2FDRA

Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
222
structure length
222
Chain Sequence
GFDLIIFDCDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVESEASIPLSASLLDKSEKLLDMRLERDVKIIDGVKFALSRLTTPRCICSNSSSHRLDMMLTKVGLKPYFAPHIYSAKDLGADRVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYPSHADRLTDAGAETVISRMQDLPAVIAAMAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of hydrolases/phosphatases-like fold protein from Agrobacterium tumefaciens str. C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 68
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2fdrA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2fdrA01
2NO4A 5AW3A 4OD0A 1Z4KA 3QU5A 4BX0A 5AKGA 4NAVA 5AVSA 4UMEA 3MPOA 3WKDA 4HGQA 2BDEA 3ZVLA 5ALYA 2IOHA 4BKMA 1QQ5A 4ZEWA 3AR9A 1TJ3A 1L8OA 1TJ4A 2HEGA 3NASA 1T5TA 3WK9A 3A1CA 2ZBFA 1U02A 4IFTA 1Z4OA 3L1VA 2BY4A 3NRJA 1RMQA 1RKQA 3ET5A 3MMZA 2ZG6A 5AI9A 3W5AA 2WF9A 1AQ6A 3WGVA 2HO4A 2NYVA 1WR8A 5ALLA 5AKIA 1Z5UA 3N8GA 3FPSA 1Z4QA 2HCFA 4F71A 2YMQA 2CFTA 3QUTA 3ZVMA 4FFDA 4XOUA 4BYGA 4Y2PA 3EF0A 3I28A 2W4MA 3VAYA 4RETA 3SLRA 3A1EA 5AW7A 1NNLA 3AR5A 4DFDA 2B1RA 4Y2VA 5ALFA 3L0BA 5E0OA 2AH5A 4Y3UA 3DNPA 1Z4NA 1ZD5A 1FEZA 1QH9A 5T41A 2R8YA 5ALWA 4RESA 3TLMA 2G06A 3KOOA 3CNHA 3R4CA 1T5SA 2W43A 3I6BA 3RFUA 1Z4IA 5AI5A 1RRCA 4KYTA 4HGRA 3P96A 1Z4MA 1RKVA 2RB5A 4GIBA 1S8OA 5ALNA 1RQNA 1CQZA 4Y2RA 1Z4JA 2G80A 2G07A 3A3YA 5AW1A 4HGPA 3ESRA 1YDFA 4EEKA 5AW4A 4CF5A 4Y2JA 2YN4A 5ALOA 5FP0A 2EARA 2YMMA 3HLTA 4UARA 3MC1A 3R9KA 2AGVA 5ALSA 2ZBDA 5AM4A 4JDPA 2R8XA 1RPZA 5AW2A 1K1EA 1XPJA 4CF3A 1N9KA 1RMYA 3WGUA 5AI0A 5ALQA 2RAVA 4NV0A 4ZEVA 3IB6A 1L7NA 2Q5EA 2R8EA 4XE5A 4YGYA 2MSNA 5AKJA 2FPRA 3L7YA 3U7GA 1YJ5A 5JJBA 3L5KA 3L8HA 2FDRA 4DW8A 4HYTA 3FGOA 2G1AA 3ESQA 4G9BA 3WK8A 2GHTA 1XP5A 4AS2A 3OCVA 3U7FB 3KC2A 1L7PA 2FUEA 2WF8A 3AR7A 3ONNA 3I1YA 3WK6A 3WK7A 2I33A 1TA0A 3IRUA 4BNDA 4HGNA 3QU9A 2PR7A 4UM7A 2AUTA 3F9RA 3NALA 1EK2A 5AICA 3OCUA 1Q92A 5AIAA 3AR4A 3UMGA 1ZD2P 2QLTA 3UM9A 2P69A 4L6CA 5A3RA 2FPUA 1VFPA 4B6JA 1QQ7A 3NUQA 5AKXA 4BX2A 4HGOA 4DWOA 3L1UA 3QU4A 2YJ5A 2HX1A 2YJ4A 1LVHA 3AR3A 3E8MA 2YBDA 1T9ZA 3L8GA 4I9FA 4HAIA 5ALDA 2EATA 5ALMA 4EX6A 3M1YA 4J2TA 5IT4A 4UAUA 2O9JA 2I7DA 3WKCA 1ZD3A 4AP9A 4UASA 5AM2A 3ET4A 4Y2SA 4KNWA 3ZTWA 1L7MA 2B8JA 3ZW7A 3B8EA 2AMYA 4YCMA 3ZX4A 5AW0A 2DQSA 3L8FA 2RARA 4GXTA 5AKEA 3EWIA 2C8KA 4F72A 2JARA 2Q4TA 3QNMA 3B9RA 1L6RA 5AHXA 3W5BA 3FM9A 4O8CA 5AVZA 3OTQA 3N1UA 5ALHA 2B30A 1O08A 5AKYA 3QYPA 2JAWA 4KX5A 2YMPA 4BX3A 3UMCA 5ALRA 2FPWA 5AM3A 1L8LA 2X4DA 1U7PA 3D6JA 1WPGA 4KN8A 5ALJA 5ALPA 3B9BA 2YFYA 3SD7A 4UM5A 3QUCA 2B0CA 3SKYA 3QX7A 1S2OA 3BA6A 3W5CA 2MU2A 3QU7A 3CZ4A 3E81A 3N07A 3FZQA 3FPBA 4XQ0A 4UW9A 2YJ3A 4H1WA 1N8NA 5AKKA 3OCXA 4BEWA 2IYEA 5IT0A 5AESA 1Z5GA 2I34A 4I9GA 3S6JA 2ODAA 4UATA 4UMDA 3ZWDA 4UU0A 1QQ6A 3SMVA 5AM0A 3WK5A 2D2VA 2YJ6A 1Z4LA 3L0CA 2I6XA 4QQFA 2OBBA 2EAUA 4Y2XA 5AVVA 2WFAA 4MUMA 5ALKA 5AM1A 3ZWKA 1X42A 3HYCA 5A3QA 4CNQA 3NAMA 2OA0A 1U7OA 4YIKA 2P27A 4ZEXA 1ZJJA 3FVVA 1L7OA 1ZRMA 5ALVA 5AW5A 5AK3A 3QGMA 3QLEA 4C4TA 4YH1A 3PDWA 2WM8A 2ZBEA 4KX3A 2WF5A 1MH9A 5AW6A 3WK4A 4EX7A 5AK5A 4Y2TA 2FEAA 2OM6A 3WKEA 5AW9A 2JGAA 5AI6A 2I54A 1ZRNA 5AVWA 2G09A 3U26A 3PGVA 4Y2QA 2FI1A 1TJ5A 1ZD4A 4EELA 3BWVA 4YIHA 3AR2A 4C4RA 5AKHA 2QYHA 3U13A 3EF1A 3E84A 4KNVA 2I55A 1CR6A 3A1DA 1Z88A 3IJ5A 3M9LA 2IOFK 1RLOA 4AS3A 2OYCA 4BEVA 5AVYA 1ZOLA 2B82A 5AVTA 5ALEA 3OCYA 1J8DA 2W11A 2GFHA 5ALUA 5ALZA 4Y2YA 3SF0A 5AIBA 1SWVA 2CFSA 4NWIA 2B1QA 1YMQA 4XPZA 2YMLA 4OFZA 2NO5A 2HF7A 4NABA 2C88A 2CFRA 1F5SA 3GYGA 2G08A 3UMBA 1YNSA 3RF6A 2WF6A 2WF7A 5AVUA 2IOFA 1NF2A 5AKLA 4L57A 1RLTA 3E58A 2IA5A 1Z4PX 1J97A 2ZXEA 3ZU6A 3MN1A 4BBJA 2FUCA 4YCNA 4EENA 2P11A 2HSZA 1SU4A 2B8EA 2ZOSA 3U19A 4DCCA 2HOQA 2PKEA 1Y8AA 3KD3A 3KZXA 2G0AA 3DDHA 1TE2A 3L8EA 2C8LA 2BDUA 3KDPA 4CF4A 1RKUA 4BNDB 3WKBA 2WHEA 3ZVNA 1IWOA 4PNHA 3OCZA 4J03A 2HDOA 1Q91A 2YY6A 1RC8A 3ED5A 4NFLA 1JUDA 5AK4A 4OCZA 1KYTA 2O2XA 3ZUPA 5AVQA 3SKXA 4UMVA 2GO7A 4G63A 1WZCA 4OHFA 3K1ZA 5AM5A 3NIWA 3U7EB 3ZX5A 2FPSA 2FPXA 3OCWA 1RDFA 5ALXA 4C4SA 1RLMA 2GHQA 4CE6A 3AR8A 1VJRA 3QU2A 1ZS9A 1O03A 5ALIA 5A3SA 5AI4A 5AVRA 3QUBA 3ZI4A 2RBKA 2R8ZA 3OPXA 2HF2A 3J7TA 3ZTYA 1U2TA 5AI8A 4UAVA 1EK1A 1YS9A 4FYPA 4L6AA 3AR6A 3KBBA 1RMTA 4IG4A 2HHLA 3QUQA 2ZBGA 3DV9A 2P9JA 3DAOA 4YCLA 5ALTA 1LTQA 5IS2A 3PCTA 1SWWA 5AKZA 1U2SA 1XVIA 3U7HB 1PW5A 3I76A 5ALGA 3NANA 4FE3A 4E88A 4MWOA 2C9MA 2MU1A 4EZEA 3QXGA 3WKAA 2CN1A 2Q4RA 1YV9A 1RQLA 4Y2UA 2C4NA 1WVIA 3PGLA 4UMFA 2PQ0A 3L0YA 3N28A 1VJ5A 1QYIA 3W5DA 2JAOA 4QJBA 4JB3A 3N5KA 4UU1A 5AVXA 2HI0A 1NRWA 5AK6A 3R09A 2VKQA 3EPRA 3SHQA 2GMWA 5AW8A 2JAUA
chains in the Genus database with same CATH superfamily
