2FEAA

Crystal structure of mtnx phosphatase from bacillus subtilis at 2.00 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
225
structure length
225
Chain Sequence
TRKPFIICDFDGTITMNDNIINIMKTFAPPEWMALKDGVLSKTLSIKEGVGRMFGLLPSSLKEEITSFVLEDAKIREGFREFVAFINEHEIPFYVISGGMDFFVYPLLEGIVEKDRIYCNHASFDNDYIHIDWPHSCKGTCSNQCGCCKPSVIHELSEPNQYIIMIGDSVTDVEAAKLSDLCFARDYLLNECREQNLNHLPYQDFYEIRKEIENVKEVQEWLQNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MtnX phosphatase from Bacillus subtilis at 2.0 A resolution provides a structural basis for bipartite phosphomonoester hydrolysis of 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatas
total genus 72
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.1.3.87: 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase.
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2feaA01
3.90.1470.20 Alpha Beta Alpha-Beta Complex thrh gene product, domain 2 thrh gene product, domain 2 2feaA02
2YFYA 5AW7A 2GFHA 4Y2RA 3ZWDA 2EAUA 3E8MA 4I9FA 3QUCA 3L8HA 2YJ6A 4G9BA 1K1EA 1NF2A 2C9MA 4DCCA 1QYIA 4BNDB 2NO4A 2MU1A 4GXTA 3F9RA 2BDEA 5AESA 1RMYA 2YY6A 4UU1A 5AVRA 2RB5A 3ZTYA 2B1QA 4HAIA 5AI8A 3R4CA 2OYCA 3GYGA 4Y2SA 3KBBA 4BX2A 5AVUA 3L0YA 4HGQA 4UU0A 4IG4A 5ALJA 3QLEA 2WFAA 3U26A 4Y2JA 1U2SA 1T5TA 5AW6A 4UM5A 2YJ5A 4BEVA 2HF2A 5ALRA 2G1AA 1CR6A 1T9ZA 4UARA 1Z4KA 4BNDA 5IT4A 3ED5A 3L1VA 4UASA 3L1UA 1WZCA 3HLTA 2W43A 4OCZA 4EX6A 2W11A 3U13A 1RC8A 2Q5EA 3L8FA 4UMFA 4Y2TA 3OPXA 4AS2A 2Q4TA 4DFDA 4F71A 3QNMA 3UMGA 3AR7A 3ZI4A 4YIHA 3SMVA 2FI1A 4UAVA 3I28A 4UMEA 3VAYA 3DV9A 2IYEA 2D2VA 1ZD3A 1RKQA 4UW9A 1QQ7A 5ALEA 4EENA 5IS2A 1RMTA 1U7PA 3OTQA 1N9KA 1YS9A 4OD0A 3QU9A 4CNQA 2HCFA 4YGYA 1Q92A 1Z4MA 4EELA 2ZBFA 3WK5A 3L8GA 5AVZA 4L6CA 3U7FB 4QJBA 3QU7A 2GO7A 5AI9A 4OFZA 3W5AA 3M9LA 4HGNA 2YMMA 4Y2QA 5ALDA 5AW2A 3OCWA 1ZJJA 1L7NA 4FFDA 3A1DA 1L7PA 2HSZA 1TE2A 1U7OA 1VJRA 4EEKA 2R8YA 3A1EA 2FDRA 3N5KA 2BDUA 1YJ5A 3AR2A 5AVXA 4XQ0A 2R8XA 4CF5A 4Y2UA 2WF9A 4I9GA 3R9KA 4KX5A 2CFRA 5ALPA 3K1ZA 4AS3A 1RQNA 3AR4A 3B9RA 1O08A 1S8OA 5E0OA 2P11A 3QU4A 3ZUPA 3QUBA 5AVYA 3NRJA 4MWOA 2AGVA 3B9BA 3SKYA 1TJ4A 1RLTA 3IJ5A 1TJ3A 4XE5A 1YV9A 1AQ6A 5AK5A 3NALA 2CFSA 4BX0A 3MMZA 4CF4A 5AI4A 1YDFA 3QU5A 4L57A 5FP0A 3I76A 2FPWA 5AIAA 2I55A 5AI5A 1J97A 2ZBGA 4NFLA 3N07A 3ESRA 2FUEA 2HHLA 4YCLA 1RRCA 2EARA 4UMDA 2MSNA 4C4TA 3PDWA 5ALIA 1U02A 5ALUA 2WHEA 3QUTA 5AK6A 1YMQA 2PR7A 1YNSA 2GHQA 2X4DA 2NYVA 2C8LA 2GMWA 4J2TA 2PKEA 3ZWKA 3J7TA 3UMCA 1Q91A 5AKHA 1ZD4A 4JB3A 4ZEVA 3R09A 2JGAA 2B82A 3ZW7A 1EK2A 1O03A 4HYTA 2FPRA 4O8CA 2C8KA 4UM7A 4BKMA 4UAUA 2C4NA 2GHTA 1SWVA 1X42A 3AR5A 1NNLA 4YIKA 2IA5A 2WF5A 3OCVA 4KN8A 5ALVA 4RESA 4CF3A 2RAVA 3A1CA 3B8EA 3QYPA 3ZVMA 1RKVA 3ESQA 3NASA 2P27A 2IOHA 2RARA 2OBBA 5AKLA 5ALSA 3WK4A 1ZD2P 3FVVA 1Z4LA 3WKAA 3U7HB 3TLMA 1KYTA 1CQZA 5AVTA 3AR3A 5AW3A 2I54A 5A3SA 5AM2A 5ALGA 3N28A 2NO5A 5AKKA 5AKGA 4E88A 4NV0A 3ET5A 2AH5A 3D6JA 5AM1A 5AKYA 3BA6A 3QGMA 4MUMA 1WPGA 4ZEXA 3WK9A 1Z4JA 3EPRA 3W5DA 2CN1A 3EF1A 2WF7A 3SKXA 1Z4IA 4Y3UA 1ZOLA 1Y8AA 5AHXA 4RETA 3RFUA 3WGVA 5AM5A 5T41A 5IT0A 3L0BA 3FPSA 1N8NA 4UMVA 2O2XA 3FZQA 3MC1A 5AM4A 3PCTA 3N8GA 3U7EB 3I6BA 4AP9A 3RF6A 1Z4QA 5ALFA 2B30A 4L6AA 5AI6A 1XVIA 3S6JA 5AK4A 2HO4A 2P69A 5AKJA 2G07A 5AW9A 2FPXA 2YMQA 4BX3A 2IOFA 2QYHA 4C4SA 5AVSA 3E58A 3QU2A 2YJ3A 3ZVNA 3OCUA 4QQFA 4G63A 5AKIA 4BEWA 2JAWA 1RPZA 1VFPA 2C88A 4OHFA 5AVQA 1F5SA 5AW4A 2FUCA 3FGOA 4KYTA 4CE6A 2EATA 1RLMA 2P9JA 3ZVLA 5AVVA 2G06A 3NANA 1S2OA 3UM9A 2FEAA 1MH9A 1QH9A 2HX1A 4KX3A 3KD3A 3U19A 3DNPA 1ZS9A 2R8EA 2HI0A 4B6JA 1TJ5A 2YMLA 1PW5A 2R8ZA 5ALOA 5ALLA 3DDHA 1JUDA 3OCYA 5AIBA 3UMBA 4KNWA 5AI0A 3CZ4A 1FEZA 3IRUA 3NAMA 3QX7A 4J03A 5AVWA 5AW1A 3PGLA 1J8DA 4UATA 3WKBA 3ZX4A 4HGOA 1IWOA 1WR8A 1Z4NA 5AW5A 5AM3A 4XPZA 5AW8A 2HOQA 2G0AA 4Y2YA 1L8LA 2JARA 3AR9A 2CFTA 2ODAA 2PQ0A 5AICA 2B1RA 4YH1A 4ZEWA 3WK7A 2BY4A 3WKDA 3KC2A 5ALWA 2O9JA 2W4MA 1QQ6A 4PNHA 1ZRMA 5ALQA 3L5KA 2JAOA 2YJ4A 1Z5UA 2I33A 4IFTA 3WGUA 4F72A 1Z4PX 2ZOSA 3A3YA 3MN1A 3NUQA 2I34A 2QLTA 1LVHA 4EX7A 4YCMA 2ZBEA 3AR6A 5ALXA 2OM6A 3QUQA 5AKXA 2FPUA 4Y2XA 4Y2VA 2JAUA 4NAVA 3MPOA 1RMQA 2WM8A 4YCNA 4H1WA 4NWIA 5ALNA 2OA0A 3EWIA 1NRWA 2HEGA 1LTQA 1RKUA 2I7DA 3E81A 2HF7A 3I1YA 4Y2PA 1RLOA 2G80A 3L7YA 1TA0A 2YN4A 2DQSA 3ZU6A 2ZBDA 3FPBA 5ALHA 3W5CA 2HDOA 3P96A 2ZG6A 2B8EA 2AMYA 3N1UA 3BWVA 3DAOA 3U7GA 5ALTA 4XOUA 5ALKA 2RBKA 5ALMA 2FPSA 3E84A 5AKEA 5AKZA 2YBDA 1L8OA 3KZXA 2YMPA 3SLRA 2WF8A 5A3RA 3KOOA 1U2TA 4DW8A 4BBJA 3KDPA 2AUTA 5AW0A 3OCXA 1EK1A 1ZRNA 3W5BA 4JDPA 1ZD5A 4BYGA 2G08A 5AM0A 1L6RA 3FM9A 1L7OA 4EZEA 2Q4RA 3PGVA 2G09A 2ZXEA 2B8JA 1QQ5A 2B0CA 1SU4A 3NIWA 3IB6A 3HYCA 5ALYA 3SHQA 3L0CA 4GIBA 3SF0A 4HGPA 2WF6A 3QXGA 1Z88A 2VKQA 5A3QA 1XPJA 5JJBA 1WVIA 1RDFA 4FE3A 3ET4A 3L8EA 1XP5A 2I6XA 3AR8A 3ONNA 4NABA 1Z4OA 3WK8A 3ZTWA 3CNHA 1RQLA 2IOFK 4C4RA 1Z5GA 3OCZA 4DWOA 1T5SA 1SWWA 1VJ5A 3WKEA 3SD7A 3M1YA 4KNVA 5AK3A 3EF0A 1L7MA 4HGRA 4FYPA 3WK6A 3ZX5A 3WKCA 5ALZA
chains in the Genus database with same CATH superfamily
