2FDRA

Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
222
structure length
222
Chain Sequence
GFDLIIFDCDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVESEASIPLSASLLDKSEKLLDMRLERDVKIIDGVKFALSRLTTPRCICSNSSSHRLDMMLTKVGLKPYFAPHIYSAKDLGADRVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYPSHADRLTDAGAETVISRMQDLPAVIAAMAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hydrolases/phosphatases-like fold protein from Agrobacterium tumefaciens str. C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 68
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2fdrA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2fdrA01
4BNDA 5AVVA 4AS3A 2HF7A 2G0AA 3NRJA 4FE3A 3I76A 2W43A 4CF3A 1Z4NA 4YH1A 2RAVA 4EZEA 1RLOA 3WKAA 3WKEA 5ALWA 2EARA 2MSNA 1CQZA 3M1YA 5AVYA 3ZTYA 5AKYA 4CF5A 1Z5UA 3ET5A 4UU0A 1VJ5A 1Q91A 5AESA 3L8HA 3U7HB 2FPRA 3OCXA 2I34A 2C9MA 2FPWA 1L7PA 1RPZA 3CNHA 3N8GA 1RMQA 2EATA 3PGLA 2AUTA 3MMZA 5AM5A 1RMTA 2B82A 2BDUA 4JDPA 4L57A 2MU2A 3BWVA 4HGQA 4JB3A 3W5CA 5ALLA 5AI6A 1FEZA 3NUQA 4L6AA 4YIHA 1TJ3A 5A3SA 3PCTA 3OPXA 2HHLA 2I6XA 4Y2SA 5AKKA 4NFLA 1ZRMA 3UMGA 4HGOA 3OCYA 3ZW7A 4J2TA 5ALZA 4UU1A 2P11A 1S2OA 3QXGA 5AICA 3ESQA 3NANA 4NV0A 5E0OA 3FPSA 3MPOA 3B8EA 2C8KA 1QH9A 2OBBA 3ZTWA 3AR4A 3AR8A 2B1QA 3WKCA 3KOOA 1RDFA 2QLTA 2IOFK 4G63A 3WK7A 2Q5EA 4BEVA 4HGRA 1ZD4A 5AVXA 2FEAA 2FUEA 1EK2A 4OFZA 3M9LA 2C4NA 3E81A 3L8FA 2OM6A 4IFTA 3RF6A 2WHEA 1MH9A 1Z4QA 4UAVA 3ZI4A 3MC1A 4KNWA 2QYHA 3L0BA 2CN1A 1Z4JA 1Z88A 4YIKA 1K1EA 2O9JA 5AVQA 2JAOA 4Y3UA 1ZS9A 5AK6A 5AK4A 3NIWA 3OCUA 4EEKA 2G09A 3EF0A 4CE6A 3UMCA 3BA6A 5ALPA 3ZVLA 5AI8A 3J7TA 3ONNA 1Z5GA 5AW1A 1Z4IA 1XP5A 1ZD5A 5ALUA 2WF7A 3WK5A 1U7PA 4Y2UA 3FPBA 2B8JA 2G08A 5AKIA 5AI9A 3WK8A 5AI4A 3OCVA 4EX7A 3KD3A 3U13A 3VAYA 4XPZA 1QQ6A 3QGMA 3F9RA 4O8CA 4NWIA 3ZX5A 5AIBA 2B1RA 3B9RA 4UM5A 2IYEA 3U26A 3FZQA 4OHFA 4OCZA 5ALEA 1RKVA 4KYTA 1T5SA 1KYTA 3A1EA 2Q4TA 4E88A 2HO4A 1RLMA 3OCZA 1NF2A 4HGNA 3QU7A 4BBJA 2R8XA 4L6CA 2IOFA 4Y2XA 2C8LA 3ED5A 1RQNA 5ALKA 3U7GA 1T9ZA 2HEGA 4IG4A 4UMVA 3K1ZA 2JGAA 1Z4OA 3WK9A 3U19A 4UASA 1N9KA 3L1UA 1O08A 3AR7A 3SLRA 1L7NA 3QUBA 2YJ5A 2YMLA 1YDFA 2FDRA 5T41A 3QU4A 1RMYA 5ALSA 2I55A 4CNQA 4UW9A 2YJ4A 4YCNA 2JAWA 3N28A 2AMYA 2BDEA 2ZBGA 3EF1A 4YGYA 3I28A 3KC2A 2G1AA 1WVIA 1VFPA 2HX1A 2FUCA 3CZ4A 2ZG6A 3KDPA 1Z4PX 2IOHA 3PDWA 5ALQA 1L7MA 5AKXA 1U02A 2YJ6A 3A1CA 1YS9A 5AVWA 4FFDA 3E58A 5AVRA 5AVTA 4YCLA 2P9JA 4XE5A 2WF6A 3TLMA 1L8LA 3N07A 1Q92A 2C88A 1YNSA 2GHTA 3IRUA 1YV9A 1SWVA 5AW2A 2WF9A 3R9KA 2NO4A 1CR6A 4HYTA 2D2VA 2RARA 4Y2PA 3N5KA 4Y2RA 1ZD2P 1Y8AA 2HI0A 2B0CA 4UM7A 2FPXA 3U7EB 3KZXA 2B30A 4KX5A 5ALJA 2YMQA 3MN1A 4OD0A 4HGPA 2YN4A 3E8MA 4I9FA 3ET4A 3L8GA 2FPSA 4KX3A 3E84A 2AGVA 3AR2A 1RKQA 3IJ5A 5ALXA 4PNHA 3EWIA 5AHXA 3I1YA 2W4MA 3W5DA 3KBBA 4DFDA 3QU9A 2FPUA 3SD7A 2JARA 5AM0A 3R09A 4UAUA 1RRCA 4H1WA 4KNVA 4NAVA 3ZWDA 2IA5A 3FVVA 4ZEWA 4RETA 2YFYA 5AVSA 4GXTA 5IT4A 3SKXA 1LVHA 3AR5A 4F72A 1X42A 3UMBA 3DNPA 2G06A 2B8EA 5ALHA 3I6BA 1ZRNA 1RC8A 3AR3A 1Z4LA 4UMFA 4BKMA 4Y2VA 1L8OA 2G07A 4BX2A 1QQ5A 4UARA 2I54A 2NYVA 2Q4RA 2P69A 3WKDA 1TJ4A 1U2SA 5ALIA 1F5SA 3SMVA 1SU4A 2GMWA 5JJBA 3NASA 1TJ5A 3L8EA 4NABA 3WGUA 4QQFA 3WK4A 5AKGA 1PW5A 5ALYA 3DAOA 4BEWA 4Y2JA 2YJ3A 5AK5A 5AKHA 4QJBA 3ZU6A 5ALOA 5ALFA 2ZOSA 5AW9A 1EK1A 5ALMA 3GYGA 2P27A 2GO7A 1L7OA 2PQ0A 1IWOA 2JAUA 3QUTA 3L5KA 4C4SA 1J8DA 3QNMA 1RQLA 1Z4MA 4G9BA 2RB5A 2OYCA 3PGVA 1RKUA 5AW0A 1WPGA 2W11A 1XVIA 2GHQA 2WF8A 4UMEA 3OCWA 3R4CA 2HSZA 4UMDA 3HLTA 3SHQA 3NALA 3QLEA 3QUQA 4DW8A 4EELA 4AP9A 2CFTA 2CFSA 3WGVA 3OTQA 3L0CA 5AI5A 1WR8A 5AW8A 5ALVA 1S8OA 5AW4A 1VJRA 2ZBDA 4Y2YA 1RLTA 1JUDA 5AM4A 2FI1A 4XOUA 3NAMA 2WM8A 3ZUPA 2DQSA 2PKEA 4Y2TA 3L0YA 5ALGA 4BX0A 5AKLA 3AR6A 1TE2A 2NO5A 5IS2A 3ESRA 5AVUA 1QYIA 5AM2A 1QQ7A 1O03A 4MUMA 3SF0A 2PR7A 2R8EA 1XPJA 1ZJJA 4C4TA 3L7YA 4I9GA 4DCCA 3FGOA 2O2XA 4CF4A 4ZEVA 3EPRA 3ZWKA 3ZVNA 5AVZA 2G80A 2I7DA 3QUCA 2HF2A 3QU5A 2HDOA 5AK3A 2YY6A 1Z4KA 1L6RA 1J97A 5A3QA 3AR9A 2BY4A 3ZVMA 4AS2A 2MU1A 1SWWA 5ALNA 5AM3A 2YBDA 5IT0A 3B9BA 2WFAA 1ZD3A 1U7OA 2ZBFA 1AQ6A 5ALTA 2GFHA 1ZOLA 5A3RA 2ZBEA 3W5BA 3A3YA 2RBKA 2YMMA 5AW7A 3N1UA 1YMQA 4BNDB 3L1VA 3QU2A 3RFUA 3D6JA 5AW3A 2R8ZA 4DWOA 4BX3A 3DDHA 3U7FB 5ALRA 2EAUA 2OA0A 3WKBA 4HAIA 2I33A 3ZX4A 5AKZA 2X4DA 2YMPA 4F71A 5AM1A 1U2TA 2HCFA 2AH5A 2ODAA 5AW5A 1NRWA 5AKJA 4EX6A 1LTQA 1N8NA 4ZEXA 3W5AA 3FM9A 4B6JA 4EENA 4UATA 3UM9A 1NNLA 4J03A 2VKQA 3A1DA 1YJ5A 4BYGA 2R8YA 3IB6A 2ZXEA 5FP0A 3SKYA 1T5TA 2WF5A 2HOQA 4XQ0A 3HYCA 3QYPA 5AI0A 3S6JA 4RESA 1WZCA 4C4RA 5ALDA 4MWOA 5AW6A 3P96A 3WK6A 3QX7A 4Y2QA 4GIBA 3DV9A 5AKEA 4YCMA 4FYPA 2CFRA 1TA0A 5AIAA 4KN8A
chains in the Genus database with same CATH superfamily
