2FECI

Structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Separate ion pathways in a Cl-/H+ exchanger
pubmed rcsb
molecule keywords H(+)/Cl(-) exchange transporter clcA
source organism Escherichia coli
molecule tags Proton transport,membrane protein
total genus 38
structure length 221
sequence length 221
chains with identical sequence J
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fecI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fecI01
3GZKA 5FYJU 1J88A 5IJKC 1HWGB 4GAYB 1JN6B 3PXHA 3QG6A 4KKCC 5LGKA 4HGKC 4GQ9H 5JXEA 1A3LH 3C08H 3HC3L 5E03A 3MNVA 3GMRB 1I8KB 3EBAA 4NM8L 1Y0LB 3NAAL 4Y16D 1NFKA 1R5WA 1P4LB 1JPGA 3O6FD 1YEIH 3OZ9H 4ODTH 4WCYH 4JJHA 5DEFA 5EOTB 1DQJA 3KPQB 3IJYB 5B3JE 4AT6B 1YPZE 3RNKA 1U58A 2FX7L 4OV5B 1L9MA 1CBVH 5IF0A 2GEEA 1IGYA 3HZKB 2Y5EA 3WJJA 5C0RL 2IFFL 4B7LA 1K4CA 1CXIA 5IESH 4JY4B 1DFBH 4GLRH 1E27B 4LPTA 5DK0B 1CL7I 4P3CH 1HCFX 4YGVB 4KRPB 5F9WB 4BKLA 2V7NA 1ZT4A 3IFPA 5HJ3B 1Z9SA 3VFTA 4N0FB 4MQ7B 4OGZA 3TT3H 5FDWA 4XNYL 5CEYB 2GHWB 3OPZH 2I9TA 1XH3B 1D5MA 3FTGA 1KGCD 4X98B 1DCLA 5BRZD 3VI3E 3PL6A 5KSBF 2NLJA 4F15B 4PJ5D 5T3ZD 4Z7UA 3FQRA 4YE4L 4G7VH 4Y5XC 3WXVL 1ZTXL 1DQDL 2FATH 3C09C 4WENB 1DVFB 2AABH 1I9IL 3ET9F 3ZL4L 4J3UA 4ODXA 1AXTH 4ONGH 1S7WA 3FQXB 3PIQB 4U1LB 4YHIB 2GAZB 3P73B 4JO2L 1PDKA 1FCCA 3GFUA 4IS6A 4YX2H 4UV7H 4OZIB 3JV4A 5GGVY 4XWGL 2HVKB 2AEPL 4Y5YB 4JPIA 4RCAA 3FOLB 5KW9L 4WHYG 5CJBA 2NXZB 3AAZB 1S8DA 3W0WD 4QTHA 4WI4A 3RX7A 1JPSL 2JJSC 5JNYA 1NQBA 1FAKT 3ZDXE 2P49B 3QAZC 4JZJC 4C83B 2G5BA 3C6SB 5HD8C 2W9DL 5BO1H 1P4IH 3BIAX 1NCBH 1JL8A 4R9HA 4PJ9A 4UTAH 3P4MB 4ZTOH 5EBWB 2HT2D 4MD0B 3T0XA 4JDTL 1I9RH 4NC1C 4PGBA 5CKGA 4W4NA 4KC3B 1XGQB 3FQTB 2Z31C 3C2SA 4ODWA 4DN4L 3LH2L 3MREB 4RQQA 3LQZB 3QG7L 4P99A 3B9KB 1IRAY 5KVFH 4TQEH 4BH8A 3OJMB 1QSEE 4JLRB 3BKMH 1U3JA 2AJUH 5DD6B 2ITDB 4MJ6A 4TNWK 4UOW1 4WTZG 3MA7B 4PJEA 1FQ9C 1HHIA 5D9SA 3P4NB 3T4AB 3ORJA 1NCAL 3UBXG 5FUZL 3O9WB 4QRSA 4YDIL 3TFKD 3I3DA 5DJZA 2H6PA 3EO0A 4RDQF 2R9HC 4I3RL 2EO1A 1G9NL 1QNZH 1RUML 3F7YA 3H0TA 4LFHD 5D7KD 3ZE2F 3ZSTA 3MRNB 