH5A 1HEKA 3NNSA 1N0WA 2YXBA 4HCJA 3LPDA 3KEOA 5DGIA 5FLEX 3KVRA 2L0XA 4HMOA 3E2EA 3KUCA 2JGLA 4P35A 5EIXA 2WIBA 1PU2A 2X40A 2GKGA 4DPKA 1II8B 1LSJA 1VPLA 2PL1A 3OFKA 4MO9A 4LVUA 1I13A 2EC5A 2RGRA 2W2OA 4KGVA 5AOAA 5EMNA 5K4AA 3ZDXB 2IDKA 5B1SA 5L6MB 1E1MA 2CW5A 2LRHA 2UZ1B 2YHAA 4FFSA 4R2LA 3WADA 1XTUA 2CLHB 2F4NA 3FPKA 2HCFA 2IWHA 3U13A 4DLKA 4MKRA 1CY2A 2KVSA 1C0KA 1JKJA 3ASVA 4MPPA 1AA9A 3B6MA 3W8NA 3TI0A 5B1HA 5FX2A 4QZCA 3QU2A 1DO0A 1SQGA 3OE7A 2QTTA 3H2YA 4PCVA 3K96A 4PE5B 3TNDA 2JFXA 4X20A 2FKAA 1IONA 3PR1A 4RVOA 5JROA 2QEQA 2PKQO 2ZJ6A 1GZUA 4DV5B 5AM4A 1W47A 3A4LA 4RWEA 2RBKA 1BH6A 3O4VA 1XCOA 2IXDA 2LGJA 1Z7GA 2NZ2A 3B0XA 3T0GA 1W0KD 5SY9A 4FWTA 2GD6A 3SVZA 5K7SA 2G28A 4I1IA 4UEKA 1T3LA 5HQTA 1C9NA 2CRXA 3IT2A 3WB0A 1EAYA 2QUBA 3Q2KA 1JMVA 2X5KO 1N48A 5JBQA 5G1PA 5ALWA 5KFPA 3MFHA 5SY6A 2RB4A 2P2SA 3OZGA 2UXBB 4DNPA 3VI3B 4ECAA 1BVRA 3BMQB 1H0SA 2FMSA 5HJEA 4YJ3B 1GAJA 3PR5B 4HY3A 1YT3A 4MR8A 1VKRA 4ZK6A 2J3MA 2OWDA 2FG7C 2IYXA 4DA6A 4Q9AA 2HJ9A 5G5HA 2AD1A 2B5VA 4L95C 1NIPA 2J4DA 1A2BA 3PF8A 4K05A 4L02A 1UMKA 3UQ2A 2VAPA 3A6EA 3IALA 2H52A 3Q10A 1NJ2A 1SELA 4PBTA 4V0KA 3DUFB 5DYIA 1CJTC 2MYPA 4MRSA 1E9CA 2ZVJA 4S3MA 2P5UA 4F84A 2B7CA 4XYLA 3QHQA 1UPUA 3LK6A 4CMEC 2PUCA 1ZQ9A 1Q83A 2FMPA 2FPIB 3IP3A 1Y8QA 2ZUFA 4ZCRA 2VJQA 5DNUA 3KYJB 3OF3A 4I7EA 3EISA 1BGVA 1P4HA 1YZFA 4OGGA 1ZONA 4BPRA 4BB9A 4ZYZA 1WXDA 1ULZA 2C7VA 4DG9A 2ZM6B 4MQ6A 3PDIA 1N92A 5ER9A 1T9CA 3ZDDA 4Z3KA 2GLUA 4GECA 1RXCA 4XD2A 4OGKA 4XB1A 5HE8A 5HHTA 3AV3A 2PR7A 2JMGA 3FHOA 4FYHA 1B0PA 1CZNA 4G37A 3I0ZA 1I3NA 3BMCA 3CW9A 3Q3IA 2DTDA 3W5UA 1FJXA 2A19A 1MU0A 1PJRA 2F3RA 1OLSA 1PUXA 1GAEO 2QF7A 4FSDA 3VYTB 1QG4A 2WQ7A 1JFFA 2A5YB 1XZCA 2ZYIA 1AD2A 3CSSA 3MPOA 4TKUA 4TZKA 4YP7A 4C87A 5ED4A 1E2JA 4RZSA 1XXHB 2E3JA 2FZEA 4CWAA 