1ZC4A 2RGYA 3FYCA 1ZWKA 2NZVG 4Y2RA 3A2KA 3F6SA 3W78A 4AUMA 4GSLA 3QUCA 3U60B 3CF0A 2J5RA 3OTGA 1IG3A 2YJ6A 4M76B 1YCHA 1E32A 3CUWA 1OT5A 3GCDA 1D1PA 3K72B 5FA6A 4NZNA 3IBSA 5J2UF 1OLUA 1WBJB 1D03A 2C58A 2X4GA 2OP1A 2YY5A 1UXHA 2C9MA 3BOSA 2VBCA 3MXOA 4L4SA 3VHRA 2FFRA 1PS9A 1UDBA 1ACMA 3WWCA 4CI0B 2VT2A 5MN6A 2AC2A 2GKOA 4GVLA 4P2GA 5EE9A 4LDZA 3DL4A 4LDAA 4MPTA 3LRXA 4WXMA 4ZVVA 1IXYA 3IHKA 4AWXA 2AT1A 5B55A 3A1NA 3QXHA 3WNQA 5HS6A 1JDUA 3F49S 3N5CA 2GA8A 2DUUA 4C3VA 3QMWA 2H4WA 3GYGA 4B3HA 1A82A 1KZ1A 2FDCA 1QQAA 5TARA 3U3KA 3QKUA 4YR7A 1CJKC 3LUHA 4LBVA 5KVQA 3V5NA 3ICQB 1MF7A 2CF5A 3GLHA 4OHMA 3VH3A 2ZJ1A 4DRXA 1NZDA 4IOLA 4E1BA 1SXJA 4J7CA 5DYTA 4ISBA 4ZVLA 4EPTA 1QTQA 5IXJA 3SR0A 4YHHB 4EHNA 3LM8A 3COJA 2EC5A 3QBEA 3UMRA 2JLUA 4KR2A 1M10A 3K9NA 4GI3A 4OLAA 2C1ZA 2DULA 2JBAB 3L01A 3O8QB 4EO4A 1KQPA 3F3YA 3HO8A 2Z56A 5DXAA 2Z1NA 4QYTA 3H3XA 4I6JA 2Y1EA 1IQRA 2QXYA 4KPUA 1UKAA 3OLQA 3MT0A 3REFA 1ESEA 4GRDA 1QUFA 2E7ZA 4MS3B 4D6YA 3RANA 4MQEA 5B7PA 1QLJA 4I19A 2PLAA 2GXSA 2BSXA 2X2OA 4B7AA 2EERA 1RZRD 5KNDA 3PXXA 1JEJA 2NTVA 3UCEA 1NBEA 4BLTA 1E2KA 2OO5C 2YC4C 1ENPA 3T1TA 4AAYA 4Z9XA 5IKOA 1P4RA 4OXQA 2HMVA 3QNMA 4C14A 3L9XA 3SQNA 3LG2A 4WD3A 4URYR 5I8WA 3I53A 3GN2A 4BNXA 2XXJA 2FUG6 2IEAA 2ODWA 2CL5A 3UAZA 3MGGA 4MI6A 4BJHB 4Q4LA 4E94A 1SVNA 2H2GA 5TGZA 4JLJA 3DMNA 1XPOA 2OB1A 4JEHA 3TXAA 1YFKA 4DYVA 4M6WB 3QW4B 1DQYA 2ZJZA 1T1SA 2YHAA 4GKBA 2V5AA 4L0DA 3M5DA 4MQEB 3R7DA 3HUUA 3VR3A 4CNQA 3NHFA 5KWIA 4N7BA 1POWA 1BYUA 4L27A 1Z45A 1R6XA 4V24A 4YAUA 1DELA 1VRWA 2QX9A 3QI2A 3Q9LA 5B6IA 4FEEA 4H7DA 1A27A 2R5NA 3D2AA 5BSUA 1B0PA 2ZBFA 3PR1A 3VYVA 4K6FA 1PFKA 1JEQA 2VDOB 1WUJS 3UHFA 2X8JA 2I6FA 3BTVA 5E4JA 4WK4B 2RCNA 4EVIA 5LJIA 3ADBA 1EDZA 4I1SA 4J76A 2A30A 4GSYA 5FHQA 1E4OA 3OH8A 2DBRA 3AY0A 2A9JA 1UOOA 2E4XA 4II2A 9ATCA 1VE1A 2KYRA 3KU4A 3ZY2A 4CM5A 4G9GA 4JSRA 4TLEA 5CB0A 4EA6A 1IQUA 1KI4A 3PEWA 1XHLA 1H9BA 2GZ1A 5JNLA 4W1RA 5LLTA 1Q44A 1DAGA 4WBNB 1Z8DA 2BHNA 1L4KA 1GWNA 2EJTA 1JLMA 2J87A 2AN3A 3B7WA 4Q9JA 3T1QA 2X8JB 4IVPA 2AKAB 1C41A 1ZKDA 2BDUA 3DR3A 3HY6A 2E3JA 1GZHB 4C76A 2JCVA 1JKXA 2JFOA 3CR3C 4GZ5A 3N8KA 1ZNQO 2ZE5A 5GJWC 4DC9A 1QAQA 2E2WA 4ZI7F 3Q6MA 3SEFA 4ZZ1A 4Y1GA 4MUAA 3FY4A 4P54A 2C8JA 3VPXA 4ZDWA 4ABTA 4CHTA 1CQJB 3A4LA 3JQEA 4MRNA 1P62B 1LGYA 1KAGA 4FPXA 1MAUA 5J4VA 1FIUA 3NWJA 3SQLA 1II8A 4FEGA 2Y9MB 4LCBA 3KFXA 5AVYA 1M2GA 3O74A 4G84A 5DFAA 5L7TA 1I8TA 3JAWB 5DGCA 2I2WA 3NMUF 3RS5A 1TK9A 2P1DA 1G8MA 4X62B 2ZRNA 1MXFA 3L4JA 2BFOA 2RE8A 2IGBA 4F93B 5L4NA 2GBLC 4KV7A 1ZGAA 3IFSA 1J70A 3QVKA 4WBXC 4F7DA 3KJEA 3TPFA 1AQ6A 1WSDA 3PWSA 3NALA 2WMNB 1Q7TA 1E1CB 5EUBA 1OIVA 2EOAA 3MMZA 4J75A 1CHDA 4I1IA 4JEIA 4R2XA 1NWCA 4I5IA 3RODA 3OWHA 2JH8A 2CUKA 4RA6A 1N2IA 1QHHA 2VYQA 4UFOA 5B1DA 3H99A 3MRVA 1BFKA 4MVYA 2Z2YA 4S2EA 1V2HE 1E9CA 3PNPA 3RASA 3EARA 3T52A 3ROXA 3ZDBA 1DBSA 2O05A 3ICWA 4IVRA 3U1TA 1C5KA 1FLAA 1L8AA 1ZEMA 4KHZA 4Q48A 2BH9A 4GLLA 2VAVA 5ERYA 1ZK1A 1W9HA 3EIFA 4N8DA 3R7WB 3ZH9B 3HKCA 4LXTA 4BKQA 4XKJA 3RYHB 1TRHA 1Z33A 3OUTA 3QVUA 2F1JA 1WDLA 2O7SA 1YASA 1YAHA 4MS1A 2I3ZA 2JLWA 1KRWA 1FNCA 1DEOA 3BIXA 4R9VA 2GLXA 4DV2B 4LJ4A 3M89A 1P5FA 4J4TA 3R4VA 4FDUA 1XXHB 2AG5A 4A2PA 3HJHA 4O4JB 2A35A 3F9IA 1SZCA 4EKDA 5H81A 1H65A 4KMMA 1TU4A 3BZWA 1TC2A 3LX6A 3L8CA 4ZMRA 3EDMA 4O2AF 4KSBA 2QRPA 2IA5A 2FPGB 3R6LA 5BNTA 5BURA 3H9EO 1QKKA 4IICA 4WOCA 4QGAA 1DS6A 2G1UA 2HU5A 1ISJA 1XZLA 1F6WA 3QRWA 4PTLA 4MRSA 4OQYA 4PNZA 4YCJA 2GAAA 2XNDA 3DNFA 3EGOA 1G2OA 4UQOA 4YJHA 4BRWA 2HT1A 4M7RA 5ES4B 1TEZA 2OBBA 5FOUA 2TECE 4XQGA 2VJQA 1SIWA 1N25A 3QPBA 4ZTZB 4L2IB 2VKTA 1V11B 2G8LA 1PGPA 2BR4A 2ZE7A 4B43A 5FNVB 2DMRA 2PH1A 2PWZA 3MYYA 3V8BA 4RK1A 4P33A 4EGSA 3EXHB 4CEHA 1UDXA 3ND6A 2O52A 4YRJA 3VPBA 4BGUA 1YUMA 2VP0A 3U7QB 2A9FA 3JU3A 4E5UA 4NCAA 1A1SA 2WUFA 4GHWA 4LHEA 4IIVA 5JV5A 5JSKA 1YFJA 5IBCA 1XN1A 3DOHA 3P0EA 2AH5A 4PN3A 1AS3A 5ILOA 3GJTA 3NBQA 4JD5A 4HX5A 1WAMA 4B3IA 4CKBA 4PZUA 3D7MA 1ZLXA 2AUMA 4KZPA 4PX3A 3NKVA 3SY8A 1RWNA 3MTJA 3OOJA 1HR0B 3OT4A 3EIOA 1GNVA 1RLJA 4C89A 5JFGA 4BNGA 4BNMA 4ER5A 1VHQA 5EMJA 4J0EA 4RXTA 3ZQUA 1H22A 1VYUA 1X1AA 4NMMA 4YEDA 4XYMA 1AA9A 3NGLA 4DKJA 3MRXA 3RFUA 3AI2A 4MAFA 1Z5NA 5AM5A 1AQUA 3BQMB 4WESB 3RAJA 1DQNA 1PWEA 2ATVA 2IW3A 3I2JA 2F59A 3OZUA 1OAKA 4XYBA 2C4UA 4FBLA 1N1DA 1GTJ1 2EGGA 2XMRA 3MGKA 1EFPB 1SJ9A 2WAXA 1W34A 2AJDA 3IDFA 3KJIA 4ZXPA 5TEVA 1OWOA 2J4FA 3EIHA 4UBNA 4UVIA 4B4UA 2ZYGA 1FXSA 2EKZA 3Q10A 3KPYA 1ZBQA 5B53A 1TIKA 4R1UA 4CMEC 5KYXA 1UM9B 1PO7A 5TC4A 1NOKA 3SE7A 3T7SA 3UT5B 3I9JA 4H59A 4M1ZA 4RFSA 5E9AA 1UPCA 4UHDA 5SV2A 1I94B 2BP7A 3LOUA 3W9BA 4ERNA 1S1MA 5K01A 1NKVA 2AZTA 4N7RA 1PR9A 1W47A 3NEJA 4M0FA 4MR9B 4WFQA 3X2SA 1HFJA 2XD9A 4BP9A 4E15A 3HUTA 3NS7A 1XD8A 3TMAA 1BJKA 5JY6A 1A7UA 2JRLA 2OYSA 4JQYA 4DM3A 4OIMA 2FVYA 4IMPA 3EH2A 4PS1A 3GIWA 5TY0A 1XVVA 1Q6YA 1JALA 1E3SA 3MINA 3LDUA 3OU6A 5JQGA 3U09A 3KOUA 1KBZA 4DV7B 3MQFA 4MKIA 4DJDC 3G5AA 2PMKA 1HDIA 5LZ7A 1S1CA 1UDAA 1UJ2A 3E4DA 3OBBA 4L4YA 3JAKB 1ZMBA 4QSMA 1OGYA 4XX1A 5G0VA 4DEVA 4A2WA 5F7XA 2CL0X 1VKRA 3SEQA 4BL5A 4QQNA 1IFXA 3T7RA 2R8OA 4KMSA 3UM9A 3OEEA 2PLWA 2HX1A 3KPJA 1I80A 3M70A 4JODA 3P5SA 3CH5A 3DNPA 