2FDRA

Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
222
structure length
222
Chain Sequence
b'GFDLIIFDCDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVESEASIPLSASLLDKSEKLLDMRLERDVKIIDGVKFALSRLTTPRCICSNSSSHRLDMMLTKVGLKPYFAPHIYSAKDLGADRVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYPSHADRLTDAGAETVISRMQDLPAVIAAMAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of hydrolases/phosphatases-like fold protein from Agrobacterium tumefaciens str. C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 68
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2fdrA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2fdrA01
1Z4LA 5ALLA 5AM3A 3NRJA 3MC1A 3QGMA 5AK6A 1S2OA 3W5AA 2OYCA 1RRCA 1L8LA 2IA5A 5AI8A 3EF1A 3HYCA 2YMQA 5A3SA 4RESA 3OCWA 3VAYA 3N28A 3N1UA 4NV0A 3WKAA 3ONNA 3AR4A 2EARA 4AS3A 1K1EA 4MUMA 3A1EA 2W4MA 2Q4TA 5AKKA 2YMLA 4Y2YA 2GFHA 3W5BA 3ZX4A 4C4SA 4Y2PA 1ZD2P 4HGNA 1L7MA 5ALOA 1VJ5A 4HGRA 5ALJA 2O2XA 2P9JA 4Y2UA 4CNQA 2I34A 3MN1A 5ALMA 1LTQA 3IRUA 3UMCA 3SKXA 2OBBA 3EWIA 1SWVA 5AM2A 5AW7A 3ESRA 2WFAA 5ALSA 3AR3A 3FPBA 3SF0A 4B6JA 1JUDA 1Z4QA 2FI1A 2B82A 2VKQA 3IB6A 1L6RA 1CR6A 4F71A 1T9ZA 4HYTA 2P27A 4CF5A 4ZEXA 1VFPA 4ZEVA 2PKEA 2C8KA 2HI0A 3WKDA 3E8MA 1CQZA 4UASA 3QUQA 3QU9A 1SU4A 3FGOA 3KZXA 3I1YA 2YBDA 4UM5A 1RPZA 3WKCA 2ODAA 4UU1A 3NANA 4Y2RA 2D2VA 1TJ5A 1Z88A 1T5TA 2BDEA 3OCVA 3QU2A 3TLMA 5AVUA 4OD0A 2OM6A 3ZX5A 5AVQA 2PQ0A 2ZOSA 2HO4A 1RKQA 4FYPA 5AKHA 4C4TA 4RETA 4Y2SA 3A3YA 4KNVA 2G0AA 4OFZA 4UMFA 3L0CA 3B8EA 3I76A 3ZU6A 3SKYA 4IFTA 5ALZA 4OHFA 2RARA 3QXGA 3I28A 3KOOA 3ZVLA 3U13A 3NAMA 2I7DA 3OCXA 5ALVA 2RAVA 3AR8A 3FVVA 1RDFA 2YMPA 5AKXA 1TE2A 3UM9A 3K1ZA 4BX0A 4Y2TA 2MU2A 4CE6A 1Z4JA 2ZBEA 3L1UA 5AM5A 5A3RA 5ALRA 4OCZA 1YMQA 3NASA 3L8FA 3L8EA 5ALYA 1T5SA 1MH9A 4G9BA 1L8OA 4XPZA 2YY6A 1Z4MA 2FPWA 3SLRA 3QU4A 1ZD3A 2IOFA 2YMMA 1ZD4A 3L1VA 1ZD5A 4BX3A 1YS9A 2HOQA 2YJ5A 4ZEWA 5AVYA 4Y2JA 4CF4A 2ZG6A 2CFTA 3ZVNA 4C4RA 3ED5A 3UMBA 3AR7A 1F5SA 1NNLA 4J03A 2YJ6A 4QJBA 5E0OA 1AQ6A 4YGYA 2R8XA 3WK8A 4JB3A 3L8GA 3KD3A 3ZWDA 5FP0A 3QU7A 5AM1A 2P11A 1L7PA 4EELA 2G07A 5IT4A 3MMZA 4BYGA 5AVZA 5ALHA 1Q91A 1TA0A 2JAWA 1QQ6A 4HGOA 2YJ3A 2C88A 3OTQA 5AW2A 4YCLA 4L57A 3SHQA 4BBJA 5ALIA 2NO5A 2CN1A 1KYTA 2P69A 1YJ5A 5AM4A 4YIHA 2C9MA 4UMVA 2Q4RA 2GMWA 3QYPA 5ALTA 5T41A 4KNWA 2YN4A 2G06A 4KN8A 5AK3A 3R09A 2G80A 1RMYA 5AVRA 4F72A 3B9BA 4KX5A 5AI4A 5AM0A 3E58A 2O9JA 3QUCA 3PCTA 2HF2A 4XE5A 4O8CA 4Y2QA 4BEVA 4HGPA 3WGVA 3MPOA 3U7HB 1S8OA 3UMGA 3I6BA 1ZJJA 1QQ7A 5AKJA 3ZW7A 3GYGA 3AR6A 4UMEA 3QNMA 1WPGA 4DW8A 3PGVA 5AVWA 3U26A 2FDRA 4YCNA 3AR9A 2WF5A 4YCMA 2FPUA 3NALA 5AKYA 1X42A 1Z4NA 3L0YA 4UW9A 3M1YA 5AI0A 5A3QA 4L6CA 5AVXA 2HSZA 2R8EA 2I54A 3ZTWA 2QYHA 2I55A 3DV9A 3QX7A 5AW6A 3PGLA 5ALPA 2DQSA 2EATA 1EK1A 3EF0A 2I6XA 2WM8A 5ALGA 1NRWA 4UU0A 2NO4A 1Z5UA 4DCCA 2G09A 2HDOA 2WF7A 2AGVA 3QU5A 3ET5A 1L7NA 2I33A 3A1DA 2NYVA 3DDHA 1RLMA 2ZXEA 4Y2VA 4BX2A 2HCFA 4BEWA 4L6AA 3L8HA 4IG4A 2W43A 4QQFA 5AW0A 3WK9A 3P96A 2ZBDA 1FEZA 2C8LA 3U19A 3KBBA 1Z4IA 4YIKA 5AIBA 2JARA 5ALEA 3B9RA 1J97A 5AICA 3WKBA 5AK4A 5AI9A 4NWIA 1Y8AA 3FPSA 3RFUA 5AKZA 3DNPA 3WK7A 2R8ZA 2AH5A 2AMYA 3CZ4A 2FPSA 1ZRNA 4UM7A 4UARA 4EENA 5AVSA 3AR5A 1N8NA 5AI6A 4NAVA 3SMVA 3ZWKA 4BKMA 3R9KA 3U7EB 2BY4A 2WF8A 2YFYA 2GHTA 2GO7A 3WKEA 5AK5A 5ALXA 3DAOA 3KDPA 1RLOA 2BDUA 1VJRA 3CNHA 1QH9A 2B30A 2MSNA 2FPXA 4UAUA 3OCYA 2W11A 3WGUA 1U7PA 1XVIA 3ESQA 4GXTA 3QUBA 2R8YA 2B1RA 3D6JA 4Y3UA 4NABA 5AW4A 3U7GA 2B1QA 2HEGA 3W5DA 3N5KA 4HAIA 5ALDA 4FFDA 5AW5A 3S6JA 2YJ4A 4DWOA 2FUEA 3ZUPA 4UAVA 3QUTA 4J2TA 1ZOLA 4JDPA 3OCUA 5AW3A 4KYTA 5AVTA 5ALKA 2IOHA 1RMQA 3PDWA 3U7FB 5AW8A 3SD7A 1IWOA 1U2SA 1LVHA 4EZEA 2RB5A 3FM9A 4YH1A 2G08A 1U2TA 2X4DA 4Y2XA 1YV9A 2AUTA 3EPRA 4BNDB 2B8EA 2CFRA 3WK4A 4GIBA 1RKVA 3ET4A 3FZQA 2WHEA 3OPXA 4BNDA 2JGAA 4XQ0A 4NFLA 2QLTA 5AKIA 2GHQA 5AKEA 2C4NA 3E84A 1O03A 3IJ5A 1J8DA 1U7OA 1Z5GA 4AS2A 1L7OA 5ALWA 3OCZA 1QYIA 3N8GA 4MWOA 5AVVA 5AW9A 1Z4OA 5AHXA 1YDFA 1QQ5A 2PR7A 2FPRA 3ZTYA 2FUCA 3NUQA 2B0CA 1Q92A 3NIWA 1WR8A 4H1WA 5ALQA 4EX6A 1Z4PX 1WZCA 2ZBGA 2B8JA 4EEKA 2HX1A 2WF6A 1U02A 2OA0A 1RKUA 1RMTA 1XPJA 2Q5EA 2ZBFA 3KC2A 4DFDA 2JAOA 5IT0A 1RQLA 5AKLA 2HF7A 3WK6A 1PW5A 4I9GA 1N9KA 3R4CA 5ALNA 1O08A 1EK2A 1RLTA 2G1AA 4FE3A 4PNHA 3W5CA 3E81A 3ZVMA 3ZI4A 4XOUA 3L5KA 1ZS9A 5ALFA 3BWVA 2MU1A 2HHLA 4G63A 2FEAA 1SWWA 2WF9A 3J7TA 1XP5A 4I9FA 1NF2A 2IOFK 3AR2A 4UMDA 2JAUA 3N07A 3QLEA 3A1CA 3WK5A 3L0BA 5ALUA 3M9LA 4UATA 4AP9A 4CF3A 5AW1A 1ZRMA 5AI5A 3F9RA 5AKGA 1YNSA 3BA6A 1TJ3A 5IS2A 1RC8A 2RBKA 4HGQA 1RQNA 1Z4KA 3RF6A 1TJ4A 5AESA 3L7YA 4E88A 4KX3A 2IYEA 2CFSA 4EX7A 5AIAA 1WVIA 5JJBA 2EAUA 3HLTA
chains in the Genus database with same CATH superfamily
