2FE9A

Solution structure of the vts1 sam domain in the presence of rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
SNSSMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Vts1 SAM Domain in the Presence of RNA.
pubmed doi rcsb
molecule keywords Protein VTS1
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
total genus 20
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2fe9A00
1DXSA 4NL9C 3SENA 2DL0A 1SV4A 2YTUA 1SXDA 3TADA 2LPEA 1RG6A 1SV0A 2KE7A 2DKXA 2E8OA 5J8YA 1SGGA 3TADC 1OXJA 5JU5A 1PK1B 3K1RB 2D8CA 2KMDA 4RQMA 4RQNA 4PZOA 2QB1A 1PK1A 1COKA 2K4PA 2Y9UA 2E8NA 2ES6A 1F0MA 3KKAA 2ESEA 2EANA 2GLEA 3BQ7A 4PZNA 1X9XA 1X40A 1SV0C 1LKYB 1V85A 5J8YC 3H8MA 3SEIA 2LMRA 1PK3A 2FE9A 1LKYA 4NJ8A 1UQVA 3HILA 4MHVA 2F8KA 2QARA 1KW4A 5L1MA 2E8MA 1JI7A 3BS5B 1WWUA 2DKZA 2KSOB 3BS5A 2L5YA 1SXEA 2K60A 2KSOA 5F3XB 1X66A 2F3NA 3KKAC 5JTIA 1Z1VA 2EAMA 2KG5A 2QKQA 1B0XA 3IDWA 2QARB 4IS7A 2EAOA 1WWVA 2F44A 1UCVA 2EAPA 2Y9TA 5KNIA 2JV3A 2B6GA 2D3DA 2QB0B 3BS7A 1B4FA 5JRTA 1OW5A 2QB0A 2KIVA 3TACB 1V38A 2E8PA 4NL9A
chains in the Genus database with same CATH superfamily
3SMVA 9ICCA 2HHXA 1X6IA 3NVZA 5KFSA 1ZQWA 2PI4A 3T5HA 9ICJA 4DFPA 1SXDA 3TI0A 5J0QA 2HOIA 2PMZF 2IOFA 4BXOB 1T7PA 1JX4A 2D8CA 2KMDA 5J0TA 3PR4A 2BQ3A 2ZJ8A 2AHOB 3GV8B 3SAGA 4KLDA 1HEKA 1QQ7A 2K8CB 9ICGA 4EEYA 3F2DA 2AH5A 1NK8A 3SV3A 3C28A 1SKSA 1ZQVA 3QUCA 2F77X 2F2AB 4PGYA 3IG8A 4Y2SA 2BQRA 4MFFA 1XSPA 2ZUDA 4GXIA 2PFOA 2HSZA 3QUTA 4C8LA 3T5KA 2DFLA 3TKAA 4C7YA 5J0XA 3IG5A 5J2BA 8ICOA 4LJXA 4P4OA 4DOBA 3NVWA 1F5SA 3PMLA 4O3OA 5KL1B 3V6KA 3C23A 5KFUA 5KG7A 5EE3A 1IXRA 5F9LA 1KFTA 1F44A 1P7DA 2VA2A 1NNLA 7ICIA 1Q8KA 5ALQA 2LBOA 4RUCA 1TK0A 4K4IA 2Q4TA 3NRWA 2NYVA 5JRTA 3RB4A 4O5EA 1L3SA 5KFKA 1V38A 1BNOA 5ALNA 1NKEA 2Q0ZX 4PGXA 2E3TA 2ISOA 3H8WA 3PNCA 5ALKA 4A8EA 3RRHA 4C8OA 4GLXA 2ZXHA 5EWEA 4DCCA 1RG6A 4DQQA 4KLMA 4EEKA 3RH4A 3GZFA 4DQPA 4PZOA 4DL2A 5IIOA 5J0OA 3OTQA 3OJSA 2J6UA 5ALGA 4O5KA 4KLJA 3RJIA 5ALYA 5ALOA 3UQ2A 2VIXA 1M6YA 8ICBA 2YMLA 2JEGA 1D8BA 4NWIA 5ALJA 4TQRA 4Z6FA 3PSTA 3ALRA 3BQ7A 4RPYA 1KL9A 1SV0C 2LKYA 2W9BA 3WK7A 4JK1A 4Q43A 4R65A 2NO4A 2EZYA 4C8NA 4QZBA 1UQVA 2HMXA 3RH6A 3M9NB 5KFOA 3E2EA 3WK9A 4U6PA 1NKCA 2HVIA 1Q3UA 2VKQA 2W43A 4J9SA 4KLTA 2KSOB 3D2QA 4MFCA 1BPYA 3MR5A 1SL0A 5BOLA 3JPQA 1XO1A 5DG8A 2ISPA 4UAZA 1KTQA 1RM6C 1ZQ1C 3VCBA 4DOAA 8ICLA 4US9A 1TFRA 4R8UB 2XIDA 1TKDA 4NV0A 3GQCA 7ICUA 4KMUA 4I2JA 2KNJA 2QB0A 2XGPA 2ZIXA 2H3IA 4NY8A 3ZD9A 1SWVA 3BQTA 5L1JA 2MAXA 2NRZA 4DEZA 3QU7A 4P2HA 4IQVA 2G06A 3N7SC 2IA6A 4I2HA 8ICVA 1ZRNA 2PXIA 2C28A 5KFPA 1O08A 7ICGA 2HCFA 1C7YA 4FZMA 1HJPA 3SYZA 4FBUA 7ICHA 1KRPA 2C22A 5AI6A 2F1IA 1PK1A 1COKA 5G5GA 4QZ8A 4TUSA 4DQSA 4QWBA 3GV7B 2OXOA 4DF4A 3C5GA 2ES6A 3J81j 4M47A 5AKEA 3OHAA 2YMPA 2KZZA 4Z6DA 2O6KA 2W7OA 4DFKA 2XCPA 4F50A 1VJ5A 3LDAA 2DGZA 1KW4A 5L1MA 2G5HB 2PMZC 3QZ7A 1SB3C 1A0PA 2XICA 1FO4A 2K60A 2JR5A 2DQNB 5AKGA 4O3QA 1T8EA 5AKLA 3BDPA 4CF5A 4DSLA 1QCKA 2P35A 2M0NA 2ZTDA 1KLNA 5AK5A 2W9CA 3IDWA 1RZTA 3WK5A 4RQ5A 2OWOA 8ICUA 2BKEA 2B6GA 4QZCA 5CWRA 5KT6A 2KKPA 1ZQFA 3RFAA 3N7RC 3HJEA 2W03A 3FYHA 4LZGA 4OO1J 4PHAA 1T3NA 2KICA 2R8KA 3OPXA 2YB1A 4NL9A 1ZQSA 4TUPA 3FC4A 4PL1A 5ALRA 3H7IA 4MFAA 3QU4A 4I2CA 3JPRA 2C2DA 4Q45A 4ECTA 2W04A 1T94A 3TARA 4DS4A 1VDVA 3LYSA 3G6VA 2KOBA 1ZQAA 1X9MA 3EZ5A 1XC9A 3QU2A 2V9WA 3RJKA 3AU6A 4OCZA 5HP4A 2P66A 3H8SA 4WJ3B 4EBDA 1S0OA 5DB8A 5J2AA 4RQ2A 4G3IA 2G5IB 3BQ1A 1JIHA 3T79A 2LMRA 4I27A 4J9NA 2XC9A 2W3RA 4OJ6A 5J2JA 1ZQMA 3PX6A 5C0YA 4DL6A 1YZ7A 5AM1A 1L7OA 5KFFA 4E0DA 1X6JA 3V7JA 2P6UA 3C21A 1O03A 5IIIA 3OJUA 1UT5A 3RAXA 5J2CA 2FPMA 3H8JA 3M7DA 1WWVA 4ECVA 5AM4A 2BZFA 4JB3A 5CHGA 2H3ZA 2DUYA 3ZD8A 3C2KA 4O3NA 3M6KA 2WF6A 4PGQA 1ZQBA 5AI9A 5CA7A 9ICVA 3NS1A 1SKWA 5A0LA 4QZHA 1ZQNA 3B9JA 3WK8A 1ZD2P 4QZDA 4EBEA 3UQ0A 4ICAA 2HOQA 5AI5A 2I9GA 4DFJA 4UW9A 7ICKA 1NJYA 2DWQA 1Z1BA 1SWWA 4NLNA 3F5EA 2MRLA 3WKBA 5ALDA 9ICLA 2CPRA 4KN7A 4QZIA 4ED2A 2LPEA 1ZQHA 4QWAA 2DKXA 3K1ZA 5J8YA 5KG1A 2BDPA 4RNNA 3M6ZA 4RPXA 5DLFA 