3PFHA 4B87A 4AS3A 2D0DA 3E9RA 3HDJA 3IUYA 3RVSA 3MA0A 1XHFA 2VAXA 1O0BA 1Z4NA 3KAKA 1MPXA 3VR0A 1I3OA 3RLFA 5JH7F 4EYSA 4OKSA 3UPTA 1G5QA 1PSWA 4PGYA 1YB1A 1ZNXA 3QEMA 2WAAA 1V9CA 3RJEA 1JLMA 2WK1A 4U8GA 3R74A 1BE8A 1VSBA 5DCWA 5FUQA 1XIVA 2WIKA 3DFUA 3SZOA 4D44A 2J9ZB 2EP7A 4RVCA 4XH9B 5TDHA 3ZN2A 4ASUA 1N8TA 4QUEA 1KFBB 4KQIA 2DRIA 4BN5A 5B7PA 5KOYA 1LLFA 2I67A 3GDGA 4NK4A 1JMVA 4OP1A 3RVJA 3WMWA 4CLOA 4ND8B 2PX5A 4D4LA 4PFJA 4Q02A 1G2PA 1GG2A 4YP6A 2CCGA 4XQ8A 1JAXA 2FFJA 2NXNA 2GBIA 3E4CA 5AM5A 4DLKA 3A6FA 5EQJB 5BOVA 2BM0A 3DBRA 3K05A 4JB3A 4RQ0A 1PZHA 1SQ5A 2AHRA 2OGUA 4HGQA 4JUCA 2QORA 5JY1A 5EQFA 1HSZA 5BOSA 2VF5X 3R44A 2VYQA 1JG4A 4DVGA 4EG4A 5I4IA 3VI3B 3AFNA 1WPRA 2V65A 3COYA 1C0EA 3S2IA 3UJPA 2GVNA 4EUHA 1P62B 4ECVA 3GNLA 3LLSA 4HDMB 4TN5A 4QNLA 1DKUA 3CPEA 1X8KA 2RIPA 3HKCA 1VPTA 3DZCA 3KU1A 2GYUA 4FN5A 3DEEA 2P11A 3MF4A 3QXGA 3ESQA 4ZK2A 2IIQA 5DQIA 1AHPA 9ICJA 1T5BA 4B3HA 2KBFA 1GO2A 4MVJH 3S2ZA 3A6DA 1SXIA 2LKCA 4LK3A 3G8BA 1GO3F 3JQCA 3UATA 4D3DA 4HUTA 5B2EA 2XCRB 1N6OA 1QM5A 1A5SB 3JARB 4D8UA 2WHPB 2BSQA 3TAQA 1E0SA 1Q19A 1FTNA 1NMQA 3B7GA 3W5IA 4C7KA 3THXB 4RPLA 2CXOA 5GINE 3AKCA 4UEQA 4DWIA 2OY0A 1UFKA 2A4MA 3GVCA 1BS1A 4KMMA 4P7JA 2B5OA 3TDNA 5KHOC 1B16A 1U45A 1M2FA 2FXVA 5T3YA 2QRPA 4TLMB 1Z7YA 4UNPA 1FYVA 4QPDA 1BXGB 4BNHA 3GA7A 3JQ6A 1R3DA 1CUJA 1UBCA 2HMVA 2ZRIA 3FWPA 4M9QA 1JVBA 4WFJA 4H59A 4FB5A 1E6KA 1JIQA 3F6YA 2OAP1 1NVGA 3HKEA 3PRYA 3DAYA 4JVSB 8ATCA 4P3YA 2IEIA 1I3MA 4UREA 3FMGA 3W1VA 5IK2A 3JS5A 1OAKA 3VQTA 2QYHA 4E09A 4K9LA 2KVSA 1UIRA 4D57A 3LT4A 3TRHA 2HU8A 3WHLA 4M9NA 1MFPA 1N4AA 3X1ZA 1XZBA 1PJBA 2H3EA 4C0SA 4WECA 1PVDA 1OZFA 3K31A 2V4MA 5CRIA 2VDQB 4TVBA 1V3VA 2JAOA 4ZT3A 1L5RA 4X3CA 1D4AA 2VTKA 3E8SA 1B22A 3FETA 3LHIA 4B31A 4D9EA 1LBQA 1KH2A 4IVNA 4BPRA 1SR8A 4ZYWA 2FWRA 5TVKA 2IPNA 2ZSEA 5F9FA 1ZJ6A 1DMRA 2QX8A 4ONEA 2V6BA 4QWDA 3ZVLA 3BJEA 2FSUA 5C0OE 4KOEC 1JIUA 3IDOA 4B32A 3BWCA 4YMUA 3R5XA 2YYYA 1QOQB 1YKFA 1KJZA 1C7QA 2FJUA 3G8AA 1WMBA 4HLNA 4BQSA 4BS9A 5AUOB 2WAQF 5CTJA 4I99A 4LOHA 3HGQA 8ICEA 2PZMA 2J8ZA 3GZTB 3MVEA 2PT5A 5FL7A 2CVQA 3M5CA 2IELA 2XUIA 4HI0E 2CF6A 1ZI8A 2H00A 2K7ZA 1QHNA 4E51A 2MR5A 5FFFA 2I4MA 5KSYA 1Z6YA 4GUAA 1CY7A 3DFIA 2P9QA 1RBZA 2HQ1A 1T2CA 7ICIA 4MRPA 5J0QA 3PZBA 3IBGA 2FPGB 2OCXA 4XYEA 1BYIA 1YU6A 2NYUA 4JB0A 1RRVA 4JXXA 1V11A 1KSGA 5DP1A 3LDFA 4F56A 3R7WA 3THSA 4AVYA 4LX8A 2Q4TA 1WCIA 4J2OA 4Q6BA 1KJQA 5D01A 1DTEA 4A6DA 2HRCA 4HDCA 3EE6A 3MOIA 1MIHA 2YQEA 3AB7A 5L3QB 2Z5LA 3RWOA 1TMYA 1MNAA 4RSRA 1UBSB 1Q7EA 4LCEA 3HKZF 1ULSA 5KTSA 3WAJA 4L6CA 3ZZTA 3EGEA 1GILA 2XMQA 5IAKA 1H0SA 3RUEA 1PNOA 3C3EA 1L3BA 4J7XA 1YS7A 3C7TA 3TRKA 4KODA 1XN4A 3AMZA 3FZGA 4GPBA 2P1ZA 2A78A 3K71B 3PLAE 5KREA 5KFMA 4UMVA 3BD8A 1WPQA 3GARA 2C1EA 5DG7A 4L5IA 4LHZA 3IURA 1NJZA 4MAAA 4FSDA 4WOBA 3D0RA 2ZVPX 3OCCA 1PI3A 1O08A 2D5CA 8ICIA 2CXNA 4WLVA 4GKVA 4FZ3A 3KVRA 4LMPA 1LFDB 3UHFA 1S02A 2CXSA 3KELA 3JQGB 3KQWA 4LQLA 2CXQA 5EMHA 3ZCSA 2I1VB 5D1NA 1QHFA 2AQ4A 1U8YA 1BS9A 4Z1MD 4U2FA 3OM1A 1E69A 4PCUA 2H07A 1CPYA 1DSSG 1QK5A 3MT7A 2XUAA 4DEZA 3N28A 5KAMA 2OFXA 5CX1A 3I53A 3H11B 3GOQA 4CQLB 2J3EA 1JBQA 3AY6A 3BILA 1BIFA 1VKNA 4AN0A 4MH0R 2EZZA 1QVVA 1MB2A 4PZUA 4KLUA 1JMYA 2C61A 3KQMA 4H18A 3H1EA 1O95A 2XAUA 2QLNA 1XU7A 3CEHA 3PWKA 2BGIA 2VRBA 5BSWA 4WUTA 5FI0B 3LY5A 4YXFA 2IQIA 4USAA 4D45A 4YCLA 1W52X 5BURA 2O2GA 4Q19A 4L5YA 1AKVA 3TLMA 2DUWA 3ZHSA 4NESA 3QE9Y 1FMLA 1SPXA 2BFDB 2FY8A 5LD2C 4WVFA 4TUYF 3FUCA 3FTPA 3RO7A 5AW2A 2WF9A 4B9VA 4YMIA 4G8BA 1NJ2A 4O0LA 3EMKA 3DZJA 4KMOB 3GAZA 1AC5A 1L5OA 5A4MS 1ZNYA 2D2VA 1LVUA 5EERA 3RJ9A 1SQ0A 1W85B 3HP7A 4C3VA 5BPCA 3GCXA 1JG1A 5B6IA 5K0JA 1XZGA 3CKLA 4IF4A 4B0OA 3O2QB 4P4MA 1PGOA 1Y8AA 3ZZUA 4N3NA 4BNIA 4CM4B 3EOZA 2CHEA 4FQ8A 1L5KA 4GNRA 2C4TA 4DJJA 4B9TA 1K7EB 3GIJA 1U8AA 2QUKA 2YNMD 3QTBA 4M8LA 1O5IA 5ADUS 2CLSA 2DWCA 5F78A 2R751 1V5FA 3V6JA 4NU8X 3F5DA 4TSFA 3P7MA 2PANA 4HGPA 4TLDA 3PQDA 3O9VA 1TUBB 1OX4A 4OHKA 2IU0A 5I7OA 5DHFA 1EIWA 4ODIA 2PXIA 2BFAA 2G3YA 3NVYA 2Q6KA 3DBIA 4A82A 2PFGA 4BDPA 1W85A 3G9ZA 3AJ9A 3WJ7A 2L42A 4FKBA 4KO8A 4OLBA 3WWZA 5J29A 5JCOA 1B41A 3PQEA 3KOYA 4IXNA 5J58A 1D2HA 3Q87B 4B7AA 3BH6A 5IAEA 2BGMA 1IIRA 5HCUA 4QYIB 1NVEA 1VL1A 4D80A 3UKJA 1BCRB 2YKGA 2H4WA 1CP2A 3R7DA 3GLGE 3TZEA 1IZ8A 4B3XA 3P71T 3DFZA 3SS9X 1DOQA 3S1LA 4LE2A 4MKXA 4ZEWA 2IUYA 5CH8A 2CFIA 1X42A 4C88A 4EGQA 3A4YA 1O7JA 1QZUA 3DKPA 4JHXA 3NDPA 1ZH8A 4KFSA 4QFCA 2B7BA 1ONBA 3MK31 3OF3A 1SHKA 3ZY2A 1WCWA 3R2JA 4LOLA 4V02A 4EQZA 4U5QA 1DJMA 4Y30A 2I2AA 1PGQA 2BKEA 4V3BA 4JQZA 5KVSA 3M9XA 1K6MA 2D0PB 3FR8A 4NSNA 4OXYA 2IS2A 3CIFA 1BTOA 4JMLA 4R1NA 1RTKA 1LSOA 3TLGB 4GD3Q 3ZHOA 4BVFA 4K3UA 1H8ED 2EERA 1R0LA 1ESDA 1KA9H 1U2SA 3DBHA 5EIBD 4L15A 4ASUD 3SMVA 1SZCA 3MOSA 2VBFA 4WADA 3KLOA 4WNIA 1HR0B 3U81A 4R9UC 4GI5A 4L7VA 3DLAA 2G5CA 5LM3A 1ZXBA 1M2HA 2DHQA 1E2BA 1RJ9A 1GQOA 2WNHA 3MYYA 1KDOA 3DLIA 4ID9A 3BMCB 2MYNA 3PD0A 5DT2A 1BVSA 2UYYA 2WTXA 5ALOA 1ZOSA 2Q5OA 3G2LA 3QK7A 2MDTA 3F2BA 4X94A 5CT4A 3M8SA 3HY6A 5A6VA 4LXYA 3GYGA 2WDZA 3X3HA 1SHZA 3ZJVA 1A77A 1P3Y1 1QS0B 1NBME 2QMOA 3W34A 1RRGA 5CEHA 2Q2WA 1D7AA 2PRYA 2J6SA 1EH5A 2F8KA 3IEMA 1I5OA 1PK9A 1DTSA 3JR7A 2JHCA 4YQWA 1L5UA 4DJFC 4CRWB 3ZY4A 3P9RA 2FTKE 4JWNA 3NJ8A 2DWQA 3A6LA 1ZGJA 2IPOA 2PKRA 2ZSDA 3ACDA 3QKSB 3O2NA 4F3NA 1HBJA 2E89A 2WF8A 2K4EA 1KI4A 1V8FA 3HA5A 3PQ2A 1RSZA 1WW3A 4PAQA 4CYMA 3M3DA 5K8VA 1MN6A 4LA4A 2WE8A 