2W7TA 4FS3A 4HZGA 3UOGA 2E49A 3TRJA 1EVJA 2JLRA 4AYWA 5JO0A 3H2BA 1I1OA 2RHGB 3ZHSA 2ZWOA 1EK0A 1MOSA 2EL9A 2HRQA 3BRQA 4IWXA 1Z68A 2YINC 1FYVA 3EK2A 4LOHA 5K3AA 2CXUA 5C34B 4D9GA 5J2TB 2Q0HA 1IJKA 2WQ6A 4B9EA 2ISQA 1CF2O 1YRLA 1F38A 3FUWA 1ZR2A 1MQAA 3HZZA 3M34A 2JD2A 2ZAOA 4NENB 2JVIA 1RRPA 2IKQA 3EEFA 4EG7A 1GZ6A 3LCCA 4XGRA 5FBVB 4CV2A 3LWZA 4B3JA 4OU5A 1JQ3A 2ZJOA 5H1YA 4NU5A 2GRAA 1C0EA 1PK8A 3DLCA 4CLOB 3AUSA 3ID6C 1V45E 4GBGA 4HWGA 3LY5A 4EA7A 1PZXA 4MA4A 3VR2D 3SM3A 4KDCA 3W7AA 1RCUA 1G6KA 2VAXA 4JJZA 1C7QA 1V7QA 5DXFA 2CFTA 2PQ0A 4JUIA 1CZUA 5MN4A 1Y5NA 4IIHA 3P9YA 3CONA 4JLPA 1E96A 4KH0A 5K6RA 4TLLB 1NMSA 1YB1A 4AO6A 4BGDA 5C5EA 3U39A 2BTQA 1I2MA 3EDOA 4IYJA 5EEHA 1KOJA 4DLWA 5BOSA 4RULA 4DUYB 1WOMA 4XGQA 2QTAA 1F8FA 2HSJA 2NNLD 3CU5A 4EQ6A 2E89A 2NU6A 1M7HA 3GGPA 4H16A 3UMSA 4B6QA 4ZI5A 3VHQA 3K9HA 4UOEA 2CZQA 4MVJI 4F72A 4KR3A 1I3CA 1UIRA 3A2LA 1N4DA 2Y3IA 3PNSA 1V1JA 3BSYA 4JLAA 4WNCA 1SIUA 2A5GA 4DZRA 3SZGA 3V42A 4OPMA 1TNDA 1AZTA 4B7CA 2PSEA 4CW7A 4H6WA 4TKVA 3ITDA 1L4EA 1QK4A 1U94A 1UBRS 3IOCA 4G1MB 4M1KA 5MGNA 3AOGA 2BZ0A 2JAUA 5BOVA 2VAPA 1X8JA 1Q7EA 2NPFA 5A6SB 1T0HB 4RABA 2AZXA 3H3FA 5FLYA 3KLMX 1GNPA 4MWTA 3UJHA 2O0KA 2ZK7A 1B1CA 4FZVA 4HWOA 4OXYA 2I7DA 4YRRA 5IWCA 2XBUA 1X7HA 2XNSA 3EIQA 3P71T 4IDNA 4PHFA 4XCXA 2BMAA 2HMWA 2Z5GA 4Y2PA 3EVZA 5DEIA 4EYEA 1YIOA 2ZAIA 4N54A 4D46A 3SC2A 2Y0PA 4MIEA 2QE7D 2AFIE 3ZS9A 5E9WA 1E6UA 2FPLA 3CZPA 1RR6A 3Q7RA 3EQ8A 3KT3A 1NQUA 5ALTA 1J23A 4MVJP 3UHAA 4EECA 3IEUA 4F2WA 3VNQA 5K3BA 1DJLA 2VDPB 4OBWA 5AYVA 4FOOA 2ECOA 4OXRA 2RGNC 5EXEA 4QHTA 1N7GA 3STVA 1NXSA 5FAXA 2FN8A 3O4GA 2IHKA 1PZFA 3MMSA 4AP5A 1XRPA 2P8JA 5A3RA 4Q15A 4TYMA 2HQBA 4LCEA 4NDNE 5JAQA 2V4ZA 1C81A 3P97A 4HS9A 3I30X 4KXVA 4QODA 2EFHB 3LNTA 1G55A 1TQ4A 2O8NA 4TYWA 3LFUA 4BFYA 1EWQA 1PEDA 2VLBA 3PQ7A 5J1TB 4BE7B 2X9GA 2ZDGA 4DCTA 1DCMA 2PRIA 1IN4A 3R5FA 3REQB 2QM7A 3IODA 2ZYWX 1QM5A 3PHHA 2BWJA 3H9BA 4KE7A 4TV9B 3UEOA 1ETHA 4WY5A 1QQ5A 5HUJA 1TCUA 2GHRA 3H4IA 4PLTA 1W4ZA 3PKIA 2ILVA 1C1HA 3SHQA 3A4YA 2PH5A 1A5ZA 1NNUA 4UAJA 4O4IA 5SICE 1SULA 3NT5A 3U31A 2OAGA 2WIFA 1I2CA 1UMCB 2GEFA 2JAQA 3BAZA 5HIKA 1EDBA 3GFQA 1IEWA 1OBVA 2FEPA 4PRLA 4C4ZA 1SVOA 1PG0A 2ZTSA 1EJ2A 4FDVA 3VNSA 2PO7A 1RQLA 2WWHA 3DV0B 4Z0TA 3ETEA 1C3VA 4ABYA 4M99A 2ID9A 1LS6A 5EQJB 2YIDA 3DFIA 2E0IA 3UFXA 5IDQA 3TSCA 4P7JA 5IP5A 2PZBA 3GCZA 1X1DA 2OECA 2JJ1A 3GJXC 3JVDA 3MILA 4G01B 5GAJA 1B8NA 3WRYA 5A04A 1GLNA 1Z0DA 1FJGB 3E3LA 3L4BC 4D79A 2B1GA 2ZRAA 2LDXA 3NBZC 3RVLA 1HK7A 1A5AB 1J9EA 1RWMA 3G6WA 4RKWA 5M5BA 1XELA 4G67A 1OT3A 3HM2A 2VUIB 3AIIA 3N2GB 1V96A 4PZCA 5AJZA 4D7AA 1NP7A 1HZZC 3CH7A 1JZSA 1SXQA 2HWKA 1ZP6A 3EZGA 4UREA 2Q07A 4TTTS 2PXCA 4WNAB 4BQEA 1H2BA 1TJPB 5CM2Z 4JXXA 1FW8A 3K7EA 1FSSA 3S3TA 3IP9A 4AJJA 1JDNA 3A1UA 1KJZA 5KQSA 3QOYA 5CX1B 4A03A 1RC0A 3CLRD 1O97C 5JNRA 2OCAA 1EFVB 4B31A 5FBQB 2WD8A 3RLIA 1DJOA 4PFSA 4J0GA 3VR6A 3K9BA 1JQKA 1LNQA 2YWDA 8ADHA 3KKPA 2A84A 2QGZA 3I5XA 1A5SB 2BLLA 5BN3A 4WY2A 3C3CA 2GHIA 4KGXA 2PM8A 2XUZA 1I7DA 3CLSD 2AG1A 2GFQA 4JBNA 5IDXA 3JWJA 5BWCA 1U90A 4XJVA 1B15A 1YZUA 3G89A 1TU0A 1ESZA 4KGDA 4S05A 1E69A 4LTDA 3ZEAA 5HX7A 1LBHA 1SBCA 3DVLA 4W9NA 2HSEA 3VZSA 3PQFA 3HKBA 1ADYA 2UAGA 4BMNA 1ESNA 3QXCA 2PS3A 2G82A 1C7EA 5LQDA 2D1FA 3A6EA 5ENZA 1FDTA 5DP2A 3P9ZA 4MDFA 3U3OA 1OYVA 1NFQA 2XNKA 5JFOA 5CCBA 1SG9A 3AK4A 2Q4DA 3F5QA 1LDBA 4MI3A 3N2KA 3P9XA 1VE6A 4MGHA 3VTFA 3ZLTA 2ZUVA 3KB2A 3NAZA 3RT9A 3UAGA 3EIEA 1EG7A 2QUBA 4EKIA 1V4VA 4EHDA 2FMTA 3SMQA 4EFKA 4QM7A 2GASA 3U13A 1A4IA 4M0DA 5TLSA 2PE5A 2X3YA 1CUYA 4Q9NA 4REOA 5AXDA 4O2AA 4F71A 1TAUA 5JDIC 3ZI4A 4BO7A 4JXZA 4ZKEA 1UXGA 2X1MA 5HNKA 3H6GA 4QGFA 3G0HA 2VHZA 5JSZB 3CNOA 4YP0A 2C00A 3SYLA 3HYRA 1VPWA 1PNVA 1G8FA 2M9MA 2QDKA 2VATA 4K9OA 3TDNA 1RKQA 3G9QA 3OQVA 4TLAA 2IC5A 4AWAA 3OPYI 1UK6A 2WWWA 4M0UA 3UT0A 3W9YA 4EY4A 4MS4B 2O3QA 3G88A 2YVKA 2AYZA 4YJ3F 1E0KA 3PFFA 1F2TA 1HDZA 1J8YF 1YBMA 4RQUA 5JDCC 5CA0A 4OHBA 3NV7A 4TMWA 1SEVA 3C7DB 3WGGA 2GXAA 3CX8A 1PZEA 3GQBB 3WK5A 1HDOA 4ZOAA 1CSEE 1CZRA 3U62A 1Z0UA 3VTAA 3SEZA 2M1ZA 1JKJB 3ZPXA 3EFEA 3NETA 3PCRB 3UWSA 4DLYA 4F6LA 2YHIB 3AG6A 1N2XA 3B5EA 1QS0A 3ADOA 3NV9A 1PZMA 4PYQA 4X97A 3VBCA 5JQGB 1G5HA 1N6PA 1OFUA 5LQMA 4FT2A 4YJFB 1HEUA 1R15A 4FGWA 3UXYA 1XEAA 5ESWA 4CM1A 1RNLA 1HKHA 2QORA 3D8UA 3K0HA 3CPSA 4I3HA 1X0VA 3BD7A 2XSZD 2H5JA 2I6TA 2I9PA 4PIPA 4RPKA 2J0QA 1H6CA 2O8CB 2CVPA 1VJCA 3B6EA 3HBAA 4Y0NA 2MHCA 3U4HA 4CU2A 5AJUA 4U1RA 1W87A 1YJ5A 4BFVA 1L4LA 5AVXA 4MV5A 1KZHA 3VYTB 3NLLA 3O8OA 1VE5A 2E9SA 4QBHA 3OBIA 1RAAA 3I9V1 2GBGA 1PDWA 1Q7RA 3IO5A 3MM4A 4GBJA 4MPJA 3ND8A 5I7RA 1PFVA 4K9NA 3GLHB 3TQHA 2W6MA 1PQUA 3HO6A 1SCNE 2HXYA 2QL7A 4QYMA 5JSFA 4U6SA 1JMKC 4TRJA 3FX2A 5ESXA 3UC9A 2FWRA 2QN8A 2XRMA 4ROSA 3ZLUA 2XUOA 4UBJA 4A92A 1QZUA 2ZIXB 1K6XA 4NCIA 1RYEA 1AUXA 4UCFA 2CJWA 3C4JA 4P7GA 3DVRX 2HU2A 4RZXA 3TYXA 4R0MA 2PKXA 3QYFA 4A6XA 1YK1A 4DYHA 1NNEA 4EG0A 1SRQA 1GPJA 3II6X 2NXWA 5F1YA 4FEAA 2BMFA 2FF5A 1JPNA 2OZLB 3LOPA 3QVMA 2MDTA 4B0PA 4EA9A 2B37A 3LRTA 5K0GA 4J4HA 1F51E 2BM0A 3VXKA 4EMSA 4FNGA 4GOLD 5FB3A 1LA2A 3DXFA 4PLYA 