1TMCB 5LWYH 5GGRB 3B5GA 1FZOB 4D3CL 1ONQB 4U1NA 3ROOA 4TPRH 1ZHLB 1CDHA 1EJOL 1U36A 1KPUB 1JPFA 1U8NB 4M6MH 1KG0A 1FIGL 1S3KL 4ZMAT 3Q6GL 3REWA 4MNQD 2PCPB 2BVYA 4OKVA 5KANG 1RULL 4WEBH 3BD4A 2P1YA 4OD1H 2E8YA 2OSLB 3FRPG 43CAB 4ZUWA 2X4TB 4TSBL 5CKAA 3CGTA 1AIFB 1CDCA 4X6DB 4XPBL 4MA1C 3M8OL 3K4AA 4S1QH 2P8LB 5IROA 2YD5A 4W81A 3O3DA 3WIFA 3ZHDA 3NCMA 1JMXA 1XGRA 1MHEA 4DKFL 3ARGD 1X4XA 5DEGB 3P11L 1VESA 3F6IA 4UU9B 4C56B 5FM5O 2A83A 3UTZB 2DQUH 1MUJB 3IDXL 4HKBB 4JQXA 1GGBL 4MNHA 2HFEB 2NYYD 3MLWH 4PJ7E 4XBGA 5DT1H 2ZSVA 1XR9B 2HFFA 3DURA 4HIEB 4RISL 5DVNA 5EFIA 3WIHL 5HGAA 1D7FA 4OCLC 1WUNT 5E2TH 2VISB 5C0NC 1U8JB 1MFCL 3J8F7 1KXTB 5I1KL 2IFGA 4K3JL 3STLA 3S34H 4YWGL 2R2EB 3D3VE 1JNLL 1GC1H 4TTGA 4B5EA 2JLLA 4JAMB 3G6JA 3ZTNH 4FA8A 4F2MB 3F5WB 4M3KB 1VKXB 2ZPKH 1H3UA 4EJ1C 4JPVH 1I3VA 1IC7L 2N1KA 1NDGA 2XRAH 4UIMA 1V8HA 2DOCA 2IG2H 3K81A 1CFTB 2VERN 5HI4C 1VACA 5E8DL 3DX9A 4M93B 4U2YA 3ARYA 5HYEA 4E42B 4P59L 1B0GB 4M9PA 4F8TA 1T83A 4OM1L 3RPIA 1K8IB 1RD6A 5SWSD 3KYOB 3S7GA 1ZLUK 4JRXB 5TPWL 2YC1B 1YEKL 4ZDHA 5CCKH 1SBSL 4UNTA 3KJ6H 1IAKA 4PUBH 4Y7MA 1U91A 5A1AA 3H3KA 2GT9B 1HCVA 1QSEA 4KJYA 5FDYA 3SBWC 3BH9B 5J6GA 4X4YA 1S5IL 3LB6D 4L4TE 4WEMB 3I3BA 3UAJC 1LK3H 4NQEA 2XWBB 3D9AH 3NIFF 5KS9A 2GSIB 3U2SA 1WEJH 1U3HA 1WFUA 1J0IA 3MCLL 3OJDA 4P23C 2ZSWA 4MAYB 3DX6A 5ILTL 4HPYL 3VGAB 4YDKL 4EKXA 1MPAH 5L9DL 2RFXA 3VU2A 3QPQD 1FNEA 2Y23A 3K8KA 4FABL 1J12A 2ICCA 5HPOA 1S7XA 5DHYA 4RMUA 4BZ1L 3VG9B 4U6HB 4QXGL 1IGCL 1XGYH 5DJAA 1D5BA 1LEIB 1YMHA 4HWBA 1FVCA 1P84J 4NHCL 3UBXB 1TVBA 4LP4A 3ZZ1A 4N9OB 3VDAA 2H32H 4XX1G 2R0WH 4D8PB 4I0PD 3R06A 4PLJC 4PJBA 2KZ1B 4PFEA 4JY5H 1BJ1J 1INQA 4IRZH 4QOKD 3BEWA 8FABB 4IDJL 1MHCA 1QQDA 2FD6H 4YDVA 1UKTA 5EO1B 1PX3A 1CE6A 2B39A 4OLXL 4X4ME 2AK1H 1QBML 3DROB 1IBGL 2HLAA 3MXWL 5K93A 4Z78B 3HNSL 1DLHB 1TVDA 2GJ6E 1T7VA 3WO4B 1A7QH 1SVZA 1WCBA 3O8XB 1CR9H 1BQLL 3DETD 1EEQA 2AQ1A 4N9GB 3DYPA 4TSAL 3VDBA 2J3SA 3Q5TA 3VWJA 4I4WB 2FJGB 3HC3H 3TNMB 2PO6B 1QACA 4KK9C 4NM8H 2X6MA 1L7TL 1NAMH 1A9EB 3NAAH 4WU7A 3KYMB 1S7QB 2OI9B 3IRPX 5ERWA 4XGZA 