2GD2A 4OAQA 3ZXUB 1ULAA 3TJRA 1QM5A 3GA7A 4DRXA 1X87A 2UYGA 1M8FA 4BZQA 4ZO6A 1QHNA 4NV0A 4WLOA 2YRXA 2QS9A 4R1NA 2JLBA 2IDKA 3FSEA 8ATCA 2CXUA 5CNJA 3NBAA 3H97A 1BVSA 1WQ4A 8ICLA 1S01A 3KTDA 4LZNA 3ZGVA 5BSHA 3LBAA 3VR2D 5BN4A 1J5XA 1X9SA 3EWIA 2J33A 1R5OA 2X7HA 1TM3E 1VQ1A 3TLEA 4J16A 3AVWA 3PRYA 4UVEA 4V03A 2VYVD 5ANRB 2IH4A 1T5BA 4E07A 3LC1O 4FR0A 4EAAA 3BREA 4EO4A 3IUJA 2PGNA 1BN7A 4NIMA 5AVOA 5LCXA 4DB2A 3OICA 3GZNA 2ZTCA 2G9RA 3KXIA 2J7KA 1CBUA 5KNDH 4JAVC 4R71A 2Y76A 4PHTA 3C41J 2CZQA 4P3OA 3SKYA 1ZQLA 4NARA 4OHFA 3RS0A 3O4RA 1O0SA 3TXYA 4AJPA 4MIYA 1QZTA 4WZ6A 1HTTA 3WLLA 4BRZA 9ICRA 2C3OA 2ZKLA 6REQB 1ACJA 4JQSA 1ZPDA 3EA0A 4QECA 3IEUA 2R8IA 4RULA 1Y3FE 4LV5B 1WB4A 1PWEA 2YHIB 4ZV4A 5F5LA 4M55A 3K6RA 3E27A 2P2ZA 1XA4A 2YCLA 3RYHA 1OT3A 7REQB 5FI3A 1C9JA 2WWGA 1WQ1R 2ZR7A 1EXWA 2D1RA 5GINE 1TXGA 1TEHA 2W0SA 3GG2A 4BVLA 4J6EA 3WADA 1RM0A 1INLA 2G80A 5BSTA 2KYRA 3GNSA 4HMOA 5HJ2A 4BVJA 3E58A 4XGKA 1POWA 4KXMA 1ZCAA 3JPOA 4OXXA 4RPJA 1M2OB 3I6YA 3KJNA 3Q85A 4DYHA 4PICA 4N1AA 5CT6A 3RTVA 1VFNA 4C5BA 5BN1A 3ICCA 4BO3A 3BXZA 3QENA 3KQTA 4ZRNA 2H17A 3FHTA 3PNSA 3QKIA 3F97A 2BGGA 4B9TA 3RTAA 3D6HA 4RK7A 4MB6A 2RE8A 3RHZA 4PHGA 5A03A 2JIZA 1Y1LA 3R3ZA 4M8KA 1S8NA 1MW9X 4GR4A 3GRKA 1L7RA 1QSLA 1WDWB 3A6DA 5J4KA 5L7YA 5JAQA 1NW4A 3ER9A 5I45A 1WSDA 2F77X 5KCZA 1XQ9A 3OUZA 3D6AA 3BSWA 2J5XA 3IP9A 5KFWA 3MTDA 2PAAA 3HKZC 5LBTA 1XWFA 1NULA 2B1RA 2AHOB 4Q34A 4JWKA 4DA7A 1B8NA 4GNKA 2X1VA 4LQDA 4EVIA 1EI9A 4MEAA 2P4HX 4KSYA 1CY7A 1C3OB 4PJ0U 5KFVA 4CDMA 3PC4A 2JI4A 4B4OA 2FMQA 4IOKA 2IOHA 2BC9A 1W87A 3UT5B 3M3DA 3D3NA 2VZ8A 5DGBA 4XA8A 3LWMA 5LDGA 3B82A 1CLEA 1YT3A 1L7OA 3CB2A 3CZPA 2JVKA 4AZVA 4NZYA 3OQVA 3UUEA 3NBXX 4B9UA 4TTSA 5B55A 1LJLA 2WJHA 1HO3A 4NE7A 3UTDA 4AZ3A 4DJDC 4M1MA 4X1IB 2DCMA 5KG4A 4PYLA 1AKQA 2OECA 2F7SA 3B1XA 4GQIA 3ZHQA 1XZHA 5H68A 4BNNA 4TMYA 1RYYA 4AP5A 1AN9A 5GQSA 3FCCA 2VJKA 2E2WA 4I9NA 2ADFA 5LYYA 2ORED 2UZ3A 1CUAA 5DLYA 3PC7A 1IQPA 1JAHA 4RXTA 4ESVA 4XYGA 1H0HA 4KXXA 1KOLA 5CTAA 3AKZA 3C48A 5DNAA 4N3NA 3U3RA 5EKUA 3WGTA 1QLHA 1DAHA 1VL6A 1DIOB 2GX6A 3NVKI 5KPJA 4DEVA 3NHJA 4G0MA 4LAFA 3SIWA 4CNQA 2ZKIA 3LDHA 4N5NA 3O8RA 2HHAA 5T7BA 1DAFA 3EC2A 4QHSA 4U2CA 3HACA 5JJCA 3H9QA 1D7AA 3HJBA 1JRPA 5KNCA 1V8DA 3GLGE 1BHO1 4GMXA 1QONA 1DC6A 3BEOA 3UOWA 4KV9A 3NANA 3RQSA 2FUG1 2PH7A 3MRXA 3V33A 1KVSA 1ULTA 3H7AA 3INNA 3L92A 1TC2A 5IMSA 3QOYA 4WFJA 3F47A 3FUCA 4I9HA 4YN3A 2IRWA 1TE2A 4KXQA 1V96A 1D2RA 5IMBA 1CJCA 1V9PA 3OCCA 2AN1A 4WADA 3ORQA 1AS3A 4Z8YA 1U90A 1X1AA 2WPNA 1SD1A 1UAYA 5EKDA 3W6UA 4QBFA 5DF1A 4KREA 2OAQ1 3W5HA 2ZI5A 1QTIA 2ONZA 1P62B 1W7AA 4H1TA 5LU9A 4D92A 2J9RA 2QRLA 1S0UA 1EFVA 5CVUA 4YUZA 3GUZA 3VVBA 2B5VA 3PUHA 3ORRA 2XCLA 1K7CA 1N2CB 4IVNA 4WNAB 4NLNA 1U5BB 4DLYA 1TW3A 2XUPA 4Z2YA 3ZTTA 2HY7A 4ATNA 2D3WA 2LIVA 2PLAA 3CURA 1N5JA 2KKVA 4C4AA 1HDGO 3G6YA 4CV3A 4OB8A 1RFGE 3TZLA 4IDQA 3EXIA 1RXYA 2C7GA 5TMEA 1O95D 2WSSA 4O3RA 3ZJUA 2DJ5A 4D81A 1C1XA 1DBRA 3H1TA 5EA2A 4O3QA 1G20B 5IM4A 5LYJA 2RHMA 3DA8A 1Z8FA 4JEUA 2K8BB 5SY9A 4I6JA 4DNXA 4FDLA 3H5WA 4XWWA 4WJLA 2WAQF 3DOEA 5BWLA 2XCQA 2V65A 2VHXA 1Q12A 1HKHA 4AZ0A 4E2WA 1HUZA 3WIEA 4MCAA 3S2ZA 2F9MA 4KLSA 1KQFA 1ELOA 4J3JA 3M70A 4N65A 1JQKA 4JUDX 1RIIA 1NYRA 4KI7A 5C9ZA 3GLFE 1L5SA 2Q99A 2XDAA 4C43A 4HLNA 2Y2VA 3QEMA 1FS6A 4R7ZA 2Q2WA 3SK0A 4I27A 5DP2A 2XRZA 3GC6A 4R51A 3CNOA 2J9FA 3LHKA 1Z1VA 4FFDA 5AO9A 3NPAA 2X2FA 2VQSA 3R7LA 1NR5A 3DTVB 3BS7A 3FPFA 2JFGA 1IWOA 1U2SA 2VHEA 3FM9A 5KYGA 4J7AA 3SDSA 3AFNA 2QVCA 2IWHA 3HEMA 3U56A 1ZZEA 4IIEA 2DULA 2E18A 1LNQA 3K09C 4MGKR 3NT4A 4WD3A 4WXYB 4PC7A 2DWCA 2Q07A 1H2AS 2TSYB 4PS0A 3RIMA 1KKMA 2L2QA 4EKYA 2Y1JA 8AT1A 4S12A 4QTYA 3VH3A 4K87A 3N2KB 3W8EA 4KE7A 1SN7A 3T3MB 2I5HA 2Z1DA 5DGAA 1BDBA 4BFWA 1K8YB 5BV8A 4LVSA 3ICXA 4AP9A 3CH4B 3BIJA 3PJEA 2R6DA 7ICTA 1HTBA 3IC5A 4DBZA 4Z4CA 2R96A 5C4IA 4KVFA 3NBKA 1JTFA 4KXUA 5A4KA 4LDAA 9LDBA 2RHRA 1EWQA 2JZNA 5IVHA 3L0IB 1WSWA 4CIWA 2F2AB 2ZRKA 2K4IA 2GVZC 3KDSE 5K2MA 1UWKA 4F6LA 1QV6A 3LZDA 2ZPUA 3SJ7A 4QYTA 1G291 3FF1A 1J42A 2V45A 2QMOA 3N0RA 2PO7A 2H2DA 5C8YF 4UASA 1ZOPA 3DAGA 3ILSA 2GERA 4V0SA 4IIDA 4P80A 4DLSA 2M98A 2NUPB 4UU1A 4MQEB 1KOGA 5LSAA 4KRXA 1I51A 2I1WA 2Z04A 5D84A 1SVMA 3ZHBA 2W83A 4O2AA 2XWSA 3V4LA 3DE4X 3M49A 2LXNA 1EFKA 4J4TA 3NKFA 5AKXA 4WAUA 3ESZA 5BNIA 3DR5A 2FQXA 2CUZA 2NSDA 1Y6FA 4RAOA 3KT0A 5CYGA 4BTEA 1ZC3A 3IHWA 4R3UC 2WRZA 1K27A 1E3WA 3L4KA 1DMSA 2NUTB 1E94E 3EJWA 4W5NA 3SBDA 2WA2A 3AJ8A 1SV0A 3RFVA 3VOTA 3RJHA 2A78A 4RCZA 2FG5A 3L7BA 4YY3B 4ZOLA 5L4SA 3A0HU 1FVOA 4IM7A 4JR0A 1Z26A 3LL4A 1EUDA 5BXQC 3CCFA 5JJLA 1FOEB 4Z3KA 4X84A 2P69A 1YJ5A 2K7ZA 3PQCA 4PPGA 4CMKA 3NNDA 3NI2A 4DL6A 2GK4A 3M3PA 1X7DA 1G5TA 5A5DA 2JI7A 1XJQA 2HF2A 5BSRA 3Q12A 1GN9A 1A7UA 3OAAA 1QQ7A 4DQLA 3P5SA 1NNSA 1EZZA 1T29A 5JLJA 4X00A 3WLKX 3IMCA 1SG6A 4NLLA 2HXGA 4W5JA 3A7DA 4F3OA 3UK7A 4C0QC 4I4IA 1L1RA 5FADA 3NJRA 1Z4NA 4DR6B 1Z45A 5A04A 3N2YA 4YMOA 3P2OA 4G85A 1F4VA 4P81A 2PXHA 4US0R 1NBHA 4ZA2A 4H7DA 1KVQA 2FPOA 1ORVA 3CWCA 3JR3A 1KJYA 2GCPA 2Q62A 2ZSFA 4REQA 4Y6LA 4YXFA 1MO3A 4P54A 4A2QA 1AKVA 4LXIA 2QB0A 2AZMA 5CYFA 2CWDA 3G0GA 2VDVE 3QPBA 4RZSA 3C85A 2ZIVA 4L73A 2Q9AA 5AI6A 5EFOA 3DR3A 1XI2A 3U7IA 4YDQA 1PJTA 3PPWA 4IIJA 3UMRA 5YASA 4ZYUA 4GVXA 3ME5A 3IERA 4YJHA 3CPSA 4RM3A 3VU1A 4QTTB 3OF2A 1BD3A 1J23A 1FZTA 3LQ2A 4COKA 2XC9A 3W2TA 2ON6A 4C03A 2WNHA 4YFVA 4GPD1 1P2BA 2SKDA 1V3TA 1OWPA 