2JMGA 2DF4B 3NRZA 9ICPA 4DSKA 1WG8A 4J9RA 2ASLA 1XNSA 4KLLA 8ICQA 1ZQXA 5DGBA 4UB8U 8ICPA 3WKEA 3ISCA 4EYHB 1F0MA 3EYZA 1MQ2A 2WB1F 4KLQA 2W9BB 4PZNA 1X40A 2R18A 3Q8LA 3EUB2 4OJLA 2NRTA 1D9FA 1UA0A 4UATA 2DPJA 2JXJA 1U9LA 4FS1A 2HBKA 2G09A 3ISBA 2ZG6A 5AK3A 1NK6A 4I2DA 5IIMA 3BS5A 1BNPA 2HOFA 2KK0A 1ZQRA 1H38A 1PUZA 4J03A 3ONNA 4B9UA 1Z00A 1WCNA 2W8KA 1NZPA 3ETLA 1Z1VA 4UAUA 2KHVA 1NI3A 3IP4B 3MBYA 4GC7A 1B0XA 3PSFA 3N97B 1U47A 5AM3A 2FJ6A 8ICFA 3ZDAA 3AM9A 5AIBA 1NJXA 1C20A 2QB0B 5HMLA 4YVZA 2FPLA 2ZIXB 1VLBA 5KFJA 3B0XA 7ICQA 2JEFA 4RZRA 3RJFA 5GTHU 8ICMA 3TQ1A 1S5LU 8ICWA 4ECRA 9ICFA 2AXTU 3E0FA 2JEJA 5DDYA 9ICRA 3KD3A 2W9AA 5KT7A 2BCUA 1T4GA 2HHTA 8ICTA 3QUBA 3ZDDA 1HUOA 4CF3A 4I28A 4DSFA 2ZUCA 4FZNA 3Q8QB 5J2GA 3MR2A 1CEZA 1SGGA 5ALIA 5KFHA 1LVHA 1PK1B 3K1RB 4RNOA 3Q8MA 4KLIA 1AQ6A 2ZTEA 5ALTA 1FEZA 2UVWA 5CB1A 3IV6A 4F2SA 4BGDA 4RNMA 2I1QA 3B0YA 4BWJA 5DB9A 2FLPA 2E8NA 4M2YA 4B9TA 3PVXA 1TE2A 2ZXIA 4PHEA 3QXGA 3SAHA 5TZVA 2AQ0A 4JUZA 5KFIA 4XA5A 9ICXA 4B9NA 1K5OA 1TK8A 2ASDA 4BWMA 3A0HU 4KLOA 4NLBA 4PHDA 2C2RA 1N5WA 1ZQZA 5F3XB 2W9CB 2BCRA 4J9LA 5IIKA 2B21A 3PR5B 4IC9A 4PJ0U 2QARB 2H3QA 2R8HA 9ICKA 5T14A 2FMSA 1UCVA 4YXJA 2DBYA 4IQTA 2NRWA 2UVRA 3S6JA 1BPBA 4IQWA 2F8LA 3PX0A 3A0BU 3VC8A 4Y2VA 4OJPA 5KFCA 1Z4OA 3D2NA 5DQHA 2PFQA 3UM9A 4Q8EA 2G07A 2ATLA 4R64A 3RBEA 4NL9C 5ALFA 2IOFK 5B5EU 3HKZF 4M0AA 1SV4A 3V6JA 2V4QA 1DGSA 2E1FA 5DBAA 4ELTA 3TADA 1Z19A 3ZDBA 2A1JA 3BQ0A 2E8OA 3EPIA 1QSSA 4UB5A 4RQMA 4DF8A 2ZIVA 1JXLA 5E79U 4UBBA 1L6NA 3PZPA 1NJWA 4DQIA 1RYUA 1S10A 2HBMA 5KG0A 5AM5A 5ALUA 2KD1A 4YMNA 2K4PA 2BDUA 4Z6EA 5ALSA 3C5FA 4CF4A 3GIJA 5J2DA 4CGZA 4XRHA 4XQ8A 1UT8A 4J9MA 3TANA 2NRXA 3IN5A 2Y1JA 4FFDA 3RJJA 1D8LA 3TFSA 7ICFA 1BPDA 3RJGA 3RRGA 1KBUA 1B43A 2HHQA 3C1ZA 4RPZA 4DL3A 4KTQA 3HP6A 4EYIB 1K1SA 5ALPA 3UMCA 4UB1A 4CNQA 1WWUA 2JGAA 4RQ7A 5CRXA 1QH9A 2B0CA 5D49A 4EBCA 5EE9A 3AQEA 3H0RB 2LM4A 1IV8A 2C2EA 3PSPA 1DRGA 3MGHA 1A77A 2LYBA 4IS7A 4O0IA 4IRCA 3JPOA 2CN1A 3T3FA 3F53A 4PPXA 2BPGA 4PL2A 2WB1C 5J2KA 1BPXA 2UVVA 2KZMA 3MFHA 3MC1A 4RQ1A 3D2SA 2K4EA 4GXJA 4KITB 5CR0A 4OJ5A 3SZ2A 5KFYA 2LI6A 8ICSA 3THVA 4FS2A 1UA1A 4NLGA 5KL8B 1NJZA 2YB4A 3RTVA 5CP2A 3ED5A 2CRXA 4NLKA 2MU2A 1ZQJA 2JHDA 2YTUA 4KN4A 3F5AA 4QIWF 1NKBA 5AI8A 5AKHA 1N5XA 4C4TA 1U45A 2WFAA 3MFIA 5KFQA 3Q8SB 1EXNA 4EZ6A 4ED0A 1NK9A 2WHEA 4DL4A 2JZBA 3BJYA 5DBBA 3MDAA 4YR0A 4DQRA 4UARA 4OD0A 3KKAA 3R9KA 5KT3A 2VA3A 1ZJMA 2KKVA 3ZI4A 5KG3A 8ICRA 3PW2A 1ZRMA 2EQYA 4ECYA 2FE9A 3GILA 3CW2C 4RQ0A 1NK5A 1KQQA 1TAMA 2K8AA 2G08A 2BR0A 3EWAA 3WKAA 2PI5A 1JI7A 3BS5B 5KFLA 4J9QA 1S76D 4YXMA 1MA7A 3KHGA 4F4WA 8ICHA 1Z00B 2F1JA 3PY8A 2KZ3A 2BPFA 2F1HA 4Z6CA 1XSLA 4UB6U 5DB7A 2ASJA 4F5NA 4YP3A 2A3VA 2YMQA 5AKJA 2WF8A 4O5CA 9ICTA 4USAA 3N7PD 4JWNA 5AKIA 4EX6A 2YN4A 1OW5A 1PVPA 5AM2A 5DQIA 2ZIUA 3F2BA 3QZ8A 2VJ4A 3OHBA 8ICXA 2IHMA 2ZUBA 2R8JA 4DS5A 3PO5A 4IR1A 5L1IA 2OEHA 3C2LA 3CRXA 3T5LA 3C2MA 3EPGA 1XSNA 1DK3A 5C5JA 1ZQDA 3RB6A 2M9NA 3K75D 2FPKA 5ALMA 7ICMA 2OYYA 4Y2RA 4ECSA 4UAWA 2FLNA 2QB1A 4ZH4A 2J6TA 3JPSA 3I1YA 3LVWA 4I2AA 3WK6A 2K8BB 5KG4A 3U26A 4TQSA 5DB6A 3SAFA 2XI9A 4B9SA 2HHUA 4O3MA 8ICKA 5KT5A 1QSYA 2JH7A 1NK4A 3M9MB 4QWCA 3BQ2A 2ESEA 5B66U 3RJEA 3QU9A 3KOOA 3HKZC 3LVVA 2RDJA 2EDUA 4QNLA 5KG5A 5AKXA 3H0LB 3KFUF 1DOQA 5KAIU 2KFZA 1SIJA 5AK4A 5ALHA 4QWEA 4M04A 1L7MA 5KFNA 5KFDA 1SZPA 3ZDEA 2LHTA 5J0YA 4UB3A 4O3SA 3NASA 4GIBA 2AJQA 1MN8A 1V9PA 2F44A 2CXYA 1ZOLA 2K4HA 3EW9A 4DFDA 3PSIA 5D46A 2MSNA 4FO6A 5H2FU 5K4LA 2RRDA 5AIAA 4BUGA 3GU3A 2V4RA 1L8LA 2E1EA 3CNHA 3RR8A 1Z3EB 5ALXA 2OCEA 2RQ5A 1KKXA 3RJHA 3QNMA 4DLGA 1Y88A 3PW0A 2A1JB 7ICLA 7ICOA 1SV0A 2IBKA 4IR9A 4M9NA 3TADC 4F92B 2ZIVB 4I2BA 1CRXA 2AQ4A 2OM6A 1WCLA 4UB4A 1XS9D 3KZIU 1L3UA 2AU0A 4EZ9A 2LYHA 5FP0A 4OJOA 3JPTA 1PVRA 2FDRA 3UMGA 1RYSA 2YY6A 4RT3A 1S77D 1QLNA 4DLEA 3H4DA 1BPEA 5AKYA 1L3TA 4J9KA 3H8MA 4B6JA 5KFVA 4KLGA 3PX4A 1RYRA 2NO5A 1ZQOA 1PZNA 3V7LA 2NRVA 7ICVA 2F8KA 2WAQF 1L3VA 2OH2A 4HYKA 4QIWC 4ECUA 3ZDCA 4MEXA 2Y0SF 4M9JA 2A1AA 5EWFA 3GIMA 