4YR3A 4BEWA 1KQFA 2ZJ0A 4DLYA 4HB2A 5CHYA 3WHLA 5L1IA 4OXRA 3UBTA 3LP5A 4J6EA 5ANRB 3GY0A 2HMTA 5KNIA 2V0CA 1ZJ4A 4DEXA 2MSEB 3WK4A 1DAKA 3G2QA 1R3DA 3HP1A 2JK1A 3L9XA 4G24A 4HFRA 4KSYA 4YIKA 4B43A 1JQ3A 4XPIA 2GASA 4MJLA 4PSCA 1SOMA 2G5HB 1I1HA 1XXHE 5FKJA 5ALGA 2PUGA 3KB2A 3AL2A 3EZNA 2QLBA 1KI8A 4O4JB 1TYBE 3THVA 2I55A 3CYMA 2PO7A 4MGZR 3TEFA 4EZBA 1J9EA 4JEUA 1QC5A 5C4GB 2SCUB 2BPGA 3BRCA 1M33A 3PZBA 4TVKA 4LWOA 3ZHCA 3AILA 1A98A 8ATCA 2WSSA 5ETJA 2GF2A 4M8LA 4N6OA 4XVHA 1RRKA 3ZCXA 2ZRHA 3SNHA 1OE0A 3TEJA 1DEOA 3LY8A 3KVNA 4Q9JA 5J0YA 5B3AA 3PNCA 3L84A 4C3ZA 1HO3A 2A0FA 2EJCA 1BMTA 1IUOA 5EIWA 2Z4SA 4UBNA 1GL7A 3OP4A 1E64A 3LDAA 2R5NA 3CIOA 1KU0A 2P6NA 4Q9DA 5BR4A 2BHRA 3MJEA 4RL4A 2XZDA 3L0YA 2INGX 2ZRGA 5DCWA 2FLNA 5JDCA 3LCCA 5I5EA 1FQOA 3D2QA 1NPTO 3BF7A 3OT5A 3NAMA 2FF7A 4MMYB 4D9NA 5CP8A 2FR0A 2KKVA 5FA5A 4EW1A 1QOPB 2Q4EA 1VLVA 4U9HS 2F3NA 5DBIA 3WGIA 4XCVA 1ISPA 1DXQA 2QRNA 2VPTA 4BJQA 1E94E 3WISA 4UM7A 3TLKA 3GGJA 2HMUA 4WLOA 3RUHA 1BQ3A 4X7RA 5SZJA 1B43A 3RT1A 5B12A 3IEIA 3KQUA 4XCXA 2VHZA 4BNVA 3E03A 4CQMD 2C7OA 1Z29A 3PW5A 1UR5A 4J43A 4B9UA 4D8UA 5AKEA 2AEFA 4DABA 4UAZA 2P5TB 5JXJA 2O9JA 2XUZA 4PZYA 5CU7A 3LX6A 3KTOA 4J0FA 4QUDA 1WZEA 4NU6A 1DBPA 4IKOA 4RGVA 1CUSA 3K35A 3OLYA 3NHZA 1VIAA 1Y6FA 2X9VA 1HA3A 1TMYA 3DE5X 1SU8A 1HNZB 4H1VA 3UMFA 2XUOA 4RKQA 1P6QA 5DGHA 3C2MA 3KKNA 1PTJA 3DP7A 3MHPA 1UADA 4HDKB 1TADA 3R3ZA 1P72A 2D74A 1BCRB 1U1FA 1YWGO 2QP9X 2ZYTX 2GARA 3ND9A 2OLKA 5E9QA 4NEGA 1VA5A 3DCNA 3RFFA 3I5YA 3HJUA 4A23A 4ZYUA 3FOZA 4RKYA 2WRZA 5H80A 3WTCA 1YU9A 3OTWA 3V9PA 3DT9A 4U2CA 4YJHA 4AIRA 1Z4NA 4X5VA 4FFRA 2WA2A 3HL4A 4OB6A 4F6RA 5I7OA 4RXMA 4AJPA 4XSVA 2B6NA 2KSOA 1H6DA 3O82A 1AROP 1YS2X 4JNCA 2QIPA 2QNIA 1N8KA 5CNJA 1ZAKA 5KKAA 3NTVA 4B17A 2WNSA 1V71A 4CM4B 5FV4A 4G9BA 