2FE9A

Solution structure of the vts1 sam domain in the presence of rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
SNSSMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Vts1 SAM Domain in the Presence of RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords Protein VTS1
total genus 20
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2fe9A00
2KE7A 3KKAA 1SV0C 2DKXA 5JTIA 1PK1B 4PZOA 1RG6A 1WWUA 2L5YA 2QARB 4PZNA 2ESEA 3K1RB 3BS5A 1SXEA 2EAPA 2KSOA 5L1MA 3SEIA 4RQMA 1B4FA 5J8YC 1UCVA 2E8PA 2E8MA 1LKYA 5J8YA 1WWVA 2KSOB 4MHVA 2DKZA 1X40A 2ES6A 2QARA 1Z1VA 1DXSA 2EANA 5KNIA 1X9XA 2F8KA 1SGGA 1V85A 4RQNA 1SV4A 1B0XA 1V38A 2F44A 1SV0A 2KMDA 2E8OA 3TADA 1JI7A 1X66A 3H8MA 1LKYB 1UQVA 2KIVA 2YTUA 3BS5B 1SXDA 2QB1A 2QB0B 2D8CA 2GLEA 2FE9A 2JV3A 1PK3A 3BS7A 2D3DA 2LPEA 4IS7A 3TACB 4NL9A 2QB0A 5F3XB 3BQ7A 2QKQA 2LMRA 2E8NA 2EAOA 1KW4A 1F0MA 2DL0A 5JRTA 2K4PA 2KG5A 1PK1A 2Y9TA 2Y9UA 2K60A 1OXJA 1COKA 3HILA 4NL9C 2B6GA 2EAMA 3KKAC 4NJ8A 2F3NA 5JU5A 3SENA 3IDWA 1OW5A 3TADC
chains in the Genus database with same CATH superfamily
1V9PA 2KVSA 3L3FX 1SV0C 5J0PA 3UQ0A 3GV8B 1NJWA 4YFKA 3OGUA 2OXOA 7ICIA 4AP9A 2EZYA 5ALIA 3L4PA 1NJYA 1L3UA 2C2RA 2FLPA 1JIHA 1N62A 4RUCA 4PHDA 4KLMA 4M6WB 2W3RA 3M9MB 4X5VA 2R8JA 2E8PA 2WB1C 7ICKA 1RPLA 4PGXA 1L3VA 5DB9A 4YD2A 1ZQRA 1QH9A 2F1JA 2W9AA 2HHVA 4BXOB 9ICMA 1X6JA 1SIJA 4U6PA 3RJFA 3HX0A 3ISBA 3Q8SB 2I5HA 3KFUF 1X66A 4ECXA 1L7MA 3ETRA 3QU4A 9ICWA 1ZD3A 9ICVA 1DK3A 2XCPA 3JPTA 3SV4A 4C8NA 4YD1A 4I2IA 5CP2A 4ELVA 1X9MA 2JHDA 4FFDA 2QB0B 3J81j 2EDUA 1NK0A 1UT5A 9ICKA 5J2JA 3T5HA 2CRXA 4O5CA 1XSLA 2ZXIA 2UVUA 4TQSA 3TFRA 3HW8A 3PX4A 1KDHA 3V6KA 5KFLA 2H5XA 3QU9A 5DDYA 2HW3A 2LM1A 1IXRA 3HJEA 2FMPA 2NRVA 3VCBA 3HKZF 4KMOB 3BDPA 3RAXA 4ELUA 5D49A 2HSZA 1GO3F 4QZCA 5KT5A 4QZEA 4J9PA 2Y0SF 1OW5A 5AIAA 1L8OA 2ISOA 3G6VA 1ZD5A 2JR5A 3HT3A 2D6FC 3TI0A 1U47A 5DB8A 4Q45A 5KFBA 3HKZC 2DGZA 1S9FA 3ZD8A 1TAQA 4O0IA 3PV8A 4KLLA 3SR6A 3GU3A 3ICXA 5L1MA 1F5SA 4KLHA 4HYKA 1UHUA 2W9CA 1TK0A 1IV8A 1X40A 2ES6A 3I1YA 4YCXA 1RXVA 4Y2SA 1B0XA 1V38A 4UBBA 4XQ8A 9ICUA 4BX9C 3CRXA 5AK3A 2F8LA 4PJ0U 1PUZA 4K4GA 4ZH4A 1QSSA 3F5AA 5DG7A 4EEKA 2W9BB 4CGZA 4CRXA 5KFCA 1RZTA 4I29A 1QQ5A 3U26A 2ZTCA 2HBJA 1TVAA 4B9SA 1ZQMA 4I2EA 4Y2RA 3C21A 2ISPA 2A1JA 3N7RC 5ALSA 5KT2A 3RJJA 4NLZA 3A0BU 4J9OA 3JPPA 4KLQA 4DSFA 3C29A 1NZPA 1S0MA 2BPCA 3AEVA 2K4PA 4JWNA 1ZQFA 1SKWA 3AMZA 3Q8KA 3V72A 4EBCA 4G9BA 4O3SA 4NL9C 2G5HB 4P4MA 5EOZA 2VJ4A 1KTQA 3H0LB 1NNLA 1NK7A 2R18A 4OJPA 4OJOA 1Z1BA 4DL7A 2HBKA 5J2KA 2QARB 1H38A 5ALXA 3NRZA 5KFMA 2AGQA 2GH1A 4RQMA 1A6SA 4RPYA 2XY7A 5J8YA 4Y2PA 1RYSA 3TAPA 3FAHA 3THVA 2K4EA 1Z1VA 1L7OA 2B21A 4DWIA 1X9SA 2KJ8A 1SZPA 1A77A 2KV2A 4GIBA 2ASLA 4B9NA 4PH5A 5L1KA 1ZQWA 3MABA 2XGQA 2XIDA 3N7PD 1DRGA 2W03A 3WKBA 4Y2VA 5J0TA 2IHNA 1UQVA 2F76X 3LDAA 4AYBC 5EE1A 3H40A 4DOBA 1SXDA 4QZHA 4OJLA 2AGPA 1ZQYA 3QUTA 2EZXA 2RHFA 5AM4A 1DOQA 1CRXA 2K8AA 3H4BA 1SWWA 4CE6A 4QWCA 1ZQVA 4DSIA 2HMXA 3AN1A 1X42A 2K8BB 4PPXA 4QZ8A 2IOFK 5EWFA 4MF2A 1S97A 4DO9A 3RJEA 1WCLA 8ICMA 2MUTB 2K60A 2JEGA 5GTHU 2KEYA 3HILA 2KJ5A 1UPHA 4Y2TA 3OJUA 5ALKA 4UB4A 5KG4A 2MU2A 2E3TA 9ICIA 2ZJAA 5KTQA 2FPLA 4RT2A 3MR3A 4NM2A 3PSTA 4C8LA 1M6YA 4CNQA 2NRZA 3GILA 2BQRA 1S77D 8ICKA 1BPEA 4FZLA 3M6ZA 1A76A 5DGAA 4Y2UA 2O6KA 4F5RA 3KBBA 1U45A 3OHBA 1WCNA 2DKZA 8ICPA 4OD0A 5AKZA 3JPSA 2FPMA 2LYBA 2EANA 5KFYA 2JEJA 4YN4A 8ICVA 1TKDA 3RJGA 4NLBA 2W55A 3MGHA 4NXZA 4EENA 5KG7A 4DCCA 1A0PA 2W7OA 3QX7A 4PHPA 2LYAA 2DQNB 3FDSA 4Q8FA 2XICA 2VANA 3H8MA 2ZIXA 2KHQA 2NRTA 3NVZA 5J2EA 4E0DA 4HAIA 3MFIA 3V7LA 1FEZA 2UVWA 2F2AB 4AYBF 1UA0A 3TANA 2C22A 4F5PA 2XY5A 4GXKA 4I2BA 2WAQC 1MQ3A 1YZ7A 4RU9A 3CW2C 8ICUA 1MA7A 8ICGA 1ZETA 1YZ6A 4FS1A 3E2EA 3EPGA 2YQEA 5F3XB 3EWAA 2DBYA 1JUDA 1ZQKA 9ICLA 1L5UA 5KG0A 1T7PA 4M2YA 1B43A 1BVSA 1T8EA 4QZAA 4B9VA 4DQQA 2AQ4A 4UB3A 4QZBA 4F4ZA 1SL0A 1KKXA 4PHAA 3UPQA 1T94A 2W9CB 9ICOA 4UATA 4PZOA 4P4OA 9ICJA 2NRWA 4PZNA 2YMQA 1D9DA 4KLFA 4IR9A 1L3TA 1TAMA 2UVVA 4GXIA 4FS2A 1KSPA 