1U48A 4O9MA 4ED6A 1FFVA 2EAMA 4F4XA 3L4PA 4KMOB 4YD1A 3UPQA 4MF2A 3WK4A 4QZFA 1U49A 3I76A 5EE0A 2XY5A 2ZIWA 8ICZA 2GH1A 3N4MB 9ICUA 5KNIA 2JV3A 4ZOHC 2ODGA 1XO0A 3N28A 5D4BA 3KTQA 5ALEA 4KLSA 8ICNA 5ALZA 4MF8A 2XVTA 2KEYA 1ZQPA 2XY6A 1A6SA 3M8SA 5EOZA 4QZ9A 4FBTA 1MSWD 3SV4A 3IRUA 1JUDA 1ZQEA 5ALWA 3RH5A 2PKEA 5ALLA 5HHIA 4JV2A 2WTFA 4QZEA 2IOHA 5KFRA 4YQWA 2YQEA 3ISDA 3BZKA 1U4BA 1N60A 2JZBB 4JMUA 3LWMA 3NVVA 1X9SA 4F93B 1ZQUA 2XGQA 5KFBA 1SL1A 4NXZA 1CUKA 1X9XA 5J0UA 1QSLA 4DFMA 1PK3A 1KFSA 2I5HA 4DSEA 2PFNA 4RT2A 2BGWA 4NLCA 3QUQA 4J9OA 2KP7A 2KJ9A 3RB0A 3M9OB 5J0SA 4ECXA 4C0ZA 2BCQA 5DGAA 5DDMA 1N62A 3KHRA 3HWTA 2W8LA 3HX0A 4IRDA 1S97A 2NV3A 7ICTA 1ZQTA 1RQLA 5J0WA 1QQ6A 3IM1A 3SQIA 4Y2YA 1NZBA 3V72A 5HHHA 3JPPA 4UAYA 5AK6A 1SZHA 3TFRA 1FIQA 4F5PA 4GXKA 1NOMA 2ZIUB 1HUZA 2R8GA 3ETRA 2RP5A 4DOCA 4QWDA 2EZXA 4BDPA 2DPIA 1HIWA 3FAHA 5J0RA 5J29A 4KLEA 1BGXT 3NUQA 3MGIA 1LV5A 3SI8A 3AL0B 5AI4A 4JV1A 2KN7A 4CCHA 2KE7A 3KHLA 9ICIA 3GV5B 2H3FA 8ICGA 1LB2B 9ICAA 3AU2A 2HI0A 1J2MA 1BVSA 3AEVA 1ZD3A 5J2HA 5HNKA 4Y2QA 2Y9UA 1N48A 4KLFA 2GLEA 4JV0A 4QW9A 1X42A 1B22A 3LWLA 4F91B 3Q8PB 1ZQYA 1ZD5A 4FE3A 4NJ8A 3G6XA 2JEIA 4ED8A 5GTIU 3KZXA 4LZDA 3RB3A 3MGVA 4R63A 4I29A 3L5KA 2EZZA 9ICMA 4M6WA 2WF9A 1MQ3A 5IILA 2ZJ5A 2KIWA 2BQUA 4QZGA 4NM1A 5ALVA 1ZJNA 5AM0A 5J2FA 4KLHA 1KN5A 2YX8A 2E5SA 4EELA 4LVSA 1DK2A 4F5RA 2HHWA 4YMOA 5KFMA 2PFPA 4DSJA 3DDHA 1JMSA 5AKZA 3HRDD 5KFXA 1B4FA 1IIPA 3PV8A 4DWIA 2HHSA 2WF5A 2W11A 4C4SA 2FI1A 2KIVA 2WAQC 9ICHA 1V97A 4P4PA 4UQGA 4F5QA 5F9NA 5AI0A 3SENA 2Y0SC 3ICXA 4F72A 3K4GA 4AYBF 4ED3A 2XCAA 2HBJA 5KT4A 4F4ZA 4Q8FA 1ZQCA 1OXJA 4IRKA 1TAQA 5AICA 3WKDA 3OGUA 2W9MA 4TURA 2KJ5A 3QYPA 4RQ8A 2BCVA 5KFZA 1L7NA 4P0PA 2K89A 3NGDA 1JN3A 4C4RA 4DO9A 2J6SA 3RF9A 1NK7A 4C7ZA 2MA1A 4EENA 1KDHA 3PMNA 3RBDA 5KFEA 3UXNA 3IHQB 4YFKA 4RQ6A 3QE9Y 1ZQIA 4HAIA 9ICOA 1ZQKA 1V85A 5J8YC 4BX9C 4RQ3A 1GO3F 2UVUA 4I2IA 2KTQA 1LKYA 3ORYA 4F5OA 5EE1A 8ICCA 2IMWP 3UXOA 2KVSA 2H3VA 1RDFA 3WU2U 3AMZA 1YT3A 2HBLA 2AGQA 2K4IA 2MUTA 4M9GA 1RQNA 1JXEA 3DEEA 4YG2A 3NVYA 3LK9A 4J9PA 1L8OA 3E58A 4KX3A 4F2RA 5HR7A 4K4GA 2ZIWB 3QU5A 2EAOA 4GFJA 5BPCA 2RLTA 4PHPA 2JRZA 2BPCA 1L5UA 2R8IA 2KV2A 4P4MA 1ZQQA 1ZQLA 4P0QA 2XY7A 3M8RA 4RUAA 2KVCA 3Q8RB 9ICNA 2HW3A 1J2NA 1DGJA 2ZTCA 2JH1A 5DG7A 1URJA 2H5XA 3MR3A 2EH9A 1IM4A 7ICJA 4I2EA 4B9MA 2AGPA 1UPHA 4TUQA 5L1KA 4O3RA 4NM2A 5KFTA 2DL0A 1SL2A 3GIIA 5HR6A 2WF7A 3AQFA 4Y2XA 3FM9A 4NLZA 4C80A 3AUOA 5AKKA 5KG2A 4FZLA 4Y2TA 4ECZA 4UBCA 4BXOA 4CE6A 1Q46A 4ACOA 1TV9A 1QTMA 3NTUA 2GO7A 2GWSA 1D9DA 2VJ5A 3H40A 5IIJA 1WUDA 9ICSA 4ELUA 8ICEA 4ED1A 3V7KA 4ELVA 8ICAA 8ICYA 1RPLA 4UAVA 4U7CA 2FLLA 1X2IA 3AN1A 4MEYA 1Z4NA 3KHHA 5JUMA 1TK5A 2FMQA 2QARA 3JPNA 5DKWA 2Y1IA 3DV9A 2W55A 4YD2A 3TAPA 4R66A 1N56A 4I2GA 3C1YA 1SXEA 1K1QA 4KX5A 5KTQA 1N2XA 1KFDA 1S0NA 4JWMA 3Q8KA 8ICIA 2F3NA 1COOA 1T3QA 2LM1A 5KT2A 4F4YA 2HVHA 5KAFU 2KG5A 4DL7A 4DL5A 5KFGA 3M1YA 9ICBA 1QQ5A 1N61A 5G5HA 5AHXA 2G0AA 2Y9TA 2ALZA 4Q44A 1NK0A 1FFUA 3F2CA 1S0VA 4YR2A 2KFNA 3PW4A 2HDOA 4M9LA 2VANA 3H0MB 3MABA 3MR6A 7ICRA 2IHNA 2W3SA 3V6HA 7ICSA 1DXSA 1KEJA 9ICEA 2N1RA 1TVAA 4Y2UA 4X5VA 2HHVA 3FDSA 3GFKB 4YMMA 3CYMA 1S0MA 5EWGA 3UXPA 4C8KA 1Q3VA 2RHFA 1ED1A 5KFWA 4KLUA 5L9XA 3OSNA 7ICNA 5JU5A 3RR7A 4RQNA 3SD7A 4UASA 4BJQA 3RAQA 3TAQA 4F8RA 2BHNA 7ICPA 1ECWA 1XU4A 1N63A 1J97A 2BCSA 1A76A 4UB2A 2EANA 4CRXA 4US8A 2W7PA 2KHQA 3PO4A 1JALA 3QEBZ 1WYGA 3SEIA 5KFAA 1D8YA 4XUSA 1JROA 1AROP 3MDCA 4AYBC 1SKRA 1S8OA 3T5JA 3HW8A 4DSIA 1TAUA 3C29A 3OSPA 1S9FA 4RQ4A 4ED7A 5L1LA 2DKZA 9ICWA 3L3FX 4M6WB 1ZQGA 4QJFB 1MC8A 2KSOA 4AP9A 3GIKA 2QKQA 1ZYQA 4PH5A 4Y2PA 1CI4A 2W54A 5TISU 4ECQA 5DBCA 4B9LA 3QX7A 5DLGA 3HPOA 2EAPA 4IQUA 4R8UA 5HMMA 4IL6U 5J0PA 4F4KA 3BS7A 3GDXA 4YCXA 5CJ7A 1YZ6A 3TACB 3SR6A 2D6FC 8ICJA 2E8PA 4GC6A 4CDGA 3CP8A 3G6YA 4YN4A 2XO7A 2YMMA 5IINA 5J2IA 1OUQA 1UHUA 1RXVA 2GOLA 1KSPA 4M9HA 5CEHA 4P0PB 5J2EA 5DQGA 4F3OA 2LYAA 2AGOA 5BOMA 1ZETA 2F76X 1L7PA 1PVQA 1ZXIA 4ECWA 5KG6A 3O0FA 2RDIA 3I28A 1LKYB 3HT3A 1RXWA 1IG6A 4QZAA 4F71A 3HILA 2QLTA 3D6JA 4MHVA 3KBBA 3WKCA 1ZD4A 2E8MA 2I6XA 4O3PA 2MUTB 4EX7A 3PW7A 2L5YA 7ICEA 4B9VA 1XWLA 1X66A 3KKAC 5JTIA 3UMBA 2Z7JA 3H4BA 2KJ8A 1BPZA 4YR3A 3PW5A 9ICQA 4C8MA 4QW8A 3BZCA 4G9BA 4P0QB 2OHFA 4Y2JA 2ZJAA 2D3DA 3QEAZ 2VA8A 4RU9A 5DG9A 2A19A 2FMPA 4K4HA 1X9WA 4I2FA 2P6RA 1JRPA