4G6FB 4JFOB 5CJOL 4ZNEE 5I2IB 2VLRA 3SJVA 1NGQL 1F3DJ 3CSYA 3KPRE 5JHDD 1OY3B 1O0VA 3OAZK 4PRID 5D8JL 4JZOB 3HE7D 3VI4F 1UB5A 2R2CA 2H1PH 2C3WA 4NC1E 4EXPX 5D7JB 1SJHB 3MGOA 5C0BB 1MVUB 2R1WA 1MCWM 4XXCC 2YUXA 3VXPB 5FXCH 4JQIL 5DZOA 5I1GL 3PWJA 4XNYH 5MEQA 3JV5A 2EYSA 3QIWC 3Q1SH 1CF8L 4NBZB 3HR6A 2YK1L 2PXYA 3CLFL 1JTOA 3V4VL 4PJAE 4LCUA 4MD4A 4MMZC 2OXHA 4YE4H 2XZAH 3B5TA 1JI1A 3OKEB 3WXVH 4P2RA 2E6JA 5D7LE 4RIRB 2BNRA 1ZTXH 1DQDH 2XZQL 4BQ9A 3G5YB 3IF1B 5IJVB 3H3BC 3IDJB 3GIVA 3UTPE 3ZL4H 2ICEA 1NCWL 4R6UA 1MSPA 4JM4H 3H7BB 3U0PB 3D39E 3V7MA 1QPXA 3RPKA 5K9JL 4JO2H 4X6CA 5HY9A 3TJHC 5E8OA 1G7HA 4EN3A 3CSPA 1NCUA 1URLA 2J6EH 3VWKD 3U4AA 4BQ6A 4UQ2B 1FL6B 1Z2KA 5CUSH 1CFQA 4XWGH 4ESKA 4LLWA 2Q6WA 5FB8B 2IANB 5K9QG 2JCCB 1UJ3C 3HR5B 4GRWF 1JGDB 3SDXA 1JPSH 4AEIL 4GRLC 4DGVL 1EZVY 3QWOA 3HLAB 5H37G 5JTWA 4HKZA 4RAUA 2W9DH 4PS4L 1AGEB 1EFXD 4DVRL 5C09A 5HHPB 2H2SC 4XXDB 4XMLL 3ULVF 1E28A 5EU4A 1JF6A 3Q3GB 1I7TB 1TZHA 3D18A 1SY6A 1X5FA 4RZCB 5INCA 2Q86B 3THML 1BQHA 4G8FA 1OGTB 3TNNA 5HHMB 1JHKL 1J8HA 5IR1A 5DGRA 2LU4A 2QTEA 5TF1L 1QR1A 2XTJD 2NY7H 1L6XA 5B4MD 2WINB 4KTYA 4PRDB 4W4OA 4JG1H 3QPXH 4JREC 4TVPL 2EDDA 1RK1B 3DIFA 2IALA 2DBLL 1QA9B 5E8NB 2CLZA 3TF7C 3MNWB 5D6DA 1NCAH 3U36B 5FUZH 2WIIB 1LEGA 4FNLL 4TVPE 4YDIH 3ARSA 1A6TB 3KPRA 4XC3H 3QUYC 1G9NH 1RUMH 2HT3D 2DI9A 5DFTA 1NCTA 3MR9A 5C0CE 3MV7B 5E0QA 5ACZA 5F72S 3OKLB 4D3CH 1ZHBA 3C60D 5IMMA 5TH2A 4QXTB 2PYEB 5ESVA 1EJOH 5KAQF 4BSVB 1FIGH 1S3KH 3BGAA 1CGUA 3QIUD 5JZ7C 3CCHB 5ESAB 2Z9TA 3QQ9D 1RULH 2VLJA 3UPCA 2BC4A 3NCJL 2XXMB 1UZ6F 2R29L 3C9NA 6CGTA 3O81A 4TSBH 1T6WA 4RDQG 1HQRA 2GFBA 5HPMB 1RUPL 1II4E 1DDHA 4AYFA 5DJ2B 3MSPA 2E9BA 4N0UB 2I5YH 4PREB 4Y16B 4WW2B 2GTWA 4DKFH 1XGTA 3P11H 1WGOA 4X8JB 1HSAA 2BNQE 2GYSA 4U6YA 3ES6B 1Q9LA 2EE3A 1S7TA 1VFUA 3QNYA 1IGML 4RISH 4PJ8A 1FORH 2J5LB 3MRRA 4M4PA 3QA3B 3MRDA 4Y19A 2P5EE 3W9EB 2R1YA 4X7CC 1MFCH 1IC1A 3RL1A 3QBTB 5I1KH 3OAUL 4NIKB 1NGXA 1KYOJ 4K3JH 5GRYA 1OD9A 1TNMA 1JNLH 3ZKSD 4QO1A 2DTML 5D72L 2I26N 3CFBA 3L3GA 1P7QA 2GSGA 1PSKL 1QO3B 3SGJA 4Q6IA 4CBPA 1S5HB 2JJWA 