5TQ2B 3WYAA 4R8KA 3TGPA 2LE0A 2JCGA 2QXUA 4J16C 1S6YA 2P9CA 3P8ZA 1N6LA 1R4MB 1NBWB 2DYKA 3DEKA 4TQUS 5D2CA 5PNTA 3AF5A 4LRWA 1W49A 4CM3A 4ZHQF 4ATNA 3T7TA 4HQ6A 1RRCA 1BVRA 5C9ZA 2O5EA 4OAOA 5J63A 1ZMRA 3DWEX 4PHCA 3TRKA 1TX4B 2R4QA 4HSGA 5CRIA 5EUCA 5FLEX 3J7AC 4AT1A 2WJAA 4C4AA 2WINI 4JVMA 4TKVB 2WAOA 1G5IA 3LU1A 2VJYA 5FWYA 3HNOA 4OSOA 3RJTA 1J4AA 4LYYA 2D54A 4KREA 4OQFA 5LVAA 1UEIA 1FX1A 1A88A 5DHQA 5KTYA 2ZRPA 2PX8A 1UWCA 4KEAA 4BMSA 2HQ1A 3WHIA 3A04A 2J1LA 1ENZA 3F47A 4CDNA 1T0JB 3K0CA 2XVMA 4RTMA 3NBFA 1JIIA 4H7KA 1U8YA 9ABPA 2XB2A 3DP9A 3TS1A 3M6MD 2RJOA 4O8CA 1GGKA 1CPYA 1GQOA 4B83A 1Y8ZA 2R11A 2FZWA 3BICA 4G5XA 4TVBA 4H08A 5BW8A 5E8RA 3UZUA 1H4TA 4EYGA 3R20A 5CBKA 1N36B 2DF8A 1FVFA 2V6FA 1FU8A 4RPLA 4F4IA 4BRZA 4MROA 4GXRA 2ZBRA 3ZVMA 3BULA 3EXHC 2H0RA 3M82A 4HEJA 4RZQA 5HS4A 4YN3A 2P5YA 4TYQA 3M6XA 3WK4A 4D45A 1XZQA 3G0IA 2WJHA 3GR6A 3CB2A 2D1YA 2HU7A 4WXHA 3CGGA 4OLJA 3CMCO 4H2DA 1NIJA 1QRUA 1WVMA 1TUBB 4AUKA 3I9NA 1O5OA 5JMPA 5F76A 2Z8XA 4XD7D 4TXJA 3AB3A 4YJ2F 1Y9AA 1VDMA 5D6NA 3N28A 2NO5A 1ZGCA 3UPTA 3KHKA 2FRDA 3EBLA 4CKYA 4OY3A 3EXIB 4QWMA 1ZGZA 3JQQA 3B70A 4TV8B 4GMKA 1DRWA 3BMOA 1U3CA 2PKRA 4O4IB 4MUMA 3WL3A 5JTTA 2M2IA 2CCKA 4BLUA 5CNJA 1WB5A 5THQA 3DGFC 3ZXSA 5HRCA 4G0WA 4S1NA 2WU3A 3MJDA 3E03A 4ALNA 1LSUA 1U0EA 4HDNB 4L02A 4BVKA 3CA8A 3C98A 3GT3A 1CVRA 4G4IA 2QIOA 2WIBA 2YTZA 2JHCA 3HR7A 1K08A 4JJIA 4PLVA 4WECA 4WOJA 2Q3DA 4BFSA 4YP7A 4DXHA 5EIBC 3KQQA 3V8RA 5BQ3A 2PNFA 4G5SA 1SCKA 3EQ2A 2OR3A 1XEWY 5D1HA 2ZTVA 4HAWA 2OBLA 3BJIC 3QOFA 3Q8MA 5JROA 4UMVA 3DQPA 4KMRA 4CM9D 1DXYA 1Z73A 3U7JA 4LJYA 4O0LA 4YRKA 3A70A 3ROTA 2P67A 3V1YA 3V80A 3RIHA 4CF6A 3ETDA 2G76A 2WG2A 4QGGA 3RF6A 1ZA2A 1YB2A 1G8HA 2QRGA 2UV8A 1E5LA 1I2DA 4CIYA 2JNWA 2QB5A 4U9HS 5TMBA 3ZK9A 1H2RS 3RVRA 4F5EA 3LS2A 3ITKA 3S6JA 2I3BA 4WZZA 5KNBA 3D8BA 3H17A 1EBBA 1FFWA 1HEYA 1YZ3A 4HN4B 4MUBA 4QT0A 1E4YA 1PTJA 2GTPA 1PR6A 4Z53A 5IWAB 3TFQA 3X1WA 4ZYWA 1VSUA 3VSCA 1E4EB 5L9AA 4OI1A 4B9AA 4J16A 3E1SA 3OQOA 3G0DA 1DC7A 1BXZA 3TKYA 4F97A 5IAOA 3GELA 1THMA 1INLA 2F1HA 3P9KA 1II0A 4UBMA 4EJSC 1TQ6A 2XJ9A 2ZR9A 4HV4A 5CA1A 1ABBA 4CMJA 1KVUA 1XU4A 2J3DA 4GOND 4DC1A 4F1KA 4C07A 3HXKA 5K4GA 2C2XA 3Q8KA 4MYHA 3S1AB 1XC7A 3BIJA 5JTUA 5LYJB 4M1OA 1R0ZA 3IKMB 3DT6A 4RXMA 4H31A 4HFJA 1IM5A 1BH6A 4XIGS 1AKMA 1J00A 2G06A 4Q9HA 1T0BA 2EHDA 5EMKA 1JYFA 5JRDS 3ZQ6A 2VCEA 4MQ6A 4C2AA 2CHFA 2Q3LA 1ZUD1 3AZQA 1M6VB 4WNIA 1LVGA 3C43A 2VJDA 3WV4A 4X1KB 3PTZA 2GKGA 4GWGA 3ZHYA 3A1VA 2XYPA 2F3PA 1UPXA 4FC6A 3PNBA 4O1IA 1H42A 5EQTA 3W2GA 1S96A 4OAPA 5JZSA 2HF9A 2RHLA 3OJLA 5FBKA 5HP4A 4FZ3A 6CHYA 4ZA2A 5LD2B 3OOHA 1WU8A 3KELA 3RJMA 4ZGGA 2O3RA 4KN6A 4MEJA 5KDOA 1HT2E 1UBLS 3PHLA 4LSZA 3F5DA 4QXPA 3K94A 2ZUTA 3VHXB 1IXZA 3X1DA 5CFLA 3V4ZA 2C9ZA 3KB6A 2VZEA 1PCXA 3EISA 4FFSA 1N7IA 1YXMA 4WKPA 2O8FB 2PFGA 4JMPA 3PZRA 2YFQA 3P2YA 4LHSA 1JI3A 1Y9EA 5BVGB 4NK4A 3E3AA 2H8KA 3EOAI 1FMFA 2FJUA 3TNDA 5K8IA 1RHMA 3ICVA 3ZDXB 5CA0B 1NXXA 3E5NA 4GR9A 1NQOA 2QE7A 4R1OA 2CNOA 2ZSFA 3GAAA 4FD2A 4FCCA 3W8EA 3JYLA 3ANXA 5ITWA 2BFEA 5LQJA 4EW6A 3CNEA 2WVGA 1XN4A 2BUBA 3IE0A 1G7SA 3NJ4A 4BMDA 4EB6B 4PYKA 5CDUA 4RDCA 5HXAA 3VI4B 1YHZA 3O0TA 2FSPA 4FU0A 2IUFA 4RHEA 4ASUA 1NWHA 2D8MA 1DRKA 2XB6A 3AUYA 1XZKA 2IXBA 2KPOA 4QFDA 1W44A 3MWYW 2RCYA 5C8ZA 4RTKA 1E1QA 2B6HA 1XLUA 2D2IA 2FRXA 2AV6A 3X0DA 1NBIA 1XDGA 1Y4DE 1I3MA 2B2CA 5C31A 5LZ5A 3EH1A 5L95A 1J8FA 1O2DA 1U2PA 4RTPA 2XKKA 5BYKA 3K4HA 3V4OA 3DDOA 2GETA 1JSZA 4LG1A 5AFSA 2GZSA 1X6VA 2DQYA 1PEAA 1VG1A 4G25A 3IAM6 1XZHA 4MDYA 1RIIA 4URZR 4E5YA 4POOA 4QBIA 2FOIA 2F4VB 2OGUA 4ZALA 3RIMA 1E9DA 4MPRA 1XKLA 3IIJA 3FN4A 1YQTA 1GSIA 1F4LA 1GPNA 1UFKA 1UKZA 1W94A 4Q16A 3UMFA 5A02A 3UMMA 5A9SA 1CUVA 1Q14A 3AI7A 1XX6A 3ESXA 3FPLA 4ETNA 4DSNA 2VDJA 4P0PB 3NB0A 3QENA 2YZNA 4GT1A 2WA1A 4HQ0A 3LQQA 1TA0A 2X0NA 4TVOA 2ZBDA 2N0SA 1GVHA 3HFSA 1X9IA 3ONFA 2B8EA 4Q4JB 1M8KA 3NXSA 2SBTA 1Q0ZA 1U8XX 3CTMA 3R6GA 1ZVQA 4TSFD 5ALKA 4CL2A 1C3JA 1MTOA 5F51A 1NP3A 2OMEA 4C6TA 4YA6A 4OL0A 2QW0X 5TMEA 1J6UA 3OQNA 1GAQA 2X0DA 5FAKA 4JYPA 1GG9A 3E8XA 2A9PA 4N7JA 2OHOA 2G25A 1X7XB 4WLEA 2UDPA 3W2FA 3DLHA 1KFJB 2QRJA 2JFBA 3RR2A 3UMJA 1U5AA 2KBEA 3JWEA 3COPA 4RHFA 3TVYA 5CXQA 3A1WA 2BI8A 2OO5A 2JJMA 1TO6A 4B2LA 4NCJA 1TVKA 4CKEB 3RTEA 3IV9A 4OB7A 5HOEA 1M66A 1W6RA 4ENQA 1DMSA 3PJEA 4FCVA 3NWBA 4MIKA 4ZREA 3GZTB 3UWDA 3WZMA 1B41A 3PP8A 4C3ZA 2C4WA 4JI8B 1J0DA 1OA0A 2CK3D 3RSQA 1R18A 2A57A 2VNHA 5DV9A 4DDVA 1I33A 2FW6A 1OX5A 1Y0BA 1GCGA 3ISJA 2FZGA 4UNQA 5J4LA 1Z5OA 2O0HA 2REXB 3QE2A 2PWPA 2V1XA 2Q9CA 1QYRA 1Z88A 2X2FA 2DQZA 5IJ9A 1P60A 2XUPA 1PX2A 1AKNA 2ZANA 1C4KA 4Z86A 3ET4A 3GT7A 2VFAA 1HE5A 1KEPA 4NRDA 1BXGA 2JI9A 3AR8A 3ONNA 5KC8A 1NJGA 1XU7A 1TZJA 5BSEA 3V9AA 2YOFA 4NU0A 1D1SA 3HG7A 3K9FC 4C4RA 2H2AA 2IYAA 2VR1A 2DWCA 5CAEB 2IELA 4WFKA 1QTNA 1T5SA 1A2OA 3CUTA 5LBTA 3HDGA 3GPLA 4BMXA 2NACA 1SRRA 4MHSA 5JISA 3SD7A 5J3JA 1ILWA 2QF7A 3C1OA 3FKJA 4V39A 1TPZA 2VH1A 3TZ6A 4EM6A 1DPGA 2JKZA 2M98A 2R6DA 2RG1A 5DYGA 4Z2AA 2PYDA 1K75A 4Z8XA 1OFUX 1ISIA 1IY0A 3TLEA 1RE0A 1TTHA 1E1KA 1GGEA 3SLGA 1R0YA 1G8JA 3DAYA 1F2VA 4MW7A 