chains in the Genus database with same CATH topology
1DXSA 4NL9C 3SENA 2DL0A 1SV4A 2YTUA 1SXDA 3TADA 2LPEA 1RG6A 1SV0A 2KE7A 2DKXA 2E8OA 5J8YA 1SGGA 3TADC 1OXJA 5JU5A 1PK1B 3K1RB 2D8CA 2KMDA 4RQMA 4RQNA 4PZOA 2QB1A 1PK1A 1COKA 2K4PA 2Y9UA 2E8NA 2ES6A 1F0MA 3KKAA 2ESEA 2EANA 2GLEA 3BQ7A 4PZNA 1X9XA 1X40A 1SV0C 1LKYB 1V85A 5J8YC 3H8MA 3SEIA 2LMRA 1PK3A 2FE9A 1LKYA 4NJ8A 1UQVA 3HILA 4MHVA 2F8KA 2QARA 1KW4A 5L1MA 2E8MA 1JI7A 3BS5B 1WWUA 2DKZA 2KSOB 3BS5A 2L5YA 1SXEA 2K60A 2KSOA 5F3XB 1X66A 2F3NA 3KKAC 5JTIA 1Z1VA 2EAMA 2KG5A 2QKQA 1B0XA 3IDWA 2QARB 4IS7A 2EAOA 1WWVA 2F44A 1UCVA 2EAPA 2Y9TA 5KNIA 2JV3A 2B6GA 2D3DA 2QB0B 3BS7A 1B4FA 5JRTA 1OW5A 2QB0A 2KIVA 3TACB 1V38A 2E8PA 4NL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DXS A;  4NL9 C;  3SEN A;  2DL0 A;  1SV4 A;  2YTU A;  1SXD A;  3TAD A;  2LPE A;  1RG6 A;  1SV0 A;  2KE7 A;  2DKX A;  2E8O A;  5J8Y A;  1SGG A;  3TAD C;  1OXJ A;  5JU5 A;  1PK1 B;  3K1R B;  2D8C A;  2KMD A;  4RQM A;  4RQN A;  4PZO A;  2QB1 A;  1PK1 A;  1COK A;  2K4P A;  2Y9U A;  2E8N A;  2ES6 A;  1F0M A;  3KKA A;  2ESE A;  2EAN A;  2GLE A;  3BQ7 A;  4PZN A;  1X9X A;  1X40 A;  1SV0 C;  1LKY B;  1V85 A;  5J8Y C;  3H8M A;  3SEI A;  2LMR A;  1PK3 A;  2FE9 A;  1LKY A;  4NJ8 A;  1UQV A;  3HIL A;  4MHV A;  2F8K A;  2QAR A;  1KW4 A;  5L1M A;  2E8M A;  1JI7 A;  3BS5 B;  1WWU A;  2DKZ A;  2KSO B;  3BS5 A;  2L5Y A;  1SXE A;  2K60 A;  2KSO A;  5F3X B;  1X66 A;  2F3N A;  3KKA C;  5JTI A;  1Z1V A;  2EAM A;  2KG5 A;  2QKQ A;  1B0X A;  3IDW A;  2QAR B;  4IS7 A;  2EAO A;  1WWV A;  2F44 A;  1UCV A;  2EAP A;  2Y9T A;  5KNI A;  2JV3 A;  2B6G A;  2D3D A;  2QB0 B;  3BS7 A;  1B4F A;  5JRT A;  1OW5 A;  2QB0 A;  2KIV A;  3TAC B;  1V38 A;  2E8P A;  4NL9 A; 
#chains in the Genus database with same CATH topology
 3SMV A;  9ICC A;  2HHX A;  1X6I A;  3NVZ A;  5KFS A;  1ZQW A;  2PI4 A;  3T5H A;  9ICJ A;  4DFP A;  1SXD A;  3TI0 A;  5J0Q A;  2HOI A;  2PMZ F;  2IOF A;  4BXO B;  1T7P A;  1JX4 A;  2D8C A;  2KMD A;  5J0T A;  3PR4 A;  2BQ3 A;  2ZJ8 A;  2AHO B;  3GV8 B;  3SAG A;  4KLD A;  1HEK A;  1QQ7 A;  2K8C B;  9ICG A;  4EEY A;  3F2D A;  2AH5 A;  1NK8 A;  3SV3 A;  3C28 A;  1SKS A;  1ZQV A;  3QUC A;  2F77 X;  2F2A B;  4PGY A;  3IG8 A;  4Y2S A;  2BQR A;  4MFF A;  1XSP A;  2ZUD A;  4GXI A;  2PFO A;  2HSZ A;  3QUT A;  4C8L A;  3T5K A;  2DFL A;  3TKA A;  4C7Y A;  5J0X A;  3IG5 A;  5J2B A;  8ICO A;  4LJX A;  4P4O A;  4DOB A;  3NVW A;  1F5S A;  3PML A;  4O3O A;  5KL1 B;  3V6K A;  3C23 A;  5KFU A;  5KG7 A;  5EE3 A;  1IXR A;  5F9L A;  1KFT A;  1F44 A;  1P7D A;  2VA2 A;  1NNL A;  7ICI A;  1Q8K A;  5ALQ A;  2LBO A;  4RUC A;  1TK0 A;  4K4I A;  2Q4T A;  3NRW A;  2NYV A;  5JRT A;  3RB4 A;  4O5E A;  1L3S A;  5KFK A;  1V38 A;  1BNO A;  5ALN A;  1NKE A;  2Q0Z X;  4PGX A;  2E3T A;  2ISO A;  3H8W A;  3PNC A;  5ALK A;  4A8E A;  3RRH A;  4C8O A;  4GLX A;  2ZXH A;  5EWE A;  4DCC A;  1RG6 A;  4DQQ A;  4KLM A;  4EEK A;  3RH4 A;  3GZF A;  4DQP A;  4PZO A;  4DL2 A;  5IIO A;  5J0O A;  3OTQ A;  3OJS A;  2J6U A;  5ALG A;  4O5K A;  4KLJ A;  3RJI A;  5ALY A;  5ALO A;  3UQ2 A;  2VIX A;  1M6Y A;  8ICB A;  2YML A;  2JEG A;  1D8B A;  4NWI A;  5ALJ A;  4TQR A;  4Z6F A;  3PST A;  3ALR A;  3BQ7 A;  4RPY A;  1KL9 A;  1SV0 C;  2LKY A;  2W9B A;  3WK7 A;  4JK1 A;  4Q43 A;  4R65 A;  2NO4 A;  2EZY A;  4C8N A;  4QZB A;  1UQV A;  2HMX A;  3RH6 A;  3M9N B;  5KFO A;  3E2E A;  3WK9 A;  4U6P A;  1NKC A;  2HVI A;  1Q3U A;  2VKQ A;  2W43 A;  4J9S A;  4KLT A;  2KSO B;  3D2Q A;  4MFC A;  1BPY A;  3MR5 A;  1SL0 A;  5BOL A;  3JPQ A;  1XO1 A;  5DG8 A;  2ISP A;  4UAZ A;  1KTQ A;  1RM6 C;  1ZQ1 C;  3VCB A;  4DOA A;  8ICL A;  4US9 A;  1TFR A;  4R8U B;  