2R8KA 4Z6CA 4YVZA 4QWAA 4B9MA 4F3OA 7ICEA 2A3VA 2ZIWA 2JEFA 1TK5A 2YMPA 5KFWA 1Q8KA 3KZIU 3SAFA 3QU2A 3IHQB 5J2FA 5AKGA 3T79A 9ICRA 1X6IA 3JPNA 4KLEA 1BNPA 1JI7A 4EEYA 4BXOA 1SKRA 2BGWA 3NVVA 2FMSA 2KIVA 1NJZA 1RYUA 5ALQA 1ZQJA 2HOIA 3JPOA 3C28A 5J0OA 3QU5A 5K4LA 1N60A 2PKEA 4NLCA 5KFNA 3JPRA 3HP6A 5AI6A 2YMMA 4TQRA 8ICJA 2KN7A 2OWOA 1DK2A 2QB0A 2EH9A 2ZG6A 2XI9A 3F5EA 1F0MA 1L7NA 4UB8U 2DPIA 4F8RA 1NKCA 4TUPA 2RDIA 9ICPA 2G07A 1ZQAA 1BPBA 3C23A 3T5KA 2JRZA 1MC8A 4RPZA 1SL1A 2V4RA 2HHQA 7ICOA 2N1RA 4QJFB 4I2AA 3ISDA 7ICQA 1Z00A 4ECZA 8ICNA 2DF4B 3QE9Y 1NOMA 3B0XA 5JUMA 3KTQA 1KN5A 3KKAA 2DKXA 4C80A 4IRKA 4DFPA 5J0QA 3KHLA 5DDMA 1WG8A 1K1QA 3K1RB 1SXEA 2DUYA 5AI8A 3HWTA 4B9TA 1ZQSA 4NV0A 4F72A 5B5EU 4DLEA 5KFIA 3T5LA 4US9A 4RQ6A 1XC9A 4UAVA 1SGGA 2K89A 5H2FU 5KFRA 3F53A 5AKLA 1WUDA 7ICMA 4DQPA 5CHGA 2HOQA 4BJQA 3OPXA 4EBDA 2E8OA 9ICGA 4G3IA 1NI3A 3FC4A 1FO4A 3LYSA 4LZDA 2KKPA 4F4YA 1ZYQA 3WKAA 9ICFA 4J9NA 4B6JA 2WF6A 1PK3A 5DBCA 4UAWA 3TACB 3PZPA 2OCEA 4ZOHC 4NLGA 3LWMA 4IL6U 3N4MB 1ZD4A 4FZMA 4DSKA 5KFAA 4UQGA 5AM5A 5KG2A 4YMOA 5DBBA 4QW9A 3PSIA 4UB2A 5IIJA 2WTFA 4PGQA 2DWQA 1OXJA 1COKA 4QWEA 3UQ2A 1VDVA 4F4XA 1LVHA 4F71A 1L3SA 4P0QA 5JU5A 2ZUCA 1KFDA 1NK6A 3KHGA 3BZKA 3SAGA 3IG5A 4KLIA 5KFJA 3WK6A 5AKHA 4UW9A 2QLTA 2PI4A 2OEHA 5ALRA 2BQ3A 4TUQA 2LI6A 2Z7JA 5CR0A 4KTQA 2KJ9A 3AUOA 1TE2A 3ZDCA 4DL2A 4ED8A 2E8MA 4Z6EA 4M47A 3QUQA 3PO4A 1ZQGA 2HHXA 2PMZF 4RQ3A 2BCQA 4UASA 5DG8A 2F77X 3BQTA 1ZQLA 2JZBA 2YN4A 4ECSA 3SI8A 2H3FA 3IP4B 4ICAA 4J9KA 3SQIA 2HI0A 2BQUA 4UAYA 2KMDA 4LJXA 3QEBZ 2W11A 2BCUA 3PR5B 3B0YA 4XA5A 1JRPA 1S0VA 1X2IA 3WK9A 5ALHA 5G5HA 2LM4A 5KFDA 3C2KA 1RDFA 8ICFA 2NO4A 2V9WA 2B0CA 2D8CA 3QUCA 4Q44A 4O3QA 2ZIUB 2WF8A 2JEIA 2KNJA 4JWMA 1LV5A 4M9JA 2XC9A 5F9LA 5L1JA 4NL9A 2R8GA 4ECYA 4CF3A 4EYHB 4I2GA 4NLKA 2EAOA 5TISU 3WKDA 4RUAA 4KITB 4GFJA 1HJPA 3PO5A 5JRTA 4I2JA 2OM6A 3PMNA 3MDCA 3M7DA 4R64A 3QYPA 3E58A 2ALZA 4C8KA 1UT8A 3RFAA 1AQ6A 2H3IA 8ICIA 3PR4A 5ALGA 5DQIA 4IQVA 7ICLA 2KZZA 5ALUA 3UM9A 4IQUA 3N28A 2BHNA 1Q3UA 1PK1B 4EYIB 4F4WA 2I6XA 4ECWA 4QZ9A 2CXYA 5DQHA 3N97B 3CYMA 5DGBA 2FLNA 2BCVA 4ED2A 2MAXA 3C5GA 2VA8A 4FO6A 4R66A 2NV3A 5KFFA 1UCVA 4ACOA 4R65A 1TFRA 1CI4A 2VJ5A 3H8WA 2KZ3A 3UXNA 5AM2A 4LVSA 2ATLA 3H0RB 3RJIA 5KL1B 3ZDDA 5AKJA 2FPKA 9ICQA 1FFUA 4P4PA 3RH6A 2KKVA 1SV4A 2GO7A 3TFSA 3VC8A 4ED6A 4UAUA 3PW7A 5EWGA 1L7PA 5AKIA 2XCAA 5AI4A 5ALWA 2HVIA 3ZI4A 1URJA 9ICSA 3KHHA 3HPOA 3WK4A 1YT3A 3OSNA 4DS4A 8ICQA 1SWVA 1N5WA 2GLEA 2ZUDA 4YP3A 5E79U 2WFAA 4TUSA 2HVHA 4MEYA 4IQWA 3M8SA 4IRCA 3QU7A 1Z19A 3ZDBA 3GIIA 4KN7A 3Q8LA 2DL0A 2ZUBA 1QQ7A 4ECTA 1D8YA 4C8MA 1UA1A 4MF8A 1S0NA 1AROP 2A1AA 2JXJA 4GXJA 4KMUA 3D6JA 3MR5A 3C1ZA 2KD1A 3KOOA 5J29A 5ALPA 2FLLA 2C2DA 2ZTEA 3UXOA 1N61A 5AK5A 5KFVA 3IV6A 1Z4NA 3C5FA 3KZXA 8ICWA 2KE7A 3IRUA 1V97A 4F92B 1ZJMA 1WYGA 7ICPA 3RBEA 1ZQTA 1DGSA 2ASDA 5HMMA 3HRDD 5CWRA 4MFAA 3OJSA 1SKSA 2LBOA 3H7IA 1B4FA 4JV2A 8ICSA 5J2IA 1WWVA 4MHVA 4KLUA 3TARA 3H0MB 1X9XA 5KNIA 1N56A 5J0SA 5KFHA 3ZDAA 2G08A 3RB6A 3G6XA 3EYZA 1HUOA 3TADA 2WB1F 1SB3C 2J6UA 3K1ZA 3QZ7A 2YB1A 5KL8B 3F2BA 1QSLA 4NM1A 1ZXIA 2W7PA 4M04A 3RB3A 4DS5A 4BUGA 1Z3EB 5AK4A 5DB7A 3AM9A 4QZIA 3NRWA 5BOLA 2JMGA 2V4QA 4DSEA 4YXMA 3NASA 1D8BA 5HMLA 5KFPA 2LYHA 1HUZA 4RZRA 3BQ7A 2QKQA 2I1QA 1S0OA 2LMRA 2E8NA 3UMGA 1U49A 9ICAA 3BQ1A 2YY6A 1BPXA 4RQ0A 2IA6A 1HIWA 2AGOA 1PK1A 4UB1A 4NLNA 3ISCA 1S10A 2R8HA 2A1JB 5J2HA 2RQ5A 2PXIA 2RRDA 5AM3A 2Q4TA 4DF4A 4FBUA 5KT7A 3AL0B 4UAZA 2GWSA 2ZJ8A 2H3QA 1FFVA 3L5KA 3LVVA 4DFDA 1O08A 3QUBA 2DFLA 1XS9D 1S5LU 2J6SA 4P0PA 3Q8PB 2P6RA 4F5QA 4PHEA 5J2BA 1WWUA 4O3NA 5IIIA 1ED1A 2KK0A 4NWIA 4NY8A 3F2CA 4ED0A 1NKBA 3TQ1A 5DG9A 4ELTA 3N7SC 1PZNA 3RRHA 2KZMA 3H8JA 5CB1A 3CP8A 2IBKA 3LK9A 3T3FA 1DXSA 2H3ZA 1D9FA 3R9KA 9ICCA 4USAA 1COOA 4YXJA 4F50A 4DL3A 4DLGA 5CJ7A 5KT3A 4FE3A 4UARA 1ECWA 3K75D 1LKYB 2JH7A 4P0PB 3GFKB 8ICEA 3PW0A 1QSYA 3SAHA 4YQWA 4DFJA 5J2CA 3I28A 2G09A 2QB1A 4OCZA 4DQIA 3BQ2A 3O0FA 5KG6A 5HP4A 3NGDA 5J2AA 4M9GA 3RH4A 4KLGA 1EXNA 2J6TA 