2SCUA 4W5OA 3C3DA 1AF7A 5F23A 1GJRA 4OB7A 2FZKA 4AU1A 1XRMA 4CIYA 8ICSA 4TQ9A 4RYLA 5DCLA 1RMTA 1DKPA 4RHCA 4L27A 4C3UA 4NCBA 4CW7A 3O26A 2GF0A 3K32A 2RK3A 1KI3A 1GDHA 2VTVA 2GRAA 4E13A 4HCJA 1H0RA 4BV2A 3OFKA 4MYTA 5LWQA 1WPRA 2R18A 1VPDA 2FFJA 2JD2A 4KPGA 5DI3B 3V8NA 1VDVA 3KKQA 4KMMA 3PC3A 2J46A 5CRXA 3D6FA 4FE7A 3G82C 3AVOA 3JATB 1RXUA 2C61A 4AG5A 1JDZA 3UC5A 5KWJA 4WLFA 1A5ZA 3LW8A 1XCLA 1AHIA 4OSEA 1XTZA 3CUWA 3RU9A 2R6HA 4JKYA 3RW9A 4LXYA 2ZXIA 1YQGA 1MAUA 2PBFA 1D4AA 1YRBA 4C6TA 3C3WA 1C1DB 3HCBA 3SJZA 4FT4A 1JKJB 2ZULA 1GSOA 2JZOA 4WOCA 2MSWA 1DKUA 1UC9A 5ITZB 4WLUA 5ALSA 2BFEB 2BMWA 2GOYA 3PR2B 3T7IA 2CJPA 3PO5A 4F3CA 4OY3A 5EI5A 4MR8A 3VKWA 5EJ9A 2TMKA 4C3ZA 4IAOA 1XCBA 4JH0A 1AXGA 1HOTA 3FDXA 2GK3A 4WBNB 2KSOA 3KOWA 4CQJA 3EFHA 3ILXA 4PCAA 3G6XA 1PFKA 1UDRA 2MAXA 3T9AA 4BUGA 2RAVA 4KQEA 2YMPA 3NHYA 2RH9B 4G0XA 3TM4A 2QLMA 2XZTA 1G66A 2OUIA 4DEXA 4D9HA 3T5BA 1R8XA 3LUCA 1N5WA 5FV7A 4BC1A 1F8GA 3AUAA 4DJAA 3RS2A 4D8UA 3CZAA 3CUVA 4QAQA 3ESYA 5LU8A 2A6PA 2JLVA 2V74B 2OV8A 2Z3WA 4JKOA 3W3ZB 1CR4A 3TLYA 2YWJA 4RIHA 4XEUA 4DOMA 4CQLB 4IIBA 4C1BA 4LZLA 2GCGA 4FI3C 1ML4A 4RD3A 5CAEA 2AK2A 1FW6A 2VTEA 1V97A 3EK2A 4O4IB 2AFHA 3C3PA 1HQDA 2QX4A 3PD7A 1E2KA 2WW8A 3NFRA 1EMDA 1QE3A 4OUDA 1W96A 4FFOA 2YZ7A 2WD8A 2ZRQA 1B6TA 4RGBA 1MU0A 1K1SA 3GJYA 5TXGA 2EKDA 4B0PA 3NYRA 3IUNA 3M1LA 5JYCA 1OREA 4NYJQ 1FX0A 121PA 3QRWA 3SQLA 2R8GA 2P6PA 4BKOA 5J3JA 2FAXA 1CP3A 1OI4A 1FU7A 1NT2A 4QIHA 2WMNB 3WYCA 2I4IA 2GXSA 2IUTA 4GGPA 4LGCA 4CM4A 2WF7A 1JX6A 1Q1AA 1ID8A 5BW5A 1CK4A 4RFVA 2R44A 5CHEA 3SF8A 4E3ZA 3NHKA 3O1JC 1M83A 4YJGB 3T99A 3EVBA 2XI9A 2D1SA 3PTZA 3LMKA 1WZUA 5AVSA 4I19A 3GJ4A 2ZJ3A 4RJTA 1RYDA 3JQAB 1KTIA 2OKGA 2RRDA 3O7WA 3GFPA 3RSOA 3VC1A 2DH5A 2Y3IA 3UQZA 1SIJA 1JEDA 2AVNA 3OFJA 4RJJA 2JFXA 2JZBA 4HAIA 2PQMA 4HKTA 3BK7A 3KLMX 3CVWA 4R8LA 3DEHA 4QZBA 4LOKA 2VQEB 3W5VA 3FGZA 1DRWA 4Q1FA 4C20A 4BNLA 4N5HX 3L0OA 1FL9A 4FUTA 4Y0AA 4BUCA 1DEKA 2FEKA 4GZ6A 2G28A 3AETA 3KXLA 3CB4A 3N8GA 3FWKA 4EWLA 1UBMS 4NYJR 2TECE 3D0QA 4L16A 4Q9IA 3KQQA 3D0OA 4L0QA 2C77A 3NVVA 1VI5A 2XHEA 3WK6A 4YRNA 3R4CA 4JVSB 3WIOA 4MDEA 221PA 4WI1A 1V5IA 2AMVA 1RAAA 3IG5A 1G21B 2I3ZA 1A1VA 3T9FA 4QYIB 5KYKA 2IYLD 2R84A 3T1QA 5TJHA 1TZBA 4QC2A 1DO2A 1IXYA 3SEZA 4JSTA 2B4YA 4IGEA 4Q4CA 2HGSA 4Y8VA 2WHXA 2G71A 4FFBA 3AM9A 4UDNA 3IOCA 4GMGA 2CC2A 4LX8A 1E6CA 4X1KB 2R6ZA 1RRCA 3PNYA 3HFGA 4CM8A 4D3ZA 3M82A 1DKRA 4PYJA 1EJ0A 3UWPA 3ONNA 1ZITA 1UXOA 2OK7A 1BGVA 1OR8A 2A92A 4QUBA 4N9WA 1L8XA 3G0DA 2GEFA 5J2BA 3KYBA 2H2WA 4HGNA 5LLSA 3KR2A 1Y9JA 1RAGA 2PYIA 2LCIA 4J7UA 2JH8A 4E09A 2VK2A 1JLSA 3O1HB 1T3HA 1QAQA 3RSCA 3HV2A 1DWUA 1RI2A 2A9OA 4CWAA 5KYTA 1ZN2A 2ZS7A 3QP9A 3SSNA 4RTPA 4D9KA 3OA2A 3H19A 2C78A 3TTXA 4P36A 1W59A 3P20A 3BGIA 1W85A 3BCUA 3NRWA 3JVUA 1TVKB 3GD7A 4EUSA 1OYOA 2ZT8A 3R0XA 4I50F 1R10A 3FCUB 2CLIB 3IURA 1P72A 4F0JA 5D00A 2VJPA 1XSNA 5C32A 2UXBB 1WEKA 3U7QA 2ZFUA 2HL6A 4OA8A 3WSVA 5D3KA 4MZXA 4A0FA 3NH6A 1M0WA 3GH3A 2FY8A 4Y2JA 4LNUA 4WWHA 3KZ1E 4YPOA 4GI5A 3PUIA 4HWOA 2OMKA 3LY7A 1J0XO 1WMAA 3V00A 2C7BA 5J5AA 4FJ1A 1I6KA 3PT5A 5T4FA 1QQ6A 5ADHA 5IKPA 1AV7A 1KMQA 4D41A 2XUKA 2ASVA 2HM7A 3F74A 1KO8A 4LV8B 5EGNA 2O1EA 1N1DA 5BWNA 3W4KA 1DUIA 4AJLA 1Q0TA 1EP9A 5HFJA 3O3NB 1IZ9A 1IHOA 1GCOA 2B7LA 2GRUA 5TGTA 4O4JB 4WY2A 1GITA 2XUGA 1D0VA 1MQAA 3U4QB 1D6JA 1S7CA 2FN8A 5IF3A 3X3HA 1ZWLA 4JOBA 3BAZA 1E63A 5LN1A 2FJUA 1A5TA 4R6XA 4DR7B 4BEBA 1DELA 4RJKA 1PL8A 2P6NA 4RQ6A 4EUNA 2E4YA 5ILQA 3PNVA 1OW5A 3COSA 1V8FA 4UU8A 3PCXA 1YNOA 3HCEA 2CB0A 3RO7A 4RGQA 3MJTA 2D1YA 1FQOA 5EXEA 5A0VA 2GEBA 4FD3A 4WOPA 3IT3A 3RJZA 1A9XA 2BUBA 4II2A 2JARA 3B9RA 1X7ZB 4PV7A 3K4HA 2EJBA 1D2CA 4KRFA 4F4ZA 5BYKA 3PI6A 2GXQA 5HGXA 5DFAA 4A0RA 2H7VA 3R9KA 4H3SA 5GAJA 1YAHA 4BX9A 3CU5A 1VJRA 3VHQA 2C3YA 10MHA 4IHJA 4GQAA 4Y3UA 2P9YA 3SU8A 1ORWA 4K6HA 1JU3A 3QVLA 2EYUA 3JYNA 1F0NA 1PSDA 3PXBA 3BPSA 2HO5A 3L6EA 3NVDA 3E5MA 5J0OA 1QZZA 1YZFA 1PBNA 4C2TA 1XS9D 4JNCA 1RR6A 2TYSB 5LZ7A 1GZVA 3GP5A 3U3MA 5FFNA 4JA2A 1IZ7A 1IBLB 2FTKE 3MGIA 3B36A 2DFDA 3SXUA 1XX6A 2XUJA 2PR7A 1XK7A 4P38A 4YRIA 4EX6A 1IEVA 5IVKA 1PGOA 4LDNA 5C5IA 5BNFA 4BUZA 1A5SB 2REQB 1EK2A 1RYEA 1YIOA 2C7QA 2UVDA 4LJ7A 4J6FA 2ZYAA 3AF0A 4AJKA 1SGWA 9ATCA 4BO2A 3BQ1A 2ZDQA 3NAZA 1VKJA 1Z75A 3K09A 5B1YA 4I1YA 2WSIA 2ZWPA 3C14C 2YHUA 5CVVA 2D5IA 4R64A 4M47A 3GP3A 1HYGA 1R0BA 4D4GA 4LTMA 4F2WA 3SBEA 3W7VA 3D3WB 1U63A 1MT3A 8ICGA 1NLMA 1BE0A 2NU8A 1OBOA 2OAGA 3N5CA 2GCEA 3P2IA 1E2IA 1SVSA 4AD8A 4R0NA 2XBUA 2NG1A 1VJ1A 2BH2A 5HUQA 3CWZA 4K1XA 2GZDA 2WJ4A 3GIDA 5G0UA 4OGFA 1MEJA 2V3VA 1NIPA 2R6R1 3MN1A 4B4DA 2MINA 3MINB 5CEFA 1O5TA 3A4TA 1YRQA 2JFFA 2YXNA 4YQEA 5GOTA 1Z5OA 2QF7A 4V1CB 4M9XA 1QC5A 5KWVA 4K6KA 5A4DA 4X97A 1UMDA 5FH9A 1PJ3A 2QK4A 1QGUB 4D0SA 2VWHA 1TIPA 1PJRA 5JQGA 4EBDA 3RB4A 1AURA 2VYQA 2C94A 3KQUA 1Z16A 2QSYA 1U4BA 2BZ1A 3LLSA 1KH2A 5DGCA 3GJSA 3KKZA 1T3SA 3T54A 5J2UA 5J2TB 3DLTA 3RUIA 3TXXA 3LFHA 4BE7B 2HSGA 3JALA 1Y1RA 5ALVA 3AR8A 4ZMSA 1N3IA 5FA5A 3E9MA 3FMIA 3JZIA 2BMAA 1XRQA 3OLYA 3THVA 4XQ8A 5CCEA 1L8OA 2PT5A 1I4LD 1YZHA 1ZUIA 