1EMDA 2IXGA 2D00A 4G8DA 1K1EA 1M1XB 4MXDA 3JASB 4A82A 5AJWA 4RDHA 5G2OA 3FTFA 3FVRA 1T5OA 3F9RA 5EWJA 4LFCB 4UQPA 1A7JA 1N0WA 1BKYA 3CRNA 1U9IC 1WSAA 2IUYA 3JQFA 3O75A 1ZZGA 4ZV9A 1R10A 2ICAA 3K0FA 1PHPA 1MJ5A 4KNYA 4O2AB 3R5SA 5DHAA 1ZJ4A 4G4JA 4IG4A 4NCBA 1DO2A 3BXFA 4LHYA 5SYMA 1NJSA 3IDZA 3AY6A 4AC9A 2HA4A 3JRNA 3MJTA 2JBHA 4LXUA 1YR9A 1P1CA 3R8FA 1S01A 1Z39A 2AD1A 1JA1A 1E2HA 3KQVA 2W2OA 1U8FO 1KO7A 5FD8A 3SNKA 5L40A 4O2BB 3SEAA 3LO5A 3SYRA 4BNLA 4B7ZA 2ECQA 4ZKDA 4GX2A 2HHHB 2HF8A 4YAKA 1NW6A 4TZTA 3A7DA 5TJHA 2POCA 1NSTA 4QOFA 1ZYUA 4BNDA 2QD1A 5G53C 2QQEA 1EXDA 4RWEA 2Y1DA 2WMYA 1FNMA 1EFTA 5I7SA 2X5KO 1LLCA 4B4WA 4MEBA 4EW3A 3EMBA 4F0JA 5J47A 2IHNA 1W5BA 2OC4A 1N57A 1GYRA 3GB9A 2C5SA 2VJPA 3GD5A 5G0SA 3GVXA 3AEUB 3OC0A 4EZIA 3L8FA 2GFIA 4GLBA 3AEXA 3NJ8A 2ZTUA 4RHUA 2G4CA 2YHIA 4DFDA 4TKUB 5ETJA 3AR7A 4KYVA 1YCDA 3Q3JB 3R3YA 2PL5A 4P84A 2CLEB 2YZKA 3QTLA 1P29A 4DIFA 2B94A 4AVYA 3GFFA 1O0SA 1AKTA 1ZN9A 2Z8YA 1PIWA 5E7QA 2DT5A 4HNQA 1QFXA 1LZLA 3F6RA 1A8UA 2H4FA 5IAGA 2PD3A 3L7KA 1JS1X 1DBIA 3DZJA 1XWWA 4F3TA 2CE2X 6LDHA 1HTTA 2W2QA 4DNFA 5H0IA 2W98A 4FOSA 4K3UA 4EHIA 3V8PA 4GPD1 2DFPA 1EXWA 5H9WA 2ZUEA 1GGMA 3QEAZ 3PXDA 4R98A 4IJUA 4J07A 1RJGA 5HVNA 2ZULA 4NOLA 5KNBD 1SM4A 2I8CA 2PRKA 3L8GA 2Q50A 1VHWA 2FLKA 2UUAB 1C8VB 5LFAA 4II7A 2JK0A 2SICE 5F9FA 2GBFA 4TS9A 4M0CA 3WMFA 3M1LA 2QJWA 2R7NA 4KQFA 4WXPA 5G40A 3FDXA 4H7IA 4YQYA 1GSHA 3FNRA 5HA5A 1BQ4A 1K6MA 4LZAA 3NHBA 3FHLA 1R3UA 1A9OA 5FBZA 3GEGA 1R8XA 1FRQA 3T4EA 4GGPA 4EJSB 4DXDA 1LW6E 1UBEA 1TAQA 2PMDA 4M8IA 3ZI0A 2HGZA 4PAOA 4BFUA 2ONZA 2CL6X 5TE9A 2Y93A 1VHDA 4LSWA 4OQ4A 3F6EX 4M8NE 5EP3A 1NY5A 3I5MA 2JRCA 3EVCA 4QYIA 3KKLA 1XRNA 1M2WA 3WYEA 1Y82A 1M2KA 1H0KA 2ZWMA 3QKIA 2AF4C 3BCRA 3W3AD 2Q28A 1GNSA 2D4AA 2G83A 1CG6A 3FMVA 5B2ZA 4M7OA 3RNOA 3D3QA 2IQ5A 3NT4A 3R3ZA 2ZSKA 5EXTA 1GXSB 2HYDA 5T64A 3ZDQA 5EJ9A 3KQHA 1R9GA 1WBBA 1ZBDA 4QBFA 2GPYA 4R7GA 3U3XA 2H65A 4LGMA 1BNCA 2DAPA 1CRLA 5EKTA 4MYRA 3ZCQA 1YS2X 1F7UA 4JL5A 4GVPA 3R0VA 2VTVA 4NONA 4ND2A 3TXYA 4FCTA 4Z7QB 1ONNA 3U0VA 3SKYA 2QTFA 1UKYA 4Q18A 1JG3A 4FLFA 3KVOA 2CNLA 1PK9A 1IC6A 3F3KA 2MMGA 1U0LA 1UXOA 1P44A 2EEPA 3UY4A 1OXKB 4GPZA 5J2TF 1F3LA 2HM7A 1CT9A 3FPEA 3WI7A 1OBOA 2VTEA 1JLKA 2RHTA 1ECJA 1GUDA 1YOBA 3BCUA 4WK0B 2AI1A 4CF4A 4EVRA 5JAZA 1T6NA 3ZWNA 2FMIA 1M8JA 1NFFA 1DARA 3LVBA 4RYLA 1E1NA 1J1ZA 4ZYYA 1E79A 1T8PA 3TI7A 2FPGA 3L4EA 1IRXA 4WFIA 1KO8A 1UQTA 3CRVA 4CTKA 1XQWA 3IOBA 2BGTA 1QB7A 1SN7A 2FEKA 2EHJA 3IA2A 1P3Y1 4GYWA 1Y4SA 3VX3A 2RMKA 2C84A 4C4TA 2JJ2A 3CZRA 1G8GA 4M1MA 1FQWA 4QPCA 1XF1A 2FK7A 3QPCA 4HD8A 4Q37A 3RBAA 3RTCA 5B1HA 2C7RA 1YNSA 5HRAA 1E2MA 4JQZA 2J3LA 1JSXA 2VP4A 1ZICA 1QQTA 2EG9A 2HBZA 2QY9A 2H6EA 1JHXA 4EI2A 1TTPB 2VUUA 2XA9A 5ICMA 4HVCA 4C4XA 2PSDA 1ZIYA 3L8MA 4G5GA 3IEIA 3NYRA 5EE3A 3GDOA 5CVDA 3MW8A 1FF9A 4REQB 3ZBPA 4BVBA 1F06A 2AQIA 1IPHA 4HYTA 1OI7A 3IEVA 4BNZA 3OX2A 3P2MA 2QMYA 2XDAA 1X42A 4LC0A 2B4RO 3VISA 3B1XA 3KXPA 4Q4JA 1WHSA 1M2JA 3L77A 5JCXA 5CFNA 2Z95A 4TTJA 3U4AA 7AT1A 2LV8A 4ZAGA 3OE1A 3TPCA 2N1MA 2JANA 4UM8B 4BWYA 1T2EA 5CDTA 1A9XA 3EXAA 3IAS6 2BCEA 4P3KA 1N5MA 4KTTE 2Y2UA 4Q03A 2V0CA 5B58T 1BHJA 5CBPA 4GNKA 2J6BA 1GL7A 2VC2B 3PVSA 3KFLA 2PCLA 1IUOA 3EOBI 2OTCA 1GKLA 1W5TA 2HMAA 3DDCA 5F21A 3ZI7A 3DOCA 4C6HA 5AW3A 3TGLA 2D74A 3U4MA 4H1VA 4OYYA 2ZGVA 5IKPA 2HWUA 1D07A 3FYUC 5TQ0A 4AXBA 1MA0A 5AM2A 3QLJA 1W4AA 3TLKA 4B47A 4ZXFA 5AKKA 2NUAB 3RAGA 5K0ZA 1XP8A 2YIVX 4GGOA 3FNBA 3NVDA 4XARA 4I9HA 3O8LA 4GMXA 1E9AA 4HBZA 3LYAA 4OMDA 5DBHX 1SHLA 4NULA 4HX9A 5AKYA 3QGMA 4MUFA 2WVHA 3M83A 4WCVA 4CTJA 5JT1A 1SD1A 4DADA 2QRUA 3ZGVA 1HNXB 3ERCA 2VK4A 1SXJC 4Z0NA 3BQ9A 4J0IA 3L1KA 5AHRA 3VYUB 2QTHA 2G28A 3CIOA 2CN1A 2OPBA 3IHTA 4DLUA 2EBFX 5C3MA 4L0QA 1L2TA 2QAGA 2Z4TA 5DM4A 1XTQA 3O93A 4BGIA 2YW2A 3LI2A 2QN3A 1KI8A 1Z4IA 1Z34A 1NYLA 1UIMA 1PJTA 3WLLA 4E13A 4HLQB 2O1SA 1CNEA 3AO0B 3G68A 3JYNA 1E1QD 1EINA 1E3WA 1VIYA 1Y1RA 3WB0A 1IBCA 3WBJA 2PT9A 1HY3A 2OE2A 5BXQC 4X61A 5FI3A 1R12A 1U0HC 2GVNA 1F4PA 3X1ZA 3I6BA 3ANNA 2XMCA 2DCMA 4D8TA 2GEBA 2I91A 1M2VB 4IZ6A 2IOQA 1XAGA 2B30A 3DBRB 2GAIA 3HUDA 2EFEB 4G5FA 4HWTA 4WK2B 4A1FA 4DCVA 4DT1A 2WD9A 2JA2A 3MBIA 4X60A 4PEVA 3IO3A 1WMFA 1YO6A 3UHPA 4DF3A 3TZQA 3FI0A 5THXA 4YRGA 4ZI7A 3HACA 3FFTA 2AXEA 4Q9AA 4DV3B 2C2OA 3GRKA 1NVTA 2YNMD 3FNGA 3FTDA 2YIJA 4BX3A 1ICIA 2IOFA 5A5GA 1I0ZA 4Y1FA 1U04A 5DWVA 1EE2A 4MWGA 1ZSNA 3VJRA 1J9GA 2Z5VA 1KSFX 3RDPA 3RLFA 4M9CA 1SHZA 2AJCA 3IDQA 1LB1B 4N3BA 4CIAA 2O8EA 3PFIA 4RGYA 4D74A 1E0JA 1QX4A 3PXBA 3V1NA 3BGDA 3LDAA 3LHDA 5THKA 5J4YA 1EFPA 2NYAA 3UPUA 2H1FA 2EJBA 1H1LA 2SKCA 2Z8YM 5BYJA 3K0EA 2PUVA 3H8JA 5FL7A 2PXHA 4UBOA 4OHUA 2F17A 4UPEA 3N0XA 4PC7A 2P9JA 4AUEA 2GBPA 5IK2A 3GJRA 4D57A 4PNEA 2R00C 3B2NA 1MHPA 1YFZA 3DB2A 4ZYVA 2KJQA 5C3UA 4OFBA 4DEXA 3OA2A 1A04A 1BW9A 3PDIB 1KMHB 4KX3A 3C5VA 2JATA 2ZRQA 4HOYA 1OLOA 5DTRA 4CMIA 4D2IA 1X1TA 1OAAA 3AESB 4G0VA 1DIBA 2QT0A 2YV3A 4Q4AB 1MRZA 2P6MA 3DC2A 5EJ5A 2DLCX 3V7YA 4KPEC 1W36D 1HQKA 5JYDA 3CUUA 1O1YA 3ZWYA 2A5FA 2FGJA 2ZJYA 2O3JA 1ORHA 4IZOA 4QPPA 4RZIA 5LP1A 4JUAA 3ZYZA 1RACA 5L45A 4KHPB 2ZE6A 