4DL6A 8ICYA 2FI1A 5J0RA 5BPCA 2Y1JA 2AU0A 5G5GA 3WK5A 5CRXA 3DEEA 2F1HA 1BPYA 1XO1A 5D4BA 4MFCA 4J9RA 9ICTA 1SZHA 3EUB2 2W54A 1XSNA 1JMSA 4WJ3B 2K4IA 5IILA 1J97A 3IDWA 4B9UA 3UMCA 1QLNA 8ICAA 2ZIWB 4BWJA 3WU2U 4DOAA 4M9NA 2WF9A 4C0ZA 3MC1A 1S76D 4C7ZA 2KOBA 4JMUA 4RNOA 5ALZA 1IIPA 3FM9A 1N63A 5J8YC 3RTVA 2G0AA 4YMMA 5IIMA 2PMZC 1J2MA 5BOMA 5AHXA 5DLGA 2G5IB 2XO7A 1CEZA 3M9OB 9ICBA 1MQ2A 2VKQA 1BGXT 3OHAA 3LVWA 7ICGA 1B22A 3RJKA 5ALMA 2KIWA 1ZQDA 3SYZA 4B9LA 5FP0A 5ALLA 4GLXA 4OO1J 4FBTA 5ALEA 5EE9A 3GDXA 5AM1A 3K4GA 5KT4A 4O3PA 3NTUA 3M8RA 2HBLA 3D2NA 4Y2YA 5KFUA 8ICCA 2ZIVB 3G6YA 4JK1A 5AKXA 3IN5A 1JX4A 1RYRA 1Z4OA 5AI5A 3WK7A 1KW4A 1ZRMA 2YX8A 2C28A 2ZIUA 4GC6A 5EE0A 2BDPA 1D8LA 4RQ5A 4C4SA 1C20A 3CNHA 3S6JA 3NS1A 2IHMA 4DEZA 3PW2A 2AH5A 3GQCA 1J2NA 8ICZA 3AU2A 4ECUA 4NJ8A 5L9XA 2KHVA 4IRDA 4EX7A 4R8UB 1S8OA 1TAUA 5CEHA 1ZQZA 4F5OA 3TKAA 4YR0A 2RP5A 4DQRA 2ESEA 2PI5A 4QNLA 1ZQXA 3H8SA 4ED7A 5HR7A 4DL5A 3BZCA 4F93B 2KTQA 2E5SA 1XNSA 4IR1A 4I2CA 1BPZA 3NVWA 5D46A 1K5OA 4XUSA 3SD7A 4O3RA 2W8KA 2EQYA 4Q43A 4M9LA 2AHOB 1SL2A 1HEKA 4J9LA 4JUZA 4JV1A 2JGAA 1RQLA 5B66U 4Z6DA 3MDAA 3QZ8A 4C7YA 5KFKA 5KFOA 5KFEA 4ECVA 1F44A 4I27A 4RNNA 4DQSA 1RQNA 5KFGA 1Y88A 4F2SA 3E0FA 3WKCA 2LPEA 4FZNA 2KP7A 3SZ2A 1Z00B 4IC9A 2R8IA 3I76A 3RR7A 3ONNA 2M9NA 2IOHA 2W9MA 3EW9A 4C8OA 1JROA 2NRXA 2XGPA 1Q3VA 3QEAZ 1PVQA 2I9GA 5ALOA 2HHSA 1KRPA 3AQEA 4RQ2A 4C4TA 3KD3A 5GTIU 3MGIA 4I2FA 4F91B 2HDOA 3SENA 4P2HA 2AQ0A 2HCFA 4RPXA 1N48A 2M0NA 1U9LA 3MBYA 5J0YA 3BS5A 2W8LA 2KSOA 1NK9A 5EE3A 2LKYA 4PL2A 3RJHA 4EZ6A 4PGYA 2ASJA 3IG8A 2WHEA 4UB6U 2Y1IA 1KLNA 2RLTA 3T5JA 5AM0A 5J0XA 4YR3A 3M9NB 4KLDA 4DFKA 1SV0A 5J0UA 4O5EA 1T3QA 3LWLA 3RAQA 3NVYA 4J9SA 5KG1A 2ZIVA 8ICBA 4J9MA 2PFQA 3BS5B 2W9BA 2PFOA 5AIBA 4K4IA 4O9MA 5KFSA 4LZGA 4OJ6A 4C4RA 5J0WA 2AJQA 3BQ0A 5TZVA 5ALJA 1U4BA 1RM6C 2ZIXB 3AU6A 5DQGA 4MEXA 2IOFA 4RQ1A 2E1EA 1IG6A 1KQQA 3Q8QB 2KG5A 4Y2JA 2VIXA 3IM1A 2Y9TA 2OYYA 2VA3A 1TV9A 5AKKA 3GZFA 2JH1A 2F1IA 7ICHA 4ED1A 4DF8A 4MFFA 3SMVA 4QWBA 2XY6A 1ZQUA 2KFZA 2CPRA 5EWEA 2PFPA 1MN8A 4OJ5A 2MUTA 4I2DA 3PMLA 4EX6A 2F3NA 1VLBA 4U7CA 1XSPA 4KX3A 5AK6A 2CN1A 2A19A 4A8EA 4XRHA 3F2DA 4KLOA 4KLJA 7ICTA 5A0LA 5JTIA 4F4KA 4DFMA 1RG6A 2P6UA 4IQTA 3TAQA 4Y2XA 2L5YA 3PNCA 2UVRA 3WK8A 9ICHA 5DBAA 1ZRNA 3M1YA 4I2HA 4RQ4A 3RH5A 5C0YA 8ICRA 3ETLA 3AQFA 2IMWP 2KSOB 8ICXA 1JN3A 1N2XA 2QARA 2MA1A 3RF9A 2F8KA 4Q8EA 1V85A 5DB6A 1L6NA 4RQNA 2PFNA 1KBUA 4F5NA 2BPGA 3H4DA 2HBMA 2F44A 1LB2B 1QCKA 3ED5A 3EZ5A 3RBDA 3ZD9A 2NYVA 1NK4A 2Q0ZX 1ZQPA 4KLSA 3KHRA 1QQ6A 3QXGA 3BJYA 3RRGA 4Z6FA 2GOLA 3ORYA 1U48A 5J2GA 4RQ8A 4QZDA 4QWDA 3PW5A 4PL1A 3DDHA 1ZJNA 4K4HA 5AKYA 8ICOA 1PVPA 1ZQBA 5ALTA 3EPIA 4R63A 3MGVA 4Y2QA 5KFQA 1NK5A 2KVCA 5ALYA 2KICA 1NJXA 9ICXA 2EZZA 3RR8A 4EBEA 2D3DA 1ZD2P 2YMLA 2XVTA 4M0AA 4DOCA 1ZQEA 2ZJ5A 3B9JA 4JB3A 2G06A 3V7KA 3V7JA 1XWLA 1BPDA 3GIKA 4J9QA 5HHIA 1RXWA 2OH2A 2NO5A 1P7DA 5DLFA 3RB0A 2ODGA 2DPJA 4BGDA 2EAMA 2B6GA 1OUQA 1O03A 8ICTA 9ICEA 3DV9A 2BZFA 3TADC 4P0QB 4US8A 3MR6A 5KFTA 3GV7B 2BCRA 5ALDA 3PX6A 1IM4A 3UMBA 2EAPA 4YR2A 3FYHA 1PVRA 3SEIA 1ZQNA 3UXPA 7ICNA 5DKWA 2RDJA 1C7YA 4EELA 3MFHA 3QNMA 3C2MA 5KAFU 5KFZA 2FJ6A 5AI9A 4JV0A 2K8CB 2ZXHA 4QIWF 1NK8A 3D2QA 1X9WA 4DSLA 2W43A 3C2LA 1CUKA 4R8UA 7ICVA 1XU4A 4QW8A 4CDGA 3NUQA 4KLTA 2P66A 4DSJA 3OTQA 4O5KA 2JZBB 7ICFA 2VA2A 3PSPA 2K4HA 2HOFA 2H3VA 3WKEA 5ALVA 5KAIU 1FIQA 1ZQQA 2C2EA 5HHHA 5HNKA 2HHUA 2BCSA 1T4GA 2FE9A 2JV3A 3BS7A 1N5XA 4RT3A 1ZOLA 4EZ9A 3Q8RB 2W04A 7ICJA 4IS7A 8ICHA 1ZQCA 5IIOA 1ZQIA 5C5JA 2BR0A 4J03A 1KL9A 1ZQOA 4CF5A 2Y0SC 1NZBA 4O3OA 5CA7A 1ZQHA 2E1FA 2BPFA 2Y9UA 5KT6A 7ICRA 4I28A 5KG3A 2P35A 2BDUA 1JALA 9ICNA 3PVXA 8ICLA 5L1IA 2ZTDA 2WF5A 2MSNA 4CF4A 3PX0A 1QTMA 4F2RA 2HHTA 1VJ5A 1T3NA 4DL4A 5J2DA 1JXLA 3OSPA 1KFSA 4QIWC 4KN4A 3PY8A 4ECRA 2KFNA 1KEJA 4KX5A 3D2SA 2WF7A 3V6JA 3ALRA 2BKEA 3JPQA 4M6WA 1LKYA 3A0HU 3RB4A 3MR2A 5AICA 1ZQ1C 3PW4A 5IINA 4ED3A 1Q46A 1K1SA 3GV5B 4QZGA 2LHTA 5KFXA 4O3MA 4CCHA 3GIMA 5IIKA 1XO0A 4QZFA 2YTUA 5ALFA 1JXEA 5ALNA 1TK8A 1L8LA 2WAQF 5AKEA 1NKEA 2YB4A 4BDPA 1DGJA 2MRLA 7ICSA 4YG2A 3M6KA 4UBCA 3ZDEA 5L1LA 5KG5A 2AXTU 4TURA 3PSFA 5HR6A 4RQ7A 1MSWD 4GC7A 5F9NA 3V6HA 7ICUA 2OHFA 4UB5A 3SV3A 1KFTA 3GIJA 5AI0A 5T14A 4RNMA 1BNOA 3Q8MA 2FMQA 3C1YA 2FDRA 4M9HA 4BWMA 4YMNA 3KKAC 2W3SA 2HHWA 4ECQA