4BYGA 1TQ2A 3BS5B 2JHDA 2O5RA 5J5VA 1B8UA 2H1OA 2X3YA 3M6FA 2PYIA 3BF8A 4P4SA 3V8BA 5K03A 5J0PA 4FT2A 1M2NA 2PX2A 2GYVA 3V7KA 4OLAA 4ZYVA 5ALKA 1G18A 1F8FA 3T7DA 1AKYA 3ZQ4A 4F9FA 3DEFA 3GLGB 1O58A 5HUHA 1U9CA 2F6RA 3IEUA 3I34X 1P2BA 4G8CA 5CA0F 2BCVA 3EW9A 5FWAA 2X14A 3QOFA 4M21A 3DFFA 2FPKA 2I6XA 2W9MA 2ZBUA 4UULA 4ZXFA 1SXGA 4ECEA 1TRHA 1L5UA 2NUPA 1SHJA 4BNDA 5GTDA 2WWXA 3AP1A 3DFMA 2W6ZA 3EZ9A 5T57A 3IMEA 5J0WA 1VXOA 1R27A 5JE8A 3O95A 4IH4A 2V74B 5C4IA 2AMLA 1VSUA 1HY3A 3L8FA 3Q0EA 3W4JA 4EGFA 4WOPA 4M8IA 5L6LB 1T3QA 1L3UA 1L3TA 2XBLA 4YCMA 3TZHA 5T7BA 1FA9A 2ACVA 2PLWA 3N0TA 2O1WA 2D3TA 5CAEB 2XMCA 4EGSA 5AESA 3D6NB 2FXIA 1RWBA 1T35A 5EMKA 3IUNA 4CF4A 1CQJB 1CXZA 3HCEA 2QG4A 4FOSA 9ABPA 4LBYA 4M0EA 2PUFA 3F1KA 5F3DA 4JLSA 2XMDA 3ZV3A 3NGMA 1F2UA 5T67A 5DH9A 1NW3A 2EKPA 2NYAA 4OQZA 1IHUA 4EDFA 4NV0A 2V5VA 3UY4A 4DTCA 5DM70 4X45A 1MAHA 2B3TA 2BI8A 3KPVA 4IG4A 3Q12A 2WK1A 4YP0A 1B0AA 2LNDA 2ZSKA 4UXJA 5DSXA 3I42A 1M0EA 4LDJA 4N18A 2J3EA 3W6UA 3R6DA 1HKUA 2OD7A 2XMBA 1B8VA 3M6WA 4NBWA 3T7CA 2P67A 4M54A 1O95D 4XR4A 1ZOLA 3Q7QA 3E0XA 4JLWA 3PQ7A 4V3CA 2EL9A 3QU9A 3IIEA 4JUCA 1C3JA 4C0SA 1FPMA 5JJCA 4A0HA 2KJ9A 3RHSA 3QV2A 1L3IA 1MOSA 1J0AA 1CUXA 2ZT5A 3BXHA 3PXDA 3RO7A 5GZ3A 1K86A 2AVDA 3G5AA 2Q0XA 3KU1A 3UOAB 5BORA 5AKZA 3VR5D 3TARA 2ZRJA 4L07A 4QA9A 2TECE 4MB0A 5J2UB 3MD0A 1QJCA 1PGOA 4M0LA 1T1RA 3FCSB 4HTFB 1PNQA 1KFKB 3RR7A 3LBAA 1L5WA 2JLCA 4IIVA 4A5OA 3PU6A 1Q1EA 3IH5A 5AVOA 3PNOA 1NY5A 3K6RA 2UVDA 2I0FA 3T7JA 3M4JA 5KTKA 1O9BA 1EUZA 4HQLA 3F3SA 4E15A 4OHBA 1DXYA 3H87A 5EJAA 3TLZA 4L15A 4JOBA 3N0RA 4ZI7B 3GJ7A 1E9RA 4AJ2A 1Z0UA 3FN4A 4IYRA 3X1MA 1QSGA 4LXIA 1SBTA 3GCGA 4EKYA 3BDAA 4R68A 3TF5A 1VKZA 4PGHA 4WL0A 3UT0A 1E1RA 2ZWIA 5AIAA 4KAXA 1MQ2A 1GA4A 3D6JA 5JCJD 4TMZA 1ZR4A 2H2HA 5AJWA 2