1NHWA 4XB1A 3H9GA 3NAMA 1W93A 1AGXA 3AHFA 3TM5A 4Z4QA 4NFSA 4EB6A 1J8DA 1DFHA 4N48A 1ITZA 2CDRA 2JKYA 4W7IA 3VSDA 4QG3A 3D4LA 3T38A 5KZMB 1JMVA 4FK8A 4JC4A 2EP7A 4RH1A 5KKAA 5KDDA 5M04A 3SK0A 4WCFA 5GTDA 3PG5A 3ZBUA 4Z4FA 1KJ8A 2VRCA 3RC9A 4WZBB 5HIAA 2O5CA 1YVPA 1BHSA 4TMXA 3SHTA 4S0ZA 4D4JA 1AC5A 4MTCA 2I99A 1Q3KA 1DRJA 2G5GX 1TKAA 2ZQZA 3JVEA 3K4PA 1ZRMA 5J9FA 4FYKA 3KKOA 4LECA 2CSUA 3L5KA 1NJ1A 3VC3A 1J25A 3SQMA 3L7OA 3KUCA 4HH3C 1N2HA 3M6IA 2ET6A 3IDAA 1WNFA 1A76A 4TXLA 1CY8A 3R3JA 1Q6ZA 5LJLA 3A3YA 1YZHA 2HK7A 2QRMA 5TNXA 3EQ7A 4FN4A 3DW1X 3U6BA 4LW8A 2G6TA 1NN1A 4GX0A 3OZIA 3A11A 5IKXA 1OKKD 2OM6A 2V6MA 3DYVA 4LXQA 5TPZA 1YVEI 5AKXA 3GLUA 3ZDFA 3LQ4A 4WKBA 4NAVA 5EKUA 3MPOA 2GEUA 4BBZA 4L8YA 2FX3A 5CFZA 4DILA 2EBUA 3V1TC 1RAIA 3VAAA 5I9LA 4PRKA 3RRYA 4DV4B 1NRWA 2HEGA 4A91A 4LQCA 1KJIA 3REOA 5LL6P 3Q7SA 3PLNA 4XH9B 5AT1A 2I87A 5L8VA 1O97D 1K7EB 4BJ1A 5BSHA 1J8MF 3B6KA 3BQNB 2W6IA 4ML3A 3I1JA 3OEHD 3DTYA 3P96A 2ZG6A 4JVSB 4DIDA 3FPJA 1KRXA 3BWVA 2FG7C 4TL6A 4HFMA 3TW6A 2VT7A 2RBKA 2ON6A 4GLOA 4C03A 2HSGA 4PZAA 2B25A 2OHGA 4F96A 4MJ3A 4MQBA 4NYMQ 5TB5A 1XQVA 1JFFB 3NTRA 4MLZA 4F2GA 2OQVA 1GM5A 4MGZR 5E38A 5I7OA 3ANTA 4BZPA 4NH4A 3ENNA 2RKWA 1EHYA 3QY0A 2CVFA 4Y2GA 1ORWA 2AKYA 2PPVA 2VSNA 5LXTB 1CTQA 4IJMA 5L4LA 2O50A 4LN1A 1G5RA 4KSCA 1U3VA 1OIWA 4QUDA 3VR6H 2OLKA 2XMBA 1X7YA 3BWBA 4G6ZA 1N8KA 4LYJA 4BO0A 1JTFA 3JR3A 3V7FA 1QRAA 2G08A 4HGYA 4GEGA 5M3BA 1KJYA 1USVA 3BC1A 4C0QC 4AJPA 1BHQ1 1ELOA 3GUVA 2NXJA 2YNMC 1LDGA 3FB4A 4B87A 4CEIA 3RADC 1EP9A 3HPQA 3CBGA 1GL6A 3CUVA 3QOWA 4L85A 3JD1A 2BGGA 3OOYA 2W8BB 4KFRA 4B3MB 4A6EA 5D3ZA 3QXSA 2NSHA 3C41J 4KJXA 3Q9NA 4LUCA 1E98A 3WA7A 2ADMA 1AKQA 3CF4G 1CJVC 1JFLA 3IPLA 4PX9A 1VL1A 2I6XA 4RLHA 4ZDJA 1SKMA 1TD1A 4CG0A 1N2SA 4K86A 4O6VA 2VZ8A 3H11A 1KU6A 2HRRA 4J0HA 2NZXA 1OOEA 5CW2A 4KO8A 3ROQA 4CN9A 2XQJA 3KT6A 4QC2A 4C1NA 4U9IS 5ADHA 1MAWA 1VHLA 4B44A 4ZIRB 2VHJA 2X0FA 1T9GR 4RSGA 3OQHA 5AK3A 4YXWA 3NC4A 1EPUA 1V39A 1HTBA 2VHEA 2PJRA 1D2EA 2OCYC 3CN7A 1R8JA 5JS8A 3NHLA 3NR2A 3EW9A 4J0JA 3WDSA 3ZWDA 5KVSA 4DVJA 2O8FA 4JI6B 1GKIA 2V03A 1QVWA 4J1QA 4CIDA 3ZCPA 4D8WA 1JXAA 2AJTA 2XGMA 3QVWA 3SFZA 1KWKA 1CUGA 1SUAA 1WXEA 4YV1A 1WEKA 3D8NA 1E2PA 4Q00A 3UPDA 4M9SA 3WMEA 1UP7A 3GXBA 2MU1A 4A2CA 4DNOA 2FUKA 1GDTA 2DVMA 2BE7A 3CLSC 3JWHA 3G1TA 4CLRB 4P7FA 1K8YB 5ECDA 3WHKA 2V4MA 4Q9DA 4PBRA 4UHCA 1TYAE 1U6JA 2ECFA 5GOTA 2GSDA 4KQKA 2OYCA 1GGVA 4B6FA 5JD6A 1JPUA 3VKUA 5JCJA 3W34A 4DQXA 1UJ4A 2R1VA 3TQFA 2PZAA 4CIBA 3AVTA 3DLIA 1H6AA 1QOZA 2I66A 3C8MA 5DTQA 4YJ2A 4RVNA 2C96A 2CJYA 2VQDA 4ON9A 1SVWA 2ZT7A 3RRZA 3U3RA 3WL6A 4PTZA 4DSTA 1VE9A 4TKMA 2BR5A 2YJ5A 4UM5A 1OX6A 5AJVB 3O03A 2CJFA 3UK1A 1XMVA 3V34A 3ZGLA 1Z2CA 4F4FA 1NLMA 3GHYA 2GD1O 4DNPA 3OKPA 1R5NA 3EGVA 3QF7A 5A5VA 5I5EA 4O02B 1DRUA 4R4JA 1PDOA 3AWIA 1Z4KA 3COVA 3KOWA 2YXPX 2B4AA 1RYMA 2IEDA 2ONYA 3OQIB 2IIQA 3EW7A 4IHAA 4OHRA 4UASA 4YMIA 3ZIAA 4AL4A 4DMMA 5CYGA 5K0JA 1H4QA 1CUXA 1CD5A 1X80A 4D0GA 2CKMA 2P5TB 3DEAA 1QYXA 4IQ4A 1X92A 3V1KA 2EZ8A 3OKCA 4IJ6A 1MMFB 5DOZA 5HKLA 3U1VA 4BLWA 1PNTA 3BE8A 3SHOA 1D2AA 3UC5A 4AS2A 1FZTA 4DC0A 1K06A 2ZPAA 5LIPA 1UJCA 3PC2A 1ZRHA 3C3JA 3EDQA 3PJDA 5CLQA 4IGKA 5EKDA 4AF7A 1TVEA 3D8RA 2I62A 2CXPA 1SKUA 3GHHA 3LQKA 3RFXA 2CNWA 1GILA 3I28A 3Q41A 4UAVA 1KMMA 4YT2A 4GDMA 1S4MA 3A32A 2AQHA 5IC5A 3C3MA 4NJEB 4JGIA 2BMVA 3ETGA 3FBTA 4YJDA 2D7DA 3UJNA 3H9QA 1YS9A 2I7TA 3ZKWA 2VYVA 5DSXA 1ULAA 4PLZA 5FADA 4NC9A 1NL3A 4BNTA 4CUJA 2ZXFA 1HM5A 3FZNA 3IP5A 3MWDA 3UFXB 4TPKA 4KC0A 1H1LB 1SCDA 1E0SA 4EOGA 2OUIA 2VDWA 1K5HA 2FSVC 3E18A 2CDNA 2XRYA 3TOXA 4R3WA 1CF4A 1C9EA 3Q3GE 1VCIA 4HAUA 4HMPA 4D9KA 3WGOA 4ZVQA 1M1YA 1US8B 5DHTA 1FS4A 3BCSA 4BO4A 4HGNA 4C5CA 1D2GA 1WV1A 3PU6A 1WCWA 2GI4A 3U5TA 1QORA 4YMHA 2CWDA 4DMKA 4QICA 1WHSB 4MO9A 5AW2A 2IYPA 2JGKA 3QQ5A 5JI2E 2O5RA 5KVCA 3CVXA 4FFDA 4ODIA 3RK1A 3TUJC 4A2QA 4C7KA 1KKLA 5KYUB 4DV5B 2G63A 1GTRA 2H51A 1WG8A 1XNGA 2Z1MA 1XGKA 4Q05A 4BB5A 4IYRA 4E32A 2DJIA 3AF2A 5IZ4A 3R8CA 1HDXA 3U80A 1JF8A 5IH3A 2WZQA 2RI6A 1E8DA 2P9QA 4BDSA 2IH4A 1H5UA 4Q1EA 3QPUA 4CKEA 4I36A 4XQ0A 3NX4A 3K5IA 4IJVA 1JJAA 3V2HA 1Q2UA 2O3TA 3GGCA 4JC8A 5AD1A 1TUEA 5JZVA 3R9KA 4B3CA 2FMHA 2AC4A 5C2JB 1BXRA 3ZY4A 5LYJF 3PVZA 4RGVA 3QBVA 3T5TA 4LF6B 1UZMA 4REMA 2LDBA 1PJZA 1P0CA 2ZWVA 1NTRA 5A7FA 1EX6A 3N3BC 4CN8A 2JFFA 2ZSAA 3BSFA 3LECA 2V5VA 2YUIA 3SVLA 4ENUA 1W85B 3OG9A 4XE5A 5EEGA 4AZTA 4X93A 5EZYA 3DZIA 5IJXA 3R5JA 1OYYA 4OUKX 4OHZA 4EF4A 3EZ2A 1CS0A 3R7NA 4BX0A 1G18A 3QWBA 4H77A 3P32A 2CB9A 2Q1TA 3DE0X 4E7OA 3ENVA 5FP0A 2V1UA 5J4HA 4L7QA 1P0IA 2I55A 3L7JA 1GJRA 2N46A 3SG0A 4OA5A 4JT4A 4ZFNA 3U2QA 1OREA 4AJ2A 4KXMA 1TXGA 1XI2A 7MDHA 5I5GA 2CYAA 3K2IA 4UNRA 3I6ZA 2NYRA 3C3PA 1DCFA 2YYAA 3BYZA 1LC3A 1EFLA 5JARA 3FH0A 2VNJA 4HVTA 1KK2A 2NXCA 5TVGA 5H68A 2GHQA 1CEQA 4FHGA 1ETUA 3DL2A 3KKNA 2BFBA 2SNIE 3F7NA 3HHPA 3K05A 3BWEA 2PUHA 1Y63A 3KAPA 2LCQA 3PJRA 4CDMA 3JVUA 4TZ6A 1CZKA 1FVOA 1T34A 1CQPA 1EEXB 3JALA 4FDMA 2R60A 4GZ3A 5LU9A 3CE6A 3BZBA 4G56A 1JHYA 2PUFA 3D0OA 4UDNA 3EXIA 1M8FA 4EY3A 4KQ6A 3T3OA 2EG5A 4NDZA 5DTEA 2J0SA 2C4NA 3IAFA 