2OORA 3DT9A 4KAJA 4YJ3B 1EI9A 3IVMA 2RHDA 1L4KA 5JLAA 5EZQA 5K99A 5DZSA 1SIUA 2A5FA 4ZICA 2MR6A 1L5GB 3WY9A 1AGRA 4GC9A 4U2GA 2D2IA 1ORIA 4QDZA 1IYZA 1TCVA 3B0XA 2OM2A 2SBTA 1H42A 2VTEA 3ISTA 3UANA 5AI5A 1XD9A 1E7SA 3F6EX 3B38A 1TO6A 3H1BA 4BO6A 1SXQA 3LQRA 3D4PA 1VJRA 4P3OA 2A84A 2HWYA 4QOSA 1O9GA 1PFGA 2O19A 3DUWA 4MGYR 4TL6A 4E7OA 1C80A 3E1KA 4GH5A 1ZISA 4O0MA 2ZRJA 2EJVA 1QG6A 2VDMB 2QNIA 4C8LA 2AXNA 4TWIA 3I9NA 3MRVA 1FXUA 4TXLA 1RXWA 2I03A 2OLEA 3OM9A 5FXMA 2CMHA 4C0XA 1KDZA 3LQYA 1RYYA 1Y82A 1U98A 3JVVA 1B6GA 1FZQA 1KAHA 2OENG 2XMCA 3HHEA 3HU2A 4YAFA 3L0YA 5SY4A 3SEFA 4EYHB 4UHKA 2ASLA 2JLUA 3GX1A 3C5GA 5CA1A 4BBPA 1F3LA 1M5RA 3TOSA 1P1RA 1RS0A 1K6JA 3DCIA 3HNPA 4L2IA 1MV8A 4UE6A 2ZETA 3IAAA 4QFBA 1JHQA 2ZJ3A 3SQXA 9GPBA 4C4TA 4ER7A 2PWPA 4YCBA 1JLSA 1XN1A 2Q6TA 2WYHA 3EZ7A 3UK6A 3V46A 3KHSA 3PD1A 5T4HA 5HM6A 4HEHA 2Y6UA 4IQ0A 4ARZA 5D3MA 3AETA 1GN8A 2P0EA 3BC1A 5LZ4A 3WGIA 4AMGA 4UUPA 2X8AA 1PT9A 3VCBA 2IIBA 3OZTA 3AIKA 1LS6A 2AR0A 4WNYA 3INRA 1Y1SA 5DGAA 1QLNA 4DSZA 1OAAA 7REQA 2O1XA 5D6NA 3SZLA 4DA4A 2YCLA 3NHRA 1NRJB 1AS0A 4MS4A 3C1YA 2EQYA 1P0PA 1T2VA 2GN8A 2CE2X 4YWHA 1QOPB 4KO4S 1F4LA 5GOZA 2AL7A 1VIDA 1QFJA 1PS8A 2GCOA 2OWDA 4BRWA 4QLBA 1SUPA 5KUTA 4PSDA 5J2UA 1M0EA 4Q1BA 2Z95A 4G8JA 3SI8A 1UJ2A 4HEQA 4TV8B 4QT0A 4ZQFA 3CEJA 1NJGA 2WWRA 3QMWA 3FX2A 4REQB 1VLHA 1Z2PX 4QXMA 3ZZ1A 1UWVA 4IR7A 1OLUB 5JS2A 4PG8A 5AJHA 1W36D 1ORHA 4P80A 3UWPA 1E7RA 1O95D 3UK0A 3RH5A 3GLGB 4DWJA 3WO1A 2X5XA 3LBHA 2B1IA 6Q21A 1HUOA 2WKQA 3UCFA 1BJKA 1MO2A 4J7UA 5KYGA 3C41J 4X63A 4HDMA 2EIXA 3OZAA 3Q5GA 1YUMA 3V4VB 4JP1A 3AOEC 5GONA 3U0BA 1GG8A 1ZSYA 4ZVUA 3SEAA 2IVFA 2J0VA 1TCAA 3IP8A 1KKMA 2JRCA 5DM4A 2QM3A 4M88A 5IW8A 5C5EA 4V0SA 1IQUA 1V43A 4BNKA 4A0FA 1L4HA 2IUEA 5GTHU 1W581 4IICA 4PWYA 2QRGA 3DM5A 3BS5A 4Q1FA 3FM9A 3UG6A 1X7ZA 2JI9A 3L7KA 3R6DA 1T25A 2BCJQ 5D49A 2RDJA 1HRDA 2FW0A 1NXWA 1CUEA 2P68A 1IK6A 4DL9A 1AO0A 2AQ0A 3A4TA 1TK0A 1Z5NA 1EQAA 3AYXB 3B85A 1XCGB 4R83A 4E7PA 4DLWA 1NDUA 3FSJX 2QAGA 3AP1A 5IAGA 4B84A 2UVRA 5IDWA 5AJZA 3LWDA 2PZGA 3I64A 2EANA 2QDXA 1E3JA 5JS7A 4MQBA 4WCFB 4G36A 2PTGA 4O2RA 4RZSA 4YJ2F 5EJIA 5BUZA 4FOSA 5CR0A 1BGVA 2WUWE 4IIGA 1C3JA 1C9JA 2PV7A 4CF7A 4M1TA 3BQMB 1RYHA 4XQ0A 3BZBA 4B82A 3JW8A 1EDDA 4PQFA 1YVUA 1YVDA 5KG6A 4RESA 1VE1A 4LBZA 5LZ8A 3IO3A 3T5TA 4XUCA 1QRAA 3NM5A 4GHWA 4BIMA 4M9GA 3GLGA 4GIBA 2HADA 3O8CA 1DQYA 1N2CB 2J0SA 3LVWA 3M5PA 4Z4CA 5IFKA 3I9KA 3A05A 2GA8A 5ARDA 2XGJA 1NJFA 2V7TA 1ISJA 3GZJA 3T6KA 5DX8A 4UHEA 2W6JD 3G0GA 1UDAA 2ZJ6A 3KRTA 5C1IA 5C3MA 3EQZA 3I76A 3FTEA 4TZ0A 3M4NA 2I4LA 3UWKA 3MWKA 1NBAA 1DKOA 2AYZA 2V7PA 5EJ7A 5AXDA 2V03A 4Q16A 2VZLA 4KWHA 4QZFA 5DGHA 2EJCA 4F5PA 1GAJA 3U61B 2UZAA 4HS4A 3NYRA 4DYDA 4DE5A 4E12A 2I4RA 4PINA 3ZIDA 2O8CB 4B76A 4YRIA 3O7WA 4F3KA 4FSHA 2CVPA 1RM4A 1U81A 2BP7A 2ZW9A 2CXHA 2LMRA 1FC0A 1SQFA 2CBGA 3PF8A 3PK0A 3PNPA 4ND4A 4QUDA 4S1OA 4DANA 5M3BA 1XZLA 4PG5A 1JDPA 2RI1A 2YNMC 1P0IA 3IMEA 1QVZA 4L57A 4GP7A 4JDPA 3JTMA 2H9AA 3GV0A 4MUGA 4NX2A 3BWVA 4DLRA 2DPXA 4K6OA 1U94A 3V33A 1ZIXA 3W5CA 3F8WA 2HHTA 5HQJA 2XUZA 4YIHA 4RQ8A 1IXZA 1Q6YA 1Y6QA 1DKQA 2UVPB 1ZQRA 1U49A 2WE7A 3EZFA 4EITA 3C5HA 2BLLA 2YWCA 4K8RB 1F7UA 2R6GA 4OB6A 4RD1A 1QO9A 1Q7TA 2QSJA 1UOQA 4RHTA 4Q34A 4LYHA 3LY7A 1BKYA 4J90A 1FUYB 4MROA 3F3YA 3JSXA 5H80A 4UU1A 1UADA 1IBKB 3KQNA 2QRZA 3M0EA 3OE7A 1UMCA 2YV3A 1AMUA 2XCPA 3PSIA 2P90A 5FOXA 4INJA 5EWJB 2C8VA 2GNPA 2HM7A 4LRQA 4ZTBA 1WXFA 5AXBA 3TCKA 3KG2A 4RQ1A 1YFZA 4XCQA 4GLBA 4A6XA 4EI7A 4AL4A 3GFTA 2IOFK 3PUVA 4OI4A 4UUBA 4EPVA 4EBFA 4NXMB 4GEKA 2B8TA 4L9AA 5JCJA 5HWSA 4JAVC 1G7RA 3G8DA 2Y77A 4LOJA 4ENSA 1U2GC 2VJYA 3E5HA 2CJFA 1ZVKA 1OLSB 1VFNA 2FUEA 4H15A 2YZKA 4V1CB 1SKMA 4PHEA 3VPCA 3A4LA 1PJ3A 3TXAA 1Z07A 5LXTA 1V2GA 2BKUA 1O0SA 1M2OB 1AUPA 2JB9A 2M6RA 4ND1A 4NZPA 5F7OA 2LPEA 3MWEA 2N1MA 5CT9A 2V74B 3JWIA 3ZQ4A 1V71A 3A9CA 5E1MA 3VPHA 1LRLA 3GJ3A 3RTGA 4O0IA 9ICSA 1R8XA 1WXEA 4ALJA 4UAVA 4R40A 2JIPA 2IYPA 1KYZA 3L7OA 3DHVA 3WAKA 5KYXA 3JVUA 1TT5A 1G7CA 1V1MA 5D86A 3RS0A 3UQZA 4BNGA 1TYAE 1N5LA 2FN3A 4IAOA 4BBZA 1IY0A 4CQLA 3TMAA 3U3OA 1WD7A 3QEBZ 3ODPA 2Q6VA 4HNAB 4IFBA 3TSZA 3LO8A 5IJ0B 1G1MA 1MORA 1S3GA 1IOVA 3GA5A 3ZR4B 1PQWA 7AT1A 2FEPA 3TQSA 1D9DA 2XMSA 1EFTA 1UUFA 3ITKA 3JZMA 3MJHA 3PCXA 2A9OA 1KJWA 5LP6C 3ZKAA 4RSHA 4TX1A 3GILA 1MC1A 3GIWA 5DYNA 3W5HA 1O58A 4LHVA 4LMAA 4J4BA 3TOVA 3TZKA 3EVBA 2ZIVA 1JU4A 5C5IA 3CM0A 1ZC3A 4YRTA 2BLNA 1KU0A 1S7CA 9ICUA 4IOJA 2CCKA 4XB6B 3EPJA 4MZDA 1X8LA 2Q2QA 3MR5A 1ISMA 2YW2A 4DZRA 3HCWA 1UEIA 2XDQA 1ZUD1 2CDRA 4NEQA 1N92A 1GU0A 2QZSA 3EEBA 4B8WA 3X2SA 5L6LB 4Y1EA 3OMXA 5MDHA 5LQDA 2ERXA 2XMRA 1NK7A 3B9RA 1ZJZA 3M6KA 3EA5A 1EB9A 4N01A 5E2IA 4RQ4A 3GGGA 1CVIA 2BTQB 1OXVA 4NBUA 4YASA 4AYWA 3DCJA 3I0NA 4FYXA 2R2GA 4J6EA 3KDAA 3UTCA 1P2FA 1RKVA 1MF7A 3M2PA 5IVPA 1ZQBA 2C9DA 1TUBA 3NHWA 3VISA 3NUZA 1G8AA 1KH3A 1D0SA 3HB0A 1R8JA 4RKRA 5BUSA 3LWNA 4HY3A 4A3SA 4OPMA 4YAUA 3LFTA 5CHEA 2I2CA 4B73A 3VUEA 5CH5A 4E2ZA 5BVGA 5EUQB 4DSJA 1CX9B 2RHMA 4YLGA 3RJIA 2DKNA 1JV2B 3AG5A 2XIDA 2ZIFA 4EK9A 4P86A 2ZGVA 2R97A 