2XID A;  1TKD A;  4NV0 A;  3GQC A;  7ICU A;  4KMU A;  4I2J A;  2KNJ A;  2QB0 A;  2XGP A;  2ZIX A;  2H3I A;  4NY8 A;  3ZD9 A;  1SWV A;  3BQT A;  5L1J A;  2MAX A;  2NRZ A;  4DEZ A;  3QU7 A;  4P2H A;  4IQV A;  2G06 A;  3N7S C;  2IA6 A;  4I2H A;  8ICV A;  1ZRN A;  2PXI A;  2C28 A;  5KFP A;  1O08 A;  7ICG A;  2HCF A;  1C7Y A;  4FZM A;  1HJP A;  3SYZ A;  4FBU A;  7ICH A;  1KRP A;  2C22 A;  5AI6 A;  2F1I A;  1PK1 A;  1COK A;  5G5G A;  4QZ8 A;  4TUS A;  4DQS A;  4QWB A;  3GV7 B;  2OXO A;  4DF4 A;  3C5G A;  2ES6 A;  3J81 j;  4M47 A;  5AKE A;  3OHA A;  2YMP A;  2KZZ A;  4Z6D A;  2O6K A;  2W7O A;  4DFK A;  2XCP A;  4F50 A;  1VJ5 A;  3LDA A;  2DGZ A;  1KW4 A;  5L1M A;  2G5H B;  2PMZ C;  3QZ7 A;  1SB3 C;  1A0P A;  2XIC A;  1FO4 A;  2K60 A;  2JR5 A;  2DQN B;  5AKG A;  4O3Q A;  1T8E A;  5AKL A;  3BDP A;  4CF5 A;  4DSL A;  1QCK A;  2P35 A;  2M0N A;  2ZTD A;  1KLN A;  5AK5 A;  2W9C A;  3IDW A;  1RZT A;  3WK5 A;  4RQ5 A;  2OWO A;  8ICU A;  2BKE A;  2B6G A;  4QZC A;  5CWR A;  5KT6 A;  2KKP A;  1ZQF A;  3RFA A;  3N7R C;  3HJE A;  2W03 A;  3FYH A;  4LZG A;  4OO1 J;  4PHA A;  1T3N A;  2KIC A;  2R8K A;  3OPX A;  2YB1 A;  4NL9 A;  1ZQS A;  4TUP A;  3FC4 A;  4PL1 A;  5ALR A;  3H7I A;  4MFA A;  3QU4 A;  4I2C A;  3JPR A;  2C2D A;  4Q45 A;  4ECT A;  2W04 A;  1T94 A;  3TAR A;  4DS4 A;  1VDV A;  3LYS A;  3G6V A;  2KOB A;  1ZQA A;  1X9M A;  3EZ5 A;  1XC9 A;  3QU2 A;  2V9W A;  3RJK A;  3AU6 A;  4OCZ A;  5HP4 A;  2P66 A;  3H8S A;  4WJ3 B;  4EBD A;  1S0O A;  5DB8 A;  5J2A A;  4RQ2 A;  4G3I A;  2G5I B;  3BQ1 A;  1JIH A;  3T79 A;  2LMR A;  4I27 A;  4J9N A;  2XC9 A;  2W3R A;  4OJ6 A;  5J2J A;  1ZQM A;  3PX6 A;  5C0Y A;  4DL6 A;  1YZ7 A;  5AM1 A;  1L7O A;  5KFF A;  4E0D A;  1X6J A;  3V7J A;  2P6U A;  3C21 A;  1O03 A;  5III A;  3OJU A;  1UT5 A;  3RAX A;  5J2C A;  2FPM A;  3H8J A;  3M7D A;  1WWV A;  4ECV A;  5AM4 A;  2BZF A;  4JB3 A;  5CHG A;  2H3Z A;  2DUY A;  3ZD8 A;  3C2K A;  4O3N A;  3M6K A;  2WF6 A;  4PGQ A;  1ZQB A;  5AI9 A;  5CA7 A;  9ICV A;  3NS1 A;  1SKW A;  5A0L A;  4QZH A;  1ZQN A;  3B9J A;  3WK8 A;  1ZD2 P;  4QZD A;  4EBE A;  3UQ0 A;  4ICA A;  2HOQ A;  5AI5 A;  2I9G A;  4DFJ A;  4UW9 A;  7ICK A;  1NJY A;  2DWQ A;  1Z1B A;  1SWW A;  4NLN A;  3F5E A;  2MRL A;  3WKB A;  5ALD A;  9ICL A;  2CPR A;  4KN7 A;  4QZI A;  4ED2 A;  2LPE A;  1ZQH A;  4QWA A;  2DKX A;  3K1Z A;  5J8Y A;  5KG1 A;  2BDP A;  4RNN A;  3M6Z A;  4RPX A;  5DLF A;  2JMG A;  2DF4 B;  3NRZ A;  9ICP A;  4DSK A;  1WG8 A;  4J9R A;  2ASL A;  1XNS A;  4KLL A;  8ICQ A;  1ZQX A;  5DGB A;  4UB8 U;  8ICP A;  3WKE A;  3ISC A;  4EYH B;  1F0M A;  3EYZ A;  1MQ2 A;  2WB1 F;  4KLQ A;  2W9B B;  4PZN A;  1X40 A;  2R18 A;  3Q8L A;  3EUB 2;  4OJL A;  2NRT A;  1D9F A;  1UA0 A;  4UAT A;  2DPJ A;  2JXJ A;  1U9L A;  4FS1 A;  2HBK A;  2G09 A;  3ISB A;  2ZG6 A;  5AK3 A;  1NK6 A;  4I2D A;  5IIM A;  3BS5 A;  1BNP A;  2HOF A;  2KK0 A;  1ZQR A;  1H38 A;  1PUZ A;  4J03 A;  3ONN A;  4B9U A;  1Z00 A;  1WCN A;  2W8K A;  1NZP A;  3ETL A;  1Z1V A;  4UAU A;  2KHV A;  1NI3 A;  3IP4 B;  3MBY A;  4GC7 A;  1B0X A;  3PSF A;  3N97 B;  1U47 A;  5AM3 A;  2FJ6 A;  8ICF A;  3ZDA A;  3AM9 A;  5AIB A;  1NJX A;  1C20 A;  2QB0 B;  5HML A;  4YVZ A;  2FPL A;  2ZIX B;  1VLB A;  5KFJ A;  3B0X A;  7ICQ A;  2JEF A;  4RZR A;  3RJF A;  5GTH U;  8ICM A;  3TQ1 A;  1S5L U;  8ICW A;  4ECR A;  9ICF A;  2AXT U;  3E0F A;  2JEJ A;  5DDY A;  9ICR A;  3KD3 A;  2W9A A;  5KT7 A;  2BCU A;  1T4G A;  2HHT A;  8ICT A;  3QUB A;  3ZDD A;  1HUO A;  4CF3 A;  4I28 A;  4DSF A;  2ZUC A;  4FZN A;  3Q8Q B;  5J2G A;  3MR2 A;  1CEZ A;  1SGG A;  5ALI A;  5KFH A;  1LVH A;  1PK1 B;  3K1R B;  4RNO A;  3Q8M A;  4KLI A;  1AQ6 A;  2ZTE A;  5ALT A;  1FEZ A;  2UVW A;  5CB1 A;  3IV6 A;  4F2S A;  4BGD A;  4RNM A;  2I1Q A;  3B0Y A;  4BWJ A;  5DB9 A;  2FLP A;  2E8N A;  4M2Y A;  4B9T A;  3PVX A;  1TE2 A;  2ZXI A;  4PHE A;  3QXG A;  3SAH A;  5TZV A;  2AQ0 A;  4JUZ A;  5KFI A;  4XA5 A;  9ICX A;  4B9N A;  1K5O A;  1TK8 A;  2ASD A;  4BWM A;  3A0H