5JRJA 3TTWA 2YMMA 3NYQA 4X7MA 5GP1A 4LZGA 2NT3A 2QTLA 1NNLA 1NN0A 4QULA 3KD3A 1ZQRA 3ZWDA 2GTPA 2VG8A 5L9AA 4ND2A 2VIIA 1CUHA 4XPIB 3SFZA 4EPRA 1SVLA 4J3NA 5KPDA 2J0EA 3GVXA 4F4HA 5BOVA 3EY4A 3AP3A 1DIGA 4UMVA 2PT6A 2IXGA 5HDQA 1H6BA 4AMGA 3K8QA 4CIBA 5JYEA 2L82A 3WE7A 5A05A 2WD9A 2V4QA 3LHIA 4OGLA 5DHPA 3AL0C 4XOIA 2Z0MA 1PL6A 4AJ4A 3HB5X 2UZ0A 5KFMA 1O57A 5KSPA 4XUCA 3H4IA 2ZWOA 3D2QA 1QYRA 3KJFA 3VHRA 1EUCA 3LSTA 2OD7A 3U3JA 3ZTWA 5IT5A 3MCWA 4BCBA 1KETA 3DKRA 1LRKA 3I9V6 4P5EA 1R16A 5JAOA 3N2LA 2ZUTA 2OQRA 4ED2A 3EGXB 3EQ6A 2QUIA 1KU6A 4Z1OA 1IJKA 3D02A 2IS1A 3V5NA 4RA6A 2IHBA 3HG7A 2HCJB 4K7JA 4KMUA 4MFCA 2NMVA 1C8VB 4HVAA 1DPFA 5JANA 2ESEA 2ID7A 3T5DA 1ESCA 3ZH2A 4FK8A 4KLIA 4WZBA 4K0RA 1UBLS 4L9AA 3NHLA 4RQ8A 3KOZA 1UKVY 3FX2A 2O8DB 4A82A 1L3BA 3EUAA 5F1OA 3HUTA 1HUQA 1T1GA 4KFSA 4YP5A 3AESA 3NTXA 3ENKA 2QT0A 4BO4A 1LVHA 3PFNA 3LY9A 4S1VA 2RHDA 4I4TB 4BNDB 1AKRA 3BF8A 1RJWA 3EXHB 4JJFA 4EHJA 1DHRA 3KYCB 1F60A 1WZEA 5L4NA 4AS2A 3K0HA 1UXJA 2UVQA 2J7PD 3NXKA 3NT2A 3NAQA 3DMFA 4BP3A 1N5IA 1IFXA 3MELA 5HE9A 4DO9A 3NBUA 2X9LA 1P9LA 3DPSA 2WF6A 1UBFA 4JB2A 3KUKA 2G5GX 2G1AA 3HRKA 3RF9A 1V45E 3TSZA 3ZGNA 2I4RA 2MSLA 1HDYA 3BWVA 2BFBB 2EKBA 2EQAA 1EBUA 3LXMA 4PLVA 5FTLA 3QVOA 1E2JA 2RI0A 2J31A 5AW1A 4DQIA 4ECSA 4F2RA 4U2KA 1G6OA 4BU1A 1F17A 1W6UA 1OPRA 4V2IA 1BMFD 2ZRJA 3ZLUA 2HJ9A 2JC3A 3HJCA 4NV3A 4ZEMA 3C23A 5HP4A 4LTDA 2J9GA 1OA0A 4URWR 1GA4A 5I7SA 4BRUA 4DV1B 3AW9A 1JHQA 1OTXA 3ZLTA 4D4IA 1TA4A 3IOYA 1VE7A 1Z2NX 4KR9A 1HXHA 2BCUA 1WCIB 3F6YA 1O9HA 8ICKA 1P81A 3WB2A 1HPLA 4RXUA 1PWXA 4EHAA 3EWNA 2PMZF 1M67A 3NATA 4TLLB 2YQZA 2OE2A 3SS8A 1ZRSA 2H31A 2P27A 5KFDA 2ZU6A 2RGRA 4NEHB 5LNK1 2XQKA 4LNAA 3G5MA 4P4TA 4BFLA 4ZI5A 2I8CA 1D2NA 4DRZA 1MOZA 1IEWA 1A2BA 2AU0A 5CNIA 1GFIA 3EVNA 4IOJA 4MB2A 4EYHB 5GTHU 1ZUD1 2FHSA 3RIXA 3MT9A 5JPDA 1P5FA 4RQBA 3L0CA 2EWVA 4IFTA 5CA0F 4F97A 3B7GA 3OCXA 3SHVA 3UQ0A 3PQ5A 4QIWF 3L4EA 3KYDB 2Y68A 1MB2A 2Y0PA 3A05A 4LWZA 4XPZA 3GJ7A 1U9JA 1TV9A 3A9RA 1FNDA 1GCGA 2WD7B 4KE6A 3EBLA 4A8JB 1TU0A 3HKCB 3UJAA 1JVBA 3FMGA 1IPHA 3QYFA 3R4VA 1W76A 3OHBA 5F77A 1IAQA 1J0CA 3LRTA 2O05A 1UOOA 4Z0NA 2CK3D 2ZROA 3OTQA 1HG1A 1BCSB 3JARB 5ALIA 4XWYA 2RDIA 4MF8A 4IDHA 1N78A 1I5RA 8LDHA 4G09A 1FNCA 3X1MA 2BI7A 3UKJA 1P1BA 3EZ5A 9ICPA 2OCXA 2O1SA 4WESB 4J0GA 3RG8A 2C82A 4XIJA 4O5OA 4BCDA 1KRWA 4QU0A 5EE5B 2WF5A 1JKFA 1DFGA 4QD3A 2A3VA 1ODTC 4OKNA 1LPBB 2F17A 5K45A 1ZMOA 4UU0A 3QFCA 1KFBB 2G09A 1QX4A 1J8YF 1P5ZB 4NBUA 4B81A 2OL4A 4HV4A 2ZQ5A 3QPAA 5JSFA 4P3KA 3Q8KA 3OHPA 4JQOA 4XSGA 3EZLA 3QEAZ 4OGGA 4YRMA 4JELA 4EEYA 4Q3NA 1I94B 1XVLA 5ERGB 1B22A 4HUQB 2WZBA 2QOEA 1T8RA 3PD1A 4DQ0A 4J1NA 5I9MA 3QE3A 1B42A 3L8ZA 2YWGA 3WSTA 1JHMA 1B74A 5THQA 3U9LA 1O58A 4UB5A 4IFIA 2WFLA 4NXMB 3K0AB 3W5DA 1CJSA 4ZREA 4EGQA 3I01A 3FLEA 1D6SA 4TWBA 4DAOA 2HZBA 3D3QA 3NG1A 4DF8A 4YR2A 2HQOA 4Q02A 4ZO9A 1L3SA 1WVGA 1R2QA 3ZUGA 5BWOA 2FPGA 3CRXA 1AXEA 3P2EA 1Z18A 3GCGA 5CM2Z 3NJ8A 2H1WA 4FW9A 3LLCA 3R7SA 1NXSA 4BRWA 3Q72A 2YWCA 3OECA 2LBOA 2DBVO 2XJ9A 1W36D 1XZKA 2JAOA 2PL3A 3DDWA 1QLJA 3Q7IA 3HBFA 1U2PA 9ICJA 5L3QA 2DXIA 4R1QA 5A5GA 2BHNA 1M1YB 2YIDA 2DHQA 4PGQA 3OQHA 1BXRB 1PS9A 2ZYUX 4I8DA 3GRFA 4Q3KA 3RC2A 4MI1A 3S27A 4QJ3A 3F78A 1DIAA 1B76A 5DXJA 3A0RB 4TV9F 1UL1X 1P0PA 3Q6NA 3QIAA 3Q7EA 2AFIB 2EZZA 4L8VA 4YP0A 1T8WA 1N7IA 1M8KA 2AG5A 2AJTA 3PRHA 2R6JA 3CJRA 3GT7A 1P5HA 1FPMA 3BGVA 1MJGA 5LPNA 1TVMA 1SXHA 2XY7A 4UJ3A 2YXBA 4UHJA 2G8NA 4MWGA 3HLYA 2Q4TA 4M8LA 4BZWA 4KIWA 3ZD7A 5KSOA 4DUGD 2J08A 4G81A 3BIWA 1WB6A 5JVDF 1K2VN 3ZI7A 1BCRB 3ZV6A 1WXDA 1H1LB 1N7JA 3T15A 4FZLA 3TRIA 1DI0A 2OBBA 1Q21A 2C0PA 3OPYA 3IP7A 3HA7A 2C83A 2P3QA 5HK8A 3KHSA 2R8JA 2C8KA 3R7WB 4J91A 5FBRB 3WDSA 4KITB 1SU4A 3VU9A 1I9CA 6AT1A 1ZM7A 3R5KA 4UM9D 4BQNA 4UOEA 3E53A 5BORA 3K0CC 1B6RA 1VBKA 3MFYA 4YT4A 2OORA 2AR7A 3HFJA 5H82A 1DWPA 1UT5A 3DJYA 3LXUX 3QJYA 5JI3E 1EQ2A 3DOIA 4TQGA 4FLEA 4N12A 4CDGA 1I6WA 1Y5MA 3T4UA 5D3MB 4FPXA 2LM4A 2B2NA 5L95A 4XUSA 3Q3HA 4WN9A 3R6LA 3AQFA 1EJ2A 4F86A 4W5HA 3TIFA 3OF3A 5JAMA 3ELDA 3GJ0A 2D5LA 1NW6A 3E1GA 4X62B 1JR3D 3TW0A 3FPKA 4X20B 1LJUA 4M0PA 1AU9A 1TM4E 1RZ3A 2G5IB 1S0OA 3S40A 3RAQA 1WEHA 2CN1A 4NTZA 1Z00A 3QYPA 5A6SA 1E6UA 4JGBA 4Q24A 1WLYA 2Q7DA 2OHVA 3KQPA 1SXJD 3FI0A 1WULS 4TMVA 2X5NA 1W52X 4K9KA 3FMOB 3ZW7A 3TUZC 3BT7A 5JWOA 2BMDA 2DBZA 2B37A 3ENVA 4AJIA 4JR1A 4FQ5A 3GV0A 4BAZA 1G2IA 1GM5A 2O6KA 3BE6A 3ECCA 1P6QA 1V37A 2RHFA 2VKTA 2IHZA 3FTNA 1GGKA 2ZIXA 3STWA 5JNUA 1H6DA 4CTJA 1ONPA 4Y6QA 1D9DA 5CLHA 5C53B 2NWQA 2VDPB 4UEJA 1QHXA 1SQFA 4L0MA 1TGVA 4F5EA 2OK8A 3DOOA 8MHTA 1NQXA 2P9EA 2FFBA 4HX9A 5TRTA 1W0CA 4LFAB 3VTFA 4XR9A 4EHNA 2FPPA 4X7PA 1P3Y1 1TT5B 5ER6A 3PJDA 5BQFA 1VDMA 2X1HA 2HMWA 3OC6A 3LDUA 4F2SA 2B30A 3IULA 5MN4A 3B1VA 3IQGX 1QB8A 2JKVA 3M9OB 1AKTA 1E9FA 2DHEA 1NMSA 2F6RA 3N53A 4UNSA 3MMPA 1EUYA 3QF4B 2R85A 1KJQA 3ZGXA 4V3CA 4ZQFA 1D5WA 4A36A 3U7FB 3MJVA 1HORA 1SKBA 3A4MA 1SB3C 3RB0A 1M1ZA 4UQPA 1TYDE 4M22A 3AEUA 3NOOA 4KQIA 4NFLA 2ACWA 1Z9BA 4XYMA 3GV8B 2Y99A 1ABFA 2J48A 2H52A 1C0LA 4PLPA 1O3YA 3RS7A 2I6QA 4FHCA 4KR0A 