2PMCA 4IZHA 5FPHA 1YB6A 1C7JA 3DBRB 2Q1TA 5ALYA 4CEJA 2OHXA 1JR3E 1D6SA 2D0PB 4Y18A 1JIXA 1SHZA 5C2JB 2EJUA 1A8HA 2XUQA 5FX2A 1NVDA 4TLBA 3WGVA 5FPPA 1PSWA 5EXDA 1Y3BE 3T5AA 2F1JA 4JASB 2KP7A 1G5IA 4K9MA 4GOJA 3CVOA 1MW9X 3C1OA 1N6RA 4YP9A 4B47A 3HRIA 2ZPUA 1TGVA 3KOMA 4OMDA 4ZWNA 1EDEA 4NBKA 2FJPA 3A6GA 4K9OA 4WNIA 3MIZA 5CB4B 1MAUA 3KR0A 1WD5A 2Y2VA 5AQ1A 3CW2C 3WRXA 4M9UA 3LGSA 1K92A 2YWXA 4Q9HA 3AESA 3WB9A 5EGNA 4R40A 1QIHA 4RPKA 2BM9A 1IQPA 3AL0C 4IIUA 3RLIA 3F1LA 4OKNA 3STHA 2R7NA 4ANFA 2NRTA 1E58A 1C3OA 1F1JA 3JQDA 3T5DA 3SHFA 1Z5WA 2HDNB 4M7OA 4YALA 3LC0A 2FUG1 3E1GA 1Z62A 4L22A 1S2IA 4O4HF 1JHYA 5IYZA 3GRVA 3UHJA 2A1UB 3VOTA 1ULUA 5FA5A 3GWGA 4EI8A 5FI1B 4A1OA 1DEHA 2H16A 2MA1A 1E2GA 1CBUA 3UBMA 3NYRA 4JJGA 5FA6A 2X7HA 2E1RA 2CBZA 4FWIB 1HNZB 3I5MA 2G5GX 7ICPA 2JJ8A 4F45A 3QQ5A 4V3BA 1IZYA 3T94A 2J9RA 2QYOA 3NETA 1GNLA 5D00A 1NVTA 4DUGD 5HF5A 3TI9A 2EL7A 2Q8NA 3R44A 2IYRA 4EG8A 3LHFA 2RI0A 5ALRA 4CI9A 5ALJA 4YFKA 3R76A 4E03A 4R51A 2Z04A 2SKDA 3EZGA 4UOEA 2WDZA 2YXBA 3U40A 1T2NA 2ZCUA 1GCUA 5KS2A 1JDNA 1A98A 2CT8A 4QWDA 4JENA 4BRUA 1LKYA 4J9KA 4G9EA 2K2QB 5AWFC 2ZRJA 2P41A 2RQ5A 3STYA 1NAIA 4QIHA 3T5LA 2M6LA 2XAAA 1J7JA 5CCEA 2JFPA 4XWGA 1YA6A 1HK7A 1N5RA 3HSSA 1P91A 3ANSA 2C61A 5DNCA 4HX5A 2E7ZA 1EA5A 3HBNA 3VNUA 4DQLA 1R74A 3IP4B 1GL6A 1T4DA 4ZTZB 3FPEA 2ZJ8A 5HS6A 4ZO7A 3RNOA 2X0KA 2N1MA 2OFXA 3SHOA 1YB1A 3Q4GA 4QJIA 2FWMX 3TIFA 3IOYA 5LFAA 4RUAA 5KFWA 2ZRNA 1QHNA 3DO8A 5JUMA 1GTRA 2DPIA 2J3EA 5B4VA 1U1IA 5KFGA 1MV8A 2WJVA 3PVZA 4D8TA 5KFHA 4AMUA 3D3WB 2A0UA 4II3A 2O8FB 3AQEA 3BK2A 5CP8A 2ZYAA 3P9ZA 1W1UA 3FB1A 4DIFA 4PNHA 2Y05A 4A15A 3SIRA 4M9NA 4WZBA 2HQBA 4AF6A 3JR7A 1LJLA 2I2FA 2GCGA 3I3OA 4OM7A 4B4WA 2R68A 2H3IA 4BBAA 3HWSA 3AFGA 2BEJA 2FMPA 3PRKE 1Y81A 1UC9A 5EJAA 1GGEA 3HCPA 4OGWA 1WG8A 3BBLA 1OWNA 2CC2A 1NJ1A 1QTNA 1Z63A 5AUQA 5D5PA 1UXGA 4ZHQF 2JCVA 2Q7DA 4EQZA 4YRZA 4FHGA 3RD5A 3LRPA 1A82A 3OHMA 5TVKA 3C4QA 2FP4B 4GL4A 5KO2A 4TS4A 4JT4A 2AMVA 4NEHB 4IFEA 2I6SA 2ALJA 4OXQA 3QELA 2BUCA 3K1RB 3ZCXA 2AGPA 5CDFA 1GQQA 4KIWA 3AT1A 2JW5A 2X22A 2IQ5A 3GY0A 1TJPB 2NU9B 1FTNA 4CF7A 4XAQA 3PJDA 5KTRA 5BVHA 4QWCA 3EEQA 4XR9A 4O33A 1Z4NA 4UB5A 2YDYA 4QC2A 1BHJA 5IAAA 2A5JA 1FC0A 3PJFA 4TRNA 3DAHA 2Y1WA 3CNNA 4PWZA 4YAKA 5IWCA 4DMMA 4XQEA 3U7IA 3KCQA 4XD7A 4HDRA 3Q11A 3OZFA 3ZD9A 1Q0HA 4A2QA 4ZOHC 4MV5A 3K9GA 1CKEA 3RT9A 4M6WA 2FDRA 1I2BA 3IN5A 2XT0A 1JRPA 2HGZA 1U47A 3FLBA 2J6UA 1NXWA 1GEGA 4OX9B 4UNNA 1P39A 5HJ2A 1ZH4A 3UQYS 1T3LA 4RJIA 1XKXA 4CCYA 4FYHA 5DX1A 2QTBA 1V1RA 4UUBA 3SEAA 1SKYE 2JASA 3L3BA 4HN9A 2WSYB 5CFNA 1ZICA 5G1NA 3C39A 3A6ZA 3RVRA 1J00A 3EA0A 1I1NA 2A1TS 2PNJA 3HBJA 3CT6A 3CZRA 2OYRA 3LLCA 5EWEA 1KQGA 4NOMA 1RYHA 4FSXA 3CRRA 4HEA6 1Q0PA 5K8TA 1U0FA 1HQYE 1YVEI 3I9KA 4M9HA 3T0FA 3INNA 1FTGA 1GDTA 2H1FA 2O8DB 3MTEA 1S1CA 3OLYA 2X8WA 2BF7A 3ZLBA 3DFUA 4BEWA 3PCXA 1YS7A 2NU7A 1RLUA 2QS9A 5JCOC 1HOXA 5BOSB 4KQJA 3S2UA 3RM3A 4JKIA 3EPKA 3K71B 2I6XA 3Q7QA 2CVZA 4I2AA 4G6ZA 4MUMA 1YAJA 5A71A 3EQ2A 1HT2E 1DIAA 3V8PA 3GT0A 2ECFA 5L1KA 4ZI3A 5A9SA 3NBYC 4I2EA 4URHA 4D6YA 1RM0A 2Z3ZA 4ITUA 2Z8YM 2I5PO 4OHZA 1C1XB 4F3OA 2GARA 3KYDA 4ZO6A 3ZU4A 4AO6A 3ZWVA 3DKIA 4NKRA 5FUMA 2O6LA 4K8OA 1C1YA 3D31A 1AKTA 4OL9A 1H42A 1UF9A 4EPRA 1XCOA 5HX7A 1I4OA 1KGSA 5ALEA 1RQ7A 3CH7A 4EPYA 2VDWA 4EK9A 1J8DA 5FJIA 4D5GA 3IP3A 4A7PA 4QM7A 2VPZA 4B6RA 2VS1A 4KPUB 1S0UA 3G68A 3P19A 5AJWA 3SC2A 1V7ZA 3AETA 2X2OA 3H17A 4H7JA 4YJ2B 1NF2A 9ICLA 1D4AA 2GUGA 3AERB 3RROA 5TE9A 3B89A 5JALA 1NL3A 1U99A 3K5IA 5K99A 1NP7A 2VJ4A 1M6EX 5IBQA 1PQ4A 2IZ5A 2ETXA 4DLYA 3UAWA 1FS6A 3LNCA 1NKBA 3RSHA 1DAPA 1KOGA 1LWNA 4QTYA 3DS8A 1T26A 1N2CB 4S1OA 1PJSA 4KDCA 5EJIA 2H7XA 1RJGA 4I2JA 4DXDA 4M7RA 2CLIB 3OZ7A 4TTPA 2JD0A 2VJAA 5HGJA 5K0TA 4JB8A 5DLPA 3GAAA 3PUHA 1SULA 3CKMA 2CW5A 2GRUA 1KR2A 1O54A 3FDZB 2HI0A 2OK7A 3CT4A 3VR3A 2XJ4A 4HNAB 5L9XA 2HYIC 5LM3A 3N2LA 2C83A 3GEEA 4P54A 3G5AA 1Z2PX 4LRYA 2PX3A 2I0FA 4E5NA 3MT0A 1Z2AA 4DT1A 3DXZA 3G82C 1TJYA 3QKTA 3N8GA 3GW8A 3A14A 5CK5A 4X90A 4JT2A 3SLRA 5C1DA 2PE5A 2CL0X 1CYDA 5L3QB 1P9LA 3MAGA 4YMWA 3UJHA 2AR9A 3JAKA 1QIEA 5J58A 1L5MA 1Z6QA 1KJWA 2Y27A 4O25A 5HRAA 1ECWA 1H0RA 1YBVA 1NI4B 2XQGA 2ZIZA 1C4KA 3I42A 1JSXA 4KOAA 1LDYA 4KUGA 4IJMA 5GPBA 1U0BB 3GH1A 3TG8A 2J09A 3T7DA 2HHWA 1RHRA 1YJXA 1IRIA 4QWBA 5KL1B 3ICCA 4DDWA 1VSVA 1QH8B 3V9AA 5E38A 4C0QC 5FLYA 3BRWD 1SIOA 2I4RA 2VH5R 4F5WA 2FMHA 4PRKA 4YLGA 4D2IA 1K08A 3FUUA 1QHYA 2EDCA 5L45A 4XFJA 1YDHA 2H1VA 3DFKA 2BH2A 2FOXA 3E61A 4E3WA 5DASA 2VJMB 1KEZA 4EO7A 4CL2A 1XTSA 1MQ2A 3WGTA 1X94A 1ZGHA 1GO3F 5L8VA 4QJFB 1E5VA 1EFLA 4R6XA 4IIJB 1HUOA 4PLYA 3AEXA 4ZVUA 1UK7A 4KLIA 3D2LA 4MROA 4R63A 3NT2A 3IAHA 4EEYA 3EWIA 1MIHA 2YX8A 1PQWA 1SC9A 1VG0B 5TLSA 4PQGA 4QGGA 3P9CA 2NVUB 4F60A 5KOHB 3FOZA 3NH9A 4TXHA 1NW7A 2CXUA 2P5YA 2UYGA 3WX0A 3N07A 5JZSA 3WLJA 1TZCA 3IQHX 3VO1A 1D9XA 3D0QA 3U5ZB 1G3MA 4QWEA 3MTAA 3ZWNA 3BT7A 1U5BA 5HA5A 4EY8A 1ZMBA 4QBKA 1E5XA 5CYFA 2A6PA 5BSFA 4EFLA 4MTLA 5E79U 5J4HA 3MWKA 3TN7A 2R00C 5GONF 4HBZA 5HIMA 3OM0A 4F3TA 4YRPA 1QCKA 4IG9A 1JILA 3VU3A 4DL6A 2KHQA 3EZNA 5G0SA 3T12A 4YAGA 2BFCA 2JJ2A 2F9FA 5HF6A 1BQ4A 2QMUA 1EUDB 3C5EA 2G09A 1TK2A 2OWOA 5FBRB 3AO0B 1MB3A 4CLOA 3RSZA 1ED1A 7ICSA 3HCNA 2YNMD 1W76A 3PT5A 1SCDA 2AG5A 2NRVA 2VYVD 3PD7A 1PK9A 1CQWA 1SKSA 5AUNB 4D9HA 4A36A 2Y3IA 2AW5A 2PRYA 3DLBA 1E6LA 4F6RB 4YONB 3FPFA 1PCXA 4CRWB 4D3YA 2C4KA 2DHCA 4EGCB 3CF0A 1NUAA 