3MWJA 3UJBA 2ALZA 4QEKA 2JVJA 4XVUA 1BDHA 3T95A 2AZXA 3WDKA 2CE7A 1GKKA 3LXUX 3H9CA 5A4AA 3BJRA 3TDMA 4QYMA 3HK2A 5IC6A 1UT8A 5J59A 2J3HA 1JEDA 1F8FA 1XF1A 3HVHA 4CMBA 2I5HA 1U1CA 2EX1A 3AU9A 1IUKA 3ZY3A 4ZHQB 4QGAA 1MJGA 1CDZA 2PVPA 3KUDA 4Y6QA 3ER6A 3OQIA 2PUHA 1N0HA 3HCNA 4M7WA 3NDRA 4FD3A 4HMPA 3CF6R 3MAJA 4PO3X 3CNQS 4ZIRA 4PLFA 2ZR8A 4KPYA 2JDIA 5KJEA 3X2EA 2R6DA 2Q28A 2X7HA 1A4IA 3Q8WA 4O5AA 2ODNA 1NMEA 1K66A 3WOHA 2YIDA 1L5LA 1KFSA 3DKVA 3DKKA 3U6BA 2DX7A 3QZ7A 1BE6A 4AIRA 3VC3A 4RY9A 3C98A 1R64A 1XKQA 1CUGA 3EF1A 3R5KA 2Y99A 3JPSA 5ECGC 1QH8B 4R3NA 5KU1A 4L8FA 4BZZA 3AFHA 2W8BB 1PZFA 2BC9A 4FHCA 1C7ZA 4LI0A 3MWDB 1UXOA 1IN6A 1US8A 1G63A 1VFPA 3OTWA 3PWSA 4GW3A 4RGVA 5HZMA 1H23A 1MC8A 5H68A 3JPWA 1MOSA 2OFOA 4WY5A 4DCTA 1ZH6A 1XLWA 5T7BA 3C7KA 3C74A 1CJVC 3JQEA 3KTAB 4RS4A 1I5RA 2E0IA 4ZXPA 2UXCB 1FVHA 3GLIE 1RAGA 2ZYAA 4M0MA 4RTLA 5LQKA 3ADDA 1L8LA 1H2BA 3DQZA 2KZMA 2ZU0C 4FW9A 3I45A 4TMWA 4OAOA 2RGGA 4Z0TA 3NM4A 1WMSA 3V7JA 2YRWA 3JVEA 1EWKA 2DUMA 3KSZO 3P9SA 3Q15C 2PA3A 4YPOA 5JLJA 1KOFA 2EHDA 1E6MA 4IIDA 3K1YA 4O4IB 1KEEB 2JVIA 4R05A 4R69A 1YDMA 4W63A 4PZLA 3WGYA 5C37A 4I8DA 3RC7A 1K68A 2B5VA 4PANA 4RL4A 4Q45A 4M9XA 4OQQA 2LIPA 1NXSA 2GFIA 2ESRA 3GJ5A 5BYJA 4KR2A 4LSMA 4BFTA 4YQZA 4X95A 1YZYA 3HHPA 2RHRA 1ITZA 3OETA 3TW8B 5ALJA 4B83A 4KL8S 1CFZA 1PWHA 4CGYA 3FPEA 4IXDA 3SAFA 4BIIA 3E8XA 4WZAB 1AV6A 5H9VA 3FCYA 3RYFB 5ADWA 1N0WA 3KPUA 4A92A 4G4JA 2A1TR 3LVVA 3IUNA 4FVTA 7ICFA 1L1FA 1NNSA 3NHMA 3T4XA 4QKQA 5B36A 1I5EA 2IE0A 5CDUA 3VDRA 3IKJA 3ZCUA 5JJKA 3H4VA 3OEED 4EGFA 2F6RA 4JROA 2AGVA 1XNJA 1E89A 1FPMA 1OASA 3I2HA 3KKEA 4PCLA 5K09A 4ZA2A 3K0CA 2J6BA 3ULKA 2VRNA 3NH6A 2QQGA 3QM1A 2O5RA 1KZYC 4QASA 2XNJA 4IG9A 5CIQA 3VSCA 4BWJA 3B48A 5JEDA 2AJ8A 1P0CA 3TX2A 1JB1A 2VNJA 2ZB7A 4MW9A 4NH0A 4BMCA 1M6HA 2X8BA 1ST3A 5I45A 3S3TA 1W88B 4HGYA 3K1JA 1SPBS 4TT3A 4ND8A 1FDTA 1GXSB 1L5MA 3IN5A 3PD7A 4E6PA 4NI5A 5AK0A 4YCDA 4AQYB 2J3LA 2HSGA 2QMUA 5D84A 3DNPA 4P4OA 3ZGZA 4AKIA 1U3VA 1M34E 2DF8A 2W2OA 2Y27A 2W04A 3FSGA 4LQ4A 2EVWX 4RHCA 4YRGA 1PNTA 2NUTA 5BQFA 1FMTA 3VDXA 2ZT6A 3UUGA 4UMFA 3PHHA 4N5NA 1HV8A 2XZPA 3FUTA 3M3HA 4UHFA 4EYQA 5GJBA 2KHZA 4HLCA 2HWWA 4MFFA 2PJUA 4OJ5A 3B6JA 1IPEA 2W9CA 1K0FA 3WKDA 1Q57A 2FSFA 1DRUA 1XELA 5ALIA 4WNCA 4XYGA 4EUKA 4TZ6A 1P33A 2GXUA 3OHSX 3KNZA 5B1HA 3V34A 3D7KA 4AY2A 5TQVA 3BM5A 1NC3A 2IHVA 2VPQA 3ER8A 3H04A 3PNSA 4RD0A 3T5AA 2O8CA 2G72A 2LVBA 4GFDA 3RRXA 1T9GS 1XKTA 4NULA 3QFSA 2P8JA 3A4IA 4DWVA 2NXJA 1WDKA 1NQXA 2PIDA 4IW3B 3RB3A 1GFIA 1TK9A 1CETA 3LF1A 1GA1A 3CRNA 5JDIA 1F3OA 3DEHA 1Q21A 1OXKB 3U6KA 4ES6A 3AHEA 3N6VA 2GO7A 3RSSA 5BR4A 1UBGA 1II9A 3GHHA 1TF7A 4HVAA 4LC0A 4MZXA 3E2PA 4C7ZA 2IF2A 2P4EA 4L50A 4EO9A 3SWWA 4UOEA 1HOXA 4J3JA 1FE8A 3NX4A 1P1HA 2X3YA 5F76A 3SYKA 1UIMA 3OM8A 3H0MB 4LJXA 1NE2A 1URJA 2NQTA 3BFVA 3DV2A 1A9TA 4TWZA 4WAUA 3SSNA 3L4SO 2LYBA 5AOBA 3VU3A 1XNHA 4ZQIA 2OHJA 3R3ZA 1V6SA 1VJTA 3NNNA 3H0CA 4TL8A 1Q0HA 3NUGA 9ICHA 2YH2A 3A04A 2FWMX 3AM5A 4LJLA 4CV3A 5BMVF 1DDOA 2IA6A 1ZI6A 2H2GA 4OJYA 3FRIA 4R41A 4OXQA 2ZTVA 2JL1A 2DUNA 3NPAA 3RIMA 2OGTA 2GKSA 5EP2A 5I6DA 4GKJB 5KSOA 2CNNA 4L0DA 4RXMA 3SC2B 3UXMA 4Q4CA 4DV6B 4J9LA 3GIKA 1QCYA 2X9GA 2HUPA 2ZSHA 3H16A 3NOOA 4FIDA 2VJMA 4NJEB 4Q9NA 2R00A 5FULA 3PVXA 1NK4A 1BRTA 3NXKA 1KMCA 3TB6A 3DVQX 4W5HA 2OQRA 5JJBA 3UGTA 1P0MA 4EI8A 3BERA 3C8ZA 4MA0A 1X9MA 3A9SA 4H08A 2ZBUA 3NRZA 4I50F 5E9QA 4DXDA 5FTWA 2RB4A 4JUDX 2FW7A 2OVFA 5JNRA 4XOUA 5CD9A 2ZXUA 4IV5A 3MGHA 2RKBA 5CFNA 2CSXA 3CVVA 4ENRA 1EA5A 2AA3A 4KDCA 5CM2Z 3OUTA 1M6NA 5HK9A 3EYAA 3I2GA 1QYWA 3WNDA 1U9YA 2XIQA 1IV8A 4M6WA 1WHSB 3L7LA 3QOXA 2ETVA 1DEOA 1XNRB 4O2AB 4WZZA 9ICVA 2WPDA 4C89A 1CLEA 4LPKA 3BDPA 1JHDA 5EXEA 5KFSA 2ZFUA 1W29A 2F8LA 2XNDA 4AZ3B 2FR1A 4DY4A 1UDBA 3WWDA 1YK1A 1GPUA 1KWKA 2BM9A 2XLCA 1DQPA 3ZVKA 4RHYA 1I7QB 1U11A 2V5AA 4NCBA 3GEHA 2WQZA 5FA6A 2H2AA 3ZWKA 3DZ8A 3PFBA 1SC4A 1ZI9A 3RRYA 2A5GA 1FXWA 2KSQA 4RVGA 4B0PA 4PJ0U 1KK1A 1B0UA 1TQ2A 2JJYA 3QPAA 3DE1X 1WEKA 3TZBA 1ZQTA 4B74A 2K7FA 1KRWA 3K5WA 1XTKA 4FINA 3A6PC 3M9OB 1Z4KA 1H6AA 2Q0ZX 2B20A 1DT3A 5M29A 4JOQA 1H69A 1U1DA 2BY4A 3MMNA 3GVPA 3C3XA 1BX1A 3HI6A 3PXBA 4B40A 3OUZA 3CLTD 3QPCA 4L4SA 2CVHA 1MOQA 3PYXA 1QKIA 3Q6MA 4MWCA 3MBYA 2WIDA 4ZH4A 3MYRA 2ZJOA 2KNJA 3JPTA 1BC5A 1FVXA 3FR7A 3LW7A 3MUOA 1O8CA 4DNOA 1FVFA 2XVAA 3B3JA 2D74A 4F6LA 4Z49A 1G8JA 5FADA 5C7IO 1O3YA 2HJHA 2WB4A 3ISJA 2NZ8A 1UHUA 2AI1A 3EZ9A 5LUAA 1M0WA 1UP4A 4EW6A 1Y9JA 1LUAA 4LDAA 4K5QA 1X80B 4AYTA 3BZUA 2FMIA 2PBLA 2PZLA 3RYFA 3W2GA 5AW7A 3H4IA 4CBVA 1IWPB 3KHRA 2LCFA 4MUXA 5HILA 2C0PA 1KGSA 3IUBA 1GOTA 1FQWA 1VYTA 1CRXA 2F43B 3X2FA 1JXLA 1H2AS 4HH1A 3AM1A 2VF2A 5DBAA 1KAQA 1ENOA 3AHGA 1JJAA 3EUWA 1E61A 2G9QA 1EXDA 4KPGA 3Q3CA 4WLNA 5E38A 3LC2O 4Z8XA 2BFEA 4CEIA 4CCAA 5JALA 4GYKA 1Y34E 1Z56C 5G0UA 1IU9A 3THRA 2V4ZA 4BOYA 3D2CA 4JLSA 2VNAA 2BMJA 4FYHA 3SY8A 1AV7A 1HG0A 4YT5A 1JJBA 1K9SA 1QZXA 3TJZA 3PYLA 1QHXA 3W5AA 2VPXA 3OD5A 4OJTA 4U7TB 1PVVA 3E35A 5AHRA 5FOQA 5BQ5A 1Z8FA 4GXQA 1YCDA 3EFBA 2HK9A 4UATA 3LT5A 7ICJA 2IC5A 1YTUA 1QSLA 2XA9A 