4O4YL 1IC7H 1U92B 3RZCA 1CFNB 4LLVB 4PD4K 2R0KH 3UTOA 4XMPH 5I73C 1EV2E 4MCYA 5E8DH 2MFNA 3PE9A 1KIPA 4PJ5B 2OXGA 4P59H 5E2VL 2YWZA 3CFKA 3L95B 4RMSA 1YEKH 3MV9E 4U0RC 3FO2A 5L88H 1SBSH 2W65B 3CZFB 3VD7A 1Z5LB 4HWEH 3ROLB 4N8PA 2J8UA 3ARFD 3QEUA 5GPRA 4F37K 3JTTB 1U8QA 1S5IH 1FAIL 1AD9A 3MRBB 4LHQB 2X4QB 3SO3C 4YK4C 3C6LB 5E7BA 1F3RB 4NRZA 3MCLH 3P30L 2P24A 3IDYB 3NIGE 4QRPE 5ILTH 4HPYH 4YDKH 1MCPH 1ZHNA 4ZPVA 5L9DH 3EYSL 3HUJA 3CDFA 1T6VN 2V2TB 4Y4KD 3HN3A 2BVOB 2MHAB 2DJ4A 2Y36L 1ZK9A 3N9GL 4BZ1H 3BP7A 2VC2H 3T0EC 1VENA 4JVUA 1UXSA 4K7PX 3UC0L 1IGCH 1T5XA 5C0AD 4GS7C 4I18C 1V7NL 3WEXB 1SVCP 4NHCH 4H88L 5C0GA 4UAOB 3S36L 4FZEL 4XT1C 3MODH 1MF2L 2DLFL 1ZWIA 3D6GA 3EIFA 3QDMD 3WHE0 4DQOL 2P45B 1HH9B 3NTCL 1ES0A 1MCHA 2NQCA 4IDJH 3KLAB 3T4YB 1MWAA 3VJ6A 4OLXH 1IBGH 3MXWH 3MROA 1Z3GL 3HNSH 2H3NA 3CDGA 5TDOA 3JXAA 4K71B 1WJ3A 1VGKA 2BNQA 1QLFB 1Z9OA 3D48R 4IRSA 1D9KA 1BZ7A 2Q20A 1RUAH 4P46B 4OQTH 5KJRL 4TSAH 4UNUA 4Y4HD 4L4VB 2DM2A 2WBJB 1N5YH 2A6IB 5DD1L 3CSBA 1RZGA 2X4UB 3WN5A 1R5VA 3QH3A 1KACB 5GIRB 1FV1A 1L7TH 2AXGB 1I3GL 2YRZA 4FQXA 2XG4A 3BOVA 3F7VA 4IRJA 3HS0B 4GG6B 4GBXD 4P2OD 1NGQH 5E2WL 4UV4L 3FT3B 1GIGL 1XIWA 4F57H 5I1EL 4L3AA 4IOFD 1UB6B 5D8JH 5AD0A 2IGFL 2FZ3A 2AERT 4OZHB 4ODUB 1RQ5A 3VFPA 2LTQC 5EBGA 4J23A 4R3SB 3QEQE 3R4DA 1KB5L 3D3VD 5BOZG 1MI5D 4HF5L 3MV8B 3T77A 3CMOL 4Q2ZB 1BAFL 5FV1L 4RX4D 3SKNB 1MFBH 4PBXA 4LKCA 3ZTJG 3ARGB 2Z8WC 4JQIH 5I1GH 4LLDA 3HZYB 3FB8B 3RWDB 1UT9A 5MENA 4DN3L 1J05A 1K8DA 1I9JL 1N2RB 2V7HB 1T0NB 1CF8H 4ZPTB 3MOAL 4NZTL 3CLFH 3BZEA 4Y2DA 2FHCA 4Z7WA 1VERA 3ESVF 5FF6B 4RGMC 5CSGA 2XZQH 2KQMA 4YIQB 3KPSA 1OTUD 3U7AA 5CILL 2Z8SA 4G8GE 3I3EA 3TO4A 1NCWH 4L4TD 4R97C 1PGRB 2J88L 1K4DB 3ZHKA 4P5MB 1FBIH 3RWGB 3P3YA 5K9JH 4WUUE 2D31A 3WFCH 3OKNA 2APBA 5I15L 1NC4A 5INDB 5FV2A 3BD5A 3V6BR 1F90H 1VDGA 4L1DA 2FB4L 1RZIA 1FIEA 3PV7A 2JIXB 2QSCL 3UJJL 4AEIH 5CJ8A 4LPYA 2IMMA 5SWSB 1JPTL 1MLBB 4UB0L 1G7JB 2VAJA 4DGVH 1FLRL 3N1QC 5DJCA 4MA7H 4PS4H 4DVRH 3DOSA 3H2WA 5D6CA 2NY1C 2H8PB 4JFEE 5BS0A 3UTSB 5CD3A 3EYVB 1QSFA 1WT5C 5E8PB 1QVOA 2HRLA 