4GECA 1T8TA 1XDBA 2A5YB 1QK3A 3AQIA 3F46A 1C0KA 4GFDA 4J2OA 2WVJA 3H1AA 2B4TO 3IVCA 4UFPA 1PG5A 1MA3A 4R6XA 4CKWB 4RMNA 2MOKA 2BELA 3PUHA 1GR0A 3W2EA 1KZ7B 2ENUA 2Z04A 2XVZA 3GCGA 1KQOA 2C2HA 3EWSA 3JTEA 3QYAA 2CUNA 1NAHA 3DD1A 4GO1A 4X71A 4ZVSA 3FVVA 5FBHA 2ADFA 4DREA 4QU0A 4F3NA 4N03A 4EG4A 5MHTA 1N6OA 1W4RA 2XY4A 1AS0A 1XL0A 2I54A 2H31A 4HNUA 2CBXA 1Y6GA 4YJGA 3R7LA 1KFBB 1E92A 4DMHA 4YUZA 3CUSA 1QGDA 1Y81A 3DKKA 3EOZA 3RU9A 2XBMA 1F4VA 3VO2A 3KV3O 3KLNA 3U4DA 3ZY6A 4EPYA 2O0LA 1QU2A 4QTYA 4KQCA 3WAGA 4MCHA 1SC1A 4QHSA 1E7QA 4RJKA 1YA8A 4DLVA 3L4SO 3KXIA 1IBLB 4I1PA 2FEOA 1Y8RA 2NPIA 2Z3ZA 4UUAA 4BCDA 3T3GA 1QHYA 1Z0ZA 4ONEA 3CZAA 4BO2A 1N7HA 2WB4A 3KZ1E 4H3VA 4ZOQI 1YUNA 2COUA 5IAKA 3RSZA 1QRDA 3VRHA 3FE2A 4HYYA 3HK2A 4LAFA 4L74A 1USWA 4GRAA 1Z3IX 1VCOA 2XUDA 4IDCA 4MS3A 4CRWB 1IHXA 4D9IA 5C5DA 2YN0A 2BEVB 2XWQA 2FJPA 2ZSIA 1G6Q1 3X1YA 2XITA 2C3PA 2P65A 3FB1A 3GQVA 4E6EA 3J81k 5DM60 3IPCA 4ZZ0A 4H1UA 4NICA 2YN2A 5CDSA 1SD2A 3U3JA 2DG2A 3MC1A 4PLFA 4MLCA 3Q3EA 4HB0A 4HPJB 1B43A 3GNSA 3RK4A 3K1AB 1ODTC 1HE8B 1Y8RB 2P4EA 2BEUA 4L8LA 1RJEA 2Z9BA 4RE6A 4QDJA 1OH8A 2XZTA 3GL9A 1I9CA 1ND6A 1DB3A 1SUEA 3GLFE 1WKBA 3RF7A 3E61A 3KPUA 1YZVA 2R7LA 5LZ9A 4Q0MA 4KWIA 4AJEA 5FEUA 1ZVMA 1Z56C 2ZEJA 5DJ5A 3UUEA 4Z1OA 3NHRA 3DPSA 3NBKA 4C4SA 1XZIA 3GRRA 4U6QA 4QDZA 2PANA 1Y1KE 2D1SA 3M6VA 1PVOA 4M54A 5B57C 2FQXA 4JP3A 2GEVA 1U80A 4HADA 1GFZA 3BSSA 4KRFA 4EO7A 2BTEA 1K2WA 3KKMA 3OCUA 4KBFA 4JOCA 4PANA 2O5VA 2UZ0A 1RM4A 2IK8A 2Z57A 3LVRE 3PXAA 1LQTA 4BEWA 1FQKA 1RAEA 5B5SA 5J2UA 1ZVVA 1JDBB 3KYDB 4UBIA 3HCPA 4OHFA 2PUAA 3O21A 2RB4A 4GLFA 1BEZA 5HYVA 3DTVB 3IAM1 2OENG 5TVKA 4OSPA 4PSCA 2ZS7A 3UVEA 4H18A 5JSHA 3QE0A 2WJJA 2GA9A 2W48A 4O59O 1OR8A 3B8HA 4TX1A 3ZVLA 4TZ0A 3ODPA 2V58A 1L5KA 3HMKA 1F5NA 2P2SA 3H2JA 3F2IA 1AKUA 4NU8X 4QFCA 4YJ2B 4YQZA 5TR9A 4E5MA 4DB4A 2WUGA 4MO2A 2G04A 1YR7A 3HEMA 4JFRA 3FLBA 2ZAGA 2UYYA 5JDIA 5LMCA 1F2UA 1C1XB 4MR8A 1JTEA 2OGTA 2RI0A 1FFXA 1Y9ZA 2XB4A 4DHWA 4FM9A 2C2KA 2PBLA 5EHGA 3I39X 2PD6A 3NBXX 3UQZA 2V7VA 2A2ZA 3ELBA 3TZEA 4QOSA 3QNWA 2IXAA 1YKFA 3I9KA 4I8XA 2Y6UA 5DHRA 3ZV4A 1WW3A 1U9CA 1OFTA 2YWFA 4WWHA 5K5EA 4J03A 2MR6A 1OROA 5JDCA 3UTCA 2GPAA 1TYZA 3CR8A 3E0XA 3FBWA 4NEQA 4R8SA 3NBUA 3DCIA 1U63A 1ZGJA 5BW4A 2B9EA 2Z5FA 3BL5A 4DG5A 1FDIA 1JQ5A 5ICGA 2EXXA 3LPLA 2HOQA 2VSXA 2PS0A 3GARA 3NW9A 1Q0RA 1L8LA 4Y2YA 1ZITA 5U9CA 4UEJA 1GRQA 2ZRMA 4OO3A 1ODLA 5LC1A 1P1FA 2QL9A 3S0JA 2DPGA 1QFZA 1G59A 1FJ2A 3JPWA 4TXHA 1HG1A 4O63O 1CETA 4MW4A 1BS1A 1GAJA 3DXYA 4LEIA 1HDGO 2HBYA 1EK5A 1BCRB 2XXBA 3KEOA 3ZCUA 1UC8A 3KQPA 1GUYA 4XVUA 4HWKA 3T4XA 3HYLA 2C57A 2X1LA 4MYSA 3WGUA 3A6JA 3DBIA 2DUNA 2QTCA 4PE5B 4Q93A 1HSOA 3Q5EA 3PRKE 3RU7A 2XLCA 4YCMA 1IU9A 3I12A 3PHGA 1TYDE 2FN7A 1T3LA 2X0EA 4X7BA 5FTJA 4GX5A 1D2HA 2AL7A 1X8XA 3FCCA 1D6SA 2RGBA 2WM8A 4YCNA 5H9VA 4BXOA 1PUXA 3NM6B 1JB1A 2HIMA 1DADA 4KXQA 4EQ6B 1A8QA 2O3SA 1O8CA 3C15C 4KFUA 2GF2A 4FWIB 1QXSA 1X7YB 4L95C 3O8BA 4N0EA 3BRCA 4DQKA 3KX2A 5JNUA 3RKRA 1FP2A 4MRRA 4PYMA 3O94A 5I3CA 2P8SA 4DBLC 1CZOA 5A03A 4MQ5A 1S3FA 3OWOA 3IJEB 4PRZA 2YS7A 1Q0QA 2WIDA 3K5HA 3K9WA 4J90A 3O84A 4TXMA 2CEKA 2F8MA 4QXAA 4OH1A 5ALHA 4JX8A 3QVVA 1U1DA 3JRXA 3IAEA 4E5VA 1DIGA 5A4AA 3PKZA 4CEIB 3O4RA 2BV3A 4D9MA 1LX7A 4QXOA 5F4BA 4AKHA 3NC0C 2HKIA 4HQOA 1WXFA 1WW2A 3FMGA 5F1PA 2WLTA 1PGNA 1UP4A 3DKRA 2ZREA 2FG6C 1AOXA 3H16A 3PWKA 1Y4ZA 4IOMA 2PV0A 5B1EA 4MAAA 2OUKA 1YMVA 1WCXA 2WD7A 3FNFA 3KZXA 1GQ2A 3ZXXA 5H8WA 4E21A 1N6KA 1QO9A 2VPYA 3A28A 3O8NA 4DQVA 2QVYX 5CIYA 1QGZA 2P2LA 5P8WA 2OGSA 2YCBA 3RREA 3R0IA 3D1JA 4QDUA 1SC3A 2X0KA 2DT8A 4M22A 5FORA 3SR3A 1UEJA 4R84A 2RHCA 1UFRA 1BWQA 3MK31 3RYHA 1CUUA 4G86A 4HUQB 2V7EA 3VGJA 3GDHA 4TWRA 2XT0A 2YC2C 3D54D 2WSBA 4R2WA 2OVBA 3G5LA 4MV6A 1XDDA 2CV0A 1IULA 2QU7A 2QN1A 2X9VA 1X80B 2N9UA 3OZVA 1R66A 4J43A 4OU4A 4CQNA 3L43A 5GINE 2NM0A 1NBHA 2EW8A 1XZMA 2X7JA 5KOIA 2FQ1A 4N0QA 1NT4A 2F3QA 4LC1A 4H0FA 2AFIA 2YNMA 3NIWA 2YHBA 1C2YA 5IZCC 1P1IA 3TK1A 4DQLA 3TTXA 1DT5A 3PWTA 3QH4A 3OURA 3LYLA 2RGWA 3JASA 2VKQA 2RBGA 1Z2EA 4MV7A 1VA4A 1WVIA 1L4GA 1D4OA 1RQ7A 4L8GA 4GOKA 4HCJA 1RZVA 5LWQA 1YR3A 3DZCA 3TEMA 1WCV1 1F0PA 1DG9A 2XNHA 4WN9B 1H8HD 5KYVA 3WADA 1O94A 2RGXA 2BGNA 1PN3A 2ID8A 4M4SA 3F97A 4YO8A 4A5SA 3RFVA 3W6OA 3BL6A 2RAPA 3GLKA 4HLUA 2HWWA 4FW8A 2RD2A 1OY1A 4MUJA 5EGSA 3QEMA 1DWQA 1WX1A 3SM9A 2LGJA 1RE1A 1RHKA 2EJCA 3DLPX 5ERGB 5B1IA 4DCOA 5KO2A 2OCBA 3LUGA 4IMJB 3E5HA 2AOWA 4K6MA 2XWBF 2J31A 3NRBA 1JHPA 1P6QA 3FXAA 1UT6A 2JVJA 3LC0A 3GUYA 4FVTA 4HFRA 3CRRA 3ELDA 4QQKA 2QHXA 2XIQA 1U3WA 3HUFA 4CG1A 1XCBA 4RH0A 4BPBA 1RFLA 2V7WA 1B6GA 4M86A 1ISFA 4GLJA 4MWSA 3I61A 5AOAA 5FUVA 3N6RA 4GQIA 1DHTA 4ZAFA 3SDSA 5IJ9B 5INTA 2RHMA 3EVAA 1SVMA 4KUGA 2YWRA 4MARA 3X3HA 4LOLA 1FUYB 2O4UX 3R0JA 4BOYA 1G5PA 1EVEA 3L1JA 2A94A 4BNJA 5BUCA 1C3XA 1NDUA 1X1QA 2ZS9A 2J0VA 3FSRA 3O1JC 2ZSUA 4CEJB 1H9AA 2B1QA 4ALJA 1DPFA 3ZU3A 5AI8A 3WZ2A 3D4NA 3BFPA 1Q7GA 2YRXA 3IR5A 1U9ZA 1ZA1A 2AOTB 2VPZA 3N2GA 1P1RA 3W2HA 2QTLA 1G20A 4HDQB 2H5EA 1V1RA 2VP3A 1MVOA 5C46F 3P94A 4HTFB 3VKWA 2VVTA 3KSMA 3LQ1A 4OL9A 4RCVA 2FEMA 2RK3A 