U;  4KLO A;  4NLB A;  4PHD A;  2C2R A;  1N5W A;  1ZQZ A;  5F3X B;  2W9C B;  2BCR A;  4J9L A;  5IIK A;  2B21 A;  3PR5 B;  4IC9 A;  4PJ0 U;  2QAR B;  2H3Q A;  2R8H A;  9ICK A;  5T14 A;  2FMS A;  1UCV A;  4YXJ A;  2DBY A;  4IQT A;  2NRW A;  2UVR A;  3S6J A;  1BPB A;  4IQW A;  2F8L A;  3PX0 A;  3A0B U;  3VC8 A;  4Y2V A;  4OJP A;  5KFC A;  1Z4O A;  3D2N A;  5DQH A;  2PFQ A;  3UM9 A;  4Q8E A;  2G07 A;  2ATL A;  4R64 A;  3RBE A;  4NL9 C;  5ALF A;  2IOF K;  5B5E U;  3HKZ F;  4M0A A;  1SV4 A;  3V6J A;  2V4Q A;  1DGS A;  2E1F A;  5DBA A;  4ELT A;  3TAD A;  1Z19 A;  3ZDB A;  2A1J A;  3BQ0 A;  2E8O A;  3EPI A;  1QSS A;  4UB5 A;  4RQM A;  4DF8 A;  2ZIV A;  1JXL A;  5E79 U;  4UBB A;  1L6N A;  3PZP A;  1NJW A;  4DQI A;  1RYU A;  1S10 A;  2HBM A;  5KG0 A;  5AM5 A;  5ALU A;  2KD1 A;  4YMN A;  2K4P A;  2BDU A;  4Z6E A;  5ALS A;  3C5F A;  4CF4 A;  3GIJ A;  5J2D A;  4CGZ A;  4XRH A;  4XQ8 A;  1UT8 A;  4J9M A;  3TAN A;  2NRX A;  3IN5 A;  2Y1J A;  4FFD A;  3RJJ A;  1D8L A;  3TFS A;  7ICF A;  1BPD A;  3RJG A;  3RRG A;  1KBU A;  1B43 A;  2HHQ A;  3C1Z A;  4RPZ A;  4DL3 A;  4KTQ A;  3HP6 A;  4EYI B;  1K1S A;  5ALP A;  3UMC A;  4UB1 A;  4CNQ A;  1WWU A;  2JGA A;  4RQ7 A;  5CRX A;  1QH9 A;  2B0C A;  5D49 A;  4EBC A;  5EE9 A;  3AQE A;  3H0R B;  2LM4 A;  1IV8 A;  2C2E A;  3PSP A;  1DRG A;  3MGH A;  1A77 A;  2LYB A;  4IS7 A;  4O0I A;  4IRC A;  3JPO A;  2CN1 A;  3T3F A;  3F53 A;  4PPX A;  2BPG A;  4PL2 A;  2WB1 C;  5J2K A;  1BPX A;  2UVV A;  2KZM A;  3MFH A;  3MC1 A;  4RQ1 A;  3D2S A;  2K4E A;  4GXJ A;  4KIT B;  5CR0 A;  4OJ5 A;  3SZ2 A;  5KFY A;  2LI6 A;  8ICS A;  3THV A;  4FS2 A;  1UA1 A;  4NLG A;  5KL8 B;  1NJZ A;  2YB4 A;  3RTV A;  5CP2 A;  3ED5 A;  2CRX A;  4NLK A;  2MU2 A;  1ZQJ A;  2JHD A;  2YTU A;  4KN4 A;  3F5A A;  4QIW F;  1NKB A;  5AI8 A;  5AKH A;  1N5X A;  4C4T A;  1U45 A;  2WFA A;  3MFI A;  5KFQ A;  3Q8S B;  1EXN A;  4EZ6 A;  4ED0 A;  1NK9 A;  2WHE A;  4DL4 A;  2JZB A;  3BJY A;  5DBB A;  3MDA A;  4YR0 A;  4DQR A;  4UAR A;  4OD0 A;  3KKA A;  3R9K A;  5KT3 A;  2VA3 A;  1ZJM A;  2KKV A;  3ZI4 A;  5KG3 A;  8ICR A;  3PW2 A;  1ZRM A;  2EQY A;  4ECY A;  2FE9 A;  3GIL A;  3CW2 C;  4RQ0 A;  1NK5 A;  1KQQ A;  1TAM A;  2K8A A;  2G08 A;  2BR0 A;  3EWA A;  3WKA A;  2PI5 A;  1JI7 A;  3BS5 B;  5KFL A;  4J9Q A;  1S76 D;  4YXM A;  1MA7 A;  3KHG A;  4F4W A;  8ICH A;  1Z00 B;  2F1J A;  3PY8 A;  2KZ3 A;  2BPF A;  2F1H A;  4Z6C A;  1XSL A;  4UB6 U;  5DB7 A;  2ASJ A;  4F5N A;  4YP3 A;  2A3V A;  2YMQ A;  5AKJ A;  2WF8 A;  4O5C A;  9ICT A;  4USA A;  3N7P D;  4JWN A;  5AKI A;  4EX6 A;  2YN4 A;  1OW5 A;  1PVP A;  5AM2 A;  5DQI A;  2ZIU A;  3F2B A;  3QZ8 A;  2VJ4 A;  3OHB A;  8ICX A;  2IHM A;  2ZUB A;  2R8J A;  4DS5 A;  3PO5 A;  4IR1 A;  5L1I A;  2OEH A;  3C2L A;  3CRX A;  3T5L A;  3C2M A;  3EPG A;  1XSN A;  1DK3 A;  5C5J A;  1ZQD A;  3RB6 A;  2M9N A;  3K75 D;  2FPK A;  5ALM A;  7ICM A;  2OYY A;  4Y2R A;  4ECS A;  4UAW A;  2FLN A;  2QB1 A;  4ZH4 A;  2J6T A;  3JPS A;  3I1Y A;  3LVW A;  4I2A A;  3WK6 A;  2K8B B;  5KG4 A;  3U26 A;  4TQS A;  5DB6 A;  3SAF A;  2XI9 A;  4B9S A;  2HHU A;  4O3M A;  8ICK A;  5KT5 A;  1QSY A;  2JH7 A;  1NK4 A;  3M9M B;  4QWC A;  3BQ2 A;  2ESE A;  5B66 U;  3RJE A;  3QU9 A;  3KOO A;  3HKZ C;  3LVV A;  2RDJ A;  2EDU A;  4QNL A;  5KG5 A;  5AKX A;  3H0L B;  3KFU F;  1DOQ A;  5KAI U;  2KFZ A;  1SIJ A;  5AK4 A;  5ALH A;  4QWE A;  4M04 A;  1L7M A;  5KFN A;  5KFD A;  1SZP A;  3ZDE A;  2LHT A;  5J0Y A;  4UB3 A;  4O3S A;  3NAS A;  4GIB A;  2AJQ A;  1MN8 A;  1V9P A;  2F44 A;  2CXY A;  1ZOL A;  2K4H A;  3EW9 A;  4DFD A;  3PSI A;  5D46 A;  2MSN A;  4FO6 A;  5H2F U;  5K4L A;  2RRD A;  5AIA A;  4BUG A;  3GU3 A;  2V4R A;  1L8L A;  2E1E A;  3CNH A;  3RR8 A;  1Z3E B;  5ALX A;  2OCE A;  2RQ5 A;  1KKX A;  3RJH A;  3QNM A;  4DLG A;  1Y88 A;  3PW0 A;  2A1J B;  7ICL A;  7ICO A;  1SV0 A;  2IBK A;  4IR9 A;  4M9N A;  3TAD C;  4F92 B;  2ZIV B;  4I2B A;  1CRX A;  2AQ4 A;  2OM6 A;  1WCL A;  4UB4 A;  1XS9 D;  3KZI U;  1L3U A;  2AU0 