1I8TA 3A8TA 5DBIA 2D5AA 2OFOA 2EU8A 4TMWA 3JWEA 3RSHA 4DV5B 2D0OB 3LM8A 1DLJA 4GR5A 1IM5A 1P18A 5CH8A 1AC5A 4A0HA 2C2HA 4R2WA 1VGQA 1XMXA 4RLFA 4MV3A 2ISOA 4HWRA 1W35A 7ICPA 3OWOA 3RKRA 5IM5A 1J2RA 5IS2A 2X41A 2P2CA 2LYHA 3PJRA 2OZKA 5FBWB 3CUSA 4QW8A 4C4XA 1KZ7B 3WIBA 1AKEA 3G5UA 2GAFA 4MKZA 3O0TA 2P65A 3L77A 4GRAA 3LKVA 1P5JA 1DSSG 3M6LA 1C3LA 5ECWA 4EUEA 3AFOA 2JGIA 3AM5A 1M2FA 2H1OA 1P74A 4HZUA 1S9HA 2A57A 3ZDBA 1V6SA 3DCJA 4G4IA 3NWBA 3G17A 3DAHA 4PWZA 3TGWA 2MUTB 1MX5A 1IBSA 1DFIA 2GLXA 1OIVA 3G7NA 4B8ZA 1DBQA 1NVAA 3ZI0A 2IZ6A 3JSAA 4WKGA 3VJKA 1FQJA 2JIBA 1HFEL 4UMFA 4Z3OA 4R9VA 1SHJA 5T4EA 3OU7A 1GT91 3DZFA 3CWQA 1A5AB 4TT3D 3T79A 1PR2A 2XB2A 1N33B 4KDCA 1CETA 3ZDFA 4Q9AA 3OJEA 1U28C 1MEEA 1PLKA 2IA6A 1N2IA 2PY6A 1S0NA 1PWZA 3H0CA 3W6OA 2HOQA 2BKEA 1Q15A 4RABA 4CF4A 1W34A 3TMYA 4ZKDA 5TQ2B 4JUCA 3DO8A 2X9VA 4TURA 4BE4A 2QNBA 3IP1A 4CEJB 1RYRA 4NJOA 1Y9EA 1FVXA 1XSLA 5KFEA 3GLSA 4QBKA 1II8A 4OMDA 3OOEA 3PLNA 3K9HA 3U16A 2DUWA 4AJNA 3BRWD 4KHZA 2P5SA 2W48A 1YD7A 2XGSA 4BHTA 2Q5JA 2GI4A 2Q3EA 3VPCA 1AT1A 5DGTA 3U6KA 1LPNA 1P39A 5DH9A 1RYNA 1S2LA 2XE6A 4AQYB 3RRJA 4QWEA 1MRNA 4JBHA 1R37A 3TARA 3NGLA 4NXZA 3P9IA 1DC5A 1CIPA 1QYWA 4C0ZA 1N2OA 2WAOA 4KWCA 3R9XB 4MI6A 1U0FA 5AIBA 4CODB 2F48A 2IEYA 1U2ZA 3KIPA 3AFGA 1BMDA 1RRKA 1HG0A 4RAQA 3MWJA 3ILVA 2IF2A 5JARA 4XDZA 3Q8QB 4B3TB 4TKMA 1KFEB 3OY2A 3FGNA 3DAOA 2PRJA 2HLDA 5DWVA 1E3SA 3UGJA 3TVDA 4NV1A 1EVZA 4LSMA 1U1EA 4GPIB 4P7BA 1U1IA 2OCDA 2QL7A 5BW8A 1ODIA 2FLWA 1JEYB 4C8MA 3FUUA 1S2GA 2AYYA 4PLZA 2G08A 4CLHA 8ICZA 4C0JA 2WTUA 4DT1B 1RKVA 3C3BA 2OBXA 1CD5A 3R7AA 2JBAB 3N58A 4RY9A 3DOHA 4BLWA 3IAFA 3ITKA 1J5EB 2P6UA 5JISA 1Z4OA 1TYZA 3AU8A 5KJ1A 2PMFA 1D9XA 1Z25A 1OVMA 3LUDA 2VSXA 2JJ2A 4BNGA 5CD1A 1W1IA 8ICPA 2LKCA 3RWBA 4BATA 5J43A 2REOA 1O9GA 3B0YA 5JSUA 2Y1FA 4M89A 2WOJA 1SKYE 3S7ZA 3OQPA 4UATA 4G1VA 1GN8A 4PBTA 1BU5A 5JCOC 1ZC4A 4ZALA 3DHEA 4E30A 2JFBA 1RQNA 2AI1A 2VNAA 1VL2A 2RI1A 5EHZA 5HFNA 2ZYVX 2Q50A 1Q0UA 1MJHA 3L4JA 3EXEA 5AI8A 5EWLB 1UDXA 4KBFA 1AE1A 2XICA 4OQYA 4KE8A 1K1EA 1NBWB 2W42A 4M0DA 5DYGA 3SJCA 4TXNA 1CQIB 2VZ9A 1VIMA 5F12A 3ZIUA 4UTXA 3H5LA 3PFBA 1M0EA 1BN6A 4Y2UA 3PTAA 5B64A 1UMBB 1LTQA 2WKQA 5JY6A 1AX9A 3ENQA 1CYDA 2VJDA 1DQSA 4ASUA 2QRVB 4C7XA 3WLTA 4DIUA 1NBMA 1JTEA 3OM8A 2GBIA 4EYKA 1D1QA 1DZ3A 3CZ5A 3PXDA 2VXBA 3HVRA 1ZQJA 2NVOA 2GJ4A 4OJKA 5KU7A 3S29A 1Q2UA 1Z88A 5TGDA 4M8SA 4H60A 2EZYA 2P2LA 2VYFA 1CF9A 1G3QA 4KMOB 4LBVA 2JEYA 4M9ZA 4QXRA 4O3MA 3VR6A 2IH5A 3LT4A 3P9SA 3MWEB 2BFOA 1EFAA 3L5OA 5K8VA 3G2LA 3QE0A 3DF9A 4YCSA 2CGEA 3H4VA 4TTQA 2F1OA 3BA1A 5I8WA 3ETLA 1ZQHA 1EU1A 3NC1C 2EEPA 3AEQA 3GLKA 1PZHA 1ZD3A 4DSFA 4G25A 1DS6A 1X1SA 1KI1A 3IMEA 3FJYA 1WSBA 3HCAA 1YFKA 2P4UA 3QU7A 1E79D 2QTVB 2P11A 4RQ7A 3EOZA 5HIMA 4QREA 3GYBA 1LZKA 2Q3FA 1FSSA 1B1CA 4F38A 2HW8A 1UCFA 1EA5A 2EX4A 1SUSA 3FNGA 2W6JA 3A3NA 4EFMA 3IVMA 3I2IA 4RF3A 2ZJ2A 3HEBA 1BH2A 1MPTA 4KXYA 4DBVO 1IN5A 2FU5C 3DQQA 5CW1A 3PYXA 4O8CA 1HNWB 4CRWB 4RF5A 1PJBA 2QWXA 3FHCB 2CJFA 4BVHA 2V5UA 1ZK0A 4ZCSA 4R2KA 2NXCA 2NTYC 3OLWA 3TRKA 1NPYA 2Y27A 1ADJA 2WIKA 4D9BA 5CLIA 4TUYA 5F9LA 3IDSA 4CT5A 1M5TA 1A8HA 1Q7EA 4GZLA 2VDRB 4II3A 4AECA 2DETA 3GQVA 1JHYA 3BJMA 4BLQA 2C96A 4L07A 1WL8A 5ICFA 2VF2A 1EM8B 4ZN6A 5THXA 4DMFA 1GNTA 1KGSA 3AM3A 3DG9A 4LOAA 1YKGA 4H6WA 4QDZA 3FPGA 4XD7D 2PKCA 3ZG6A 1KSPA 1PJQA 1LBIA 4MV4A 1T9KA 4PO8A 5EJMA 2OO3A 5AP9A 2ERCA 4BNIA 2IU6A 1KE2A 2ZZNA 2EH9A 2WYHA 3PPXA 2WNSA 1SHLA 1XNRB 2COEA 1R5NA 3IE2A 5AW5A 2WQ6A 3V3KA 3SSMA 1OZ0A 5AJVB 4BX8A 1D9ZA 1OY1A 4B8YA 4FYIA 4EZEA 4BJ1A 3EXFA 5DXAA 2OO5C 4ZGBA 2PXCA 5KYXB 4I2EA 1MIHA 1F7VA 2L5YA 2CVQA 2Q49A 4JLKA 1XD2A 3GOHA 1ODLA 2I78A 2V6BA 1RLJA 2BFNA 4CMEC 2WKWA 1HYHA 3BQNB 3WP0A 3IHLA 2JJ1A 5JXHA 3PRKE 2ZUEA 4Q43A 2CNNA 2I2BA 4OQZA 3HFRA 4NONA 2CHQA 4D8VA 1XROA 5TF4A 4U00A 2G0NA 1WYGA 2VYNA 2JH3A 2B1JA 4O1MA 1PG2A 2I1QA 3E9EA 4QLBA 3HWRA 4LHZA 2HOIA 4CG2A 1SXQA 1ECWA 4Q8FA 1FDSA 4F92B 1GKKA 2HIHA 1V11B 1SXDA 1MDFA 3EPIA 4B0OA 3EXAA 3VR5H 3TL2A 2PPVA 2HJRA 1E3EA 4CGZA 1NPDA 2VCHA 3V8PA 1GVHA 1I3OA 2JB9A 2V6FA 4CMGA 3GUCA 3TTYA 1U3VA 2ZAYA 2N1MA 5IVIA 3AZOA 4IJQA 3IFSA 2KJ9A 4JU9A 2BGJA 3ZLJA 3A1VA 4BBAA 3MW8A 3WGNA 4LF9B 3RC1A 1H93A 1L3IA 4X66B 3DZHA 3E6AA 2QM0A 2HYDA 2BGLA 1D4ZA 1HIWA 4XLTA 3PSFA 1SPBS 3GT3A 2GZRA 5GV7A 4X45A 3KZMA 3FOFC 2DWQA 2O7SA 2DPYA 4F6RA 3N8IA 3TBHA 3G0IA 1ZLXA 3PUXA 1NXPA 1FFVA 4EAQA 3L8FA 5JATA 4X3PA 1H23A 3ZE2B 5DBFA 4U7GA 4ZHQF 5HCNA 3L7LA 2VPZA 1NFRA 1GR0A 5AJTA 1ZD4A 4G1EB 3PEVA 5C81A 2NXJA 4TYYA 1UBUS 4UUPA 1CIVA 5FYQA 1UZAA 2NVUA 4CT0A 3HTXA 3KQWA 3OZWA 1UJMA 2O8NA 4QZHA 2ZIEA 2J45A 3IL2A 1E5LA 1J2EA 3E22B 4OQPA 3VR4A 4AC9A 2XO7A 2PZMA 4XVHA 5JR3A 2GHRA 4WSOA 4E4RA 3CRVA 1FYEA 2VP6A 8ICQA 3D64A 2NV3A 3L04A 2VOJA 3K1RB 4IJVA 1YDEA 1M6WA 4JSRA 1GNRA 1GOTA 3WHLA 1U99A 4CCSA 3VDQA 3VTKA 1DKLA 5BWCA 4EQ6A 2H3EA 4L15A 3MQ4A 1J2TA 1A96A 3L7IA 2E1PA 3GPLA 3HNRA 2CSXA 4LQCA 4L6CA 1LLFA 5KFTA 4XRGA 1G18A 2PGJA 2B4TO 3HNOA 1QQTA 3OZSA 5DRYA 3LRXA 1W73A 3KZKA 5K4AA 5ICCA 4U7DA 1BE6A 3BRSA 1MXFA 3UK2A 4G9EA 4ZK6A 