5E00A 1SM3L 5T3XL 4DZ8A 4X4XB 2IBZX 3ZKQD 2F74A 1TZIB 1U42A 3D69B 3THMH 1IEAA 1MHPL 5DF0A 3L3HB 3L5IA 3QUMB 3QHZL 1JHKH 4K7PL 3PP3K 2B20A 5T3XE 3GSVB 3X3GL 3KYNB 4TVPH 5CMAA 1TJIL 4RNRA 3G5VB 5EUOB 3RWCB 1A2YA 2GJ6D 1I8IA 4PLNC 5DD0L 2M1KA 3DSFL 4HWZA 1JP5A 5LBSH 3VDCA 3DMMC 4FNLH 4ELME 4RAVA 4JO3L 4BELD 5SV4A 5DDHB 1NGZA 4N1EA 1G7LB 2AJYL 1R3JA 4QOKB 2E8ZA 4F7TB 1EEUA 4FQQB 3SY0A 3PWNA 3FCTA 1MCOL 4O2CB 2VXTL 1I85C 1R3LB 3BP4A 1EHNA 3LPGA 5FA3A 5ID0A 5D7IF 3LDBC 5HD8D 1AI1L 3MFFA 3VFNB 3U48A 2HJLB 3GK8L 4F7PA 4ZUSB 4G8EB 4CVXA 4U4BA 3IDMB 5ETUA 4S1SL 1ZT1B 7FABL 3NCJH 4DEPB 3W9DA 3TIEA 3U83A 3NCEB 5CSZA 2R29H 1BPVA 3D2UA 3CSGA 3QDJA 1T1XA 2UV3A 4P49A 3TBTA 5IEKA 4YPGA 3QDGE 1A02N 2Z31D 1RUPH 1WWBX 4X5WA 4CVUA 1F00I 2BOBA 2BXZA 5F7DB 4QXUL 2FJFB 3EFDL 5I8KL 5D7SL 2BFVL 3P4OB 1NJ9A 1S7SA 3HZMA 2Z93A 4EUPB 1WF5A 2C9AA 5LXGL 3EO9L 3FRUA 4HUUB 3WNLA 2Q87A 1IGMH 1CFBA 1ZKAA 3RUGF 4NNYB 3PWPE 4M5YL 4WFFE 3MNVB 1I7UB 3CUPA 2J7LA 5I18L 1FO0L 3GO1H 2PF6A 3HA0A 3I50L 3WS3B 3HE7B 5D7LD 3UYRL 2R9HD 4TTDC 3LKSB 3UTPD 1N59A 1KJ2L 3S6CA 1JPGB 3D39D 3OAUH 4E9LA 1IM9D 1DQJB 2EXWC 1FFOA 3GJEA 2DTMH 4Z7VE 4L8SC 1XT5A 2VDKL 3MRQA 3W11C 1K4CB 3NPSC 3R8BB 2BVPA 5ESQB 4ZO9A 1GSMA 4HZLA 5EO0A 5E2VH 1U9KA 4YHOL 2CRYA 3SE9H 3EGSB 4BKLB 1ZT4B 3IFPB 3VXTA 1FE8L 1ZA3A 2ARJA 5B3NA 3VFTB 5F1IB 3K2UL 5EO9A 1T1WA 5IMLA 3C2AH 2BCKA 3UO1L 4KUCF 3FTGB 2IJ0C 3D0LB 5D93C 2P5WA 3PL6B 4JJ5A 2NLJB 5F7WC 3FO1B 1FAIH 4PV9A 3VWKB 1RHHA 2J8UF 2APTA 1NMAL 2DKSA 2PW2B 5JW4Q 1MH5A 2VLKE 1EVUA 5F21B 3EYSH 1HOCA 2GJZA 3EYOB 2C3HA 4LQFL 4XI5C 3DVGA 5CZKA 5C0ND 4M5ZL 1EFXB 4CGTA 3N9GH 1ZV5A 3BEVB 1UCBL 3QWQB 5L0QB 1F4HA 3JV4B 2R0ZL 1KSRA 2AXFB 4TVPD 3BKYL 3WFEL 4KRMB 4U1SB 4PJFF 1S8DB 4QRTA 4QTHB 5JNYB 1V7NH 1KIUA 2F8XC 5F88A 4XAWL 5C0CD 3EFFA 3S36H 4FZEH 2XKUA 2DLFH 2G5BB 3ULSA 2CH8A 1MIEH 5IVXF 4DQOH 3QNXB 4CDGC 4PJ9B 4Z7NF 4PJXA 3NTCH 5KVEL 2NY4C 3W82A 2FBOJ 1TITA 1R3IL 1Z3GH 4MB5A 5GRVK 3LAFA 2C4XA 1EBAA 2EKJA 1T2QL 3DV6A 5E6IC 3GMOA 3QB7C 4ODWB 3UAJD 4HH8A 2R15A 4KXZI 4K55A 4NWTL 4X0KB 4AMKL 5CJXA 1JGUH 1I75A 5KJRH 