chains in the Genus database with same CATH topology
2KE7A 3KKAA 1SV0C 2DKXA 5JTIA 1PK1B 4PZOA 1RG6A 1WWUA 2L5YA 2QARB 4PZNA 2ESEA 3K1RB 3BS5A 1SXEA 2EAPA 2KSOA 5L1MA 3SEIA 4RQMA 1B4FA 5J8YC 1UCVA 2E8PA 2E8MA 1LKYA 5J8YA 1WWVA 2KSOB 4MHVA 2DKZA 1X40A 2ES6A 2QARA 1Z1VA 1DXSA 2EANA 5KNIA 1X9XA 2F8KA 1SGGA 1V85A 4RQNA 1SV4A 1B0XA 1V38A 2F44A 1SV0A 2KMDA 2E8OA 3TADA 1JI7A 1X66A 3H8MA 1LKYB 1UQVA 2KIVA 2YTUA 3BS5B 1SXDA 2QB1A 2QB0B 2D8CA 2GLEA 2FE9A 2JV3A 1PK3A 3BS7A 2D3DA 2LPEA 4IS7A 3TACB 4NL9A 2QB0A 5F3XB 3BQ7A 2QKQA 2LMRA 2E8NA 2EAOA 1KW4A 1F0MA 2DL0A 5JRTA 2K4PA 2KG5A 1PK1A 2Y9TA 2Y9UA 2K60A 1OXJA 1COKA 3HILA 4NL9C 2B6GA 2EAMA 3KKAC 4NJ8A 2F3NA 5JU5A 3SENA 3IDWA 1OW5A 3TADC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE7 A;  3KKA A;  1SV0 C;  2DKX A;  5JTI A;  1PK1 B;  4PZO A;  1RG6 A;  1WWU A;  2L5Y A;  2QAR B;  4PZN A;  2ESE A;  3K1R B;  3BS5 A;  1SXE A;  2EAP A;  2KSO A;  5L1M A;  3SEI A;  4RQM A;  1B4F A;  5J8Y C;  1UCV A;  2E8P A;  2E8M A;  1LKY A;  5J8Y A;  1WWV A;  2KSO B;  4MHV A;  2DKZ A;  1X40 A;  2ES6 A;  2QAR A;  1Z1V A;  1DXS A;  2EAN A;  5KNI A;  1X9X A;  2F8K A;  1SGG A;  1V85 A;  4RQN A;  1SV4 A;  1B0X A;  1V38 A;  2F44 A;  1SV0 A;  2KMD A;  2E8O A;  3TAD A;  1JI7 A;  1X66 A;  3H8M A;  1LKY B;  1UQV A;  2KIV A;  2YTU A;  3BS5 B;  1SXD A;  2QB1 A;  2QB0 B;  2D8C A;  2GLE A;  2FE9 A;  2JV3 A;  1PK3 A;  3BS7 A;  2D3D A;  2LPE A;  4IS7 A;  3TAC B;  4NL9 A;  2QB0 A;  5F3X B;  3BQ7 A;  2QKQ A;  2LMR A;  2E8N A;  2EAO A;  1KW4 A;  1F0M A;  2DL0 A;  5JRT A;  2K4P A;  2KG5 A;  1PK1 A;  2Y9T A;  2Y9U A;  2K60 A;  1OXJ A;  1COK A;  3HIL A;  4NL9 C;  2B6G A;  2EAM A;  3KKA C;  4NJ8 A;  2F3N A;  5JU5 A;  3SEN A;  3IDW A;  1OW5 A;  3TAD C; 
#chains in the Genus database with same CATH topology
 1V9P A;  2KVS A;  3L3F X;  1SV0 C;  5J0P A;  3UQ0 A;  3GV8 B;  1NJW A;  4YFK A;  3OGU A;  2OXO A;  7ICI A;  4AP9 A;  2EZY A;  5ALI A;  3L4P A;  1NJY A;  1L3U A;  2C2R A;  2FLP A;  1JIH A;  1N62 A;  4RUC A;  4PHD A;  4KLM A;  4M6W B;  2W3R A;  3M9M B;  4X5V A;  2R8J A;  2E8P A;  2WB1 C;  7ICK A;  1RPL A;  4PGX A;  1L3V A;  5DB9 A;  4YD2 A;  1ZQR A;  1QH9 A;  2F1J A;  2W9A A;  2HHV A;  4BXO B;  9ICM A;  1X6J A;  1SIJ A;  4U6P A;  3RJF A;  3HX0 A;  3ISB A;  3Q8S B;  2I5H A;  3KFU F;  1X66 A;  4ECX A;  1L7M A;  3ETR A;  3QU4 A;  9ICW A;  1ZD3 A;  9ICV A;  1DK3 A;  2XCP A;  3JPT A;  3SV4 A;  4C8N A;  4YD1 A;  4I2I A;  5CP2 A;  4ELV A;  1X9M A;  2JHD A;  4FFD A;  2QB0 B;  3J81 j;  2EDU A;  1NK0 A;  1UT5 A;  9ICK A;  5J2J A;  3T5H A;  2CRX A;  4O5C A;  1XSL A;  2ZXI A;  2UVU A;  4TQS A;  3TFR A;  3HW8 A;  3PX4 A;  1KDH A;  3V6K A;  5KFL A;  2H5X A;  3QU9 A;  5DDY A;  2HW3 A;  2LM1 A;  1IXR A;  3HJE A;  2FMP A;  2NRV A;  3VCB A;  3HKZ F;  4KMO B;  3BDP A;  3RAX A;  4ELU A;  5D49 A;  2HSZ A;  1GO3 F;  4QZC A;  5KT5 A;  4QZE A;  4J9P A;  2Y0S F;  1OW5 A;  5AIA A;  1L8O A;  2ISO A;  3G6V A;  1ZD5 A;  2JR5 A;  3HT3 A;  2D6F C;  3TI0 A;  1U47 A;  5DB8 A;  4Q45 A;  5KFB A;  3HKZ C;  2DGZ A;  1S9F A;  3ZD8 A;  1TAQ A;  4O0I A;  3PV8 A;  4KLL A;  3SR6 A;  3GU3 A;  3ICX A;  5L1M A;  1F5S A;  4KLH A;  4HYK A;  1UHU A;  2W9C A;  1TK0 A;  1IV8 A;  1X40 A;  2ES6 A;  3I1Y A;  4YCX A;  1RXV A;  4Y2S A;  1B0X A;  1V38 A;  4UBB A;  4XQ8 A;  9ICU A;  4BX9 C;  3CRX A;  5AK3 A;  2F8L A;  4PJ0 U;  1PUZ A;  4K4G A;  4ZH4 A;  1QSS A;  3F5A A;  5DG7 A;  4EEK A;  2W9B B;  4CGZ A;  4CRX A;  5KFC A;  1RZT A;  4I29 A;  1QQ5 A;  3U26 A;  2ZTC A;  2HBJ A;  1TVA A;  4B9S A;  1ZQM A;  4I2E A;  4Y2R A;  3C21 A;  2ISP A;  2A1J A;  3N7R C;  5ALS A;  5KT2 A;  3RJJ A;  4NLZ A;  3A0B U;  4J9O A;  3JPP A;  4KLQ A;  4DSF A;  3C29 A;  1NZP A;  