1ZN7A 5JLAA 4NWIA 1OHHD 3M8SA 2PT7A 5CXQA 3QQ5A 4Q4JB 3GLHA 3OJSA 2XT9A 2JI9A 1Z5NA 4KWIA 3DMGA 4HT3B 3R77A 2CNWA 4LSWA 2CDBA 3LO8A 1AA9A 1CUKA 3D6JA 5HBGA 1SHUX 3R6DA 1FRVA 4EARA 1V5FA 1GZ4A 4CG0A 2Z43A 2W2MA 1L4BA 4V0QA 2XXAA 5LXTB 4IZIA 1FDRA 5D5QA 1IK4A 2VTBB 4M88A 1RMQA 3IT1A 3SC6A 2XCSB 1TW2A 1DTWB 3RFTA 4YXMA 3RQIA 4BQOA 4UOZA 5FUXA 3FSGD 2IOQA 3H3FA 1YONA 3A2KA 5CB4A 3LT0A 2M1ZA 5HM8A 4OHOA 1E9EA 3TI0A 4N3CA 4QVGA 5FWYA 3QA3E 4XWTA 4B4KA 3MR2A 4EY7A 2WFMA 3PUYA 4FDMA 4YMTA 4GYWA 2C9ZA 1N57A 3TPCA 2J6BA 3RJEA 3TIVA 2B9EA 3V48A 1OU0A 1M0SA 4JA0A 1G9SA 1XWWA 3K35A 1Y7LA 5JAHA 1DEXA 5CB6A 1M54A 3RK1A 1DQRA 3UJ6A 2WT9A 2JIDA 1L5YA 1TQ4A 5KNLA 1L5OA 2WJWA 2V0GA 4B82A 1D1SA 2GCOB 2VA8A 1FP6A 4NDAA 4EGSA 1CR0A 3ZXSA 4C4SA 4ER6A 1X74A 3B1ZA 3TOXA 4OHYA 3UC9A 2C3UA 2Y1XA 3D4LA 3OZDA 4JC5A 1Z39A 4RT3A 4HLUC 4I7EA 2LZ0A 1ZQVA 5IN4A 5E38A 2ZB3A 1JVNA 4QVIA 3OIDA 4PR0A 3KAJA 4R5MA 1QSGA 3H0LB 5KFAA 1FFGA 4HAZA 2H1SA 5AD1A 5SZIA 2VT2A 1DBPA 1MIOA 5EINA 2BDEA 4D45A 3H87A 2ECQA 4K5QA 1ULZA 1B23P 3PITA 3UPDA 1RE1A 1PNTA 2XY6A 3OEHD 2IEBA 4ZFNA 1JDJA 2QRHA 1JG1A 2RC5A 3WL5A 1TAUA 4DG8A 1KWKA 1V41E 4FS2A 3MBOA 2GLUA 4ZYVA 1ZU4A 4BWJA 2QYTA 3Q5EA 1HEUA 2ZBEA 2ZRBA 2J41A 4Z6EA 3JVVA 3MRSA 2BGRA 3C6QA 2HU5A 2XGOA 1PTKA 4FNGA 4RL6A 3LBHA 1YS9A 5FQNA 3V4FA 3ZVNA 4P4LA 2O3JA 1N2JA 3MQFA 1WV1A 2CLLB 4MUYA 2ZE8A 2PJUA 3CLTC 1IUPA 1UKCA 3RH6A 4O4HA 2H11A 5JFOA 1LBTA 3N9IA 5HVNA 2EP8A 2XZDA 4PQGA 2ODGA 1GUBA 1UT8A 4NNOA 3T5HA 1Z47A 3ZXXA 3RYFB 1X1DA 2PG3A 2MYPA 2AQ4A 5CFMA 4KJZA 5FUWA 4GS5A 2V7BA 1L8AA 1NVBA 4LE1A 3P32A 3C43A 2HK8A 4E5DA 3QBJA 5LOVA 4JFAA 3TUIC 3VOAA 4YALA 3VI4B 3ICPA 3SLGA 3U26A 5KG1A 1OAAA 2YY5A 2WMYA 1S7GA 3CGWA 4DNFA 1TVEA 4R3WA 3GG9A 4FKBA 2XVZA 1YC5A 3GGGA 1Y88A 3NDPA 3R8FA 1AKMA 2ALZA 2Q1YA 4L9SA 1U6JA 4Q3LA 4JJ7A 4IX9A 1E7YA 3UWDA 1Z36A 4G0QA 2B6HA 4Q8EA 2WMOB 3IX7A 4EEZA 2GEJA 1V7QA 3PR3A 1RPJA 5T6BA 2D0PB 1ECPA 3LUKA 4BKMA 2HUNA 5HUJA 4HWGA 4NCJA 1GO3F 1SZPA 3IT2A 4QBGB 4HWKA 4CPDA 3NORA 5T57A 3R40A 4DXAA 4C2UA 2F3NA 3QKRA 3ER6A 1TKBA 4I29A 2VBGA 1YOVA 3OHSX 3F73A 1B6SA 9MHTA 3RRZA 4BRSA 4US1R 4YUWA 2BEKA 5KVVA 4NOKA 1JMSA 1TC1A 4UVDA 2ODQA 1G4AE 2R1UA 1TO6A 2BEWA 1FLVA 1F8UA 4YT8A 1YZGA 3G1WA 3U6BA 3ZC3A 2IYFA 2NU6A 4XXHA 2IW1A 4RSHA 4KH0A 1RM5A 1WOMA 5CR0A 4FQ8A 4R84A 1TCCA 4Q39A 3KR9A 2IEAA 2ZI7A 3LX5A 4NCHA 3A7EA 1DRJA 2PSDA 4G5OA 1IHYA 3DC7A 3AVYA 4LJKA 2FFRA 1NVDA 2QN2A 1NJXA 1J70A 3UVEA 2K4EA 2XD9A 1QTMA 4KRYA 4CU2A 2QZPA 3MTJA 2RCNA 5AJHA 2EQYA 2WTXA 5ADWA 4FNMA 2RGEA 1W9MA 3EPHA 2ROQA 4XASA 1P4SA 1F2TA 2XB9A 3L40A 3O8OA 4ZQHA 1E6LA 4JK3A 2NZ2A 2OGUA 4XRHA 1RTKA 2EIHA 3I9NA 2QTRA 4AS3A 3OOWA 1CUWA 3ERCA 4IKPA 1QIEA 2FP3A 1O8CA 2XIJA 3WYDA 3MGCA 2XMRA 3THYB 5JCOA 2CMDA 3G59A 4G84A 5DASA 1GTL1 4CV2A 4L5YA 1FS4A 5DK6A 1FSPA 1F3OA 4L76A 4G4GA 2R8HA 3IDZA 2ZBVA 3W1WA 1OXJA 2BLLA 5DB8A 2Q5HA 3O5AA 4GYYA 4ZEXA 1CDDA 3DWIA 5HRAA 2BCJQ 1KU0A 3KZXA 1VI6A 3T0FA 3PX4A 1THZA 2J3KA 4EGFA 5HKLA 1XDUA 1MABA 1AXRA 1PV1A 1DRVA 5GONB 5AVQA 1RKQA 4MHVA 1TK2A 2WSLA 5LMCA 3WZ2A 1TRHA 5EVJA 4HZIA 1XEXA 1ODSA 3DLCA 4V02A 5TPZA 4J0FA 3OT1B 4RHEA 3QBTA 3QJ5A 1JIKA 2QTMA 3PDCA 3PGXA 2EKPA 4OL9A 4BFZA 3RS3A 3P2KA 4F5OA 1XDBA 1M1UA 4ZQEA 3C8UA 5IWCA 1M76A 5J2CA 3RVNA 3JQRA 3LV8A 1T9GR 3QWIA 4M3NA 1K8RA 5TMBA 4CCWA 3G49A 3V8EA 4E70A 2AL7A 4OSOA 2JVIA 2Y8EA 3ED5A 3F5EA 1SBHA 2YWDA 7ICUA 4FBMA 1UJBA 4GXKA 3RV4A 2AG6A 4B76A 1V71A 4RZIA 1JXLA 3DV2A 2IWRA 5G53C 5JNTA 5JUWA 2Q7XA 1GZ5A 5IFLA 5JS1A 1AA6A 4EOGA 3WV5A 4ECQA 4RCYA 2VXOA 3EIXA 3CF6R 4KSCA 3E1KA 4OJPA 5HIJA 1MRZA 3DBLA 3NTLA 1G16A 2IHNA 4X71A 3E9YA 4KBYA 2GJ9A 3OJUA 3LGSA 4P7JA 2XTNA 4CLRA 1Z0FA 2I3DA 1T0IA 2VDWB 4MGIR 3RUPA 3C5FA 3CT6A 4D4JA 1YFLA 1X8KA 5JHGB 2JF0A 4HZGA 5FLXA 2H48A 1T7PA 3REQA 2RGUA 4PL1A 3WGGA 1UUFA 5L1KA 1P2FA 3WL6A 5JUMA 5FOSA 2DECA 4OGKA 3QZ7A 1X9MA 4U9IS 1T35A 1BU8A 4Y2VA 2CSUA 4FSDA 3AF3A 1F8XA 3VR3D 5IK2D 2JIPA 4ML3A 1OX5A 3KKKA 2DWOA 3Q5DA 2BSAA 1I1HA 3LWNA 2ZWMA 1EHCA 3FKSD 3MJFA 5JBQA 3ZWKA 3PKZA 4LI3X 5G1OA 5A5VA 3EH2A 5FOXA 3ACBA 2IV2X 1U7PA 3K72B 3KJXA 3V9AA 1G8FA 4KZPA 1E2NA 2BFCA 2GAJA 1VXRA 2YJ4A 3QUTA 2BVNA 4JDPA 2C9CA 1B14A 1C7EA 3SPXA 1UM9B 5G0VA 1GARA 4DWWA 4Y2XA 1EP1B 1YZNA 3H75A 3KJZA 1JN0A 1CQPA 1GIAA 1PEKE 4EY6A 1WCWA 1GPLA 1C4WA 2D8AA 2XYRA 1LLQA 4M9HA 1F6BA 1FLDA 4R0MA 5D6NA 5CDUA 2YNMC 1NFQA 3V6MA 2H16A 1RPTA 4LRSB 3OFNA 3KPUA 4PC6A 4ZYTA 3PDUA 4UE6A 5E9AA 1L5UA 1M34A 3KELA 1Z3CA 5EJ6A 4UTZA 3HCDA 3VM6A 1JFFB 5IJWA 3TG8A 2OO5A 2VT3A 1C8LA 5K9ZA 4FEAA 3BGWA 2FN7A 1T3QA 1L9KA 4CF3A 1S1MA 4E03A 2ONCA 2GASA 1NRJB 1CE8A 5EWEA 3GEDA 4WOJA 2P77A 4G65A 4D56A 1XG5A 5JAUA 1REQB 4CMEA 1VLZA 3GDXA 3DT9A 1OC2A 5C1OA 3I9JA 4QYSA 1LUAA 5DNCA 5HR6A 4OXRA 5KUTA 2CRXA 2WHPA 4R54A 1C29B 1FMJA 2IZOA 2WAQC 1JB1A 3IAEA 3KUCA 3VZBA 4TRMA 3ELYA 4OFWA 1RYMA 4KVZA 1F38A 4MVJD 3KLBA 2UYCA 3HL0A 3CPHA 2COUA 3O3CA 1ZQFA 1CJTC 1W0JD 2QTGA 3QHAA 2IHYA 2E6UX 3HYTA 3P9XA 8ICNA 3UV6A 1NAHA 3GEHA 3VPDA 4WBSA 3RI3A 3FVVA 5DP1A 1X13A 1E9RA 3T3FA 2EWWA 4AY4A 2FQQA 1KZ4A 3CZRA 1YMQA 4DUYB 3IVXA 