1PQZA 4JRYE 5DD1H 4ZD3L 4JFFE 4BH8B 2DDQL 5E99L 1R3HB 2BSTA 5J6HA 1YNLL 4PJDF 4P23D 4WRLA 4O5LL 3C60B 4PJEB 1HHIB 2QKIA 5D9SB 3U30B 2BX5A 1I3GH 3GRWH 4N8VB 1IL1A 4S0SD 1ZEAL 4QRSB 4GXVL 5A3IC 4JFYA 5DJZB 2H6PB 4QHNA 1YPZB 4X4ZA 3QULA 4FFYH 4UDUB 1HQ4A 4Z7VA 4KUZL 1J1XH 3F7YB 3P9MB 3H0TB 1YNTA 4J8RA 5E2WH 1T80A 4UV4H 1GIGH 1A1NA 4NPYA 1OM3L 5I1EH 4CW1B 4U1KA 2P5ED 3QP3A 2IGFH 4U1NB 3ROOB 4PRPE 3K2MC 2HAZA 4JQVC 3FN9A 2HP4A 5MERB 1JPFB 1KB5H 2F5BH 1FH5L 4HJJL 4PLJD 4HF5H 1JHLH 1VFOA 1MLCA 3C87A 3CMOH 3OKDA 4R2GB 3REWB 2E3VA 4OKVB 2Z92B 1K3ZA 3V0WL 3K8MA 2GI7A 3G04A 5K59E 1A4KA 1P9MC 3U46A 3CX5J 3DWTA 1BVKB 4DN3H 4JFQA 1I9JH 4ZUWB 2C26A 1DBBH 3MOAH 4NZTH 4M61A 5GZOC 4HFUL 3RDTA 4P9MH 3WIFB 5IG7A 5ICXB 3MV9D 1REIA 1XGRB 2XACC 1H8NA 1AO7E 2E7LC 4QHLA 4FQLL 3S4SA 2O93L 1KLGA 1UACL 4TN9A 4KK9D 5C07E 4NKOB 5IV2A 4MNHB 1Q72L 3QUKA 3DURB 5I15H 1DLFH 4KK5C 5EFIB 5HGAB 1YY8A 2IADA 1KTLB 4QRPD 2FB4H 4DUVA 4Q74A 2COQA 3UJJH 2FBJL 3STLB 5GRXG 1JPTH 3QISA 5JW4N 1UWEL 3QIBD 1A1MB 3G6JB 2FSEA 3VXMA 5EZOH 1Q8MA 1NDGB 4UIMB 5C0DA 1KJVB 2QSQA 3V4UL 2MSPA 4N0RA 5CP7A 1QFUH 2JJTC 1N0XH 3DX9B 3U7WL 2RHEA 2F8OA 1NC2A 5D2LA 3RPIB 3DX8A 2QQQA 2OLDA 3QIWD 1MHPH 1NEZA 1HXYB 3VXRE 3D25A 1IAKB 1M7XA 1E4KA 3QHZH 4LASL 4K7PH 5FCSH 3F58H 4Z7QE 5JDJA 1QSEB 4Y4KB 4KJYB 3ARVA 3X3GH 4ODBD 3OAYK 4X4YB 1T1YA 1U8MA 1HDMA 1NPUA 3ALWA 4PGZA 5L2KE 2GIYA 2JKXA 1W2KT 4QHKI 4NQEB 5DD0H 3MLVH 4OIAA 4TULL 3HKFA 5F8QC 4P4KC 3DSFH 4YAQB 1B90A 1RIUH 5HYSA 1RU9L 5EZIL 2ZSWB 3IS0X 1WC7A 2MQCA 1MFNA 3DX6B 4JO3H 3HI1B 3TJHD 3ZO0A 2RFXB 1BJMA 3TZVD 3UCRA 5FM5M 1FNEB 1NAMA 3VGBA 3DUUB 1FDLL 2WP3T 1F3JA 3FO9A 3FQWA 3EO1A 4PRPA 1JCKA 1R24A 4G80B 1CDYA 2VIRA 4Q9BA 1LDPH 5H8DA 2VXTH 1D5BB 4G6JL 3HG1E 1YMHB 5E4IA 1BQHG 1AI1H 1FVCB 2AEQL 4BYHA 3BUYA 4KKAD 4HUXA 1MQKL 4GW1B 1F02I 43C9A 2IH1A 4K2UL 3ZKMC 4S1SH 4JPKL 7FABH 4PJBB 3V7AE 5SWQA 1INQB 3BEWB 3MLUL 4PJIE 1QQDB 3QEQD 4I0CC 2XQYG 4DZBB 4CNIA 1H0DB 1P7KA 5GGQL 1YECL 4Q9QL 5DXWA 5T33H 4B50A 4MWFB 3GJFB 5SX5K 3MRFA 2XI9A 3MJ7A 4M02A 3EFDH 5I8KH 5D7SH 3EOAA 2BFVH 1WCBB 2G60L 