1S0M A;  2BPC A;  3AEV A;  2K4P A;  4JWN A;  1ZQF A;  1SKW A;  3AMZ A;  3Q8K A;  3V72 A;  4EBC A;  4G9B A;  4O3S A;  4NL9 C;  2G5H B;  4P4M A;  5EOZ A;  2VJ4 A;  1KTQ A;  3H0L B;  1NNL A;  1NK7 A;  2R18 A;  4OJP A;  4OJO A;  1Z1B A;  4DL7 A;  2HBK A;  5J2K A;  2QAR B;  1H38 A;  5ALX A;  3NRZ A;  5KFM A;  2AGQ A;  2GH1 A;  4RQM A;  1A6S A;  4RPY A;  2XY7 A;  5J8Y A;  4Y2P A;  1RYS A;  3TAP A;  3FAH A;  3THV A;  2K4E A;  1Z1V A;  1L7O A;  2B21 A;  4DWI A;  1X9S A;  2KJ8 A;  1SZP A;  1A77 A;  2KV2 A;  4GIB A;  2ASL A;  4B9N A;  4PH5 A;  5L1K A;  1ZQW A;  3MAB A;  2XGQ A;  2XID A;  3N7P D;  1DRG A;  2W03 A;  3WKB A;  4Y2V A;  5J0T A;  2IHN A;  1UQV A;  2F76 X;  3LDA A;  4AYB C;  5EE1 A;  3H40 A;  4DOB A;  1SXD A;  4QZH A;  4OJL A;  2AGP A;  1ZQY A;  3QUT A;  2EZX A;  2RHF A;  5AM4 A;  1DOQ A;  1CRX A;  2K8A A;  3H4B A;  1SWW A;  4CE6 A;  4QWC A;  1ZQV A;  4DSI A;  2HMX A;  3AN1 A;  1X42 A;  2K8B B;  4PPX A;  4QZ8 A;  2IOF K;  5EWF A;  4MF2 A;  1S97 A;  4DO9 A;  3RJE A;  1WCL A;  8ICM A;  2MUT B;  2K60 A;  2JEG A;  5GTH U;  2KEY A;  3HIL A;  2KJ5 A;  1UPH A;  4Y2T A;  3OJU A;  5ALK A;  4UB4 A;  5KG4 A;  2MU2 A;  2E3T A;  9ICI A;  2ZJA A;  5KTQ A;  2FPL A;  4RT2 A;  3MR3 A;  4NM2 A;  3PST A;  4C8L A;  1M6Y A;  4CNQ A;  2NRZ A;  3GIL A;  2BQR A;  1S77 D;  8ICK A;  1BPE A;  4FZL A;  3M6Z A;  1A76 A;  5DGA A;  4Y2U A;  2O6K A;  4F5R A;  3KBB A;  1U45 A;  3OHB A;  1WCN A;  2DKZ A;  8ICP A;  4OD0 A;  5AKZ A;  3JPS A;  2FPM A;  2LYB A;  2EAN A;  5KFY A;  2JEJ A;  4YN4 A;  8ICV A;  1TKD A;  3RJG A;  4NLB A;  2W55 A;  3MGH A;  4NXZ A;  4EEN A;  5KG7 A;  4DCC A;  1A0P A;  2W7O A;  3QX7 A;  4PHP A;  2LYA A;  2DQN B;  3FDS A;  4Q8F A;  2XIC A;  2VAN A;  3H8M A;  2ZIX A;  2KHQ A;  2NRT A;  3NVZ A;  5J2E A;  4E0D A;  4HAI A;  3MFI A;  3V7L A;  1FEZ A;  2UVW A;  2F2A B;  4AYB F;  1UA0 A;  3TAN A;  2C22 A;  4F5P A;  2XY5 A;  4GXK A;  4I2B A;  2WAQ C;  1MQ3 A;  1YZ7 A;  4RU9 A;  3CW2 C;  8ICU A;  1MA7 A;  8ICG A;  1ZET A;  1YZ6 A;  4FS1 A;  3E2E A;  3EPG A;  2YQE A;  5F3X B;  3EWA A;  2DBY A;  1JUD A;  1ZQK A;  9ICL A;  1L5U A;  5KG0 A;  1T7P A;  4M2Y A;  1B43 A;  1BVS A;  1T8E A;  4QZA A;  4B9V A;  4DQQ A;  2AQ4 A;  4UB3 A;  4QZB A;  4F4Z A;  1SL0 A;  1KKX A;  4PHA A;  3UPQ A;  1T94 A;  2W9C B;  9ICO A;  4UAT A;  4PZO A;  4P4O A;  9ICJ A;  2NRW A;  4PZN A;  2YMQ A;  1D9D A;  4KLF A;  4IR9 A;  1L3T A;  1TAM A;  2UVV A;  4GXI A;  4FS2 A;  1KSP A;  2R8K A;  4Z6C A;  4YVZ A;  4QWA A;  4B9M A;  4F3O A;  7ICE A;  2A3V A;  2ZIW A;  2JEF A;  1TK5 A;  2YMP A;  5KFW A;  1Q8K A;  3KZI U;  3SAF A;  3QU2 A;  3IHQ B;  5J2F A;  5AKG A;  3T79 A;  9ICR A;  1X6I A;  3JPN A;  4KLE A;  1BNP A;  1JI7 A;  4EEY A;  4BXO A;  1SKR A;  2BGW A;  3NVV A;  2FMS A;  2KIV A;  1NJZ A;  1RYU A;  5ALQ A;  1ZQJ A;  2HOI A;  3JPO A;  3C28 A;  5J0O A;  3QU5 A;  5K4L A;  1N60 A;  2PKE A;  4NLC A;  5KFN A;  3JPR A;  3HP6 A;  5AI6 A;  2YMM A;  4TQR A;  8ICJ A;  2KN7 A;  2OWO A;  1DK2 A;  2QB0 A;  2EH9 A;  2ZG6 A;  2XI9 A;  3F5E A;  1F0M A;  1L7N A;  4UB8 U;  2DPI A;  4F8R A;  1NKC A;  4TUP A;  2RDI A;  9ICP A;  2G07 A;  1ZQA A;  1BPB A;  3C23 A;  3T5K A;  2JRZ A;  1MC8 A;  4RPZ A;  1SL1 A;  2V4R A;  2HHQ A;  7ICO A;  2N1R A;  4QJF B;  4I2A A;  3ISD A;  7ICQ A;  1Z00 A;  4ECZ A;  8ICN A;  2DF4 B;  3QE9 Y;  1NOM A;  3B0X A;  5JUM A;  3KTQ A;  1KN5 A;  3KKA A;  2DKX A;  4C80 A;  4IRK A;  4DFP A;  5J0Q A;  3KHL A;  5DDM A;  1WG8 A;  1K1Q A;  3K1R B;  1SXE A;  2DUY A;  5AI8 A;  3HWT A;  4B9T A;  1ZQS A;  4NV0 A;  4F72 A;  5B5E U;  4DLE A;  5KFI A;  3T5L A;  4US9 A;  4RQ6 A;  1XC9 A;  4UAV A;  1SGG A;  2K89 A;  5H2F U;  5KFR A;  3F53 A;  5AKL A;  1WUD A;  7ICM A;  4DQP A;  5CHG A;  2HOQ A;  4BJQ A;  3OPX A;  4EBD A;  2E8O A;  9ICG A;  4G3I A;  1NI3 A;  3FC4 A;  1FO4 A;  3LYS A;  4LZD A;  2KKP A;  4F4Y A;  1ZYQ A;  3WKA A;  9ICF A;  4J9N A;  4B6J A;  2WF6 A;  1PK3 A;  5DBC A;  4UAW A;  3TAC B;  3PZP A;  2OCE A;  4ZOH C;  4NLG A;  3LWM A;  