3VSEA 3O93A 2ZRNA 4ZVPA 1SL2A 1NJ2A 3PMLA 2HPVA 3TJMA 1I7NA 2QBYA 1MMFB 3A10A 3AR7A 1VIAA 1ZIXA 1NI4B 2CVHA 1VJ0A 1YL7A 3OCJA 3RADC 4H7EA 4CR8A 4L5CA 4I1UA 2BMVA 4Y0VA 3HW8A 2O6LA 2KP7A 1OUQA 2HR1A 1QH8A 1QIIA 4GL4A 3G79A 3RRNA 1R88A 2AQ0A 5HBRA 4DV0B 4S2UA 2AFHE 4RT2A 3HHEA 4UHBA 3O8NA 3EGVA 4RXMA 5ENDA 4F72A 2CPRA 3TAUA 1XUOA 4BGEA 1IRXA 4HQRA 1QG6A 3M6IA 3BN3A 5H2FU 5KFNA 4OI4A 3HB9A 4J94A 3RJMA 1S97A 3M89A 2PX3A 4BGUA 4KN7A 4F5QA 3GYGA 4TQSA 4NK5A 1KZHA 2MSKA 1MGPA 1N0VC 5F7JA 5FI5A 3INGA 5LUAA 4UTRA 1N3BA 1WDMA 2QN8A 4H2DA 4X1YB 3AKCA 2M6LA 2R66A 1K0FA 1QFZA 4U7HA 3TSWA 2Q1WA 3TH5A 4QNLA 2DU8A 3NBFA 4JEMA 3RREA 3A3KA 5BOLA 1IG0A 2X7XA 5JBIA 3V1YA 3ICWA 4GC6A 1JR6A 3K6SB 1JPNA 4C07A 4YT5A 2R5NA 3PX6A 4A8PA 2VAPA 5DGIA 2LWIA 4Z1MD 4IV8A 2VHVA 1GKYA 1EEXB 4YJFA 4BP1A 1XC7A 4F5ZA 7ICEA 4I2AA 4CLOA 2K7FA 4BNUA 3E5RA 2OZVA 2A59A 2VWGA 4KVAA 4ZKEA 4MVJF 1VMKA 3F5QA 4DMHA 3RABA 3WO0A 1RE0A 2H63A 3D7NA 3OKCA 5F52A 3OCYA 1J2NA 5KAPA 5AUPB 2XA1A 2ZU0C 4MPTA 3KJGA 1HC7A 4BNMA 7ICMA 4L4XA 3TEFA 4I4LA 4UUOA 2EBFX 4AJ2A 2P0EA 4UAVA 3DS8A 4PBSA 4WVLA 4L0DA 2K4PA 5ALKA 3D7KA 1YQTA 3RR2A 4MFAA 1YCGA 4WCFC 2LTAA 1VI2A 3I9V1 3QE9Y 1E64A 1OV4A 2FMPA 1CY4A 2YFHA 3SAGA 1O54A 2GM5A 1K5HA 4MWOA 4FCWA 4JV5B 1DAPA 1HLPA 2QUZA 1EB8A 3NUQA 3AI3A 4YI5A 3H2HA 1ISGA 4CV1A 4F6CA 3EUEA 1QWOA 3F5AA 3DHYA 3QYJA 4PX3A 4KLGA 5A7FA 3ES9A 3NKLA 5TE9A 4HYYA 4NK4A 3L43A 3P9NA 4BIIA 1T6BY 4IEEA 5F78A 3V4OA 3JQFC 2Y1OA 2V0NA 4CNBA 1JDNA 3MFQA 2QJRA 3DAPA 4GOLD 2OHXA 4LJXA 1RCTE 3T5TA 3EEOA 4M0LA 1VJCA 2ZTDA 4JSYA 5CNMA 1Z4LA 2VP5A 4KLEA 3V6KA 4XM0A 5JROA 5IBPA 1LWOA 2YMQA 2YJTD 1KBUA 5K0CA 2CL6X 3CEPB 2EARA 4Q3CA 4JEIA 2IZ5A 3EQ9A 1K6XA 3BDAA 3DEJA 4DILA 2DHRA 1AGXA 5IC5A 3MJSA 4JJEA 4RWEA 2G7ZA 3E2EA 2V7TA 4EDFA 1B8UA 1NA5A 2PMEA 3ODGA 1HETA 3FCEA 1VFPA 3HPOA 1GQFA 3VV2A 2I6SA 2W6ZA 5FUBA 1FNBA 3ZIAA 1SU6A 1JU4A 3IR6A 4B40A 4BOYA 3IVRA 5DW0A 2BH9A 2EW2A 2O7RA 3VH1A 2RBGA 4Q3OA 3F53A 2I2CA 2QVYX 2G25A 2IUUA 4LSZA 4B4VA 1EYZA 1XB2A 3B8EA 1Y1SA 3V4ZA 3L3FX 5M3BA 4B32A 1UMCB 4C7OA 3EGOA 4ANFA 5FX2A 2PKQO 2DYKA 3NHFA 4YXWA 4C08A 3S7TA 4P1ZA 1XTRA 1C7IA 1YB2A 2IOFA 2ZS8A 1SVOA 1AGPA 1PG5A 4DZZA 4DCTA 5E1BA 1FMCA 4YJ3F 4U6QA 1OH5A 3WK8A 1BQEA 1N9ZA 4S1PA 3DFUA 1JI0A 1LI7A 1WM1A 1SUAA 3RNLA 2IXEA 2DPXA 2AS0A 1ZO8A 4EPTA 1Q0RA 4OQEA 3AH8A 2R7NA 3NM5A 2P5TB 3DDNA 1TZKA 4NE2A 2KV2A 2W6MA 2CD7A 4M4SA 1WCNA 1N8SA 2QAJA 2XOEA 3OBBA 5KFCA 3RT7A 1YDWA 4BV8A 3E9CA 2EEZA 1OI2A 5C0OE 1JHUA 4IMJB 2EKZA 5EAIA 3Q0IA 3V4SA 5G0TA 3TSYA 4DLAA 1GG5A 5DX0A 3C3EA 3SQIA 2RHOA 4DANA 4MPPA 2G40A 1J6UA 5HPYB 2MYTA 4NP6A 4KYVA 4QXPA 1PJZA 2C54A 3C2KA 5IHXA 4UVIA 2WICA 3U19A 4OHKA 1NMQA 3VDNB 2Z2YA 5AICA 2WSYB 3KSZO 4LMBA 2DM6A 4JYCA 4GMDA 2QVXX 4DJEC 4H6VA 3QKWA 5E79U 1LKZA 3G5AA 2IV7A 1JFTA 4G4SO 5MGBA 4I2GA 3KB1A 3O8DA 1OZAA 3KDAA 4AFNA 3CNHA 4Z7OB 2XEDA 2Q3JA 2HSJA 5D7NA 4TN1A 4N3AA 5LDHA 1L4UA 1X39A 2VPXA 4XKJA 1XHEA 3RIHA 4PZUA 3HBMA 2QA5A 4Y6RA 4ZO8A 3ZY6A 4ND8B 2OCEA 2GM9A 1YV9A 2VSFA 1UPTA 1VPLA 1ZQYA 3BMCB 1R4NA 5I48A 4Q12A 4LQ4A 1XZGA 5K8CA 5LIRA 3GFFA 4Y1RA 5EWJA 2EHJA 3U1BA 9ICWA 4Q66C 4B79A 2HHQA 1C2YA 1KVUA 1ZH0A 1XK6A 3I39X 1Z4PX 5CM8B 1I7QB 2XYVA 5T64A 1PRYA 5F2OA 5C46F 1F6WA 1T0BA 4ECXA 2QI9F 4D9CA 3MCZA 4PAWA 5BQPA 4X9XA 3ZWXA 5BUQA 3R76A 4UCWA 4ZVQA 1YWGO 1TA9A 2CFIA 4GXQA 3TOVA 4MV1A 1I32A 2GM3A 4LF5B 3KBOA 3G3EA 4B2IA 3T1HB 2VSOA 2XADA 1V8ZA 5I9BA 3CT4A 3CF2A 2C42A 3LA8A 3BXFA 4PAOA 4ZI7A 4W99A 1RRGA 1NQUA 1MCZA 2YASA 2BGNA 5AVJA 1NP3A 3WLAA 4AX4A 3EGDB 5TT1A 1H5NA 1RXEA 3P2YA 4RYDA 3PKJA 4YQWA 1ULSA 2QX9A 2HDNB 3LCMA 5ALOA 5DM1A 5EJFA 2CXRA 3GPIA 1X15A 4CJXA 2A4MA 3HJEA 4R8VA 2PZFA 2QTTA 2JFYA 4IICA 1X9GA 4DKXA 1JUDA 4ZJYA 1LPOA 3LQ4A 2HXYA 4UZSA 1XMVA 1TK3A 3ESCA 1ESDA 1RWOA 1YQWA 3D5QA 2N75A 1EDEA 4TMKA 5DGHA 1BRTA 3WAGA 1PVPA 3WNCA 5EIBD 3WNZA 4QRDA 3GMDA 2ISQA 4RHTA 3CF4A 1TK0A 1XMSA 1TVCA 4DTIA 2UVRA 3I28A 2WHQA 3CFYA 2FPMA 4CTNA 1XZFA 3FETA 1FP4A 5C34B 1AO3A 4KPUB 5ALRA 2PZGA 2HHTA 5DIZA 1PHPA 3I8XA 2JLXA 4NX2A 1E1MA 4AM8A 4YA6A 1KVRA 3WDLA 2I0FA 3BFPA 1AQ6A 1R9GA 3E7FA 1ZI8A 2BV3A 1PGJA 4RHUA 1AK2A 3RBAA 4F8EA 3TECE 4WKNA 4XAQA 1QXSA 4WNCA 4IDEA 4OEHA 3TE6A 2G67A 5IYZA 3DZKA 2ZTEA 2BQRA 4AKGA 1VYTA 5K4HA 1S9FA 4YJKA 4HDQB 4JLAA 3B9BA 3GRYA 3NHSA 2Z4SA 8ADHA 3SP1A 1EFRD 2P7HA 1VG8A 3VJRA 3N74A 1N2ZA 4USAA 1TEXA 1Q83A 4I14A 3D31A 4MYHA 4JP8A 4TS9A 2PLFA 2JRZA 4TUQA 5A4IS 3M2TA 1X9WA 4QZEA 4E15A 4D9FA 5CITA 4IR9A 4RX1A 2AUMA 1KQQA 4MDFA 1YZUA 4MYSA 3LXRA 1H42A 1ZJMA 3LD9A 9ICSA 2KZ3A 1FFUA 1QYVA 1E5QA 5LBIA 2QDXA 4HDNB 5IXJA 1JFVA 3FCXA 1I2ZA 5JAZA 3G0CA 4Q7JB 4QU5A 3C29A 1E7WA 5BQ5A 1K89A 3KB6A 1RWXA 1TIBA 5AJWA 4YXJA 4J1SA 3CLHA 4GX5A 4KLFA 3BIXA 4GBED 1XT6A 5ESXA 4XX0B 4WZBE 5TF0A 2OZLB 4M0MA 3SIRA 5BSKA 2IYWA 3ZYZA 5EE3A 4KQFA 5B7QA 3W5JA 2CWWA 1LQUA 2O3RA 4FLMA 2QN6A 2CT8A 4PZDA 4PW0A 1QR2A 2PFKA 1WMDA 3KALA 2Q28A 2D8MA 3F7TA 3LXXA 2WT4A 5I3ZA 3JX9A 2Q1UA 5EWMB 4MW7A 3H9CA 3PFWO 2W2PA 2CLDX 2A5GA 3U5ZB 5DLDA 1JE1A 2HRDA 4KLTA 1KZYC 4QXMA 1LFAA 3NIWA 2CDCA 3SR3A 5HKAA 2KWIA 9ICCA 5H7XA 