1W0VA 4KVNH 3VRLE 4RMRA 4LRIC 3NBNA 4P2OB 1CI5A 1YEEL 5DSCA 2MQ0A 1R5IB 4AG4L 3IFLL 3SDAA 2X4SA 3VWJB 2QLVB 5I18H 1FO0H 5F9DC 4BQ8A 3I50H 2RCSH 4HAGA 1C16A 3OL2A 2A6DA 3UYRH 4QY8B 1WFOA 3QUYD 4XC1L 4G8GD 3O11A 4RFNC 4QHUB 1H5BB 3D3VB 4AIZA 1JUFA 3S37X 2J6EA 3UTTE 3SJVB 4WUUD 2BSSA 3CSYB 1DL7L 1IC4L 2R23A 1FYTE 3F12A 5HI3C 2HMIC 4ONFL 3QFJE 5JZ7D 5CZVL 35C8H 4GUPA 1QFOA 4KAQH 2CMRL 3QXDA 5E1AB 1KULA 1AP2B 1HYRC 4YDLB 3LN4A 4PRBA 4YHOH 5D1XC 4FFZL 1HHKB 1S7RA 2KBGA 3HPLB 3K2UH 3MRLA 5GS1C 4OI8A 3PWJB 4JFED 1MJJA 4ELKA 1Q0YH 2ARJQ 5MEQB 1LMKA 3UO1H 4L4TB 3L5XL 2EYSB 2CIKA 3K7UA 2OTUA 1JZ3A 2PXYB 1KNOA 5KSVA 3WV0A 2B5IB 3KPTA 4ISVA 3BKCL 4LLYA 4MD4B 5CIPB 1FSKC 3FFDB 3DXAE 2HA1A 4P2RB 4G9DA 4NQDA 2NXYC 1FGNL 5T3XD 4WJ5A 2IBGA 4F9LC 3QRGL 3I6GA 3PNWA 4NKMA 3RI5K 4LQFH 2J8OA 4X6CB 3LPWA 4M5ZH 5E8OB 1G7HB 4EN3B 3QDMA 4HIXL 1K2DA 1UCBH 2R0ZH 4GKOA 3BKYH 4LLWB 4WEUD 5I8OH 4ZFOA 5F89A 2HYMA 3SDXB 1TXKA 4U3XA 5C86A 1IAII 5I1DA 2Q76B 1IEBA 4OBRA 2I07A 1IKNC 5C70A 4XAWH 4UDTA 3QWOB 4RAUB 4ZSOE 1U8OB 2W0LA 3MRCB 5AG8A 1AQKL 2ATPA 4DWHA 5KVEH 5EU4B 4Y5XB 4HK0A 4OGYH 1ND0B 1TZHB 3JTSA 4X7TB 3C5ZA 3ECBA 1CLYL 1R3IH 4IM8A 5INCB 4PJXF 3SE4A 1UWXK 1N6UA 1T2QH 4OJFL 2WLZA 4HX1A 1BQHB 4G8FB 4Z5RA 3SGKA 1V5JA 2CKBL 2JK5A 3V6OC 3SDDA 4NWTH 4AMKH 3QDGD 2EDFA 1EAPB 1AXSA 1OF2A 4KRPC 5F9WC 4ZD3H 1ZVSA 2DDQH 5E99H 4XP1L 3VD4A 1YNLH 2IALB 4L3EA 5C0JA 4O5LH 2CLZB 4LDLB 2DMKA 4LQ1A 3L5WB 1BVLA 3NCFB 4GXVH 2H26B 4F15C 3VA6A 4MQXC 1C12A 3KPRB 3PWPD 4KUZH 4WFFD 5J9PA 1FYTA 4PTUA 5I76A 4MDJB 1JGEA 3M07A 3C5JB 1OM3H 3TWCH 5ACZB 1DVFC 1ZHBB 5ADPL 5TH2B 1A3RL 3ULUC 5ESVB 1WVZA 3GMPA 5C1MB 1ROWA 4N1HB 4HQQL 5E5MA 1NKOA 4D9LL 1GH7A 3GIZL 4HJJH 1IZKA 1CDIA 2UYLB 2VTFA 2VAAA 4Z0BL 4CN6A 5CWSA 2VLJB 4UT9L 1PD6A 1O7VA 4Y5YC 1G7PA 2NXZC 5DZLA 4RWYL 4HDIA 1I7RA 4BK4A 4PJAB 4Z76A 1IE5A 1UQSA 1HQRB 2IF7A 2GFBB 2O5ZL 1FL5B 1TPXB 4YZFF 4ZS7L 1UM5L 1AKJA 3EOTL 5AYUL 1DDHB 3DV4A 3PJSA 3BPNC 3LY6A 2VL5A 5GRVL 4U7KA 1YEDA 1XGTB 3D39B 4FQLH 1HSAB 2ICWJ 5HYJA 4U6YB 5I16B 3IJSA 5GISL 1ERNA 3QNYB 4YQXL 3ARWA 1I1CA 5F9JB 