5EL0A 2X86A 1NT4A 1HKUA 3LQ1A 3AGPA 2O52A 4RVFA 2Z3VA 4UZEA 3UMFA 1KO7A 3OA0A 4MB0A 5C31A 1TYZA 9ICCA 1UJ5A 4UFPA 3I6IA 1EA7A 4J4TA 4RD1A 4CMEA 3VPBA 1N5OX 3K6SB 1SCJA 4WI1A 3JYQA 2QWXA 2GJ4A 3DDUA 3ZI4A 5BUZA 4ETMA 4MS3B 5FHQA 4EFMA 2FHSA 1G8YA 1B2RA 2HF8A 4MYUA 2JC3A 1O9BA 5B37A 4U6NA 4W9RA 1VECA 4Q16A 5FNVB 4M83A 2GTHA 3CRZA 1UEIA 4WXMA 3CNBA 2WYIA 3RSFA 1AA9A 1GLGA 4QG3A 1ZBQA 3D0OA 3TMAA 1GPH1 8ICRA 1Q1EA 4ACBA 5DTRA 2OCKA 3EG5A 2ZSJA 3CSSA 5J29A 1Z6ZA 4H6VA 3ZD6A 1L4FA 3JALA 1M73E 3SZMA 3Q9UA 5IKPA 4KLZA 1Z75A 4FE7A 2Y4NA 2F9MA 2W5UA 4RF5A 2QKYA 5JS2A 3N3BC 3T0IA 2HBLA 4ERXA 4ENTA 5I7OA 1HQKA 2WV9A 4O1IA 2ISCA 3URKA 2AWOA 4IZOA 4DCSA 2BEWA 3AHGA 3ZE9A 2D5CA 4BWMA 3QRWA 2KI5A 3ZDBA 2GCEA 4GC6A 3PPVA 4W1PA 3PR2B 4BECA 3EA4A 5J47A 4TTIA 3K70C 4LOHA 3VSBA 2A1IA 1U9ZA 2AYXA 2WJIA 1ISRA 1P62B 2Y6VA 2PLNA 1RBMA 3RVQA 3DNFA 5KSOA 4KAJA 4EI9A 4LDJA 2VDVE 3KZ1E 3RS9A 4NONA 4NS4A 4NZMA 2WM2A 1FF9A 2CPRA 5CYPA 1NK0A 2Z30A 2HZ7A 2YX1A 4UHCA 3P2OA 1Y7HA 3NYWA 4LJYA 1TO6A 3DR3A 5KJFA 2IHTA 1NW6A 1BQ3A 3JAMA 2PMBA 2ATLA 2P67A 5KI6A 2HPHA 4XYBA 4JI1B 2ZTDA 3UJCA 2Q3DA 1XZAA 4G5HA 1ZNZA 1E7MA 4CNBA 2OXCA 1Y1SA 4YD1A 4QYXA 5CW2A 1FMLA 2OD2A 7ABPA 4X8OA 4MDEA 4E51A 2QP3A 4EH1A 2HNAA 3CS3A 3VGPA 4YP7A 1PUJA 4F3RA 3WNVA 3MEQA 2D1RA 5J2DA 1JEOA 1Y63A 4P5DA 5DNVA 4C4PA 4PONA 3FYDA 2A78A 1V6AA 3F6EX 3LT4A 5KSYA 4WN9A 1FL9A 2E6UX 1IY2A 1S0VA 5FI0B 4P4SA 2MU2A 3CZ4A 1UAYA 4UXJA 4C5CA 4L50A 2CDCA 2OPHA 5KWSA 1RPLA 4HH0A 2VQFB 3OOWA 1YZFA 2R8IA 3BHJA 1R1DA 4CLEA 4NL9A 2C5SA 4UDYX 2PK3A 2GTIA 4HD8A 4E1VA 3CEMA 1X92A 2W0MA 5HMLA 4QASA 3O4JA 2NSDA 3H2GA 2ZB2A 1IBMB 1ZRMA 1KK3A 2XNDA 4JMPA 2H2FA 4ZQHA 1FP2A 2AFIB 2PJRA 4YMHA 1N3LA 2WUFA 4KO2S 3K4GA 3O8BA 2NZUG 7ICJA 3R74A 4DF3A 3IAFA 4IDOA 5M3BA 1Q3UA 3C6ZA 4H7HA 1TJ5A 5LWQA 3R3XA 5JNUA 4LNAA 4C4RA 1OB5A 1F0NA 2W2OA 5CR9A 1U0NA 5B53A 2HA6A 4FHEA 4MCHA 5CDSA 3CZCA 2H1CA 1CQJB 2P0YA 5ED4A 3T5BA 1XZDA 4WK6A 2Q28A 3HA7A 3KPVA 2VBFA 1B43A 5F2OA 3SPXA 1SKWA 1XQWA 1KDPA 1O87A 1XCJA 4ZO9A 1U8EA 2GN1A 2P11A 1EPUA 1FTQA 1SU4A 1NZPA 1JEYB 5H81A 4W5TA 4IIVA 2PUGA 5HZMA 2JFFA 2D1SA 2R8PA 1X15A 3T4XA 5UKDA 4MPDA 1RZTA 4I2NA 4J03A 2OLKA 1DAEA 3QPBA 4XJTA 1M75A 3JVEA 1RYDA 3SC6A 4UMVA 2KSOB 4QRDA 2P65A 3G5UA 2E82A 3CLRD 2DPXA 1Z3EB 3TR5A 3OURA 4LZLA 4F5QA 1MRSA 1G16A 1BPYA 1M5TA 3NC0C 2XTMA 2ERYA 3TIIA 2OBMA 3LZ6A 4Q19A 4WZAA 1J7KA 3L7KA 1GGVA 4EW2A 3EXG2 4LXTA 2BGIA 1V39A 3EASA 5B3JC 3H9GA 3OBBA 1ND5A 3ZEIA 3FZGA 3JD4A 3G8YA 2A1JA 5FB3A 1WUDA 1EXWA 1QK5A 5AOAA 3H0KA 2FQ1A 4D82A 5D49A 4LFBB 1FDOA 4E14A 4GEKA 1CVRA 5D3ZA 1W8IA 3THSA 4IIFA 5TVGA 4ENQA 1G2QA 3MWLA 2QX6A 1UIRA 1F44A 1FFCA 2B25A 4EF5A 1WU7A 4IYRA 5KFEA 2Y1CA 4JEIA 2XPCA 5DMXA 4TM8A 3MGIA 1YZKA 2B61A 5LUBA 1O7JA 2DJ5A 3TXXA 4MR8B 2CMHA 2PWZA 3VAYA 1SUSA 5KU7A 4ND1A 1JI7A 2N0SA 1ZVKA 4M0EA 3AFMA 3BERA 4RADA 4ITRC 2Y71A 3QYAA 2A9VA 1WOMA 3AW8A 1KJ9A 2O3SA 1YVRA 1F38A 1T1GA 1IQUA 3A4IA 1MORA 3HXOA 1M1YA 2LR0A 1P1BA 2EARA 3SS8A 1AHNA 2FJUA 4X60A 3W3AH 3GJSA 4GF5A 1RXWA 3EGCA 3FLAA 4IUBS 2X5KO 4LJLA 3L8DA 3PMLA 5IX8A 4WBNA 3E5NA 3T7AA 3RJ5A 3RAQA 2ISSD 3H6GA 2B4QA 3WLFA 4LQLA 3H5WA 2WIJA 1DEOA 2P4EA 5FBLB 1F4VA 4YR7A 3OCUA 4IQ0A 3CISA 1MG0A 1DTEA 1OY1A 2MHCA 4LVUA 5KFSA 1Y6ZA 1XZGA 1SXHA 1QRSA 2DECA 5LCXA 3U48A 1GDHA 3ZU5A 3B48A 3L1KA 4KODA 2ACWA 1NMYA 1RQRA 3NBZC 2B8JA 3O0DA 1J8VA 1HE1C 5SZHB 3P20A 1T0JB 3O4IA 1GTL1 2JR5A 3PRJA 2Z56A 1NR7A 3RQIA 5JLAA 4RK7A 1XCBA 2XVXA 3D6JA 1VG9B 2E4ZA 5LKAA 2YZNA 9ICGA 5A0LA 3DEIA 1UBUS 1I10A 4MGHA 1WKCA 1WHTB 1KAOA 4PTLA 2FG6C 2QRZA 4I1YA 1HTBA 4LISA 1YKFA 4JFAA 2EW8A 3IESA 3X3HA 4UJ5A 3SMVA 3F71A 4WOBA 4NE7A 1H4QA 3M81A 5E3JA 1FSSA 4HMOA 3I2FA 3NEYA 1MJGM 4BATA 4KL8S 5ARBA 2OHIA 4ER3A 1LX7A 2DPMA 1ECFA 2EL9A 3ZLTA 4OSOA 1FRVA 3OJ0A 4DGQA 3RTVA 2PX8A 3WRXC 2RC6A 4LXQA 2ZUEA 2XMBA 2PZEA 3L7MA 4GL2A 2DH6A 4TLMB 3M4XA 2CLDX 3ZH9B 4RS3A 4CL0A 4KNVA 2I55A 4GFJA 4ECVA 5C8DA 2C3PA 3PA6A 4AKSA 5KWJA 1MXFA 4GVLA 4OP2A 2GB4A 1RLIA 1B7GO 1BSVA 2ZWMA 5JASA 2XZTA 3DFFA 3G0IA 4BJ3A 1AUOA 4CTNA 2X1MA 1FDSA 1KYQA 4KRXA 1Z18A 3P7MA 5K3SA 1KETA 5JH7A 2DAPA 2GSWA 3VR2D 4DBVO 3IVGA 2ZOSA 2PKEA 3HJGA 2D13A 5CFPA 2BDUA 1VJDA 4YUAA 2N46A 2IXAA 3K1TA 2DPGA 3T1TA 1SHUX 5AK4A 5L3SA 4BGEA 2V3CC 1T8TA 1RQPA 4ER7A 2I67A 3MCWA 2ORWA 2F4VB 3GB9A 4F4YA 4FHDA 4MEBA 4DCOA 2X0DA 1DAIA 3O8OA 4DM4A 4XB2A 3WBFA 3OOYA 2HHUA 5J2BA 4GMXA 1XF1A 5T67A 2COEA 2G5IB 1EQUA 1GZSA 3VA7A 2OXFA 4NBTA 2MYNA 1NDQA 1ISHA 5EKXA 1NASA 3AP2A 4FEAA 3I73A 4DA9A 3ZGXA 1KC1A 3L2OB 3RI3A 5D1NA 4KQMA 3DOFA 1XROA 3H0RB 2V6GA 2D2XA 4LK2A 1JB9A 3S4YA 3ZQJA 4AJ9A 1DOZA 4R41A 2V8BA 4DL2A 3I1FA 1FDWA 3KHSA 1Q19A 4FFOA 2O8NA 2OUKA 3RVDA 1SAYA 4M1SA 1JFVA 4FOSA 1P75A 2ZBFA 4K28A 3MOGA 3EJ6A 3QOFA 3D6FA 4BBPA 4PIVA 1V25A 3RCBA 4KMRA 4UC0A 4LJ7A 1FFYA 3CNEA 1ZUD1 2D5LA 4NJMB 1JDZA 4KRYA 1AKNA 6CHYA 1JQAA 1GNPA 1KRHA 1BE1A 3UHPA 4Z51A 2HAEA 5KYNA 1T35A 1KP9A 5T7BA 1WLSA 3VHXA 4XVUA 2GYYA 3JQ6A 1OD6A 2Z58A 2J1LA 3ANLA 3EH1A 3T61A 3VTKA 4K6OA 4IDNA 4PZAA 3DQQA 4AC9A 2HIHA 3SEQA 3QKSA 2J6BA 3K9CA 1FUEA 3RHSA 1Z5VA 