5JFGA 1SGGA 1W6RA 5CUQA 2Q5EA 3LOQA 1RQLA 3C3CA 3PL1A 4JR2A 3TPZA 2E4VA 4NAUA 4ZCIA 4CEIB 4FE3A 1GAJA 4MARA 3PR5B 4EHFA 4UDOA 2IBTA 4H0CA 4QT0A 3DTVD 4TYPA 4L72A 3FDIA 4X61A 3TQRA 5H4GA 3TPFA 4FZNA 1O7JA 1TKAA 2YNMA 4N54A 2LD4A 4K3UA 3NBMA 4HBZA 2E8OA 5CLGA 2HUPA 1QVWA 4GG1A 4PGFA 2I4MA 4A15A 5JMPA 1H0KA 1C14A 3WB9A 5I01A 4U3JB 1HOXA 1Z12A 4QFDA 4D8XA 2VH2A 3VZQA 2FPLA 2OXOA 2Y92A 3VUFA 3VAYA 3QPVA 2PS9A 4ITRC 1ZICA 1U31A 4JV1A 2GZ1A 4M9UA 1ITZA 2KMLA 1AM4D 1RJ9A 1VKOA 5AUNB 1UQRA 1N2HA 3U4DA 4ARSA 3KKMA 4ID9A 1JDVA 1KEEA 4PR3A 5ALJA 4JX8A 1H65A 2C7PA 1JQBA 3PDIA 2AXPA 2FX3A 2JDIA 1RABA 4TXHA 2YIVX 1GUYA 5KT6A 4BTLA 4PX5A 4BJ6A 3GJXC 3EB9A 1WB9A 1LPMA 1O96B 3PUWA 3O4VA 5EYPB 1I14A 4RMGA 4IDPA 3IODA 3EUB2 2AXTU 3B7WA 3ULKA 4JBNA 5JZOA 1QGED 2D2VA 2KD1A 1ZMTA 4TL6A 3B9JA 1YU6A 4N41A 3GHYA 2F67A 1JHDA 1E2LA 2OHJA 3W6NA 2C0QA 1EIWA 1PS0A 4GOMD 4JY7A 4ED3A 3U4IA 2P3OA 1YJAA 1B2RA 2H92A 3DE6X 4PZOA 3DKPA 3N4MB 1TZJA 3UENA 3H16A 1MAVA 1ZCZA 2VF5X 4R2JA 2W8BA 5CA7A 5KYUB 4NU5A 3RSGA 2ZCUA 4S2EA 1HBJA 4A8HA 3UV7A 1KZ9A 2QARB 4EB0A 3SNKA 3RAGA 5J8YC 3M1AA 3F2DA 4LJ9A 4YHHB 3MK31 2BZ0A 4J9RA 4OKSA 1THGA 1VBNA 4C0WA 5TGZA 2P4EA 4DQDA 2YV3A 5H1YA 1DC4A 2AGOA 4DLBA 5C0YA 3HA5A 5FNVA 3KKLA 5JXIA 3TINA 1TNDA 2WJ3A 3TCNA 2IU4A 1KJJA 1B4DA 4JLBA 2AZTA 4FR2A 3UMYA 2HT6A 1ZQDA 1LDGA 1T13A 3BSYA 3QJGA 4B3BA 3ZHOA 3UT6A 3H99A 1KI6B 3PY8A 2AEFA 1CUYA 2AZ4A 3P2MA 4RPZA 2ZB2A 2WUEA 3FYCA 1B6GA 1PFYA 4YD1A 2HA2A 4RVNA 5F3DA 4AN0A 5KG2A 1BNOA 5A3QA 4WNIA 2UZIR 3KXKA 1MGOA 2G9NA 3PFIA 5KFZA 2FSUA 4OKIA 1XCMA 5L3SB 1XNSA 5JCXA 3PRJA 3M5DA 5I7EA 3UWSA 3H8JA 3BOSA 1JHXA 1Z8DA 3FPSA 2MRLA 1XFDA 3VC2A 2C92A 3AR5A 2H3HA 2R25B 1S96A 3BD7A 2BR5A 3VDXA 3FUXA 2I65A 5I8ZA 4JUZA 2M6RA 3AHEA 4AZSA 1E1LA 4W9NC 3AUFA 2EQ5A 3WGUA 4PNEA 1P1FA 3ADKA 5ES3A 3MA0A 1XDWA 1G2OA 3L8YA 4OBWA 1XFAA 4HB0A 2VJLA 5KFFA 4LJRA 1WUTA 1Y1KE 5C8YA 3E1SA 4ZAFA 2C9OA 1JRLA 4RNCA 3TQFA 4Q16A 2KFNA 2C9BA 3TG2A 5AR1A 2QEQA 4OI0A 4AX8A 1FRQA 3HKDA 1IBCA 4BGDA 4EKEA 2VNKA 4MUAA 4EVRA 2GHQA 3I53A 3CTPA 5AUQA 1T25A 2YH2A 5AW9A 4S1WA 5FBQB 2BHRA 3MGBA 1AKUA 1JGTA 2XMCA 1G7SA 3EFBA 4MQ4A 2FN9A 2BI4A 2R62A 2GF9A 3GW8A 3G2JA 1XPRA 9ICOA 5B1SA 1I10A 4OP1A 1Y9ZA 1JQAA 4H0FA 5DN9A 3MWGA 1YR9A 1KJ9A 1AY0A 4GZ5A 3M6AA 1K7XB 4Z7JA 4W9MC 1T1RA 2OB1A 3GCZA 4L5JA 2H2AA 2JA1A 3DVAB 3ANSA 4PZEA 3HWSA 3HADA 4FGWA 3S2FA 4HGQA 1Z35A 2PRKA 3RSZA 1UK6A 3LGAA 3PFGA 3NDRA 3H4MA 2PJDA 2XQIA 4TMTA 4NLZA 3K0CA 3JAMA 4HY3A 1P3JA 1RC1A 1Y6QA 2B2XA 5ECYA 1ADCA 2BCSA 2MSDB 2PIAA 3PHGA 4M87A 1XVAA 3WLSA 2QRJA 2BRUC 2EJUA 4I1OA 3HVKA 3FDZB 4JS0A 5B4VA 2DLDA 3U31A 3DEYX 1W2WB 2G9UA 4RVFA 2YVQA 4YP1A 3QBDA 3PDJA 4XB1A 4DA4A 4XWGA 4EGJA 3ELWA 4BVAA 5KNDD 1Q77A 1FU8A 4TUPA 1VSUA 1U4SA 3MCTA 1EXVA 1Q20A 1SKRA 1Z7YA 3HR8A 9ICNA 1PT9A 3ZZ0A 2Q5LA 3U9SA 3TLGB 3OQNA 5J0PA 1W48A 2FWAA 2G0AA 2C5SA 4UPDA 2F64A 4M37A 1SKSA 5A62A 4AO8A 1ZHFA 1YI8A 4HATA 4B9EA 5JS2A 2AMLA 2Z8ZA 5BRJA 5FPSA 4I4NA 1SBIA 1KO4A 2DUMA 4X91A 4FO6A 4S35A 2QM3A 2W6IA 4MUXA 1Z8HA 4RO0A 5AXCA 4O4LB 4OQQA 2GVDC 1TTHA 3FYHA 4E5UA 2VJMA 2P6RA 3S4YA 5BOSA 1M6VB 5AM1A 1CZHA 3FOEC 1IOVA 4NBTA 2RH5A 3MXOA 3F96A 1VHJA 4B9MA 1NASA 1WHSA 4QM6A 1O6ZA 3DFFA 1J8VA 3U5TA 4JIMA 5FBHA 2AE1A 4P4SA 3TSAA 3MBIA 1QFJA 4LRXA 3BMNA 5IABA 2GMWA 2ZJZA 1LCIA 5DM70 1RHRA 1GU7A 2QSJA 3THOA 3J7AC 2WEKA 5AI4A 1W0KA 5KYWA 2O4UX 4O3FA 3OEYA 3TW6A 5FHRA 5EHIA 3OE7A 2FSFA 3AHCA 4A8EA 3BVPA 1WBBA 4WXRA 2DKOA 3DLAA 2XLCA 2YYZA 4YAOA 3H5IA 4MV5A 2GZHA 1L7XA 4E5VA 4PLCA 3FW1A 5IJXA 1B3RA 4C7MA 4DXHA 1JEEA 3BMOA 1Z2PX 1XTUA 1X8XA 1OYYA 5AW6A 3C6XA 3TK1A 4DDWA 4ALMA 4QVKA 1AMNA 2PMZC 3NHUA 1NY6A 1H8ED 2O6HA 3STUA 4ZXPA 5HQJA 4C7KA 3EPPA 4RJLA 3WMEA 4RVSA 1E9BA 2LE0A 2I87A 1X7YB 1CVLA 2FUNB 1S8FA 4OK3A 1GZ7A 4LRTB 5B1HA 1I2BA 2KM1A 5DDIP 4NLKA 3TBFA 3AL2A 2I4LA 2DLNA 3DTNA 2FMSA 5IJ9B 5M5BA 2CKDA 3E0FA 3D6NB 4QTUB 3T3EA 3GBSA 1US8A 2OH2A 2AQIA 4LYEA 3WGYA 2OMEA 4QIWC 3HI6A 4GPAA 2EJVA 4WACA 2RK4A 4DG9A 3H40A 4YCDA 2HLPA 3NXSA 3JQDA 4B7CA 1CZUA 2RSLA 4GOJA 5K3CA 4KOEC 1I3MA 3HHPA 2NZVG 1Q7GA 1KY4A 2H51A 3QVGA 4I55A 1KRHA 5DHQA 4A23A 2C4UA 3N39C 1YACA 5DG8A 2E4AA 3JQAD 4MJXA 5ITVA 4YRDA 2FMUA 2VBFA 1P19A 2JA2A 1WY5A 4LVUA 2H4ZA 5K0TA 3AEKA 1KIFA 5HS6A 1E9AA 5AOAA 5TEVA 3ICQB 1R5JA 3EN0A 5IAAA 4P7KA 4O63O 2D6FC 5FAKA 2QJTA 2W54A 1U6IA 3EXG2 5CFZA 2O3SA 3AFIA 5ALUA 4LHYA 1LK5A 4RQTA 2R8OA 2OCGA 3A04A 2VNHA 3HS3A 1J9EA 5E6RB 5EP3A 4LZPA 1SUEA 3AGQA 4PS1A 4PPNA 4NM1A 4NS4A 3SXJA 3SV4A 4YJ2A 1FC0A 1KWGA 3DLBA 4TTVA 2FEPA 2Q45A 3DV0B 2WWVD 3PWSA 1EM6A 2X6TA 1SBQA 3GPDG 1E7MA 4BQQA 3RJ9A 4IJWA 1XXHA 2NPFA 2W2LA 4L8GA 1ESEA 1RP7A 4HTFB 2L19A 3WHPA 3ZD6A 3IVGA 5JJKA 2QB1A 4DYVA 5EZ6B 2VQDA 3T9BA 5DB6A 2XR1A 5KYNA 1U28A 1JG4A 4D6YA 2QMEA 1Z3EB 1SVIA 5GJCA 2DE0X 1KYXA 1B0UA 4C0SA 2VR1A 1I5OA 1ZQKA 2EZTA 4CF5A 4O4IF 4W4TA 3EGEA 4G0OA 4LYDA 5A4MS 1RPZA 4R01A 1VIVA 1CYEA 2LKYA 1KK1A 3DL2A 3U7RA 2DZDA 5LJLA 2GBFA 3EOAI 3SZLA 3EQ8A 3PEFA 3UPQA 4Y2SA 2XITA 1F51E 3QKUA 4NMXB 1U45A 2JLSA 3KUUA 5GPBA 3Q8XB 1PKEA 2O4CA 2BT4A 3K3PA 2GFQA 3FB4A