3H5IA 1D6JA 1QBGA 2B25A 1V9SA 5FJIA 4YVFA 3DEKA 1O2DA 2HDHA 1MQ3A 2N1BA 3SZ3A 3TZQA 4Z0HO 2BZ0A 4B6OA 1H6CA 4B4OA 2Z98A 4P6VF 1AXGA 2IHTA 4A9AA 3DLTA 3HM2A 1KTIA 4ETMA 1U7DA 5HFNA 2XMGA 5DIZA 3S2YA 2GPBA 2C2EA 1T3TA 2JDID 3K2QA 2QTZA 3QYPA 5ECDA 5KFFA 2IU3A 3KQQA 3OZCA 3IA7A 4FUTA 1TM2A 3AH8A 5BOLA 1TM4E 1PWZA 2H2WA 3QELB 1WP4A 1H9BA 3G5AA 2R6CA 4NC9A 9ICTA 3V9AA 3FFTA 2P3SA 1ATIA 2P9FA 1RI5A 3V00A 1E63A 1R6VA 1DCFA 3HDHA 3ENNA 2Q4BA 3DMYA 3O26A 3R3HA 4O4LF 1W34A 3M6ZA 1MMFB 2VP5A 4AUEA 1LC3A 4DBLC 1MKYA 1ZD8A 1UMBA 1YR7A 3P0FA 3FPCA 2HLHA 5JTUA 3IIKA 3SHFA 4HGZA 3O21A 1X87A 4DQDA 1E6WA 2PGOA 9ICIA 1C1YA 2C4VA 2W43A 2DUUA 2FRDC 4AUMA 3KQLA 4CL3A 3M7IA 1U8EA 3P9KA 4LQCA 1O4VA 3UBMA 1NSTA 2ZE5A 1J5EB 5D3QA 3BVPA 1R2QA 5KPJA 2HSDA 2A3VA 4EARA 4IRMA 3U1BA 5CEEA 2OBXA 3QLJA 4NZNA 2QD2A 5HHIA 5JCXA 3U7HB 3W8EA 8ICXA 2XKJE 3WADA 1GTG1 1N6IA 4R81A 3VVBA 1F7VA 3ENQA 2C9MA 2OV6A 3WGLA 1RPZA 1Z08A 4IL6U 5JD5A 3N8GA 4G5GA 3DAPA 4HMQA 1D4ZA 2ZIAA 3CZ5A 2B82A 3GGCA 1Q7CA 5DI9A 4FLMA 2QSUA 5CDYA 1QE0A 2ATLA 3OD1A 4BCDA 3KUKA 3OOYA 5BPFA 2HREA 1VKRA 4DIMA 1D9ZA 2B7LA 2FMXA 4F3CA 5DU2A 2Q5IA 2CYBA 3LBNA 3PCTA 4JK3A 3RTBA 4BQQA 5A9RA 1EHCA 3AB3A 1E3EA 2WD9A 2CLCX 5FWAA 3C39A 2Q99A 2O5CA 2WUGA 4RXUA 1YE3A 5KVQA 4WXMA 2DE0X 3GYBA 3KXPA 3B6IA 1YUNA 4JC8A 4G5QA 1FDSA 2WAXA 3ORRA 3LHKA 1PVPA 2BFDA 1ZMOA 2OH2A 2ARKA 4G1VA 5CP8A 1UT6A 3T7JA 5CA1F 1F1JA 4MRAA 1L4BA 2F3TA 2YFKA 1YB5A 4OP2A 4WIAA 1YH3A 5HSGA 1IM2A 5FAKA 1NPTO 1NDQA 3PUWA 1EP9A 1P9WA 3MEQA 5LOVA 2NUPB 1OGIA 2Z2JA 3GHYA 4OUDB 4ZCIA 2XD4A 1SUAA 2BGUA 1Z74A 4UNIA 3LK6A 5K3DA 1YBAA 2Q1UA 1L5ZA 3AJAA 4G1BA 3IDWA 2B34A 3GJQA 1C3VA 5EY5B 3VJKA 1G3UA 5FQOA 3N7RC 3ZJ5A 4JX9A 5CDSA 2FEAA 4J0GA 5EUMA 5A06A 3MDAA 3M89A 1PW7A 1WDMA 3TD2A 1ISGA 4CM6A 4RAQA 3RRZA 1JF8A 2OB1A 1ECWA 1K8XB 1SIOA 3R7AA 3RK0A 3ILSA 5LOVF 1M2VA 2BDTA 4URHA 5KJ1A 2VSQA 1R0BA 2HT1A 4DSEA 3PQFA 1NUSA 2O1SA 5I7HA 5EIXA 2GCPA 4KO3S 2FSIA 3S40A 3G7NA 2Q2NA 4DC1A 5IX8A 3L1JA 2DQZA 4ZOQI 3BQ2A 3PR2B 1QKKA 3U40A 1I0LA 1NMXA 1SVKA 1UBKS 2XADA 4TWJA 4LJKA 3JWEA 2BHSA 3QFTA 2E1RA 2A59A 3G0OA 2PAAA 2DULA 1T5OA 4XRHA 3QJYA 2P35A 2HO5A 5GVRA 2ACWA 5DJ5A 3T9DA 2D8MA 4QRIA 1JQLB 3GP3A 3TGPA 1USVA 4MYDA 1P5ZB 4QZ9A 3DS8A 1E79D 2PSFA 3WQBA 4QWBA 2FZ5A 4JIMA 4H0FA 5IJAA 4TL7A 4G84A 1R5JA 3DBVO 3UMCA 2ONJA 4M9UA 3GJZA 4BQOA 1E99A 5EUCA 5AI8A 4JMPA 2DUJA 4FKMA 1RWQA 2GXAA 2AE1A 4R8UB 2QX4A 1OFVA 2H08A 2P67A 4BFVA 4AULA 1ECJA 3WYAA 2FQQA 4DM4A 4JSRA 1DC6A 1WXGA 2V96A 5H59A 3G6KA 1OE0A 3C5FA 1UJ6A 2PMCA 1DRJA 4B3CA 1LGYA 1RABA 1XTPA 1PFUA 2OHIA 2R6ZA 4GXIA 3KWJA 3PJFA 4HFJA 3MCVA 4DFKA 1WXXA 2BI7A 4DOAA 3EISA 3IBTA 4KFTA 1NZPA 2JCGA 5B3JC 1VC2A 3FD8A 1NUHA 3SQWA 4IGKA 1MW8X 3GJ7A 1XKLA 3IAM6 1FRZA 1HO3A 5LA6B 4BC1A 4UM5A 1I36A 5SY9A 1NBWB 1Z75A 2Z56A 4DL4A 4GPAA 4RPHA 3ESYA 2W22A 4TRJA 5FWNA 2I91A 4P9NA 1WLYA 5KT6A 1CZRA 1C7RA 3OTGA 5EZYA 4Z2YA 3J81A 2J0QA 1MVLA 3EW7A 4G24A 4M8KA 4LYAA 4TTPA 3PX2A 3HWRA 4N82A 4BDSA 1W46A 1VMKA 1COKA 2YWBA 3PPIA 2XT9A 3FI0A 2R6JA 4L73A 2OP0A 4ARZB 4Z54A 3NBYC 2F2AB 4IVPA 2Y68A 1DIGA 1YOBA 3PJGA 4U4AA 5AD1A 4OQLA 1B14A 1N6HA 4EY5A 1T13A 3CX7A 1OWPA 4JLJA 1Q1NA 4HRXA 4TQSA 3WL7A 4ZT6A 1G8KA 3EPGA 1BSVA 5CT8A 2MINB 3OJOA 5SYMA 4DJAA 1KEEA 4O4HB 4NLLA 1D5WA 1RPTA 1YC2A 4MQMA 1GUZA 2RMKA 1IEQA 2CL6X 1D3AA 1OROA 1XDDA 4WA7A 5EVJA 3JD1A 2IEGA 3R5JA 3BFPA 1NK8A 4YHBA 1ZZEA 3CMMA 4O29A 1J0XO 4YREA 3ZWVA 1U4NA 2I2BA 2Y2UA 1BA2A 1IZ0A 3K1ZA 5SY6A 2GM9A 1Y1KE 7ICRA 2NXCA 4D0NA 3G8CA 5E9AA 1TJYA 4JI5B 4UU7A 4ZCMA 2CZGA 2HRBA 1ZSNA 4G89A 1G5FA 4MI9A 5F9LA 2Y0SC 4XI9A 1PL0A 4WKBA 2FWNA 1UMKA 1M1UA 3ZHVA 2G9NA 4IDQA 5KNCD 3AFGA 4EY8A 3GLIA 2DLCX 2AJDA 4ZQGA 4KLAA 2PSDA 2CDNA 3FFWA 2W9CB 2X1MA 1Q84A 4A2WA 3WZLA 4J9KA 1UKBA 3FPFA 4EA8A 5MN6A 5DB8A 3ZIAA 4FYJA 2JAWA 4FNGA 2ISCA 2ECOA 3O1JC 4Q7KA 3HCPA 4MYHA 3I5UA 2EZXA 4FGLA 1NVVR 1QV7A 2NTJA 1X13A 3E9ZA 3M6VA 1BKSB 2Q9AA 1IN5A 2BEUB 1TIPA 3QA3E 4HNRA 2KSOB 3D4LA 4MUHA 5CK4A 1P0FA 5EIAA 3L7CA 1WHTA 4RDCA 4MV0A 2EEZA 3DEZA 4HDKA 4Q9LA 1E94E 3KPYA 4TMZA 2PU5A 4TUYA 1B23P 4ZVSA 1VSUA 4D3FA 5LUBA 1LFAA 2QMYA 5AKXA 1M54A 2KVCA 4OU4A 3CW2A 1CUSA 1Q2XA 4U6SA 5JVDA 5GIPE 2FZGA 3VZSA 1HUZA 5AVTA 2XYGA 3LOUA 3V4OA 3OWXA 2JLAA 5B12A 2QAJA 2FMSA 1AZWA 4PSAA 1KPGA 3OA2A 3O90A 1OYYA 1SGWA 1YQTA 1P4RA 3JRXA 1FLAA 2KSOA 4V0KA 2WIFA 4FCWA 4EAQA 4NLBA 1XRNA 5E4TA 4LYFA 3LIIA 1CERA 3L6EA 1ZUNA 3D3JA 4Y2PA 1KZ7B 2AT1A 2Q0XA 1YRYE 4H6PA 3IE1A 4DKJA 4C6TB 4JEIA 3V1UA 4WMLA 4RTQA 1DK2A 4LF7B 1YFJA 1HA3A 1XRLA 2F3RA 3CLTC 1XZFA 4PC3A 3KSAC 4H1VA 1EVZA 3TR6A 4Z1OA 4UHDA 1N3LA 3E18A 1XJ0A 2O2JA 3I9V6 2ZSFA 3TIGA 1R16A 3ETRA 4O1IA 2ZJ1A 4RA9B 3AL0C 3PXXA 4X84A 5LCXA 2YWFA 1ZRSA 1JEJA 3FIJA 1N3YA 1DLJA 4UXHA 3G7SA 1E60A 3F9CA 2P9BA 3JQAA 2OMKA 3E03A 1BROA 1NBHA 2C1XA 3JYHA 3LG2A 4RVUA 5FBWB 1DOAA 3OPYA 3VNUA 1TPZA 3IQFA 4W1SA 3V7KA 4YECA 3OP4A 1Z82A 3UFBA 4E5NA 2PFSA 4ZK6A 1YD7A 3A1VA 1JTVA 4Q5IA 1WUKS 5KWEA 4O1MA 1P4GA 2PX0A 4AC9A 1QDUA 2RE8A 2JGJA 3PFGA 1M8GA 3LZDA 5AM0A 2E48A 4Q3AA 1PLKA 1HLFA 3NHYA 3NTVA 3C8UA 3I2FA 4PXYA 1UBNA 