4IL6 U;  3N4M B;  1ZD4 A;  4FZM A;  4DSK A;  5KFA A;  4UQG A;  5AM5 A;  5KG2 A;  4YMO A;  5DBB A;  4QW9 A;  3PSI A;  4UB2 A;  5IIJ A;  2WTF A;  4PGQ A;  2DWQ A;  1OXJ A;  1COK A;  4QWE A;  3UQ2 A;  1VDV A;  4F4X A;  1LVH A;  4F71 A;  1L3S A;  4P0Q A;  5JU5 A;  2ZUC A;  1KFD A;  1NK6 A;  3KHG A;  3BZK A;  3SAG A;  3IG5 A;  4KLI A;  5KFJ A;  3WK6 A;  5AKH A;  4UW9 A;  2QLT A;  2PI4 A;  2OEH A;  5ALR A;  2BQ3 A;  4TUQ A;  2LI6 A;  2Z7J A;  5CR0 A;  4KTQ A;  2KJ9 A;  3AUO A;  1TE2 A;  3ZDC A;  4DL2 A;  4ED8 A;  2E8M A;  4Z6E A;  4M47 A;  3QUQ A;  3PO4 A;  1ZQG A;  2HHX A;  2PMZ F;  4RQ3 A;  2BCQ A;  4UAS A;  5DG8 A;  2F77 X;  3BQT A;  1ZQL A;  2JZB A;  2YN4 A;  4ECS A;  3SI8 A;  2H3F A;  3IP4 B;  4ICA A;  4J9K A;  3SQI A;  2HI0 A;  2BQU A;  4UAY A;  2KMD A;  4LJX A;  3QEB Z;  2W11 A;  2BCU A;  3PR5 B;  3B0Y A;  4XA5 A;  1JRP A;  1S0V A;  1X2I A;  3WK9 A;  5ALH A;  5G5H A;  2LM4 A;  5KFD A;  3C2K A;  1RDF A;  8ICF A;  2NO4 A;  2V9W A;  2B0C A;  2D8C A;  3QUC A;  4Q44 A;  4O3Q A;  2ZIU B;  2WF8 A;  2JEI A;  2KNJ A;  4JWM A;  1LV5 A;  4M9J A;  2XC9 A;  5F9L A;  5L1J A;  4NL9 A;  2R8G A;  4ECY A;  4CF3 A;  4EYH B;  4I2G A;  4NLK A;  2EAO A;  5TIS U;  3WKD A;  4RUA A;  4KIT B;  4GFJ A;  1HJP A;  3PO5 A;  5JRT A;  4I2J A;  2OM6 A;  3PMN A;  3MDC A;  3M7D A;  4R64 A;  3QYP A;  3E58 A;  2ALZ A;  4C8K A;  1UT8 A;  3RFA A;  1AQ6 A;  2H3I A;  8ICI A;  3PR4 A;  5ALG A;  5DQI A;  4IQV A;  7ICL A;  2KZZ A;  5ALU A;  3UM9 A;  4IQU A;  3N28 A;  2BHN A;  1Q3U A;  1PK1 B;  4EYI B;  4F4W A;  2I6X A;  4ECW A;  4QZ9 A;  2CXY A;  5DQH A;  3N97 B;  3CYM A;  5DGB A;  2FLN A;  2BCV A;  4ED2 A;  2MAX A;  3C5G A;  2VA8 A;  4FO6 A;  4R66 A;  2NV3 A;  5KFF A;  1UCV A;  4ACO A;  4R65 A;  1TFR A;  1CI4 A;  2VJ5 A;  3H8W A;  2KZ3 A;  3UXN A;  5AM2 A;  4LVS A;  2ATL A;  3H0R B;  3RJI A;  5KL1 B;  3ZDD A;  5AKJ A;  2FPK A;  9ICQ A;  1FFU A;  4P4P A;  3RH6 A;  2KKV A;  1SV4 A;  2GO7 A;  3TFS A;  3VC8 A;  4ED6 A;  4UAU A;  3PW7 A;  5EWG A;  1L7P A;  5AKI A;  2XCA A;  5AI4 A;  5ALW A;  2HVI A;  3ZI4 A;  1URJ A;  9ICS A;  3KHH A;  3HPO A;  3WK4 A;  1YT3 A;  3OSN A;  4DS4 A;  8ICQ A;  1SWV A;  1N5W A;  2GLE A;  2ZUD A;  4YP3 A;  5E79 U;  2WFA A;  4TUS A;  2HVH A;  4MEY A;  4IQW A;  3M8S A;  4IRC A;  3QU7 A;  1Z19 A;  3ZDB A;  3GII A;  4KN7 A;  3Q8L A;  2DL0 A;  2ZUB A;  1QQ7 A;  4ECT A;  1D8Y A;  4C8M A;  1UA1 A;  4MF8 A;  1S0N A;  1ARO P;  2A1A A;  2JXJ A;  4GXJ A;  4KMU A;  3D6J A;  3MR5 A;  3C1Z A;  2KD1 A;  3KOO A;  5J29 A;  5ALP A;  2FLL A;  2C2D A;  2ZTE A;  3UXO A;  1N61 A;  5AK5 A;  5KFV A;  3IV6 A;  1Z4N A;  3C5F A;  3KZX A;  8ICW A;  2KE7 A;  3IRU A;  1V97 A;  4F92 B;  1ZJM A;  1WYG A;  7ICP A;  3RBE A;  1ZQT A;  1DGS A;  2ASD A;  5HMM A;  3HRD D;  5CWR A;  4MFA A;  3OJS A;  1SKS A;  2LBO A;  3H7I A;  1B4F A;  4JV2 A;  8ICS A;  5J2I A;  1WWV A;  4MHV A;  4KLU A;  3TAR A;  3H0M B;  1X9X A;  5KNI A;  1N56 A;  5J0S A;  5KFH A;  3ZDA A;  2G08 A;  3RB6 A;  3G6X A;  3EYZ A;  1HUO A;  3TAD A;  2WB1 F;  1SB3 C;  2J6U A;  3K1Z A;  3QZ7 A;  2YB1 A;  5KL8 B;  3F2B A;  1QSL A;  4NM1 A;  1ZXI A;  2W7P A;  4M04 A;  3RB3 A;  4DS5 A;  4BUG A;  1Z3E B;  5AK4 A;  5DB7 A;  3AM9 A;  4QZI A;  3NRW A;  5BOL A;  2JMG A;  2V4Q A;  4DSE A;  4YXM A;  3NAS A;  1D8B A;  5HML A;  5KFP A;  2LYH A;  1HUZ A;  4RZR A;  3BQ7 A;  2QKQ A;  2I1Q A;  1S0O A;  2LMR A;  2E8N A;  3UMG A;  1U49 A;  9ICA A;  3BQ1 A;  2YY6 A;  1BPX A;  4RQ0 A;  2IA6 A;  1HIW A;  2AGO A;  1PK1 A;  4UB1 A;  4NLN A;  3ISC A;  1S10 A;  2R8H A;  2A1J B;  5J2H A;  2RQ5 A;  2PXI A;  2RRD A;  5AM3 A;  2Q4T A;  4DF4 A;  4FBU A;  5KT7 A;  3AL0 B;  4UAZ A;  2GWS A;  2ZJ8 A;  2H3Q A;  1FFV A;  3L5K A;  3LVV A;  4DFD A;  1O08 A;  3QUB A;  2DFL A;  1XS9 D;  1S5L U;  2J6S A;  4P0P A;  3Q8P B;  2P6R A;  4F5Q A;  4PHE A;  5J2B A;  1WWU A;  4O3N A;  5III A;  1ED1 A;  2KK0 A;  4NWI A;  4NY8 A;  3F2C A;  4ED0 A;  1NKB A;  3TQ1 A;  5DG9 A;  4ELT A;  3N7S C;  1PZN A;  3RRH A;  2KZM A;  3H8J