3LCJA 4S2EA 4BTEA 4F11A 3S29A 2CBXA 4A92A 4RHCA 1N9KA 3MT7A 3TQTA 4LC0A 1ZQTA 3C5VA 4IF6A 3MWEA 5G0TA 1UHUA 3HXKA 4RANA 4EMSA 4GM4A 3ONVA 2FE1A 5KYUA 4QZCA 4CMCA 3HGQA 3LLVA 4DLBA 2KK0A 3FUWA 2MRLA 5ETJA 5CEHA 4FLEA 2AZMA 2HJGA 4B80A 1JFLA 5LP6F 2ERXA 4NPCA 1IJFA 1X19A 2NSLA 4MVJA 2JGDB 4PZNA 621PA 1ZD3A 1DOHA 4IDQA 4CBVA 1RJ9B 4UHHA 4TQAA 2FXIA 1TEVA 4AG6A 4TMTA 1ACMA 2PXCA 4JHLA 2P3QA 2E3JA 4OI0A 4AYWA 2JAWA 1NUQA 1EVEA 5DB4A 3O8LA 3BZUA 4A6XA 3TANA 1B8VA 1Y4SA 3KEOA 3JU3A 4G0UA 1RVDA 4JY7A 2CDBA 5BT8A 1Y89A 1Y80A 2C2MA 2FDCA 4ED3A 3P0HA 1E9DA 2H29A 1L4LA 3CHYA 3D5EA 4DL7A 2I34A 2ADMA 4M9ZA 3T7KA 1AKVA 3R3UA 2C7QA 3FGNA 3GLQA 2QN3A 2PRSA 5FTJA 2EAUA 1REQB 3RSCA 5LOVB 4P0TA 1IXKA 1ZM2A 1BDMA 3UHAA 5I9TA 4IX1A 2VIIA 1LJ8A 2IGTA 1GNVA 3B78A 4FOLA 4RIFA 2ZE5A 3DMHA 4KHPB 3A26A 2TECE 4CM4B 3BQMB 2GX6A 4KO8A 8ABPA 2EYQA 1ZD4A 1FP7A 4Z0TA 1TNDA 4TN5A 4OXKA 2ZS8A 4FONA 4DR7B 3E84A 4ZVOA 2RH9B 1GUAA 3I2IA 2O7VA 2VZ9A 4D9KA 4BJQA 5AVTA 2H1HA 5IHXA 3ZI0A 4WFIA 2XCSB 1YDEA 2WC1A 1IONA 4DEYA 3ONWA 3RS5A 5JHGB 3L06A 2QJOA 3BD7A 5C4GB 3VR4A 1R4ZA 2GAFA 1IWPB 4YLYA 3NLLA 4TSFD 1NJWA 2PGAA 4HNUA 1SRRA 3KQPA 2JATA 2OH2A 3GILA 1Y34E 3ISBA 1EP2B 3PJEA 4KLCA 2ECKA 4Y2GA 1SXDA 2R86A 3ZY4A 2IYAA 2C0QA 3QM1A 5BOVA 4MQEB 4O2BB 4PVCA 4H7IA 3M7IA 4F38A 4A0RA 4TUQA 5EUBA 3UG7A 4QBIA 1UT6A 3X1WA 2QXYA 5JS8A 2IBTA 1AGXA 4PAGA 4Q4JA 2CNWD 2ZJ3A 5CNJA 4EG4A 4E21A 2XCUA 3IM1A 3U7HB 5CR0A 1TVKA 4IBOA 3ZK8A 2O14A 4PBRA 4KRGA 3I53A 4BU1A 3RUAA 1GG2A 1DAMA 1Z28A 2AFRA 3G79A 4KQXA 5CYOA 3VPSA 1Q7EA 3JPPA 2GEUA 3MUEA 1Q84A 4HGQA 3TLEA 8ICEA 4JDUA 3N05A 2P9ZA 2PO7A 3NTVA 2QQFA 2W6OA 4CMJA 1TMKA 5LXTA 1Z5UA 1ESZA 4KXFB 4NYIR 5TGZA 4JV2A 1D0SA 4CV2A 2W83A 2BOVA 4KXLA 4D3FA 3M4NA 2AXEA 3TR0A 3QVGA 1FDRA 5T41A 3FRJA 1WQ1R 1J99A 3CM0A 4YYZA 4QDJA 2ES6A 4ARZB 5F9MA 3BWBA 2Z6UA 2LW7A 4YQFA 2VEOA 1XZIA 4V0QA 3H11A 1G9SA 4UARA 2Z5FA 4RQBA 1MW8X 1MQ9A 5IDWA 2C59A 3KKMA 2EBHX 3SQXA 4GBMA 5KFJA 2KFZA 4EDFA 4HS9A 2HK6A 2EJTA 3FMGA 2I33A 1A97A 4QO8A 3NAGA 5LKRA 3H1BA 2Z4RA 1SVKA 3KXIA 2FGKA 2JKVA 3PLAE 3OTWA 3I23A 1VMKA 2D8MA 3BORA 2B7CA 2ZYWX 2IYYA 3UUEA 1JLLA 3DC2A 1AKQA 2DHRA 4F04A 1QFZA 5T3UA 5J0PA 1EWYA 1BX3A 1RRMA 4HFNA 3ZZ0A 2YV2A 4I46A 4MJ3A 3B8EA 1T0IA 1M1NB 3EWSA 5CT5A 2RCYA 5ICSA 5HHTA 3ZE2B 3RJJA 4HMPA 2CHGA 2Q4TA 4TZKA 4CCSA 2GM5A 2ZR7A 4GKBA 5T4FA 1JMSA 1CSEE 1TKRA 4HH4A 1L4YA 1RWWA 3IKVA 2XOXA 2YFYA 2R9VA 3ETNA 3VVBA 3FHJA 5KYXB 3FZQA 5I01A 1M2WA 4PY2A 5EP1A 1ZONA 1QC5B 1NP3A 4DMCA 3LYLA 2CVQA 4WKCA 2M2IA 2PS0A 5FO1A 5L4NA 5CDYA 1YS6A 4TKVA 4X6YA 3C48A 4DJFC 1HG0A 3EEIA 4EA9A 4ZOCA 3ES9A 2BBSA 3GDFA 5AM1A 4MAAA 2DFTA 3HYCA 2AGQA 1GY8A 1ZMOA 4MFCA 2QTWB 4P8RA 3WBBA 3V6LA 3O6VA 2XNHA 1PD0A 4GMDA 2VHUA 2PSEA 1BS9A 2XLBA 3A10A 3CF4A 3NUGA 1ZQ1A 5JLJA 1G4UR 4M89A 1WY5A 4JYZA 3IVCA 2QT0A 1EWTA 4QDOA 2M9MA 4L3VA 4UEOA 3PUVA 3C8ZA 1RLOA 2C2BA 4X24A 1Q44A 4DA0A 3UJBA 1QS0A 2HDWA 3M82A 4HNVA 2X13A 1PWYE 1SIUA 4L76A 4OYLA 3EVZA 4UDOA 1ZQSA 2H11A 2FFAA 4DKXA 1VPLA 4XI9A 1WWKA 2Y9UA 1N6NA 4IKPA 1PR6A 1AKEA 2NO9A 2E1EA 4JYAB 2V1XA 2XA2A 1S9FA 4ARSA 5L3RA 1A4RA 3VH2A 9ICBA 2UXDB 4GP6A 1NC1A 3N59A 3NCHA 3RAJA 2GN0A 3MGBA 1WQ4A 2ZT6A 3F5QA 2O3RA 8ICSA 4EYSA 3OCZA 4BMZA 2AXQA 3KP1A 4X92A 4KQ6A 2X0JA 1IMJA 1IN5A 3PFFA 4RZSA 1YKGA 2IIVA 1IUKA 3OQHA 4D4JA 2D8CA 1ZUHA 1T2CA 2JLUA 4UFNA 3G0HA 3PA8A 3S28A 1VJRA 3KJXA 3QPVA 3GA0A 4J43A 2KOBA 4LI3X 4ZKDA 4KG7A 3EXFA 3O8QB 4MI1A 2IW1A 2JIQA 4IHKA 3U1BA 4BO7A 1A4UA 4JI7B 4XRGA 2AZ4A 1OUQA 3F6BX 4C0SA 3A3NA 5ARDA 2EXXA 5AYVA 3JWGA 1T8SA 5ICMA 4JOQA 5AK6A 4Z7QB 4IR9A 3TLZA 1H85A 4YS6A 3PWZA 4WJ3B 4JNCA 3WGUA 3FPGA 1V41E 1Z4KA 1K1QA 3X0DA 4UMEA 5IIMA 1GKYA 3OE7A 3H0CA 5CB1A 4YT8A 4JIMA 3PFGA 1KFJB 1KF0A 3HUEA 4HB2A 3LYSA 4PLCA 2IYWA 3S1AB 4QWMA 1Z35A 4JEHA 2Y1GA 1U2GA 3A6LA 3QMVA 1JKMA 1EYZA 1Y1RA 1NK9A 1Z8HA 4NYJR 4BFTA 2AI2A 4GG1A 1ITZA 1CJUC 1W75A 1PVRA 1JQBA 4EWLA 1GUDA 4CT0A 1I13A 4DDTA 1UK8A 4N3BA 1U9CA 3M4ZA 2AF4C 3DOJA 3T15A 3DAPA 3IQFA 3CJQA 5DWDA 5EN4A 5CFOA 1T1EA 5C52B 5AW2A 4QOGA 3RQSA 4BDSA 4HWTA 1LGYA 3VKVA 2PGLA 1OWMA 3V4VB 2RGGA 4HEA1 4Z6DA 2SECE 3UB4A 4C87A 3PSTA 5DTQA 4F2DA 2D0DA 5HK8A 4CMEC 1QUFA 4PSUA 2BFDA 4OFBA 3WAJA 1T8EA 3DEFA 3V8RA 3O94A 2WABA 4KLNA 2KHVA 4DLVA 3KWJA 2PHZA 1B16A 3MGCA 3SCZA 5B2EA 2ZZMA 3O4RA 2VZLA 4FFMA 3RSSA 3BWCA 5J2FA 5KZMB 1UP7A 1S77D 3VR5H 4N39A 1K7SN 2PZGA 3KUCA 1CZKA 1AY0A 3GLHE 5AXBA 3W5BA 2QM3A 1PL8A 2H3QA 3B9PA 4UBBA 3FMFA 2F77X 3ORFA 1ZY2A 4FS2A 4NZPA 4G1EB 1YBAA 5DGBA 5H82A 2WSMA 3HDTA 4PC1A 4PFJA 3NIDB 4ESVA 3C23A 2CVFA 2VTEA 1BCRA 3I32A 1V3QE 1K2VN 1G7CA 3SDZA 1U4NA 3WLSA 1AK9A 3E5RA 5TPWB 1ULBA 4MV9A 1P1IA 3OZEA 1NXXA 1MC4A 4G86A 4PQFA 1BYUA 3KKZA 1FSZA 5KJ1A 5DTEA 3MA0A 1T0HB 2P2GA 2P2YA 3C6YA 2WYHA 2W48A 5L40A 4FINA 3A0RB 4E5VA 2QVBA 5CT9A 2XKKA 2GPTA 1X8JA 1BCSA 5AVWA 1C8KA 3U26A 2GLXA 1Z8DA 2HSDA 1XYVA 3CX7A 1AROP 3L05A 2BR0A 2CF5A 5AKHA 1ID1A 4DWJA 3H5OA 1KVRA 5H02A 4ED7A 1KIMA 1BD4A 1TK5A 3GFVA 3K5PA 1K8YB 3DF7A 5J2UF 4I50B 4L9AA 1EEHA 3CV3A 4IX9A 1F2TA 7ICLA 3NGDA 2AK3A 5LR6A 1VDMA 3VNRA 3AP3A 