1KPIA 1PJCA 2B98A 2IA5A 1XJWA 2W2KB 1GZ5A 3AL2A 3IKVA 4NNPA 4GXTA 4RETA 2I3GA 5CYOA 1CW2B 2P2DA 4QQ8A 4Q7MB 4F72A 5H83A 1THGA 1G21B 1Z0SA 1SXEA 1ZMRA 4E11A 3ZS9A 1FUEA 1U0RA 2IGBA 2X5OA 5CURA 3VR3D 5T57A 3E9NA 3BCRA 4RQBA 1GZ7A 2A5DA 2J7KA 4DPLA 1Y5MA 1ZQNA 2HPZA 1XMIA 3CX3A 3UXYA 3KKZA 4N9WA 4BKMA 3RBAA 3EYZA 3AV0B 4PGHA 1F44A 3C6ZA 1L8AA 2LD4A 3G6YA 2FGJA 3T1NA 1YUBA 1TYBE 2IPLA 5CDFA 1SU4A 2QP4A 3LE8A 4B6EA 1RQ2A 3TLAA 3NWOA 1B00A 2VI5A 3IXLA 4XJVA 4LJ5A 2GF9A 3H1FA 4FXOA 3SQMA 4J0HA 1G2QA 3G5UA 1C0KA 4QNMA 5DNDA 2XXAA 2DERA 4UJ5A 1PQUA 4ZHQA 3VBEA 5JASA 3NOVA 2YXBA 1TK8A 2ZB2A 2R60A 2FSPA 5IJ9B 3K0FA 4GSLA 5EL0A 2MIIA 4RLFA 3OT4A 5E6RB 1QB8A 2I7XA 1JQDA 3T5LA 3ZDBA 1JR2A 1K1SA 1ES9A 3IRVA 4I3FA 1FOEB 3USZA 1A82A 3TR5A 2GVDC 3HMQA 1MOPA 1W4AA 2VYVD 1LW7A 3VPXA 2JBWA 3D3EA 3WA6A 1SVMA 2C5EA 3HGTA 4R31A 2CDBA 2A58A 3MCTA 1RHUA 2RG7A 3T3EA 2AWOA 2J0EA 4EPXA 5KT7A 3NXSA 1PJQA 1V8DA 1T0PA 4YCAA 4Z9BA 2OYCA 3QBVA 2FOIA 4C4YA 3AMVA 2OLKA 1OJ7A 4QGBA 3MCZA 4XWAA 4B6FA 1M7GA 3T7EA 4YXWD 2C92A 1DAFA 1RBYA 4RK7A 4GC7A 1H2XA 1E9FA 1P91A 1UKEA 4FNAA 4DQVA 1NRXA 1IFXA 1NN5A 1RR6A 2E1PA 2HHCA 4QVGA 1NVMB 3TNYA 4EF6A 2R86A 4R98A 5BY2A 4RQ6A 3QWAA 3M6MD 1KFKB 2WJ4A 2C3UA 1L1EA 1V5WA 3QQ5A 3UAVA 1TM7E 4JI4B 2PT9A 1AKQA 1FYWA 3G17A 4J0QA 4I81A 1H2EA 4RVFA 1BOOA 4TTSA 3ZDDA 1P7CA 4JSYA 3KOUA 4Q21A 3S5UA 1D9FA 1J22A 5JNTA 1IQ0A 3PIDA 2H52A 2ZXHA 4WCDA 2BCVA 1KZ6A 5C8YB 1GLVA 2GPYA 1I3LA 1OFUX 1T1JA 1EAMA 3CVWA 4CLXA 3DXZA 1JYEA 4FGKA 1ZQJA 5J2BA 1XLTA 1Q8KA 2I6SA 1I7SB 3N2IA 5COAA 2I1QA 1EVEA 1OAOA 1RAAA 1N6KA 3AUOA 1KBUA 2FLKA 1R15A 2Y1WA 4OQYA 5AHOA 4PX5A 1CY4A 2JCYA 2VHXA 2E4VA 1YIAA 3IMKA 4U1RA 3UQYS 4XQ9A 3VJMA 3QE4A 2JLSA 3HJBA 1Y3DE 1MG5A 1IHXA 3JQ8B 4X90A 3U56A 3GT4A 1JZSA 1Y3BE 1X7YB 4AG3A 4EVSA 5I9NA 1KMMA 1SIJA 2KD1A 4QVIA 1GGVA 1AKMA 3QVTA 1XK6A 4KLNA 3N0TA 4ZQBA 3C15C 1LPNA 1PR3A 3ZBPA 1JWBB 1L5WA 2NTNA 3ZWCA 2QD3A 3ESBA 2C59A 1OH6A 4MYRA 2IYFA 1G59A 2DLDA 3GBVA 5LD2B 4I9GA 3HJUA 4Q1EA 2GM4A 2UZ3A 2X6TA 4AZ0B 1KBOA 2EKLA 2X1LA 5E6UA 3TIFA 4O3QA 3O9ZA 4DQSA 2WLSA 4EKDA 1XRQA 2O7SA 3K0AB 2DSTA 4XR4A 2QRKA 5KTNA 3P0IA 1KL9A 1E2DA 2JKYA 4HBGA 4A4DA 2IHJA 3T06B 1VCIA 4OGLA 4ARUA 2XBMA 5KG3A 2MSEB 1E9SA 2YY6A 4KQGA 2AQIA 5JATA 3L04A 1T8YA 2D3WA 3DO6A 1NE7A 3QH4A 1E1CB 1JIIA 1UT5A 2JHGA 2AGQA 1FFGA 2HH9A 5IH3A 4DJTA 1R4NB 4J9UE 2UXDB 3EC1A 1SWWA 3AHFA 3FZYA 1J8FA 4BJ6A 4ZWNA 4YJHB 4JOSA 2YBDA 4G0YA 3IUQA 4XD2A 2PGLA 1OZAA 3F4LA 4PS1A 2FX2A 5G40A 1KDYA 4PZYA 2ZK7A 2FEOA 2JFXA 2ZRLA 3BIJA 4LJ8A 3PX4A 1P5FA 4XIIA 5LP1A 2QAGB 5ADHA 5J2FA 3O8BA 4OO3A 3QWBA 1UBUS 2BBWA 2E8NA 2X4LA 1E7QA 2WWYA 4IOMA 4Q9KA 5AOCA 4BNDB 3T7RA 4C43A 1N2EA 1KI3A 2BFFA 3MFYA 4BZPA 5KYYA 4DIEA 1I4WA 3CSUA 1JLLA 1Y0BA 4YFKA 3BIXA 3KLBA 1NJXA 2IU4A 2AFIB 2QE7A 1TMKA 2DTEA 3ISBA 2ES6A 1KOJA 1YBVA 3Q6IA 4MVJG 5DV9A 3S2FA 4YAJA 3RJJA 1RHMA 4PPXA 3RK1A 2WINI 4G1EB 3RBEA 1YVRA 2DFNA 1JDBC 3EC7A 4GP6A 4GZMA 5GQSA 4Z4QA 5G02A 1ZQYA 3K8QA 1FJHA 1R1DA 2X4DA 1PHPA 3DKIA 4EI9A 3NEPX 5B7GA 3KBOA 1GAXA 5EWEA 3PX6A 5J4YA 4YRQA 2KE5A 4I29A 3R7LA 4PL1A 4XYBA 1LTQA 1TYCA 3IAEA 3F3MA 3NJ4A 2Q1WA 3CBGA 3SX0A 3R41A 2AEFA 4G4SP 4TMYA 2AOVA 1NP7A 1WW8A 1M1YA 3UQ0A 2VK4A 4X7PA 4AQDA 4J03A 1N5MA 2C9BA 2X8WA 3H2JA 3KT0A 4EZBA 2HWUA 2W6IA 4Q6WA 4JBWA 1XD2A 3GFVA 5JS6A 1CHDA 1Y89A 1IB0A 3CKKA 2Y8EA 3HVIA 4G85A 1U3FA 1IE3A 4BV3A 4D9MA 4E07A 1TVEA 4Z9AA 2R8HA 2OGZA 2RCNA 3ASVA 4YP0A 5JDCC 3T3GA 4K4IA 3NOXA 3VNQA 2JFVA 1H4QA 9ICQA 4Y0VA 3QUAA 2ISPA 2X2FA 4LYYA 2QG4A 5HBGA 3RSLA 2DBVO 4LF5B 1ZCJA 5D51S 2GHRA 2PZEA 1XC7A 4QUIA 5EE5B 1BQ3A 3AEKA 4DIOA 4YB8A 4DVJA 4ETIA 2VF4X 2G0TA 2BJWA 1WXQA 1Z2OX 1P61B 1PTKA 1SA0B 2PL9A 5DTJA 2ET6A 3LUJA 3OQHA 4I4NA 3T1HB 2WJHA 5TMDA 3F8TA 4QHSA 4YONB 4YCMA 3GDXA 1G20B 3O8OA 1FPQA 2XDWA 4K28A 3HO8A 4MKGA 3WVNA 5JW6A 5IIJA 2XCTB 2CL0X 4EBEA 4ECXA 4EKEA 2HT6A 4PGAA 2WTNA 1G42A 1RT9A 2YJGA 8ICSA 1N2IA 1J24A 2RK3A 3FH0A 4MUFA 4QYTA 4BNFA 4B43A 3DTVA 4ND6A 2V98A 3LL7A 1Z6XA 3MJFA 3V5NA 5CJJA 4GX2A 3KYDB 1G8SA 3QVXA 1QQAA 3EDYA 1VBMA 3FKSA 2PX4A 3DR5A 3L8YA 4XWTA 3V4LA 3BGVA 4IQWA 1L5SA 2FGKA 2R2AA 1OXSC 1D2CA 1QIHA 2BF4A 1D6MA 1VL8A 3RS3A 4MUJA 2AG0A 1Q91A 2QQ0A 3TFWA 2QB1A 1JPJA 3RBDA 3AEQA 4NLGA 3V8MA 4L78A 9LDTA 1SOMA 3DBLB 1ESEA 4TWAA 3AEZA 2HSWA 3GV7B 1GSIA 1Y1LA 3B3QA 3JWGA 1XZNA 5FV4A 2XXAB 3OZBA 3TTSA 4WKCA 3T54A 4P0QA 3DEIA 1EINA 4NBSA 1ZQVA 4NARA 2XIJA 3VHRA 2FWIA 2BELA 5IN4A 1BW9A 1NW9B 4RK0A 5T6BA 5ALLA 1AGNA 2C57A 2JJ2A 3NUQA 2PX8A 1X74A 2ZYUX 5EC8A 1X8JA 5FL7D 3SZMA 7ADHA 5B1EA 2KI5A 1RYUA 2QARB 2A5LA 2HEIA 4MVJM 5TMBA 4CKEB 2I6XA 1ZK4A 2LBPA 3D6VA 1K1QA 3RWMB 1YA6A 1L3VA 3GEEA 5I8PA 2W2MA 1RP7A 1WUHS 2XCOA 3BXGA 3X1MA 3JQ7B 1PTJA 1WHSA 3ZW7A 2QBYB 3KPWA 2JAPA 3RAQA 2BFMA 1RHRA 2BR5A 4O2AA 5K0EA 4BN0A 2R44A 1W5TA 1Q0SA 1LPBB 4NMXB 1QO0D 3E23A 1XTZA 3TQQA 2KLHA 2Z5FA 4R6XA 4F86A 1XVLA 3I62A 2REBA 4FFPA 1QH9A 4KOAA 2OECA 1TRKA 2XCAA 2DR3A 5LLSA 3ROXA 3SR6A 4D8WA 3KOOA 2HPAA 4QL3A 1I6KA 3PHIA 5IBQA 2DETA 3Q8QB 2XDAA 4MMYB 3VZDA 2AJBA 1M6EX 2GPTA 2XY7A 1B3BA 2J3DA 4R1SA 2I3BA 