A;  5CB1 A;  3CP8 A;  2IBK A;  3LK9 A;  3T3F A;  1DXS A;  2H3Z A;  1D9F A;  3R9K A;  9ICC A;  4USA A;  1COO A;  4YXJ A;  4F50 A;  4DL3 A;  4DLG A;  5CJ7 A;  5KT3 A;  4FE3 A;  4UAR A;  1ECW A;  3K75 D;  1LKY B;  2JH7 A;  4P0P B;  3GFK B;  8ICE A;  3PW0 A;  1QSY A;  3SAH A;  4YQW A;  4DFJ A;  5J2C A;  3I28 A;  2G09 A;  2QB1 A;  4OCZ A;  4DQI A;  3BQ2 A;  3O0F A;  5KG6 A;  5HP4 A;  3NGD A;  5J2A A;  4M9G A;  3RH4 A;  4KLG A;  1EXN A;  2J6T A;  4DL6 A;  8ICY A;  2FI1 A;  5J0R A;  5BPC A;  2Y1J A;  2AU0 A;  5G5G A;  3WK5 A;  5CRX A;  3DEE A;  2F1H A;  1BPY A;  1XO1 A;  5D4B A;  4MFC A;  4J9R A;  9ICT A;  1SZH A;  3EUB 2;  2W54 A;  1XSN A;  1JMS A;  4WJ3 B;  2K4I A;  5IIL A;  1J97 A;  3IDW A;  4B9U A;  3UMC A;  1QLN A;  8ICA A;  2ZIW B;  4BWJ A;  3WU2 U;  4DOA A;  4M9N A;  2WF9 A;  4C0Z A;  3MC1 A;  1S76 D;  4C7Z A;  2KOB A;  4JMU A;  4RNO A;  5ALZ A;  1IIP A;  3FM9 A;  1N63 A;  5J8Y C;  3RTV A;  2G0A A;  4YMM A;  5IIM A;  2PMZ C;  1J2M A;  5BOM A;  5AHX A;  5DLG A;  2G5I B;  2XO7 A;  1CEZ A;  3M9O B;  9ICB A;  1MQ2 A;  2VKQ A;  1BGX T;  3OHA A;  3LVW A;  7ICG A;  1B22 A;  3RJK A;  5ALM A;  2KIW A;  1ZQD A;  3SYZ A;  4B9L A;  5FP0 A;  5ALL A;  4GLX A;  4OO1 J;  4FBT A;  5ALE A;  5EE9 A;  3GDX A;  5AM1 A;  3K4G A;  5KT4 A;  4O3P A;  3NTU A;  3M8R A;  2HBL A;  3D2N A;  4Y2Y A;  5KFU A;  8ICC A;  2ZIV B;  3G6Y A;  4JK1 A;  5AKX A;  3IN5 A;  1JX4 A;  1RYR A;  1Z4O A;  5AI5 A;  3WK7 A;  1KW4 A;  1ZRM A;  2YX8 A;  2C28 A;  2ZIU A;  4GC6 A;  5EE0 A;  2BDP A;  1D8L A;  4RQ5 A;  4C4S A;  1C20 A;  3CNH A;  3S6J A;  3NS1 A;  2IHM A;  4DEZ A;  3PW2 A;  2AH5 A;  3GQC A;  1J2N A;  8ICZ A;  3AU2 A;  4ECU A;  4NJ8 A;  5L9X A;  2KHV A;  4IRD A;  4EX7 A;  4R8U B;  1S8O A;  1TAU A;  5CEH A;  1ZQZ A;  4F5O A;  3TKA A;  4YR0 A;  2RP5 A;  4DQR A;  2ESE A;  2PI5 A;  4QNL A;  1ZQX A;  3H8S A;  4ED7 A;  5HR7 A;  4DL5 A;  3BZC A;  4F93 B;  2KTQ A;  2E5S A;  1XNS A;  4IR1 A;  4I2C A;  1BPZ A;  3NVW A;  5D46 A;  1K5O A;  4XUS A;  3SD7 A;  4O3R A;  2W8K A;  2EQY A;  4Q43 A;  4M9L A;  2AHO B;  1SL2 A;  1HEK A;  4J9L A;  4JUZ A;  4JV1 A;  2JGA A;  1RQL A;  5B66 U;  4Z6D A;  3MDA A;  3QZ8 A;  4C7Y A;  5KFK A;  5KFO A;  5KFE A;  4ECV A;  1F44 A;  4I27 A;  4RNN A;  4DQS A;  1RQN A;  5KFG A;  1Y88 A;  4F2S A;  3E0F A;  3WKC A;  2LPE A;  4FZN A;  2KP7 A;  3SZ2 A;  1Z00 B;  4IC9 A;  2R8I A;  3I76 A;  3RR7 A;  3ONN A;  2M9N A;  2IOH A;  2W9M A;  3EW9 A;  4C8O A;  1JRO A;  2NRX A;  2XGP A;  1Q3V A;  3QEA Z;  1PVQ A;  2I9G A;  5ALO A;  2HHS A;  1KRP A;  3AQE A;  4RQ2 A;  4C4T A;  3KD3 A;  5GTI U;  3MGI A;  4I2F A;  4F91 B;  2HDO A;  3SEN A;  4P2H A;  2AQ0 A;  2HCF A;  4RPX A;  1N48 A;  2M0N A;  1U9L A;  3MBY A;  5J0Y A;  3BS5 A;  2W8L A;  2KSO A;  1NK9 A;  5EE3 A;  2LKY A;  4PL2 A;  3RJH A;  4EZ6 A;  4PGY A;  2ASJ A;  3IG8 A;  2WHE A;  4UB6 U;  2Y1I A;  1KLN A;  2RLT A;  3T5J A;  5AM0 A;  5J0X A;  4YR3 A;  3M9N B;  4KLD A;  4DFK A;  1SV0 A;  5J0U A;  4O5E A;  1T3Q A;  3LWL A;  3RAQ A;  3NVY A;  4J9S A;  5KG1 A;  2ZIV A;  8ICB A;  4J9M A;  2PFQ A;  3BS5 B;  2W9B A;  2PFO A;  5AIB A;  4K4I A;  4O9M A;  5KFS A;  4LZG A;  4OJ6 A;  4C4R A;  5J0W A;  2AJQ A;  3BQ0 A;  5TZV A;  5ALJ A;  1U4B A;  1RM6 C;  2ZIX B;  3AU6 A;  5DQG A;  4MEX A;  2IOF A;  4RQ1 A;  2E1E A;  1IG6 A;  1KQQ A;  3Q8Q B;  2KG5 A;  4Y2J A;  2VIX A;  3IM1 A;  2Y9T A;  2OYY A;  2VA3 A;  1TV9 A;  5AKK A;  3GZF A;  2JH1 A;  2F1I A;  7ICH A;  4ED1 A;  4DF8 A;  4MFF A;  3SMV A;  4QWB A;  2XY6 A;  1ZQU A;  2KFZ A;  2CPR A;  5EWE A;  2PFP A;  1MN8 A;  4OJ5 A;  2MUT A;  4I2D A;  3PML A;  4EX6 A;  2F3N A;  1VLB A;  4U7C A;  1XSP A;  4KX3 A;  5AK6 A;  2CN1 A;  2A19 A;  4A8E A;  4XRH A;  3F2D A;  4KLO A;  4KLJ A;  7ICT A;  5A0L A;  5JTI A;  4F4K A;  4DFM A;  1RG6 A;  2P6U A;  4IQT A;  3TAQ A;  4Y2X A;  2L5Y A;  3PNC A;  2UVR A;  3WK8 A;  9ICH A;  5DBA A;  1ZRN A;  3M1Y A;  4I2H A;  4RQ4 A;  3RH5 A;  5C0Y A;  8ICR A;  3ETL A;  3AQF A;  2IMW P;  2KSO B;  8ICX A;  1JN3 