2K5UA 3OE4A 3EEBA 2IODA 1Z1VA 2XB2A 5KOIA 1PJBA 3H75A 3Q2OA 1EGVB 4NBVA 4L7QA 4WKOA 3P4XA 2DPJA 3GAMA 4WL0A 1KDVA 3K0KA 2A57A 1RWQA 1DX6A 2Q4OA 2BPFA 1YL7A 1TV9A 3PHLA 2MT9A 2O2XA 4PPGA 5JR3A 5KT2A 1D2NA 1J24A 2X4IA 2EKBA 1PLKA 4Q9DA 3I39X 1DBSA 3SE7A 4LMBA 4M1QA 1QAQA 3B6JA 3GRPA 4C4ZA 3DQPA 5FYDA 4Y9RA 4G1CA 4CXMA 4TYYA 1OOEA 4L5IA 4UB1A 4PHPA 2VK2A 3PX3A 9GPBA 3HLYA 2X3YA 3INTA 1CUCA 3LBYA 1CDDA 2ZAOA 4X66B 1V5IA 1CZOA 4NL9C 4PLGA 3UMJA 2NYRA 2L69A 1WVIA 1QSLA 3W9SA 5EZSA 2AGOA 4WEOA 1J2TA 1NKTA 3K7EA 1E1MA 1WCWA 2YKGA 1ZQOA 3ELDA 4X1KA 3ZDYB 4TYPA 1V4VA 4I55F 5HF8A 3NJRA 2I03A 1IV8A 3OD1A 4LOIA 3Q1LA 4PQRA 4BC1A 4NXZA 4XWTA 5J0WA 5C8YB 5CH8A 4X85A 2C54A 2GF9A 2D1YA 2JK0A 3DT9A 1RHMA 3G8CA 3SN6A 3IA2A 1ZRHA 2JI6A 1USVA 2B1RA 3L0BA 2I4LA 2AUNA 6AT1A 3H05A 1ZD5A 3G2IA 3ZW9A 2G70A 2VT7A 1UQTA 3OD5A 1VHTA 4HGRA 3DO5A 3A05A 5D3MA 2LDXA 2UVPA 3TQIA 5FLKA 4CR7A 3L4PA 1TT7A 1UPTA 2XDQB 1KZHA 2Z09A 1SOWA 4JK1A 4DQRA 2F90A 2ZRKA 4UBJA 4F4CA 1N3IA 4DF8A 2RGBA 2AU0A 1E1RD 2YIMA 3RJGA 4KR0A 1OR8A 1DELA 4WKBA 2GHTA 5CG2A 2RGWA 4TKUB 4KAXA 1XTBA 1YBMA 2J32A 3UQZA 3AR4A 4JELA 2AXPA 3UM9A 2BEKA 4X61A 3ZWOA 2H3VA 1GTG1 2PKXA 4ONEA 1TEZA 3QFFA 1JLKA 1ZQVA 1B74A 1KK2A 2YJ5A 4J9MA 4GYKA 2GKOA 4IH9A 2WZBA 3IALA 1KEEA 3OO0A 5DV9A 2WTNA 4EKGA 1YOBA 5K5EA 4X65B 4IUYA 4E2WA 4P0QB 3HVRA 1JHQA 1ZU5A 2OK8A 3E1KA 3B1KA 2I6UA 4Q15A 5HQJA 1DOAA 3AIKA 2V7QA 2EFGA 4HBGA 3N75A 3B20A 3AF4A 2EFJA 1L5UA 3SAHA 1RI4A 1GTSA 3KR9A 4V2UA 5B3AA 3IUEA 5AUPB 3PC7A 4N41A 2FWNA 3O82A 3HJCA 2BMWA 1UZUA 3PHHA 1XP8A 1IWBB 2IDKA 1HWYA 4H2DA 2IYEA 3H5TA 4ESOA 5BV2P 1EFDN 1JYSA 1Y82A 3S6JA 5JXWA 4UATA 2PY6A 1DJNA 2CNLA 4G67A 4JJKA 3L0CA 4JJFA 3WQQA 3LIIA 1XZFA 2I7VA 1MBZA 3WIDA 1QLWA 1SGGA 4RPCA 4OY3A 1CNMA 3EQ9A 1S6YA 3EH2A 1HYHA 1Z6TA 1CUGA 4FR0A 1S8AA 2P9QA 1F20A 2SICE 1JU4A 5T6BA 3LXRA 2VDUE 1JEAA 3EDMA 4UTOA 2AXNA 4R9NA 4OP3A 2ENWA 5F1KA 4BAUA 1U04A 5C3MA 3NBMA 2E48A 2ZZNA 3SJAA 2Q1UA 1E3WA 1M76A 2PANA 1H3NA 2A9JA 2K4HA 1CD5A 3LBFA 1PFGA 3ILVA 4L8YA 4JQYA 4JP1A 2G9VA 2YUTA 4P5EA 1CE8B 5JTIA 1ZINA 5KYWA 3RARA 1EBFA 3ZZMA 5IBPA 3QG1A 4QFCA 4BMSA 1K75A 4IRDA 3VSCA 1G8KA 3KDSE 3OEHA 1M1UA 3PXDA 3FI9A 4DCCA 4O4LA 4G3IA 1V3TA 1KPGA 1YQQA 1IM5A 4F2GA 4DBLE 1TQ8A 1JU9A 5HKKD 3R6LA 4FJ0A 2YZ7A 1JUDA 3T7TA 1U94A 5F3DA 1AQJA 4UE6A 3GIJA 2ZBQA 3FFXA 1HMYA 3TRKA 3WGNA 3ZEAA 2P2DA 3E3AA 4KMOA 1VG1A 5I7UA 3NTOA 4MUEA 4B75A 3A7EA 4RELA 4MUAA 4EHNA 4L6AA 5FOQA 3H7AA 4Q82A 3U0BA 2I3DA 5KCMA 3V6MA 3DE6X 1NXQA 3T3OA 4YR3A 3OBIA 5ALGA 1S4QA 1VHLA 2PLWA 4BIIA 4D8VA 2V4MA 3SHWA 1D1TA 2JAOA 5IJ0A 4JB3A 4IIDA 3NTXA 4N0PA 2V5AA 4KKVA 2EP7A 3WDMA 1PKXA 2WD7B 1JDUA 2NUBA 5EIHA 2C5HA 3BHNA 3CB4A 1US8B 2AHOA 3U3JA 3WLNA 5HRCA 1XTVA 4GXKA 2IDJA 4D43A 3DZJA 4EHLA 4KSBA 4QQRA 1R3DA 1PJ3A 1LC3A 1W2GA 4IXDA 3FNBA 4IEEA 3ZIAA 3N2YA 3AM4A 1A69A 2NXEA 4B3MB 1BMFD 3DNPA 1W35A 3FNFA 1EK0A 5TDHA 2V9PA 2ZSBA 3GEGA 3P96A 4AJEA 1SVNA 4ND6A 4MI6A 4DCUA 2Z3WA 3K0FA 3T5TA 5C53B 5E6RB 3DEYX 3DL2A 3K1AA 3U4QA 2AJCA 6YASA 4YDSA 1FQKA 1J8FA 3TAPA 2JGFA 2B20A 3GP3A 3DDNA 3W9BA 1LLUA 1M54A 1BDIA 3HABA 4DV1B 4GMKA 2R2GA 2HZBA 1GQ2A 2POCA 1VKHA 4YQWA 2XC9A 1TKDA 3LBHA 4B3BA 5G0WA 4KLRA 1MRZA 1DE0A 4FYKA 2J0UA 3CEHA 4HSGA 1KI7A 1DWOA 4OHUA 1VYVA 2D2EA 3I2YX 2PKRA 4P4NA 2FW9A 3C6XA 5ITZA 4B2YA 2PMWB 3HPOA 5EWFA 4OHBA 1G8AA 2QSZA 1X7HA 4Q00A 3ISDA 2NO7A 3O38A 2NUAA 5TJHA 2QVZX 3RIHA 4NBLA 5EWLB 4EX6A 4NNJA 1P5ZB 3P27A 3GEBA 3ME5A 2QVCA 3IYLW 1GA4A 4C7ZA 3ENNA 1XD2A 4TV9B 2YDXA 4MVWA 4O2AF 5AKEA 3UWPA 3I9LA 2ZCVA 1FO4A 2VHEA 2OP1A 1JBQA 1IVYA 2CWWA 2Q29A 3EAGA 1G0NA 2OFWA 2WT8A 2J0QA 4Y6QA 3O7MA 1DFGA 2GXUA 3M9NB 2RGUA 4DQUA 4JMLA 4YCDA 3IQDB 5DX8A 1A9YA 5CLIA 5CLFA 4RMGA 4NV1A 4TLDA 2D2IA 4NEQA 2HRCA 3BGIA 4ALMA 2EWVA 4TTRA 5FAKA 4LDQA 2DY0A 2XTAA 3P0JA 3KAJA 1UC8A 4GWGA 3WWDA 3WLQA 3UT0A 1C41A 1E9SA 2Q5OA 4QWAA 1VXOA 3PSAA 2J87A 2VK1A 5KNCA 4EA7A 5CCBA 3T3NA 1DDIA 4Q66C 3AJ9A 1U7OA 3RVPA 2VNKA 4Y1RA 3GDGA 3PFBA 4ED6A 2Z2KA 4UEKA 2J4FA 1GZ7A 1URPA 4EGFA 3VUFA 5FTWA 5BW5A 1SBTA 4EJFA 3D9QX 3A1DA 3DKVA 2P4HX 4I5IA 1ZXBA 4WOPA 2ZIAA 4R4JA 1YBFA 4YJHB 4O2RA 3PQEA 2VI5A 1M6VA 1G98A 1QGDA 3ZZUA 4YXWD 3HWX1 3C28A 1E66A 3LHSA 5C5CA 2H9YA 1PS8A 4JEMA 2IDMA 4ZVMA 1UFVA 3F3SA 2IUSA 3MTJA 5B36A 1RWPA 2K87A 2Z1DA 2ZYIA 4KQCA 2UZAA 1Q91A 2ZREA 1R5BA 4YRJA 1E3EA 2W58A 3H0LB 4RVDA 3PV8A 4KQGA 4DBZA 4RF4A 3PYXA 3ZZ1A 1PTJA 3HA5A 2O1XA 1CJBA 1UDCA 2O59A 3F73A 1Q7RA 2BKAA 1P2FA 3CC8A 3PITA 4WA7A 1LI4A 4PYJA 5AI4A 1EP3B 4YJ3A 1U48A 3OO1A 3E35A 1H0HA 3DHNA 1WUYA 1XWIA 4EAQA 4EGSA 1NNSA 4RULA 5HIJA 3KVRA 3N2NA 1FUKA 2XDYA 5F2NA 4IKEA 4LXIA 4PRLA 4GUDA 4AY2A 3SVZA 5J1SB 2A5FA 2V1UA 1YZ6A 1G18A 4LS3A 4JD5A 2G9ZA 1ZA1A 2XUJA 3FKSD 3PMNA 3ZBTA 1TJ4A 1W19A 4K3VA 4RTSA 1WKVA 3ZH2A 3V46A 2IYTA 4GOKA 5K0SA 3DTVA 5DM1A 4HN2A 1KI6B 1QAOA 2HHSA 1WDWB 1P73A 1LSSA 1BS2A 1DOQA 1DTSA 3GC6A 2YIDA 5FWAA 4C3UA 3NHYA 1ZIDA 4UVGA 2NO6A 1V97A 2VYND 2H0RA 2QUJA 3FGZA 1XPUA 3SR6A 3A3KA 2HC9A 4KGVA 4AMYA 2XICA 5C7OO 5GIPE 1ZHFA 1YCDA 2HW3A 4UVDA 4EEKA 4CF5A 1NBAA 1NZJA 3DVRX 4DZTA 3IPRA 