5KREA 1NUSA 1ZNZA 1ACJA 3GLIA 4Q3BA 1U28A 2HIHA 2ZPTX 1YBVA 2ZVPX 2W5UA 3H5TA 1IEQA 2XUAA 4DGQA 1ZC3A 1CR6A 3R44A 3EULA 4UARA 1AB5A 1FQOA 1YE8A 4OQZA 4QU5A 1JECA 4MUHA 2B1JA 3ED5A 2I9KA 5JVDA 1FYDA 4FEYA 2QXTA 721PA 3LL7A 1IZ8A 2QNBA 3SCZA 4C7JA 1BKSB 3NXKA 3S70A 3VR0A 5H4GA 3IESA 3S44A 4LE0A 5DT9A 2JPDA 1J2UA 4ZV4A 2GCGA 2GPWA 2Q4TA 1G2QA 4Q7KA 1FMCA 2RHRA 2FUG1 1AQIA 2FPOA 2XYRA 4PLHA 4JVNA 3ZU2A 3I8XA 2PUJA 3HEBA 5KOJA 4N40A 3CLUD 3G5TA 2VJNA 1P2BA 4NL4H 4RVGA 5A0VA 3M5PA 3QM1A 1WLSA 3TAHA 5LMUB 2HLHA 1EUDB 1QIHA 1RMTA 3O6VA 1B7GO 1SXIA 2QJFA 4DQUA 4LZNA 1D9XA 3QU9A 4WN9A 3ZWCA 3SC4A 1BDIA 1NPTO 2YH2A 3RVOA 1ZN7A 4DOMA 5KYWB 4P5PA 4OHYA 3DXXA 3WNBA 2B34A 4B3RB 1VTKA 3SOZA 2W2TA 1CUHA 1STOA 2VJMA 1GDHA 2QL5A 4C3OB 4XVRA 3WC4A 4B85A 1XE3A 2D62A 3C85A 4IINA 4MLPA 1JFSA 2WJVA 1XYGA 3E9DA 5LP6C 1N3IA 3LCMA 3G5UA 1ZL0A 1L1RA 1MVNA 1UBJS 2AOUA 3L6OO 5AI9A 4RZUA 1SCAA 1DP4A 4PYRA 1H8EA 3LH5A 3IUMA 3HU1A 1OWLA 1L7XA 1EZ1A 2A88A 5ECYA 2AXQA 2WSIA 3W8DA 1GUBA 1L6IA 2HCTA 3DCJA 3NHZA 4QYWA 3ISVA 1ZJJA 3GAZA 1N2EA 1YE5A 4JY7A 3DZDA 4CMEA 4R3NA 1VJRA 3B3AA 3OZSA 6Q21A 3DHYA 5E2AA 3LUPA 4ZDIA 4AP6A 3PD0A 3AL0C 2A33A 2R2GA 5BSKA 1LCIA 1HO3A 2IEZA 1CZNA 2HHJA 4JDUA 3TKAA 3SPXA 3DOIA 3MB8A 2VJLA 3ME5A 2E5FA 4IZIA 4U2CA 4RA9A 4B4DA 3DCNA 3ASVA 1SUSA 2PH3A 3K6JA 1QONA 4URUR 3W6PA 1NPDA 4ARVA 4EMTA 4FFOA 3GLSA 3ZCTA 3STWA 1XNHA 1YCGA 2FK8A 4UE2A 2HDHA 4AY2A 4KX5A 2Z30A 3EDYA 5E6SB 1AXRA 2YQ4A 5E0OA 3DD5A 1MV8A 3VA7A 5DK6A 2ACWA 3GJ4A 2CXOA 2PZEA 3ONDA 4MR9A 1UBUS 1FTNA 2CLLB 1DT3A 3WLFA 3RGWS 3WGTA 4MVJE 2PMEA 4BMPB 3V8MA 3K73O 1MTZA 5HHTA 1XQ9A 6ADHA 4QOIA 4TVSA 2X15A 4PGHA 4IRUB 4IHJA 1VJ1A 2YXBA 3QLUC 1KOGA 1YDHA 1I4TD 2VZ9A 1J22A 2XDQA 4HQKA 5JS7A 4LPKA 4LBZA 2W6JD 1IOVA 4TKUA 4YMWA 1YIAA 3MHTA 3FDZB 2QPTA 1J97A 4FE7A 3F4LA 4N6GA 3V48A 4D9CA 1DFIA 5LLDA 2PL1A 2IPAB 2QSJA 3ABOB 1KP2A 1T5BA 3OETA 4AS1A 4RACA 3S1LA 2QMHA 4KOEC 5H7XA 1Y8QB 5GY7A 4Y98A 1G17A 3FMIA 1DZ3A 1L7AA 1PZNA 3CRW1 3GLQA 3KSRA 2PBFA 4FCWA 3RRBA 4E12A 5KMGB 4K40A 4CQLB 5EIOA 1Y89A 2DH6A 3TOSA 2NYVA 4JP8A 4RORA 4FNOA 3ZJTA 1OHHA 2QM0A 1WUIS 4YJ3B 2QUJA 4UPDA 1A4XA 2GDZA 3GFVA 3ZJYA 1G0NA 3OOEA 4J1NA 4ZWNA 4BU1A 1DTSA 1Q91A 3DOOA 2C2MA 1M34B 3OEYA 3VPGA 1QCDA 1ZD4A 4UCXA 1PLKA 3VYRB 1N92A 4MKRA 4WBSA 2WYOA 4OXKA 2NUAA 5H80A 3T0IA 1ZH2A 3GDFA 4ZU6X 4L5AA 2V54A 4Z7NB 1KA9H 2P6RA 2HRCA 4E2YA 4M0EA 2VH2A 1FUUA 2C8KA 1KKMA 2H52A 4H35A 4HJRA 1VL5A 5B30A 2Y05A 1K8XB 3SBDA 4MW5A 2NVWA 3ZV6A 1TA4A 1D0SA 2GLUA 2IW1A 4ZEOA 4P32A 3H9JA 3RUDA 1YI1A 1B6TA 1VIAA 2K2WA 3VU1A 4CF3A 4XUEA 5A2GA 4GXNA 4I55A 3TR6A 4CXMA 4MHTA 4E4YA 3E8SA 3NOXA 3RTAA 4ZI7B 2B2XA 1T2AA 3O9ZA 2IIBA 2WFLA 3INYA 5HK8A 2I4IA 2ZS8A 3SQXA 4N5NA 1V1MA 3MMXA 3NOVA 3ODGA 4ARIA 1LJ8A 5FFFA 3T5PA 1O94C 3V4SA 5F5XA 1KEWA 3EGDA 5JS1A 1DAHA 3EQ6A 4R1PA 4X1KA 2VNIA 2ZYSA 3FCUB 1YHNA 4DKXA 1TIBA 5FOXA 5EHXA 2HZBA 1K6JA 2CHUA 3ET5A 2BJVA 2FGKA 3D6JA 1X8KA 4RVCA 1K5GA 1WSWA 4IJQA 1LX6A 5E6RA 4M9RA 1IJEA 2P9BA 4BGVA 1ZM2A 3BMQA 3ZYCA 3TF5A 1M1YB 1US8A 5DN9A 4I6GA 3WHLA 1NN0A 4CL0A 2NOAA 3OX3A 1KIMA 4LJ8A 5G4KA 2ZT6A 5K05A 5LB2A 2HJ9A 2VL7A 4YRMA 1D3AA 3EZ9A 1QR6A 2F67A 3MVEA 1R6UA 3MCTA 5JALA 1BX0A 1E0DA 1XLVA 2WF7A 1NVWQ 1LS1A 1Z08A 3IOYA 5AHWA 2HCBA 3K15A 1NVVR 1Q7CA 2J5XA 3D1VA 3SS7X 1Z47A 2YBEA 3BRWD 2DHDA 3DWIA 3PHIA 4F9GA 2PJDA 4YACA 2J67A 4N47A 4B3BA 1W52X 3Q6NA 1C30B 1QZXA 1T1EA 1DV1A 2Q6KA 2Z09A 4E3ZA 2OMKA 3DR5A 4YRTA 1E1YA 2WWIA 2IUUA 4MUGA 2F64A 4PN7A 1FXUA 3T5AA 5JJLA 3OIWA 4P4UA 1BDJA 1O77A 1T6ZA 2IPNA 5CLGA 3N8GA 1K63A 1OWPA 5T4BA 3IEKA 4L5CA 4AP9A 1KSGA 1EM6A 2FR8C 2ZLBA 1L1QA 1MNAA 3VR1A 4NVRA 1LV8A 4ZO6A 2QTVB 3U16A 4M3NA 1IVSA 2XGOA 2HO4A 5FF9A 5SZHB 4AM8A 1XCMA 2B4QA 3AERB 2BYTA 2X6RA 3F2VA 3OWXA 3QX8A 4LMRA 1EVKA 2ECKA 2V7XA 1SOAA 3GLFA 3P9IA 4YBZA 1QWOA 4PO3X 5HIJA 5ENVA 3SHVA 3TLZA 1JG7A 3H8VA 4BO5A 1QZZA 2J3HA 1S8NA 3EFOB 3QZUA 3CX7A 2YJ3A 4OYHA 3SXJA 1Z82A 1CZLA 2VSYA 5E9QA 1MAAA 2R6AA 4Y9SA 2WU4A 3BHMA 4LQDA 4MUNA 4C22A 3ETJA 4I5EA 4ZO8A 4JN6B 1G21E 4IHJF 1WULS 1FJXA 4WGGA 4LFAB 2J46A 1NG9A 3UUFA 1H0SA 2VUSA 2Y71A 1FRFS 4R71A 3H13A 5SY4A 3DF7A 1W1WA 2A9QA 2EATA 2F62A 3ACCA 5HILA 3KZNA 3ETLA 2ZB4A 3EA5A 5B3JC 4K87A 3L4BA 4UUOA 1AK9A 2IZ1A 4PSUA 4JR0A 3SF8A 2C04A 1E3QA 1YL7A 2H08A 1V5GA 3KXKA 3OEED 3FRIA 1NVDA 3LT4A 2PGDA 1EJ0A 3EUWA 1KNQA 2Z98A 4O1MA 2R8ZA 3CNQS 2Y0BA 4IH1A 3I04A 4W5WA 4DA0A 5FTNA 3ACDA 1ZJ5A 5JZ9A 2P7IA 1AGPA 2V96A 2Z3VA 4RF5A 4WX2B 5LP6A 2D6FA 3UJ7A 1IEVA 1VQ1A 2X23A 1NC1A 2G77B 3FDZA 3F8SA 3IQDB 1AGNA 1C0LA 4MV3A 1U5BB 1X19A 3HFJA 2Y2VA 1P4JA 1K6IA 1MQ9A 2NZUG 2WHRA 1EE9A 1XZCA 2Z58A 3DC7A 3GLHE 1P31A 3K32A 4M55A 4MP3A 4WEQA 3SN6A 3WLNA 1LY1A 3CVVA 5DLPA 1GFSA 2VBIA 4CGYA 4ZGBA 3TRDA 3F6CA 4DWWA 1VBKA 1VG0B 3MTGA 3N75A 4XWGA 3RYIA 5AW8A 2D2FA 1UWVA 3H8SA 3E2PA 2YY7A 3W1EA 2JJ8A 1I3OA 3HDJA 4YLGA 1I7QB 1W48A 3KWMA 3PD7A 2VXYA 2UZ1B 4GPBA 5KEIA 1QPGA 2UZAA 5EWJB 2NO6A 3DKVA 2N1BA 1O58A 3SIWA 4N5MA 3DJYA 2PKQP 3HY3A 3NH9A 5AR1A 2O9JA 4Z4HA 3FUTA 4QT4A 2MTBA 3CYFA 2UVQA 4CIXA 3F71A 1N78A 2GGSA 2RGAA 2YXEA 5I3ZA 2X41A 2CW5A 1YL6A 2EKQA 2KMLA