4RQNA 4RV9A 5ADVA 2PZ8A 4L4XA 3L1KA 4LNHA 4KQJA 3PRHA 1D1QA 2PS0A 2RKOA 3OFSA 5JPIA 9ICEA 4DIKA 4S1VA 1Y37A 1H93A 5P21A 1XEAA 2PD3A 3KL4A 2A9RA 4N39A 4O4JB 4DLLA 2YZ2A 1GSAA 3HUUA 3HXPA 3T4EA 1O9HA 4PZNA 1SXJD 1H2YA 2FMQA 1UK7A 2DJIA 2IYQA 5E3JA 1MH9A 4U2EA 4B09A 5BV8A 3HCBA 2H1CA 3PJEA 1PKXA 3ZKWA 3EX7C 5KZMB 4JUFA 4A5SA 1JG7A 3NFRA 5JOQA 4M7RA 4Q18A 1K1EA 2K5UA 1T4MA 2XY5A 2FVXA 3MTIA 4NONA 1I3CA 3MM4A 4KNWA 4MHSA 5FTMA 2M1ZA 4YAIA 1ISSA 1G9TA 2CZCA 3OQBA 1CF4A 3QE0A 4GYJA 4MJLA 4KSCA 3P0RA 4G3XA 5IVHA 4NVRA 2DCUA 1RYDA 1K7XB 1QANA 3KWFA 5KFDA 4F38A 2BHTA 2KIWA 1XP5A 2PGIA 3VU8A 1DV2A 1Y7TA 2GHIA 2N0SA 5I9MA 4B4DA 2WF7A 3DVSX 3E70C 4Y2UA 1DJPA 1VE6A 3CH6A 3NEJA 4UEWA 3WIEA 3ZU5A 2DP4E 1GVHA 5GZ6A 1F20A 1JHRA 1X9WA 4RT2A 4XM2A 1CK4A 1E77A 4V39A 3DP9A 2W2NA 2GK3A 3KYJB 3O93A 5TF0A 2C83A 2YS6A 3F9RA 4FYIA 3SEIA 5JU5A 3OEWA 4OMCA 3ZX5A 4BX8A 2Z3ZA 4HQOA 4HP8A 3QKWA 4UVDA 4RTNA 5U1PA 3HCAA 1UFRA 1MQ8B 3ADCA 3G3EA 3Q8LA 5ALEA 1XRJA 4UDYX 2JEOA 3KYIB 1AB6A 4CQMB 2EX0A 3DL0A 1I6WA 5AOVA 4QW9A 1MJ5A 3I04A 2Y71A 3PKJA 4TSRA 3RC2A 3STUA 2LM4A 1MXHA 5DLFA 2NU6B 4UCQA 4JU9A 5U4XA 2W2LA 1X0VA 3S55A 3GFQA 1ECGA 5CBKA 4YJKA 1CY0A 1XF9A 2LE0A 2OAGA 2X0NA 1Q20A 1ZL0A 3OLZA 4Q8FA 1ZQ1A 2GNOA 3EGDB 2NOAA 4F4WA 2VDRB 2WWHA 1R7RA 2AJTA 3C70A 3FTDA 2ZI9A 3D5QA 4WGGA 2A1JB 5A7FA 1ZA2A 3OSZA 1KEZA 3LMKA 1EEHA 3P9IA 1CR0A 3PDCA 5B2FA 3AK4A 1ZQAA 4QYIA 3PSAA 4O3FA 3PEWA 1JFSA 3VDMA 4L8GA 4R1PA 2XZOA 2Q6OA 5EA2A 1DAKA 2AF4C 9LDBA 1E32A 1NF8A 2RHJA 2HFJA 3ICQB 1U8FO 1XNGA 1YQGA 3FYSA 3MJDA 1W5SA 3ZK8A 3RS5A 2FHPA 3RWBA 1Q1EA 5COQA 2YJ5A 3Q3EA 2JHPA 3JD2A 3P0JA 1ZN7A 3DF9A 1KDHA 4YRRA 5DXFA 5A4DA 4MGHA 4YJ3F 4F5RA 4ZOBA 1PL6A 2GTPA 5D5HA 4GZ5A 1U6KA 4DGQA 5CW2A 1L3CA 2V8OA 3WE7A 3A7DA 3VR6H 4J1TA 4G86A 4XEUA 4OQXA 2E18A 1Q3KA 3AF1A 3IEUA 3BB1A 2H0RA 4I0WB 3ELDA 4G1UC 3WWYA 5LP6A 1TFRA 2XGMA 4BRSA 3ONFA 1GNVA 3I37X 4N03A 2OD9A 3K73O 2Y0DA 4OMUA 1L6IA 3L7IA 1E5QA 4R9VA 4RYLA 5MHTA 3LI2A 2FFRA 4RVHA 1RRMA 3UV6A 1RPNA 4MKZA 1TQDA 1XQXA 5BP7A 1HYHA 4UUNA 4C0QC 1U02A 2JZOA 3AERB 1YS9A 3QZ8A 4LDPA 4NZ9A 4X97A 4C29A 4BEBA 4WBNF 2ZZKA 4YP7A 4HLQB 5G2OA 1N75A 3T9BA 5FPPA 5DSTA 5DH9A 4WKPA 5KFOA 3UMMA 1RZRD 1FFHA 3KJEA 3MWFA 1ZQXA 1SVUA 4IRCA 1N2JA 1Z7EA 3P27A 4KK4A 2WYUA 5DHSA 3B53X 4W5TA 5FAXA 3MR3A 3FY4A 1LC0A 3NKFA 3QI2A 2OFPA 3FBGA 2QLLA 1SCNE 5K45A 2X6RA 4ER6A 4Z3OA 3ZDFA 4DDTA 4UTVA 1K7FB 1PDWA 2BUAA 5FOWA 3N5KA 3QXSA 1KYQA 4YN3A 4DHEA 2H1OA 1MA3A 5JE8A 2HI0A 2IDMA 4MEJA 5AJYA 4IXMA 2VJDA 3HWX1 5DO9A 4UM7A 3RVMA 4EEZA 1PR5A 1PV1A 4HFRA 4TMFA 3A1TA 2EWVA 2R8RA 1HMPA 2XQVA 1X7WA 4OATA 2ZVJA 4Y9DA 5EHQA 1RWKA 4YRPA 4KR3A 3I1FA 1JI3A 2KOBA 1U7ZA 2IRWA 2WR8A 1C81A 5LBUA 2NAPA 1ZG3A 4JD5A 5BV7A 2AB0A 3AVXA 1U3UA 3W79A 1BO6A 4TRNA 5HJ2A 2AX3A 1XFDA 3VNRA 2XQJA 1UZUA 3A31A 3ZGLA 3E9YA 3L8GA 1JN3A 1NJ5A 2XSZA 4RY2A 4ENQA 4KX3A 1LRKA 1FFXB 4FFBB 1PUZA 1YZFA 1F2VA 3UHPA 4F5ZA 4YDRA 2FFAA 3KKLA 3ANYB 1XDUA 1W6UA 3HXKA 3I1YA 3EW9A 1KDPA 1NLYA 1E5DA 1WB4A 1JDZA 2NU9B 4AURA 4DMRA 1ZQIA 3EUEA 1JB9A 1K08A 3OKAA 4DZZA 2AG6A 2XMDA 3U0VA 1SCUA 4BKRA 1FSFA 2AQHA 2IUFA 2JNWA 2JW5A 3RC1A 2ZS7A 4MEAA 4L28A 3RVOA 4BJ5A 1VG8A 1ESZA 2AEMA 4WJKB 5JRDS 2V4UA 2A1UB 3QE2A 4IEIA 3TPFA 1ZQ9A 4BTVA 3A6ZA 3UXOA 4ZEMA 4KRXA 3EWAA 3UN1A 4YR7A 5JAHA 3IS3A 4EHLA 3H6HA 3K70B 3PHJA 1YIDA 3TX6A 4K05A 3FMFA 5A0VA 3FUXA 2Y9TA 5IDXA 3RJTA 4XD7A 2VDWA 4KXNA 4OM7A 4DGSA 2FPKA 5KYKA 3IM1A 1GQQA 3UH1A 4LY0A 4PPYA 2ZRPA 2B3DA 3OSNA 1AX9A 1TU3A 3NASA 3EFOA 4UEJA 1V6CA 1M2WA 3DTNA 4OSPA 3VMFA 9MHTA 1QC5A 1F2TB 4YMMA 4CTJA 3HU1A 4GL4A 4GVLA 3L6OO 4ZKDA 4MRVA 5C1BA 2PRSA 1IHDA 4JXZA 3PE4A 5TC4A 2JLWA 4TS9A 4PYLA 2UXBB 2BCUA 1P8AA 3C5VA 1VI2A 3BA1A 3EDRA 5AT1A 1MJGM 4RF2A 4EG8A 1HTTA 3VYUB 5DI3A 5ERXA 2AFRA 4LXTA 1CJKC 4DSTA 5BYBA 4B2IA 1E0JA 4ZJYA 2TS1A 4B6QA 3H11A 3K0KA 3EF3A 4BLQA 4EPYA 5DEIA 5FL3A 3GLFE 2Y6VA 1UBEA 4UHJA 4PG7A 4NICA 3QNMA 1E3QA 4E1VA 1RQLA 5DHPA 5J47A 3SNHA 4EGAA 5J2DA 2C2YA 4F4HA 4IZHA 1Q2UA 4W4TA 3D9QX 5K3SA 3QE3A 3AIOA 4B8YA 4BFYA 2ZYVX 5KMGA 2R3SA 3DPSA 1RG6A 2RKWA 1PJSA 4YK7A 4AG6A 2I7TA 4O3OA 4EL0A 4I2FA 2Q3DA 1XVVA 3R3WA 4YAOA 3SXUB 2ZVQX 5EI5A 1A9PA 5KNBA 1JG2A 3CB4A 1GKUB 1SHUX 3G6WA 4KI7A 4DQRA 4AP9A 3LECA 4LZPA 3R7NA 1B0AA 4BO1A 5MN5A 3GH1A 1FFYA 2CFTA 1RYZA 3TACB 1G3MA 4LDZA 4U63A 4F85A 2KMLA 1XTRA 1KF0A 1KSFX 2C94A 3U7QA 2P41A 1SZDA 4FFWA 2JIZD 5EE1A 2BL4A 3C87A 5FNVB 1O94C 2RAFA 2PMBA 1H5NA 3CIOA 2V7BA 5I9BA 3GLIB 2HUNA 5TS3A 5FI1B 1W0KA 1A27A 5HCNA 4YJDA 4BMSA 5HIJA 3IG5A 1F8GA 2CHGA 3BYZA 4PNZA 2A6PA 3DKRA 2M6SA 5IMBA 1JYSA 3RANA 5IKEA 2CMFA 2QOEA 4EGJA 1TKRA 1Y6FA 3EAFA 4WBNB 1EBUA 1U9JA 4PLZA 4ILEA 4PX3A 1AURA 1OIWA 2DQSA 4ED2A 3NG1A 2I78A 1J90A 3NQ41 1IN8A 1U2EA 3QP9A 4TTJA 5CLFA 5LDDC 4TUYB 3ZTTA 3MGCA 2WSBA 1AKUA 1CS0B 1U1GA 2SECE 3UQ2A 2VFAA 4KI0A 2WYVA 2OXIA 4MUMA 4G9EA 1M83A 2XXBA 3JQAB 4RV4A 4KVGA 4DM3A 1GFZA 5LWQA 2OCKA 1V39A 1IHUA 4JP8A 3E3AA 2Z30A 4EGSA 4NL9C 4IIBA 3MGKA 3RGWS 1VTKA 5IH7A 2OCLA 1NLUA 1ILWA 4O4LA 2Q7DA 2O3UA 4FN4A 1W5FA 3B1XA 4JLWA 4OH1A 2ATCA 3R5TA 3LBIA 4KYIB 