1CYEA 2H00A 3K32A 1NY5A 2EG9A 2HLHA 4BMOB 1MVNA 3T52A 1DC5A 3PPYA 2ISPA 4JX9A 3P4UA 3ZC3A 5IKEA 4UDNA 3EPHA 4AXXA 4ICAA 2BHSA 2PR2A 2AMLA 5IVIA 3VO2A 3M5CA 3HDYA 2WU0A 3GO4A 4ENRA 3HB4X 3I4CA 1EWVA 1GV0A 3LU1A 1KIAA 1X70A 3A4NA 4Y1EA 3ZPXA 2KQUA 1K7CA 1KDOA 3ZCUA 4NC9A 3V2IA 2ZSFA 3D5TA 3IEUA 3D6AA 5FR1A 5K0CA 1FUUA 1V8OA 3OQNA 1YFKA 4ESEA 4XLTA 1UOOA 4Q24A 4FBMA 1QLNA 4JU9A 2GPJA 1IG3A 2FW7A 5JOQA 3SKVA 1G2IA 4Q05A 3G9XA 2AC2A 5K8LA 2VDMB 2GD6A 1N56A 2GN6A 1EFTA 4ZOAA 3C8UA 3KPUA 5BSMA 4OREX 2LV8A 1ZIXA 4ZRDA 4MI3A 2QNBA 3RC7A 5FFFA 4H6WA 4Q9KA 4FB5A 3ERCA 3ELYA 1HYEA 3RTCA 5AESA 2EKPA 3LBNA 3GARA 4LOJA 2LE0A 3CGGA 2FUNB 1LLCA 4TROA 3B2EA 3FSEA 3O2SB 5EPOA 4DDVA 1MOQA 4RO0A 1XFDA 4UNIA 2PUAA 1SC1A 3QVTA 4U0KA 5A2QA 1D03A 3CF2A 1B42A 1PL7A 2JGEA 2JFOA 3CF6R 2ECOA 1BVRA 4JVMA 2OWDA 4I4TA 3DOEA 1UWKA 1DJOA 1B3BA 1QP0A 3KHTA 2QK4A 3OZAA 1EXNA 1Z88A 1H1LB 2PEZA 1YJAA 4DL5A 3H5IA 2ZIXB 5T3YA 1Q6YA 4MW5A 3RO7A 3MSCA 4K6GA 3DUFA 3Q8XB 4I1IA 3WDKA 3IE1A 1KMNA 1YMQA 4Q1AA 4EG1A 1KO4A 4U9UA 1ATIA 4TUYB 4F9GA 4JZKA 3WYFA 3SZLA 1SVLA 1V1MA 2XGSA 5JNVA 5SYMA 2ODEA 4B9TA 4J0IA 1W36C 4YRNA 1MJNA 2ZIVB 5C5IA 1OX4B 3DMFA 3SU8A 1ISJA 3RC3A 3E27A 4HX2A 4B0OA 4XPIB 4BNLA 1EP9A 1WYGA 1C7IA 4P3OA 1UIMA 5HW0A 2HA5A 3L4KA 2C04A 5F78A 4D0RA 3R9IA 3F8TA 4CTMA 4RKEA 5BSWA 3V8BA 4JGGA 3IDZA 3DVQX 3W9YA 2OOSA 3C3AA 5IVPA 4UAVA 4D9MA 1BD3A 4LZAA 3E9CA 3I64A 4M1ZA 2Z2YA 2RK4A 4NXMB 3OKCA 3PWTA 4BKPA 3RFAA 3TBKA 1Y1LA 3T7RA 5EFOA 1XZ8A 3FWKA 2W00A 1GVHA 3EPRA 3K4QA 4URFA 4TZ0A 3C97A 4NCIA 3PFHA 1SC6A 4OHYA 2R85A 3LWZA 2XUKA 2VUUA 3IR6A 4CEHB 4YN4A 3IJEB 3O9VA 4YMGA 5FULA 3TSWA 1PEAA 1P8AA 3P0RA 4R71A 5CLHA 4IFTA 4XA8A 2Q3LA 1ZQ1C 3PHBE 3NR2A 5CXUA 4N6OA 3V1YA 5ALLA 2C58A 1A88A 5EQDA 1EJ6A 1I7DA 3HRDD 1I5EA 4PEVA 2PKQP 3EBOA 5B66U 6NULA 4QDXA 1EZZA 3V6KA 3JZMA 1N1DA 3UB2A 3P8ZA 7ADHA 2E4WA 1ZU4A 4A0FA 1RC0A 3HR8A 3JQ8A 2IPNA 1VL8A 4M8NE 3THXB 2G06A 3GJ3A 2ZYHA 2QN2A 4ODIA 3DOHA 1VL1A 4ZZ1A 1E2PA 1JX4A 1QH1A 1RYZA 4DEXA 4IY1A 1KQ3A 3P71T 3FLEA 1ZGBA 4G9GA 1PO7A 1CR2A 2VP5A 3WLPA 1CUIA 9ICIA 2DBRA 3B3FA 3IB6A 4FZ3A 4LF8B 4LRUA 3LY5A 2VWPA 1JSRA 3D3QA 5AJZA 4ZDJA 3KJQA 5CM8B 4EYEA 2R6DA 3C43A 1E2EA 4EVSA 2UZIR 2V6BA 2C4TA 1T3NA 1QR2A 4MV1A 3QV1A 3Q87B 3X2FA 3M4JA 4E4RA 4ED9A 1G8SA 1JI3A 2B8NA 1JGTA 2HX1A 2YJ4A 1KR5A 3L8GA 4GPD1 4HAIA 4QZVA 5AXDA 1O0SA 4JQCA 4Y2SA 2QV7A 1BPXA 2BUAA 3WYNA 3DHVA 2ZRHA 4MZDA 2OUIA 4YUYA 3TW8B 4YACA 3U4AA 4BMDA 1EE1A 4PO9A 4U7JA 3ZKWA 3ZDCA 3DM9B 3Q3HA 2GZHA 1A2QA 4C08A 5ICGA 2REXB 3H13A 1H8EA 3AEKB 3PC2A 5JSZA 2WWWA 3IEXA 4LJ6A 1NF3A 2V45A 3U3XA 4H3KB 3GGGA 3QEKA 3E18A 1K97A 4RXUA 2O3TA 3IHLA 3FYTA 4BFZA 3UAXA 1XJQA 2OENG 1NQOA 3VR6H 3L7LA 4CKEB 1U2GC 2JLZA 4BLVA 2EQBA 3M6ZA 1L5OA 5C5DA 3Q1KA 1E1DA 2X5JO 1ODIA 3EBLA 4HNSA 4C0HA 4IVRA 5D2CA 3NAMA 2AG1A 1E6CA 1ZQAA 1TF7A 1X7YA 3CIFA 3BKWA 2J9FA 3AOGA 1FNDA 1L9XA 1KAQA 2IP1A 3R0VA 4NBUA 9ICWA 5T4HA 4OAPA 1HORA 2JEZA 4I66A 1BX0A 1QDLB 3H4TA 5AP9A 4FZMA 3GDWA 5CA1A 3H9BA 3MAJA 5IF3A 4PSCA 2XMDA 1OXTA 1OASA 3QPWA 2NV0A 4U00A 3RS3A 4BLOA 4TT3A 4U7HA 2PI5A 3TLKA 3GYGA 3UYLA 1H05A 1OA0A 2FTKE 4P7KA 4IDEA 1R66A 4QPPA 4EUNA 5KNLA 1OXSC 5CT6A 1X8XA 2IA5A 2PZFA 4QTXA 4FGLA 3HTXA 4MQMA 5HTKA 3RB6A 2VUIB 2XY6A 1U81A 1WF3A 2VQ3A 3A11A 2H07A 4F5PA 3MRVA 3UXMA 2E8MA 5F4BA 4H4DA 3DE0X 4RHTA 4R8RA 3IBFA 5M04A 3DFIA 2Q6VA 5DOZA 1WZCA 4TTJA 1ZD9A 2PPVA 4TL7A 4Z49A 3LUCA 3C7TA 2BISA 1OIVA 3KKQA 2DT5A 3MMXA 4LOKA 3LPLA 3DP7A 2VSOA 3O03A 1M2OB 4NZYA 2OQ2A 4B3HA 3CBGA 4KJXA 4E5YA 4RHEA 5LA6A 4NU6A 1Q3TA 2EKZA 4D41A 2HA4A 2J6HA 4B8ZA 4W4TA 4HDMB 5EP3A 4C01A 4IQ4A 2O3JA 3DULA 3IBSA 3B6IA 4O1HA 2DQ4A 3M34A 3OLWA 1NJ2A 1EHIA 3OCJA 4ZEMA 1QJ4A 1YS1X 4EG7A 3VOSA 3PVXA 1ZK4A 3QVMA 1TJ3A 4BQRA 2W9CA 3RT7A 3FVWA 5JC1A 4KYIB 4B4UA 3L1VA 5FKJA 4W6ZA 1RMQA 1T6NA 4S0ZA 4QYIA 4IV5A 5HHHA 4YXJA 3AFNA 3W8FA 3DPUA 2J0EA 4O3FA 2Y99A 2AX4A 3IQGX 4LC1A 2AD1A 2C2WA 1I1OA 4WKGA 2L5YA 4DFDA 1BNPA 1O8BA 1W9HA 2GJKA 2XGGA 5CG1A 2A0FA 4PE5B 4G4JA 3PQFA 3HU5A 3A6JA 7ICFA 4NZ9A 5JMPA 1UPUA 2J6TA 4MFFA 4NY8A 2J9XB 1BC5A 3D6HA 3MUOA 5J4YA 3U37A 1ESNA 4M0UA 2YN4A 1J39A 3U4HA 2JD1A 4M0LA 5ALOA 2YWFA 1QIGA 1ETUA 5DIFA 2FRXA 1C2YA 5DKFA 1QXSA 5H0IA 4C6SA 5CPFA 3GFKB 4OMCA 4TTAA 1LSUA 3BQ7A 2IXBA 4MUKA 2OD9A 2IELA 5LNK6 1P7WA 4TLCA 4Q5IA 5TMEA 1GSHA 3NBKA 1H2WA 4HQ0A 1DIGA 4PAOA 2ZB4A 2VVTA 5C7IO 1A7KA 3ETEA 1H4TA 4AROA 3SSAA 1F06A 3FA2A 2G63A 2G9QA 1SXJB 2VCHA 3RJZA 4POAA 1SHTX 1D5WA 3BK7A 5A62A 1T6YA 1Z0FA 3EIHA 4FKZA 3BS7A 3REQB 3I5UA 4EAAA 1JPUA 3IIIA 2AJQA 3WGKA 3CO0S 2B78A 3AG5A 2C8KA 3VVLA 1MOZA 2B37A 2XD4A 1DKOA 3BWEA 4HTFB 4NMXB 2QM8A 3M1IA 2W2VA 4R3UC 1W0KD 2OBLA 4FKMA 1SQ5A 1EFCA 2OV2A 2R7LA 2KBFA 4MUBA 3TD9A 1U2DA 1UDRA 2H8GA 4EY3A 4J9UE 3V4SA 4PO1A 4H60A 2GK7A 2EH9A 2HMVA 3GIWA 3N0RA 1NAHA 2Y8EA 3V1NA 1SC4A 1A7AA 5A05A 3ZDRA 5IC4A 3ZHZA 1TQ6A 2HQ1A 3MB8A 4EA6A 2JDIA 1WEHA 2HVHA 4QXRA 1I2MA 1ZYQA 2G9NA 1MLDA 5KOJA 2QLMA 2CYAA 1B6GA 3RYFA 1YE5A 2APJA 3FDSA 1DSSG 1LLFA 3WMGA 2VPIA 4EUSA 1N34B 5LYJA 3JWPA 3E5HA 4L0CA 4O02B 5BYKA 4BMVA 3H5RA 1W6RA 