A;  4EZ9 A;  2LYH A;  5FP0 A;  4OJO A;  3JPT A;  1PVR A;  2FDR A;  3UMG A;  1RYS A;  2YY6 A;  4RT3 A;  1S77 D;  1QLN A;  4DLE A;  3H4D A;  1BPE A;  5AKY A;  1L3T A;  4J9K A;  3H8M A;  4B6J A;  5KFV A;  4KLG A;  3PX4 A;  1RYR A;  2NO5 A;  1ZQO A;  1PZN A;  3V7L A;  2NRV A;  7ICV A;  2F8K A;  2WAQ F;  1L3V A;  2OH2 A;  4HYK A;  4QIW C;  4ECU A;  3ZDC A;  4MEX A;  2Y0S F;  4M9J A;  2A1A A;  5EWF A;  3GIM A;  1U48 A;  4O9M A;  4ED6 A;  1FFV A;  2EAM A;  4F4X A;  3L4P A;  4KMO B;  4YD1 A;  3UPQ A;  4MF2 A;  3WK4 A;  4QZF A;  1U49 A;  3I76 A;  5EE0 A;  2XY5 A;  2ZIW A;  8ICZ A;  2GH1 A;  3N4M B;  9ICU A;  5KNI A;  2JV3 A;  4ZOH C;  2ODG A;  1XO0 A;  3N28 A;  5D4B A;  3KTQ A;  5ALE A;  4KLS A;  8ICN A;  5ALZ A;  4MF8 A;  2XVT A;  2KEY A;  1ZQP A;  2XY6 A;  1A6S A;  3M8S A;  5EOZ A;  4QZ9 A;  4FBT A;  1MSW D;  3SV4 A;  3IRU A;  1JUD A;  1ZQE A;  5ALW A;  3RH5 A;  2PKE A;  5ALL A;  5HHI A;  4JV2 A;  2WTF A;  4QZE A;  2IOH A;  5KFR A;  4YQW A;  2YQE A;  3ISD A;  3BZK A;  1U4B A;  1N60 A;  2JZB B;  4JMU A;  3LWM A;  3NVV A;  1X9S A;  4F93 B;  1ZQU A;  2XGQ A;  5KFB A;  1SL1 A;  4NXZ A;  1CUK A;  1X9X A;  5J0U A;  1QSL A;  4DFM A;  1PK3 A;  1KFS A;  2I5H A;  4DSE A;  2PFN A;  4RT2 A;  2BGW A;  4NLC A;  3QUQ A;  4J9O A;  2KP7 A;  2KJ9 A;  3RB0 A;  3M9O B;  5J0S A;  4ECX A;  4C0Z A;  2BCQ A;  5DGA A;  5DDM A;  1N62 A;  3KHR A;  3HWT A;  2W8L A;  3HX0 A;  4IRD A;  1S97 A;  2NV3 A;  7ICT A;  1ZQT A;  1RQL A;  5J0W A;  1QQ6 A;  3IM1 A;  3SQI A;  4Y2Y A;  1NZB A;  3V72 A;  5HHH A;  3JPP A;  4UAY A;  5AK6 A;  1SZH A;  3TFR A;  1FIQ A;  4F5P A;  4GXK A;  1NOM A;  2ZIU B;  1HUZ A;  2R8G A;  3ETR A;  2RP5 A;  4DOC A;  4QWD A;  2EZX A;  4BDP A;  2DPI A;  1HIW A;  3FAH A;  5J0R A;  5J29 A;  4KLE A;  1BGX T;  3NUQ A;  3MGI A;  1LV5 A;  3SI8 A;  3AL0 B;  5AI4 A;  4JV1 A;  2KN7 A;  4CCH A;  2KE7 A;  3KHL A;  9ICI A;  3GV5 B;  2H3F A;  8ICG A;  1LB2 B;  9ICA A;  3AU2 A;  2HI0 A;  1J2M A;  1BVS A;  3AEV A;  1ZD3 A;  5J2H A;  5HNK A;  4Y2Q A;  2Y9U A;  1N48 A;  4KLF A;  2GLE A;  4JV0 A;  4QW9 A;  1X42 A;  1B22 A;  3LWL A;  4F91 B;  3Q8P B;  1ZQY A;  1ZD5 A;  4FE3 A;  4NJ8 A;  3G6X A;  2JEI A;  4ED8 A;  5GTI U;  3KZX A;  4LZD A;  3RB3 A;  3MGV A;  4R63 A;  4I29 A;  3L5K A;  2EZZ A;  9ICM A;  4M6W A;  2WF9 A;  1MQ3 A;  5IIL A;  2ZJ5 A;  2KIW A;  2BQU A;  4QZG A;  4NM1 A;  5ALV A;  1ZJN A;  5AM0 A;  5J2F A;  4KLH A;  1KN5 A;  2YX8 A;  2E5S A;  4EEL A;  4LVS A;  1DK2 A;  4F5R A;  2HHW A;  4YMO A;  5KFM A;  2PFP A;  4DSJ A;  3DDH A;  1JMS A;  5AKZ A;  3HRD D;  5KFX A;  1B4F A;  1IIP A;  3PV8 A;  4DWI A;  2HHS A;  2WF5 A;  2W11 A;  4C4S A;  2FI1 A;  2KIV A;  2WAQ C;  9ICH A;  1V97 A;  4P4P A;  4UQG A;  4F5Q A;  5F9N A;  5AI0 A;  3SEN A;  2Y0S C;  3ICX A;  4F72 A;  3K4G A;  4AYB F;  4ED3 A;  2XCA A;  2HBJ A;  5KT4 A;  4F4Z A;  4Q8F A;  1ZQC A;  1OXJ A;  4IRK A;  1TAQ A;  5AIC A;  3WKD A;  3OGU A;  2W9M A;  4TUR A;  2KJ5 A;  3QYP A;  4RQ8 A;  2BCV A;  5KFZ A;  1L7N A;  4P0P A;  2K89 A;  3NGD A;  1JN3 A;  4C4R A;  4DO9 A;  2J6S A;  3RF9 A;  1NK7 A;  4C7Z A;  2MA1 A;  4EEN A;  1KDH A;  3PMN A;  3RBD A;  5KFE A;  3UXN A;  3IHQ B;  4YFK A;  4RQ6 A;  3QE9 Y;  1ZQI A;  4HAI A;  9ICO A;  1ZQK A;  1V85 A;  5J8Y C;  4BX9 C;  4RQ3 A;  1GO3 F;  2UVU A;  4I2I A;  2KTQ A;  1LKY A;  3ORY A;  4F5O A;  5EE1 A;  8ICC A;  2IMW P;  3UXO A;  2KVS A;  2H3V A;  1RDF A;  3WU2 U;  3AMZ A;  1YT3 A;  2HBL A;  2AGQ A;  2K4I A;  2MUT A;  4M9G A;  1RQN A;  1JXE A;  3DEE A;  4YG2 A;  3NVY A;  3LK9 A;  4J9P A;  1L8O A;  3E58 A;  4KX3 A;  4F2R A;  5HR7 A;  4K4G A;  2ZIW B;  3QU5 A;  2EAO A;  4GFJ A;  5BPC A;  2RLT A;  4PHP A;  2JRZ A;  2BPC A;  1L5U A;  2R8I A;  2KV2 A;  4P4M A;  1ZQQ A;  1ZQL A;  4P0Q A;  2XY7 A;  3M8R A;  4RUA A;  2KVC A;  3Q8R B;  9ICN A;  2HW3 A;  1J2N A;  1DGJ A;  2ZTC A;  2JH1 A;  5DG7 A;  1URJ A;  2H5X A;  3MR3 A;  2EH9 A;  1IM4 A;  7ICJ A;  4I2E A;  4B9M A;  2AGP A;  1UPH A;  4TUQ A;  5L1K A;  4O3R A;  4NM2 A;  5KFT A;  