3ZV3A 1L4MA 4JJEA 1LK5A 2PMDA 5HOEA 5CNIA 5A0LA 4UTPA 5J9FA 1X7GA 4QU0A 5KTYA 5A9TA 4ALMA 3C85A 4KXWA 1JH8A 1WG8A 4Q1CA 4TXHA 3EXHC 1NJYA 5DM1A 3AR9A 3ONWA 3K6SB 8ICJA 1U5BB 1VPEA 2PX3A 2NTYC 2ZSIA 4URYR 5IUJC 3MUFA 1T8WA 2ONYA 3UJAA 3PJRA 1EG7A 1FMJA 1Z3EB 1N6LA 2H63A 4PO1A 2YX1A 2BMWA 1N7JA 1N7IA 1PS0A 3RUDA 4D6XA 3NYIA 3O73A 4MQLA 3W9SA 3U3XA 1L4EA 2BR4A 1AQ6A 2RK6A 3N2ZB 3AF0A 4JJKA 1DX4A 4GGOA 2E85A 4MQ5A 3C6QA 3MT0A 2W4QA 2WSMA 3RODA 4XCXA 3UFXA 4DB2A 3PFWO 1LW6E 3T52A 4R16A 3FJOA 4TS4A 4GBMA 5ILGA 1RBQA 3TXYA 2OOSA 4U9IS 4CFYA 1XTBA 1EUYA 2B7CA 1P7WA 4B75A 1RAIA 4BRUA 1IM4A 4DRXB 3A9UA 4OXKA 3P0EA 2DH6A 1S96A 4M99A 1QDLB 3KKKA 3SI7A 1TYDE 1JKFA 4YRSA 5L1IA 2HNAA 4II7A 3NB0A 1Q0PA 4PBSA 4C7OB 2C2DA 2R84A 1KYXA 4N1AA 3HYLA 2FJ0A 5KNLA 2VA2A 1U9IC 4YGXB 2OHFA 2VNIA 4F6RA 2AH5A 3JYLA 3DGEC 1ADJA 2XYRA 1TYEB 1ABFA 5AW5A 1X70A 3NBFA 2X8JB 1PN3A 3FDFA 3LP8A 4K03A 5FBLB 5EWJA 4ARAA 3GZNB 4M37A 4LI3X 4I1IA 5NLLA 5KFHA 1MTZA 3D4IA 3K20A 1Z3CA 3DC2A 3EHEA 1K0UA 2UZIR 4US0R 3OO0A 3K7EA 5TJ9A 4H1HA 2ZIGA 3LK7A 3MJEA 4RFSB 4Q9AA 5KNCH 3DT8A 1BDBA 1N77A 3LBAA 4TYWA 3BE6A 2XYVA 3SKYA 1JEEA 3CEMA 4B6SA 5AP9A 4A2QA 4EAAA 5BYAA 2HRQA 3WHKA 1GYPA 4RIHA 5LA6F 1U63A 8ICCA 3E6AA 2SKDA 1GNPA 3MNFA 4MS4B 5GY7A 5HKBA 1VMIA 3CXUA 3SIRA 1EDEA 2EFCB 2V1XA 1A7JA 3LLCA 1W4RA 3VPSA 4BP9A 5IDVA 2V0GA 3FHOA 2W9AA 2YRXA 3DC7A 4K6FA 5A02A 1XXHE 3EK2A 4MWOA 1NC1A 2PIAA 1V1RB 2OZKA 2XNDD 3SXPA 1QUFA 4DLNA 3IUPA 4AZTA 3BN3A 2VNKA 3QNUA 2ODPA 1QVRA 4ANFA 5IBCA 2VG8A 4DLYA 4X7MA 4I5EA 5T5QA 1D6SA 1M67A 1R8QA 4JYAB 5EFOA 2OXRA 1TYZA 1BU8A 2GWRA 2CHFA 4XASA 5JPCA 3PQ8A 3VI4B 5AVVA 1JE0A 3FMPB 1CTQA 3NTQA 2VIXA 2YFQA 3DEYX 3RHFA 2JKVA 4F5OA 3O4GA 5BWOA 2I5PO 1EFVA 1SBNE 3THXA 1U8CB 2WUEA 3GP5A 1NRIA 4ELTA 2V59A 3M1YA 3X1JA 1Z28A 4P5DA 2F77X 3LT1A 1T5LA 5KG1A 1NW6A 8ICAA 3CN7A 3SX4A 1UXGA 3C7DB 1PVOA 1KGDA 2FPRA 4N7RA 3SJAA 5I7UA 1QZ3A 5IULC 3Q9LA 2PXXA 3IESA 4RX1A 3CVXA 4OJPA 2H5JA 1M75A 2AI2A 4Z4FA 3CNHA 1SUEA 1YCGA 4H77A 2UYCA 2IYAA 1L4YA 2H1IA 2UDPA 1N34B 2PWAA 4MQEB 4WESA 3H65A 2NV6A 1IHYA 5G5HA 2C2HA 3D2SA 4ZT4A 1ICIA 1Y4SA 1RWMA 1DRGA 2XCLA 3RS2A 5DN6A 1X1DA 4TS1A 5CH3A 5JCJD 3SJUA 2AGOA 4X3PA 1K3UB 1HFWA 4ECUA 3HZOA 4QATA 4CN9A 4LG1A 4OK6A 1O5OA 2IFTA 2X0KA 3OPXA 2HIGA 2OZLB 3U39A 2WJJA 1H9AA 4LSWA 1X1AA 1JSLA 4PN3A 4JUIA 1P2GA 1ECFA 4BHTA 1RI2A 2X3FA 4IJ5A 4MVJF 1EA7A 4BNLA 3QKIA 3ZLUA 4FZ5A 5AICA 4KR6A 2X76A 3BRCA 2AG5A 1TB4A 4Y67A 4XVQA 4RLQA 4M49A 3ICWA 1TU4A 5J8YA 4I8XA 3H9JA 1NAHA 2ZTUA 4XB2A 3VC2A 2H8GA 1VP9A 1HQDA 1M76A 9ICNA 3EZYA 4H7IA 1EVJA 3OQ1A 1SBYA 2XT6A 4LJ4A 1CRZA 4WN9A 5BNZA 3UAXA 3SJBA 1JHZA 3GV5B 2IYWA 2OBYA 3FPJA 1HY3A 1LLCA 3N5CA 2B6GA 1W4ZA 1ZD4A 3BHMA 1US8B 1R8SA 3QY0A 4I9HA 5C31A 4XJXA 4PO9A 2VL7A 5JTIA 1OH5A 2EQ5A 3WLTA 2XSZD 4ZFNA 2ROQA 4I55A 2ASJA 1Y9DA 3HUEA 3WSTA 4DUYB 4P5EA 4YR0A 5L1KA 4RABA 2JFNA 1B0XA 1PR1A 2HNKA 2VJOA 1E1CA 2CWWA 2NV2B 3ESAA 2JI8A 4GLOA 4IILA 1SM4A 1NXXA 2OM6A 2D5AA 2GK7A 4GOOD 4F92B 4GMGA 3GCZA 4NCNA 4WSOA 3H2BA 4XSHA 1EK6A 1TT7A 4ZDIA 4RQ2A 3M9NB 3TVYA 1SBIA 3ASUA 4L75A 3KHTA 4MB0A 4P4LA 4YRLA 5BMVA 1M8JA 2YWXA 4FKZA 3PXUA 3SGLA 1GEEA 2XOKD 3EVAA 5CVCA 4F4IA 4YUWA 2QJRA 4G5RA 1DDIA 1NSFA 1YFKA 3MGVA 2XO7A 1SIWA 2CJPA 2CJYA 2Z8ZA 3PDHA 5CITA 1V26A 4BMDA 3PVCA 4PX9A 1K75A 1YKSA 2J33A 4X8OA 2FB9A 1M1ZA 1P31A 1XXHB 2Q3FA 3IQWA 4FBGA 4Y3UA 3GA0A 1TGYA 3PXGA 1I32A 3RFTA 4D7AA 5HKLA 1P39A 2EDUA 2FMPA 1XZQA 4QGFA 4PBRA 4CE6A 1ODTC 1LZLA 1I2ZA 3EDQA 1LQ2A 1SIBE 1T9GR 1TZBA 4EH1A 4CIWA 1A3CA 3PE3A 5TVGA 3TRFA 4HVTA 1OV4A 3NP9A 3A70A 3GAMA 5DWDA 1YQQA 2RONA 1QB7A 3HP6A 1X7XA 2FSSA 4IHJF 5BQPA 3WQRA 2Z6QA 4PYJA 1AY0A 3EH2A 3IL2A 1CUVA 3SC6A 1HXHA 1DPFA 4D0GA 1R00A 4U9UA 4RK1A 5JZSA 5FYQA 1UPTA 3G13A 3BSSA 3JQRA 5JTTA 1LBSA 4IF6A 4BY9E 3NS1A 3OZSA 3ZQUA 4Y9TA 3QXCA 4IUYA 3AHHA 1TCCA 2C99A 3KTQA 4QZIA 2C77A 1ONPA 3OAAD 2BOVA 2GVZC 4K87A 1K3TA 3MZ0A 4I4CA 1BA3A 3E9DA 4U6NA 1EZZA 2HLPA 3WYBA 2G67A 4OCZA 2YV5A 3L8DA 2TECE 3I42A 2PLNA 2F67A 4LWQA 3ZZNA 1NPYA 1SZJG 4L8WB 3HA2A 3QF4B 4V38A 1GA4A 5BW6B 3HCFA 2XH8A 2AXEA 5L8VA 1AQNA 4NE2A 3VNVA 3UOAB 5GM2A 1K92A 2K4MA 3OA0A 3OH8A 5CVJA 1P75A 1YMUA 5AJWA 4DC9A 4EG7A 5TQ0B 4FX2A 3QU7A 4OYLA 2CV1A 4GKKB 1VDMA 5CVTA 1R50A 5ICGA 5JCPA 2J5QA 1U04A 1FFDA 2PH7A 4MLCA 4R1QA 3V1YA 4AY5A 1A2OA 1E4YA 3BQTA 1R27A 1Y4DE 2O2DA 1Z8DA 2Y9MB 1FXSA 2C3PA 1RQNA 4YJHA 3R6LA 4W9NA 1XZEA 1DLIA 1PSDA 1BQ4A 1T8EA 2CLFB 2EIHA 3KZ1E 1CUWA 4RJJA 3T94A 4AWXA 3H84A 4D9KA 4QGSA 5GV8A 2O7RA 5M04A 1A5BB 3WK9A 1FTSA 3EJ6A 4F5DA 1WETA 2BT4A 4X91A 4UASA 3EGXB 3ETEA 4QIHA 3EQ6A 1XWFA 3ROTA 1QC5B 3NDIA 3SOZA 3QUBA 4TWBA 4UZEA 1N36B 3CLHA 1YDFA 3PQ3A 1VDVA 1IOZA 2BFFB 3OBBA 3LQ2A 4W99A 4EUFA 4IKOA 1FTGA 4W1PA 2ZJAA 2PX6A 1NVDA 3UJ6A 2DY1A 3RYCB 2H4HA 1VIVA 2I55A 5FR1A 5TEWA 4ETNA 3DNFA 3F5MA 4JKYA 1GZDA 2OAQ1 3NGDA 2P78A 3R7SA 1S6YA 3QIVA 2BDEA 3GFFA 4PXSA 2SNIE 2B6HA 2EG5A 1ZLXA 4GR5A 4IJQA 1V35A 2O8DA 1CR4A 3K9BA 4OLHA 4H7JA 2D8CA 4NKRA 1U3DA 4PLGA 1HT3A 1NA5A 2F3UA 3Q7TA 3SFZA 4A1OA 1QCZA 3B1VA 3CZ4A 2OD2A 2ZG6A 3BD6A 3CUSA 3