3C7AA 3CLUD 4OHMA 3QPCA 3EDYA 5TQ2B 1ZX1A 3SC4A 1R8XA 3TTSA 5H16A 4AY5A 2E4VA 3MDAA 3ZBQA 2B1QA 3DDOA 3NVAA 2BSQA 3GOHA 1J07A 4X0EA 3LA8A 2DH5A 2VJOA 1QVZA 4JC8A 5LDHA 4ERNA 1IHPA 1KN5A 3L7DA 3G9TA 2LUOA 3B0XA 1D5CA 1Z15A 1DIBA 2KNJA 1MVLA 4O2LA 1I2ZA 1KBZA 1RJDA 3LX8A 3GJ0A 3SSNA 2KVSA 4JR2A 3KVYA 1F0KA 1Z56C 3VQTA 3HNOA 2WBLC 4TV8A 3AF2A 4NATA 2IYNA 1GKUB 1EUCA 2KSQA 4H7PA 1YGYA 4FMCF 1Y8QB 3FHCB 4NAUA 4MRRA 4XH9B 1DUVG 3WFJA 3G7SA 1W34A 2WAMA 1GJRA 2PH7A 3UJAA 3R5XA 4RPLA 2LM4A 1ZMXA 3EGWA 3DV9A 4A5SA 13PKA 3Q40A 4PSAA 2LI6A 4YFYA 1BHQ1 5ILGA 2IEBA 2BFNA 2OBYA 1X9XA 1F7UA 3AF3A 4N7JA 3GLFE 4BGDA 2E55A 4C3ZA 1ATZA 2H2WA 3JPYA 1G21E 4PZEA 4QOEA 3K0HA 4QW8A 4XUGB 1GGJA 4KQ2A 4DJ5X 4D3DA 2EX0A 1II8A 2ZBRA 5H3CA 2XCTB 1FP6A 4S3MA 4ZAXA 2BY4A 3WQSB 2GAAA 4QNMA 5AQEA 2HO4A 1T3ZA 4TTVA 1SXJD 3K73O 2AFHB 1TUEA 2W7PA 4QDZA 4PGQA 3PWSA 3QVSA 2IHMA 4TTSA 4I3GA 2IEYA 4M38A 2X58A 4L5CA 3HO1A 1H65A 1XJ5A 1V9LA 3MLEA 3CIOA 2DRIA 3H9CA 3TXAA 4U3JB 4DOMA 1FS4A 3GAFA 3TI7A 1ORVA 4YT4A 3RRHA 1XNSA 4ZOLA 2GFQA 2YW2A 2QPLA 1I4WA 3KT8A 4UKDA 4UAZA 1UJCA 3RVOA 2Q21A 2ZBPA 4WPGA 1XA0A 5A4IS 3FMPB 4J0QA 1S3GA 5EWGA 3O47A 4PLPA 1UJNA 1XP5A 3FX2A 5F2KA 4QHTA 4DQIA 4RPHA 1XHLA 5ADUS 1P0QA 3FYCA 2R5NA 4ECRA 4KNYA 3ELUA 3QMMA 4P3XA 3Q3EA 3D2AA 4DIOA 3LTNC 3NM6B 1N61A 1RWVA 5J5VA 4FTWA 1J23A 1B8PA 1GAQA 1IZ9A 3QOYA 3AHEA 1FYFA 3IURA 3A6PC 1ZQ9A 4J1NA 4QDKA 4ZIRB 4XWAA 2CEAA 3IOEA 3JQ9A 1TFUA 4X5VA 2AZTA 2GERA 3CUWA 3KZKA 3EZ5A 2P3SA 5CB4F 3BD6A 2VRCA 2GDZA 4U6QA 4OXNA 1Y48E 4LZGA 2XDAA 1KSJA 5AHRA 1ZI8A 4R1PA 3E05A 2P4UA 4DRXB 5I7WA 2CUTA 4GPBA 1A4IA 1D2MA 4NJEB 4KIFA 4U8HA 4AJJA 2CYBA 2AEJA 4AKGA 3QVKA 3GZNA 4XDGA 1GCIA 3II6X 1J2RA 3BK1A 3UWMA 1JHDA 1CETA 3RGGA 1GOTA 5AJUA 5CB6A 4KX3A 2ZQZA 5HIKA 1VMDA 2OAP1 4XWKA 4IDPA 4YB8A 1GTZA 2ODWA 3IMGA 4Z3OA 4XIFA 5CD9A 1CR6A 2AIRA 1A9QA 3GRRA 6GPBA 1E4OA 1Z6GA 3AU8A 3S5UA 1OTHA 1SCUB 1O1YA 4DIDA 1P4AA 2PWAA 5BRJA 5HR7A 1R9NA 2FAXA 2VPTA 3ABQB 2REBA 1QSGA 3C3EA 2QDKA 1VMAA 3MWDA 1JEQA 3OWHA 1KJQA 4TQ9A 2XBLA 1NRXA 5KJEA 5ECYA 2Q9AA 1JPJA 2H92A 1XEWY 1II9A 3GEMA 4LUCA 3DL7A 2WHPB 2G6TA 3QXSA 1CRPA 4MJXA 3X1YA 3CG4A 5FCDA 1S0MA 4JJAA 3N97B 4NENA 4QIWC 1SVMA 1AMOA 2Y66A 2JLBA 1UBTS 3VM6A 3GLIE 1L3SA 3IHKA 4BP8A 4CE6A 3A4LA 4UPEA 3KKNA 4IQ8A 1UBKS 5FOXA 4OJQA 3Q98A 5T5QA 4CV1A 1HDXA 4GEGA 4H7DA 1BPDA 2JXJA 4GZMA 1IXRA 4L8GA 2ZBGA 3VYWA 4RTRA 4JSTA 1RI2A 2UUCB 2HHVA 3BKXA 2GNAA 4P83A 5EERA 4RD0A 5JU6A 5BV8A 2QPTA 1T8RA 1JLHA 4QEZA 4K88A 3KHKA 1KL7A 1FNSA 3IUPA 1A77A 5KYTA 4DSFA 4XWYA 2X0FA 2REQB 1U0LA 2FW1A 4U1RA 3E2EA 1SEVA 1W4ZA 4HV4A 3OC6A 1GAJA 3OKFA 3V4OA 4RZQA 3O3CA 4I8IA 4R7ZA 1HETA 2NYVA 1OHHA 3OJCA 1S3FA 1SQGA 4LNHA 4US9A 4XOUA 2BKLA 2VAPA 2X0NA 1CUFA 5JPDA 2C4VA 1AF7A 3UCXA 1NYTA 1FS5A 4E33A 3RFUA 4FX5A 3IMFA 4Y0VA 3X1KA 1X38A 3WXMA 2V4UA 1NWCA 1KMMA 1XVUA 2JJYA 3R5SA 3CKKA 3WLAA 3NHWA 2VUSA 4MUGA 2XXAB 3KFVA 3VC7A 4NYMQ 4C4XA 4D7AA 3OJOA 2QQEA 1VCIA 5H4GA 3F5SA 2BGTA 2WB1F 3O9ZA 3X1JA 3ASYA 3A1WA 1A2OA 1IM2A 2XTNA 1W5BA 2E3TA 5FOWA 3KC2A 4EEXA 1ORIA 1NLFA 5DDMA 5EVJA 1G38A 1PTJC 3IJPA 1D7AA 5J23A 4AO8A 4GKVA 1HDCA 1MDFA 3NALA 3HPQA 1EFPB 4BEJA 2IOQA 3RS7A 3IEKA 3W4JA 1P3DA 2PQ6A 2VRBA 2RKBA 4MF8A 2XWPA 2O8VA 1QMGA 4N8EA 4MUYA 2I4TA 4P4OA 1JH9A 4NL4H 4D9FA 5CK4A 3W5SA 3ZD7A 2O07A 2PM8A 4N01A 4X1YB 3LUGA 3KAQA 2ZPAA 4K0RA 4BNJA 1ZNXA 2EBWA 1ARZA 2IZ0A 3ESAA 4I28A 2FOIA 1J2EA 2UVUA 1XK6A 1B14A 2F1HA 8ICTA 4P4TA 5ELMA 5LYYA 2ZTSA 3JPRA 5BWNA 2XZOA 2OBBA 4S0XA 5IKMA 1OYVA 1XIVA 3CH4B 1RRPA 3QE2A 3SI7A 1R6TA 2JVKA 1UKYA 2ZWVA 4BV9A 5IVHA 1IHOA 2EBFX 2R62A 4MVXA 3DV0B 1DQYA 3D4PA 5AW9A 3U6BA 1E0KA 1BZYA 3LP5A 5GP1A 1W9MA 1GU0A 4LSZA 3LLUA 3QSGA 3I45A 5FTMA 2VQSA 3M5WA 5KWVA 3H2SA 3WMRA 1VB5A 5GJBA 4WUVA 2WFZA 3DZIA 3QE4A 4LV5B 4EMUA 1B1CA 5TF0A 3RJHA 3IDFA 4HUJA 4Q43A 2GS9A 5KX5A 3MBOA 3CEJA 2BCUA 4RA6A 3I9OA 4YMVA 4HMQA 3BN3A 1LPAB 1M2EA 2HRDA 2AZXA 2XO7A 1XO0A 2CNOA 4HDNA 2J3HA 4HP8A 1XC9A 4NF2A 2ZBVA 2BMEA 2W8KA 3WWCA 4OLBA 1CNFA 5BQFA 1OLOA 4BRZA 1MKYA 3SX2A 4RPYA 1N78A 3BGSA 4U63A 3PO5A 2ZSHA 4X95A 1Z6XA 3C21A 3BSFA 2RJOA 3S1LA 1DMRA 2G28A 1R9GA 3OA2A 5FI5A 2XMZA 4ZMBA 4MWZA 3LW7A 3PKJA 3EMDA 4M22A 1M1XB 1S76D 4G0OA 3OPQA 2WMYA 3QXCA 4UNPA 4JSYA 3VNSA 3C8HA 1N8KA 5KG5A 3AU9A 3TQHA 1JIHA 5JDCA 1I4LD 4OJTA 4RD3A 4PNPA 4RKFA 1V0JA 4W1QA 3KYIB 1GDDA 2G7ZA 1T6XA 2XMQA 4QU8A 3H5AA 5FHRA 3TG2A 5JY6A 2BVNA 1NF8A 4Y67A 2A0XA 4IF4A 3PP8A 4CTKA 4EB3A 4RVHA 2XBUA 3Q2IA 4DQ0A 4CUKA 2J8ZA 1N7JA 4LZJA 1HE4A 1NK7A 1DZIA 4PYOA 5FJJA 1GV1A 5JCJD 2IZ6A 1U02A 3JPTA 3GGSA 1M6WA 2BKVA 3G7NA 5KSPA 3IR5A 5DU2A 4G1BA 2XE7A 3RS2A 4GOMD 1B6SA 5LD2B 3ST7A 3C6QA 3JX9A 4L28A 9ICMA 3HB5X 4A82A 5AW7A 1SD2A 2YZMA 1TZBA 2OCXA 1Z16A 2ASLA 1J22A 3PUWA 1Q15A 3AINA 1NVBA 1HFKA 1GUBA 2QAGA 2YRFA 5ADHA 4MKFA 1J5XA 4U5XA 4WACA 3CEAA 2BE9A 9ICRA 3WHLA 3LF2A 4U2FA 2IQIA 4GI1A 4DLEA 1UBSB 2CMDA 3PXBA 1UANA 1FLAA 3KTFA 1TCVA 1O6ZA 5IP5A 4G5OA 3JARA 1O9GA 1NFFA 4O5KA 1SOAA 2X42A 4ECQA 3RB4A 4FW9A 2IF2A 4IGFA 3A4VA 4BP3A 2VT6A 2BZ1A 1KZYC 5KFUA 1UPHA 1AGPA 2JEFA 3THRA 2NGRA 