2DL0 A;  1SL2 A;  3GII A;  5HR6 A;  2WF7 A;  3AQF A;  4Y2X A;  3FM9 A;  4NLZ A;  4C80 A;  3AUO A;  5AKK A;  5KG2 A;  4FZL A;  4Y2T A;  4ECZ A;  4UBC A;  4BXO A;  4CE6 A;  1Q46 A;  4ACO A;  1TV9 A;  1QTM A;  3NTU A;  2GO7 A;  2GWS A;  1D9D A;  2VJ5 A;  3H40 A;  5IIJ A;  1WUD A;  9ICS A;  4ELU A;  8ICE A;  4ED1 A;  3V7K A;  4ELV A;  8ICA A;  8ICY A;  1RPL A;  4UAV A;  4U7C A;  2FLL A;  1X2I A;  3AN1 A;  4MEY A;  1Z4N A;  3KHH A;  5JUM A;  1TK5 A;  2FMQ A;  2QAR A;  3JPN A;  5DKW A;  2Y1I A;  3DV9 A;  2W55 A;  4YD2 A;  3TAP A;  4R66 A;  1N56 A;  4I2G A;  3C1Y A;  1SXE A;  1K1Q A;  4KX5 A;  5KTQ A;  1N2X A;  1KFD A;  1S0N A;  4JWM A;  3Q8K A;  8ICI A;  2F3N A;  1COO A;  1T3Q A;  2LM1 A;  5KT2 A;  4F4Y A;  2HVH A;  5KAF U;  2KG5 A;  4DL7 A;  4DL5 A;  5KFG A;  3M1Y A;  9ICB A;  1QQ5 A;  1N61 A;  5G5H A;  5AHX A;  2G0A A;  2Y9T A;  2ALZ A;  4Q44 A;  1NK0 A;  1FFU A;  3F2C A;  1S0V A;  4YR2 A;  2KFN A;  3PW4 A;  2HDO A;  4M9L A;  2VAN A;  3H0M B;  3MAB A;  3MR6 A;  7ICR A;  2IHN A;  2W3S A;  3V6H A;  7ICS A;  1DXS A;  1KEJ A;  9ICE A;  2N1R A;  1TVA A;  4Y2U A;  4X5V A;  2HHV A;  3FDS A;  3GFK B;  4YMM A;  3CYM A;  1S0M A;  5EWG A;  3UXP A;  4C8K A;  1Q3V A;  2RHF A;  1ED1 A;  5KFW A;  4KLU A;  5L9X A;  3OSN A;  7ICN A;  5JU5 A;  3RR7 A;  4RQN A;  3SD7 A;  4UAS A;  4BJQ A;  3RAQ A;  3TAQ A;  4F8R A;  2BHN A;  7ICP A;  1ECW A;  1XU4 A;  1N63 A;  1J97 A;  2BCS A;  1A76 A;  4UB2 A;  2EAN A;  4CRX A;  4US8 A;  2W7P A;  2KHQ A;  3PO4 A;  1JAL A;  3QEB Z;  1WYG A;  3SEI A;  5KFA A;  1D8Y A;  4XUS A;  1JRO A;  1ARO P;  3MDC A;  4AYB C;  1SKR A;  1S8O A;  3T5J A;  3HW8 A;  4DSI A;  1TAU A;  3C29 A;  3OSP A;  1S9F A;  4RQ4 A;  4ED7 A;  5L1L A;  2DKZ A;  9ICW A;  3L3F X;  4M6W B;  1ZQG A;  4QJF B;  1MC8 A;  2KSO A;  4AP9 A;  3GIK A;  2QKQ A;  1ZYQ A;  4PH5 A;  4Y2P A;  1CI4 A;  2W54 A;  5TIS U;  4ECQ A;  5DBC A;  4B9L A;  3QX7 A;  5DLG A;  3HPO A;  2EAP A;  4IQU A;  4R8U A;  5HMM A;  4IL6 U;  5J0P A;  4F4K A;  3BS7 A;  3GDX A;  4YCX A;  5CJ7 A;  1YZ6 A;  3TAC B;  3SR6 A;  2D6F C;  8ICJ A;  2E8P A;  4GC6 A;  4CDG A;  3CP8 A;  3G6Y A;  4YN4 A;  2XO7 A;  2YMM A;  5IIN A;  5J2I A;  1OUQ A;  1UHU A;  1RXV A;  2GOL A;  1KSP A;  4M9H A;  5CEH A;  4P0P B;  5J2E A;  5DQG A;  4F3O A;  2LYA A;  2AGO A;  5BOM A;  1ZET A;  2F76 X;  1L7P A;  1PVQ A;  1ZXI A;  4ECW A;  5KG6 A;  3O0F A;  2RDI A;  3I28 A;  1LKY B;  3HT3 A;  1RXW A;  1IG6 A;  4QZA A;  4F71 A;  3HIL A;  2QLT A;  3D6J A;  4MHV A;  3KBB A;  3WKC A;  1ZD4 A;  2E8M A;  2I6X A;  4O3P A;  2MUT B;  4EX7 A;  3PW7 A;  2L5Y A;  7ICE A;  4B9V A;  1XWL A;  1X66 A;  3KKA C;  5JTI A;  3UMB A;  2Z7J A;  3H4B A;  2KJ8 A;  1BPZ A;  4YR3 A;  3PW5 A;  9ICQ A;  4C8M A;  4QW8 A;  3BZC A;  4G9B A;  4P0Q B;  2OHF A;  4Y2J A;  2ZJA A;  2D3D A;  3QEA Z;  2VA8 A;  4RU9 A;  5DG9 A;  2A19 A;  2FMP A;  4K4H A;  1X9W A;  4I2F A;  2P6R A;  1JRP A; 
#chains in the Genus database with same CATH homology
 1DXS A;  4NL9 C;  3SEN A;  2DL0 A;  1SV4 A;  2YTU A;  1SXD A;  3TAD A;  2LPE A;  1RG6 A;  1SV0 A;  2KE7 A;  2DKX A;  2E8O A;  5J8Y A;  1SGG A;  3TAD C;  1OXJ A;  5JU5 A;  1PK1 B;  3K1R B;  2D8C A;  2KMD A;  4RQM A;  4RQN A;  4PZO A;  2QB1 A;  1PK1 A;  1COK A;  2K4P A;  2Y9U A;  2E8N A;  2ES6 A;  1F0M A;  3KKA A;  2ESE A;  2EAN A;  2GLE A;  3BQ7 A;  4PZN A;  1X9X A;  1X40 A;  1SV0 C;  1LKY B;  1V85 A;  5J8Y C;  3H8M A;  3SEI A;  2LMR A;  1PK3 A;  2FE9 A;  1LKY A;  4NJ8 A;  1UQV A;  3HIL A;  4MHV A;  2F8K A;  2QAR A;  1KW4 A;  5L1M A;  2E8M A;  1JI7 A;  3BS5 B;  1WWU A;  2DKZ A;  2KSO B;  3BS5 A;  2L5Y A;  1SXE A;  2K60 A;  2KSO A;  5F3X B;  1X66 A;  2F3N A;  3KKA C;  5JTI A;  1Z1V A;  2EAM A;  2KG5 A;  2QKQ A;  1B0X A;  3IDW A;  2QAR B;  4IS7 A;  2EAO A;  1WWV A;  2F44 A;  1UCV A;  2EAP A;  2Y9T A;  5KNI A;  2JV3 A;  2B6G A;  2D3D A;  2QB0 B;  3BS7 A;  1B4F A;  5JRT A;  1OW5 A;  2QB0 A;  2KIV A;  3TAC B;  1V38 A;  2E8P A;  4NL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...