A;  1N2X A;  2QAR A;  2MA1 A;  3RF9 A;  2F8K A;  4Q8E A;  1V85 A;  5DB6 A;  1L6N A;  4RQN A;  2PFN A;  1KBU A;  4F5N A;  2BPG A;  3H4D A;  2HBM A;  2F44 A;  1LB2 B;  1QCK A;  3ED5 A;  3EZ5 A;  3RBD A;  3ZD9 A;  2NYV A;  1NK4 A;  2Q0Z X;  1ZQP A;  4KLS A;  3KHR A;  1QQ6 A;  3QXG A;  3BJY A;  3RRG A;  4Z6F A;  2GOL A;  3ORY A;  1U48 A;  5J2G A;  4RQ8 A;  4QZD A;  4QWD A;  3PW5 A;  4PL1 A;  3DDH A;  1ZJN A;  4K4H A;  5AKY A;  8ICO A;  1PVP A;  1ZQB A;  5ALT A;  3EPI A;  4R63 A;  3MGV A;  4Y2Q A;  5KFQ A;  1NK5 A;  2KVC A;  5ALY A;  2KIC A;  1NJX A;  9ICX A;  2EZZ A;  3RR8 A;  4EBE A;  2D3D A;  1ZD2 P;  2YML A;  2XVT A;  4M0A A;  4DOC A;  1ZQE A;  2ZJ5 A;  3B9J A;  4JB3 A;  2G06 A;  3V7K A;  3V7J A;  1XWL A;  1BPD A;  3GIK A;  4J9Q A;  5HHI A;  1RXW A;  2OH2 A;  2NO5 A;  1P7D A;  5DLF A;  3RB0 A;  2ODG A;  2DPJ A;  4BGD A;  2EAM A;  2B6G A;  1OUQ A;  1O03 A;  8ICT A;  9ICE A;  3DV9 A;  2BZF A;  3TAD C;  4P0Q B;  4US8 A;  3MR6 A;  5KFT A;  3GV7 B;  2BCR A;  5ALD A;  3PX6 A;  1IM4 A;  3UMB A;  2EAP A;  4YR2 A;  3FYH A;  1PVR A;  3SEI A;  1ZQN A;  3UXP A;  7ICN A;  5DKW A;  2RDJ A;  1C7Y A;  4EEL A;  3MFH A;  3QNM A;  3C2M A;  5KAF U;  5KFZ A;  2FJ6 A;  5AI9 A;  4JV0 A;  2K8C B;  2ZXH A;  4QIW F;  1NK8 A;  3D2Q A;  1X9W A;  4DSL A;  2W43 A;  3C2L A;  1CUK A;  4R8U A;  7ICV A;  1XU4 A;  4QW8 A;  4CDG A;  3NUQ A;  4KLT A;  2P66 A;  4DSJ A;  3OTQ A;  4O5K A;  2JZB B;  7ICF A;  2VA2 A;  3PSP A;  2K4H A;  2HOF A;  2H3V A;  3WKE A;  5ALV A;  5KAI U;  1FIQ A;  1ZQQ A;  2C2E A;  5HHH A;  5HNK A;  2HHU A;  2BCS A;  1T4G A;  2FE9 A;  2JV3 A;  3BS7 A;  1N5X A;  4RT3 A;  1ZOL A;  4EZ9 A;  3Q8R B;  2W04 A;  7ICJ A;  4IS7 A;  8ICH A;  1ZQC A;  5IIO A;  1ZQI A;  5C5J A;  2BR0 A;  4J03 A;  1KL9 A;  1ZQO A;  4CF5 A;  2Y0S C;  1NZB A;  4O3O A;  5CA7 A;  1ZQH A;  2E1F A;  2BPF A;  2Y9U A;  5KT6 A;  7ICR A;  4I28 A;  5KG3 A;  2P35 A;  2BDU A;  1JAL A;  9ICN A;  3PVX A;  8ICL A;  5L1I A;  2ZTD A;  2WF5 A;  2MSN A;  4CF4 A;  3PX0 A;  1QTM A;  4F2R A;  2HHT A;  1VJ5 A;  1T3N A;  4DL4 A;  5J2D A;  1JXL A;  3OSP A;  1KFS A;  4QIW C;  4KN4 A;  3PY8 A;  4ECR A;  2KFN A;  1KEJ A;  4KX5 A;  3D2S A;  2WF7 A;  3V6J A;  3ALR A;  2BKE A;  3JPQ A;  4M6W A;  1LKY A;  3A0H U;  3RB4 A;  3MR2 A;  5AIC A;  1ZQ1 C;  3PW4 A;  5IIN A;  4ED3 A;  1Q46 A;  1K1S A;  3GV5 B;  4QZG A;  2LHT A;  5KFX A;  4O3M A;  4CCH A;  3GIM A;  5IIK A;  1XO0 A;  4QZF A;  2YTU A;  5ALF A;  1JXE A;  5ALN A;  1TK8 A;  1L8L A;  2WAQ F;  5AKE A;  1NKE A;  2YB4 A;  4BDP A;  1DGJ A;  2MRL A;  7ICS A;  4YG2 A;  3M6K A;  4UBC A;  3ZDE A;  5L1L A;  5KG5 A;  2AXT U;  4TUR A;  3PSF A;  5HR6 A;  4RQ7 A;  1MSW D;  4GC7 A;  5F9N A;  3V6H A;  7ICU A;  2OHF A;  4UB5 A;  3SV3 A;  1KFT A;  3GIJ A;  5AI0 A;  5T14 A;  4RNM A;  1BNO A;  3Q8M A;  2FMQ A;  3C1Y A;  2FDR A;  4M9H A;  4BWM A;  4YMN A;  3KKA C;  2W3S A;  2HHW A;  4ECQ A; 
#chains in the Genus database with same CATH homology
 2KE7 A;  3KKA A;  1SV0 C;  2DKX A;  5JTI A;  1PK1 B;  4PZO A;  1RG6 A;  1WWU A;  2L5Y A;  2QAR B;  4PZN A;  2ESE A;  3K1R B;  3BS5 A;  1SXE A;  2EAP A;  2KSO A;  5L1M A;  3SEI A;  4RQM A;  1B4F A;  5J8Y C;  1UCV A;  2E8P A;  2E8M A;  1LKY A;  5J8Y A;  1WWV A;  2KSO B;  4MHV A;  2DKZ A;  1X40 A;  2ES6 A;  2QAR A;  1Z1V A;  1DXS A;  2EAN A;  5KNI A;  1X9X A;  2F8K A;  1SGG A;  1V85 A;  4RQN A;  1SV4 A;  1B0X A;  1V38 A;  2F44 A;  1SV0 A;  2KMD A;  2E8O A;  3TAD A;  1JI7 A;  1X66 A;  3H8M A;  1LKY B;  1UQV A;  2KIV A;  2YTU A;  3BS5 B;  1SXD A;  2QB1 A;  2QB0 B;  2D8C A;  2GLE A;  2FE9 A;  2JV3 A;  1PK3 A;  3BS7 A;  2D3D A;  2LPE A;  4IS7 A;  3TAC B;  4NL9 A;  2QB0 A;  5F3X B;  3BQ7 A;  2QKQ A;  2LMR A;  2E8N A;  2EAO A;  1KW4 A;  1F0M A;  2DL0 A;  5JRT A;  2K4P A;  2KG5 A;  1PK1 A;  2Y9T A;  2Y9U A;  2K60 A;  1OXJ A;  1COK A;  3HIL A;  4NL9 C;  2B6G A;  2EAM A;  3KKA C;  4NJ8 A;  2F3N A;  5JU5 A;  3SEN A;  3IDW A;  1OW5 A;  3TAD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...