5K51A 4EBEA 1YOVA 1KXJA 3ZWWA 5JVDB 4XGKA 1NYQA 2HSGA 5IG2A 1E5DA 5C81A 2XNSA 4N6NA 8ICFA 4AMVA 2G82A 2OCGA 1FBNA 3EHDA 1OWOA 4TUSA 5CDGA 1R4AA 2PS1A 1WUTA 1JDBB 2XIQA 1WXQA 2PUVA 1E6KA 4H0FA 4ROSA 3MGHA 1E99A 3CVWA 3I6ZA 3RUFA 1RWBA 2D2VA 3LSTA 5FWXA 1AQUA 3FCAA 1MZPA 5J2GA 5BSGA 4ZH4A 3H2ZA 2DGZA 3O2NA 5LQCA 4V0LA 1PUZA 2WTXA 2XY7A 1SBIA 4OOFA 3U39A 4RPZA 2OCEA 3PF8A 2FCAA 4L7VA 3OVMA 3GRKA 1G20B 3S2FA 1E6EA 3PW4A 3EG9B 3NAZA 3WGMA 4LE2A 1V5GA 4Y2TA 4U2KA 4UB6U 4XVRA 5KFMA 4R0NA 1F60A 4KJZA 1WXDA 4IIJF 1X1SA 2JKZA 5JZOA 4OA5A 4LJXA 4OI4A 3KJGA 4EBFA 3D5QA 2QMEA 1I80A 2CE2X 4DDMA 3MS7A 4LHXA 4N7RA 5DQIA 2K4IA 5ALUA 1PJQA 3SF0A 3KEFA 4J76A 1AD2A 3TBHA 3M2TA 1NQTA 1UAAA 1I14A 5FEMA 3OTIA 3AF6A 4L6IA 2GAOA 2B4KA 4FDTA 3D7KA 4C7OA 2WUDA 4PHGA 4WKNA 1PX2A 2AG0A 3JQFA 2W2KA 4I1PA 3AMZA 3BXHA 3KO8A 1JB1A 1VLLA 3F2IA 1DQPA 2VUTA 3DLAA 3X1XA 3MCVA 1RPNA 2XCPA 4YJGB 3CTMA 3IKJA 4O5OA 4BNDB 3CMMA 1I4EB 3RFTA 2BPCA 1Z8NA 4YREA 1DKRA 2H48A 4ZGBA 2CK3D 2HJHA 1X7WA 4HUQB 3OZRA 4K9NA 3G0DA 1Z0SA 3P2IA 5COAA 4OXIA 2KIWA 2N3ZA 5EINA 3HT3A 4P35A 2VL7A 1QAMA 1O9HA 3RU3A 2G71A 4YJFA 3DMYA 3NHUA 4XCXA 3FJ1A 4UOZA 1E7WA 2MUTB 1YK1A 2WI8A 3K9WA 3GVPA 3GJZA 1J70A 4P4MA 5LQMA 3F9CA 2WYVA 4RQ6A 4Z99A 5CNKA 4MVJP 1BXZA 3AB7A 3FAKA 1JHPA 1CDOA 5KTYA 3CLSC 4MUIA 2ZAMA 4KACA 1R5JA 1JTFA 4DSNA 4P9NA 4GYYA 2Y1LA 1SL0A 1L8OA 2JA1A 1KZ7B 4K46A 4IUCS 1H2YA 1A72A 4RNDB 4KTVE 5KFYA 1USIA 5D7NA 4ARBA 4DCVA 1DWQA 4FCCA 2D3WA 4Y2PA 3VO8A 5I45A 3KOZA 1L6IA 4RMHA 1L7EA 8ICNA 3FY4A 4G41A 4CM5A 2BDPA 2W3SA 3QI2A 1E89A 1F14A 4KQ1A 2R8YA 2JZOA 5EE9A 3S2IA 4BX8A 1VJ1A 1M3SA 1JRLA 1GR1A 4PL1A 1IZ8A 4PICA 1FP4A 1IBKB 1NJ6A 5KKAA 3L8CA 3EIFA 2JCBA 2RRDA 3OLXA 5JXJA 3BMQA 2F43B 1J8QA 1XU4A 1SBZA 4EB6B 3EVDA 4PCVA 1XXHE 1PK1B 4R7TA 4JI6B 5GZ1A 4XTCS 4KLSA 3VGJA 1JVBA 1GO2A 1QDEA 1X0VA 2KBEA 4ZANA 1JKIA 4J75A 5FPKA 1FPQA 3RWBA 1PT7A 1NATA 3AF1A 2JIZD 3PZPA 4EHAA 1A96A 1VLBA 3AUUA 3EA5A 5DGXA 1MIOA 5HKAA 5A3RA 1KYYA 1VFPA 2O8EA 3FDIA 1PNTA 2X8LA 1JL3A 5IBRA 2HKIA 3E8MA 4I9FA 4L3WA 1O96B 5KKNB 4ILKA 3O5AA 4AF8A 3RRJA 1ZQKA 2A30A 1DGSA 3V1TC 4NM1A 1K4KA 4H1HA 3JQ7B 5CHEA 3CBQA 3KYJB 2PXXA 1KSPA 3HP6A 3A4YA 2DXIA 4V3CA 2EHJA 2R4UA 4B9MA 1QYXA 3OM9A 1Z2EA 2CL6X 4X20A 3ROQA 3KYBA 4ABYA 3A1TA 2IXDA 4QULA 1ZESA 1EVLA 1Y1KE 3K94A 2P9TA 1UMBB 1U8AA 1U7DA 1E8DA 4RW0A 4ZAVA 2YFHA 5AM0A 4I2DA 4EHHA 4C30A 1T1JA 5K2OA 4DLXA 1MABA 2IEGA 2VDKB 4NDZA 2PMZC 2HNBA 2KKVA 5ICEA 5GOTA 3IMCA 5ALKA 1USUA 3JRWA 1E3SA 4G4IA 5L4LA 5DCUA 2D59A 1WSWA 3ZNNA 4PG8A 3FFAA 1Y5LA 2VF2A 2B99A 7AT1A 1M5UA 5KQRA 1SM4A 4LCJA 1M9NA 3BXXA 2Q5HA 3OQMA 2FB9A 2GOLA 2X14A 5KUTA 3BWVA 3TE7A 3IV7A 1WA5A 3JY6A 3M83A 1GAWA 4TMWA 3W6PA 2D4HA 4ZVPA 3U5TA 4M9JA 4MR9B 5IIOA 1W5AA 3QW2A 3HYNA 4PIMA 4ZCTA 3FYSA 4RY2A 4H7FA 4EZBA 2G4VA 1QO9A 4YDQA 2WQZA 3SQMA 1OW3B 4B3FX 5DULA 5A5DA 2VTDA 1DCKA 4B2IA 4YV1A 4EP1A 1Y8AA 2GPNA 2X9VA 2LPMA 4I0WB 5KG3A 2OYYA 3VPGA 3EBPA 2OZLB 3L49A 3G0BA 4LX8A 3KQQA 3L8YA 3DVAB 1R4MB 3Q6MA 3CNQS 4C1NA 4GPTA 3UKOA 2WV7A 1AIPA 3A0BU 4RL4A 2CFCA 2NXJA 4MB2A 4XW2A 1UZLA 1UWCA 2A8YA 2AQKA 3Q3GE 4S1VA 3F98A 3VR0A 1U2DC 4LPKA 5C4MA 5LMUB 3B53X 3Q88A 4RNCA 3V4RA 1ZXIA 1LTQA 3M9WA 2GYUA 1W581 2JVJA 3STUA 4K6MA 4JV1A 1UM8A 2C9MA 3GLVA 1E61A 4WK2B 3BD8A 3BH7A 4CIAA 3LPNA 2JRCA 3LC1O 3P9NA 2BJHA 3TLAA 1ABEA 1S8FA 2RIRA 5EMLA 3HNRA 4JS0A 1MSWD 4L74A 5ENZA 2CF6A 3ZHBA 3H87A 2AKYA 2IZOA 1FXWF 3W2GA 4JYPA 2A88A 1LI5A 8ICIA 4KFRA 1TB4A 3CG0A 1P9RA 4R0MA 5F4ZA 2QZPA 2EKDA 2OOKA 1F0YA 3RIEA 1KKMA 1YA8A 3QMWA 1WL8A 3GH3A 1JXMA 3RTBA 1GTJ1 4BKQA 3GZTB 4FWTA 1WB5A 1XRSB 3L7CA 3K8OE 4KWEA 3HP1A 4BMXA 5DSTA 1XV5A 3UUFA 5TMPA 4IIHA 2P2LA 3LBIA 4PGFA 1BDJA 4TM7A 1JSLA 4Y6PA 2X5NA 1MO3A 7MHTA 4JJZA 4OUDA 4UD6A 2X4GA 4FEEA 2ONJA 2QN7A 3RWMB 3QJ5A 1O2DA 4J3NA 1P72A 2G40A 3LVQE 5JNTA 2R6ZA 1EQAA 4G5SA 4NBRA 3SIPA 4WINA 4F4ZA 4IQUA 2FFQA 3L4JA 1CQIB 3CA8A 1KORA 2FX5A 4FQ7A 1B3RA 4P53A 5NLLA 4EF4A 3OT4A 4MV7A 4LZOA 5AKXA 2WWTA 4HGOA 3UH0A 3AILA 5BN3B 5BSHA 5J0RA 4NE9A 1V3UA 1Q2UA 1QOPB 3OTHA 3J80A 3DE2X 3KKAA 2R8JA 3CE6A 1XMPA 4MVCA 3GFTA 1SNYA 2MTBA 2QJWA 3FOBA 3V5NA 4DNQA 3CW8X 1LBSA 2C2OA 2FVXA 2X9GA 3NOXA 2QOEA 3QY0A 4G09A 2ZUDA 2X8AA 4RH0A 2B30A 4O4IB 4HEJA 2PMKA 3W79A 2HMAA 2GZRA 3OM8A 3F4BA 4Q7EA 4CM6A 1TYDE 4W7HA 1BH6A 4X84A 1UQUA 3JYPA 1IRXA 2C7RA 5K6TA 5EJ5A 1N8NA 5AKKA 3ABIA 4NCNA 1ZIPA 3M6FA 1NW4A 1N6LA 3OOHA 3HGMA 1BJRE 1ZQPA 4CMIB 2HUNA 1QANA 4BXOB 2EGGA 3OZTA 5TSDA 4EJSB 4PBSA 2QBYA 4D8XA 4PAQA 4NX2A 5G4KA 4M0KA 2A67A 4B5KA 4J2OA 4IDDA 2XDWA 4YAOA 2CL5A 1XZQA 4WGGA 1YR3A 3DD1A 4L3OA 3Q5GA 5JS1A 5BPFA 1EK5A 2PJZA 1FFEA 2P40A 1GZHB 2O3UA 4V0MA 3KVOA 1JKJB 3OX4A 4ILEA 2EQ5A 1ZRNA 4JFRA 5A1JA 1C81A 1IEWA 2XA1A 3NNDA 3L0SA 2AQ0A 3B13B 1EHCA 2GN2A 1RJWA 3CLTC 3FPCA 3VYTB 4CKYA 5TV2A 2F9LA 1IY1A 3MMNA 2BLNA 3EOAI 1PZEA 2XKAA 4YRSA 4OSEA 1T4CB 1L5WA 1GRNA 3H6HA 1SCQA 3R7LA 3PK0A 4ENUA 4BQIA 4BWYA 1TQHA 1JQ3A 4EYOA 5IYZB 4M1KA 3DOOA 5DG8A 3N58A 1SL2A 4L07A 2WINI 1ZH8A 5HNKA 4BVGA 3I52A 3RBDA 1KL9A 2DR3A 3ASZA 3JQ9C 1EVIA 4F2PA 1RSZA 2C5EA 3WRVA