3GGWA 5I71B 1SMOA 1MCQA 4PJ8B 4OZFH 3MRRB 2P8PB 2I9LA 3B9KC 5FM8A 4NN7C 4Y19B 2R1YB 5DRZA 2VLKD 4N5EC 3RL1B 2MCG1 4OLUL 4LL9A 4G9FA 1NGXB 2FBJH 4OFPA 3L6FB 1IGTA 5JHLL 5A43C 1UWEH 2DLTA 1B6UA 3CFBB 4OM0H 3L3GB 3T0AA 4K7PY 5MEPA 3O9WC 1OPGH 4LOUC 3RZCB 3V4UH 5BW7C 5SX4I 2R8SL 1OLZA 1FN4A 3DGGA 1TCRA 1KIPB 1LP9A 4E41E 3V5HA 4CVZA 4LAQL 2NY3D 3CFKB 4KTDL 5EC2A 1RFDL 3FO2B 2A6JA 1D6VL 4ZXBA 4OCSL 4PGJA 2AJXL 4AH2B 1CFSA 5BMFL 4PD4J 5DQ9A 4ODSL 3QEUB 5DMIL 3SE8H 4ZO6A 4ZUVA 4K8RH 4X80L 1VHPA 1AD9B 5DHXB 4M1CC 5DRXB 4OQTA 4TULH 5B38B 1T5WA 1VADB 4NRZB 2PW1A 3P0YH 1U2CA 2P24B 1RU9H 5EZIH 4X9FA 5EDXA 5JR1L 4O02H 1ZHNB 2R2BA 4JRYD 3OX8A 4ZPVB 5IB1A 4JFFD 3HUJB 5C0CB 3CVHL 4PRNA 5DR5H 3LEYL 2ADFH 3CVIL 4IHOA 1FDLH 2AXJA 3KPMA 2VB5A 4K3DH 3BP7B 3RNQA 3IXAA 1N64H 3DYMA 4YBQC 1ZXQA 3O6ML 1NBZB 2B1HH 2GITB 1T5XB 4J4PA 1I7ZB 1VFBB 4G6JH 4LSPH 3GSRB 1KENL 2B1AH 3PG2A 4DTGL 1UENA 1AHWA 2H2PD 2NY1D 2OQJA 1IMHC 1MQKH 3OXSA 4LPVA 1DQQA 1ZWIB 4K2UH 4JPKH 1DE4B 4ODVL 4KMTL 3OR6A 2R0LH 2E27L 3MLUH 3OTTA 1FZJA 2PTTB 3DECA 2UWEA 3MRKA 1MWAB 3BO8A 1OAYL 4A2LA 5GGQH 3IT8D 3P0VL 4HS3B 3MROB 2BDNL 5DJXA 3QJFA 1EVTC 2H3NB 5J8OA 4TNVF 3CDGB 1UKSA 2AJVL 5TDOB 2VZTA 3VI3F 1I8LC 4QKXB 3LKNA 1VGKB 2BNQB 3RIFK 1GPOL 3RVUC 3AMKA 4IRSB 1D9KB 3TO2B 1BZ7B 1ZGLA 4ZOCA 1AC0A 5TQ2L 4M93C 1PYWA 1B2WH 4KQ4L 2BHZA 5I1AA 5FA4A 3IFLH 3AXLA 4QTIH 5E9DA 1BD2E 3AS2A 5T1KA 4KMQA 3DMMD 3WN5B 4NFDA 2VITA 1AO7D 2P5EB 3QH3B 5C7XL 4ZFZB 3UROR 1OSPL 1EERB 4FQXB 3PWUA 3F7VB 1JZ8A 2V9TA 2NX5D 4IRJB 2NY2D 4KDTC 5C07D 4CN1A 1GGIL 2ZNWA 2X1PA 4GKSB 1DL7H 1IC4H 1XIWB 2FO4B 3KLDA 3O0RL 4IJ3B 4MJ5A 4WW1A 3ZDXF 4MAYC 4RGOL 5AD0B 1DTUA 3VGAC 4ONFH 3ZYZA 3ZE0E 2VN7A 4E41A 1T1ZB 1XF4B 4Z7OF 1A14H 2CMRH 1L0XA 1LNUB 3X13B 5FECA 3I6LE 2CIIB 3TIDB 3WLWD 2W38A 3VG9C 3V6OE 4LKCB 3RFZC 4LEXL 5LJYH 4LLDB 2EE9A 1J1OL 3KLHC 3SHSA 3FQNA 3L5XH 1I4FA 4OBSA 3HPJA 1K8DB 2KQNA 2ID5A 2DIJA 4PY8I 1UH2A 3CXDL 4ZAKD 2F53E 4R7NA 2IBZY 3QT2A 3LQAC 5DJDA 3BZEB 5D2NC 3FN0L 3BKCH 1MAKA 2YSSA 4Z7WB 2VABA 5BZWB 3VXRD 1IT9L 3EYUH 5F96L 5EOQL 4RFOL 3ULUL 3VD3A 5ALCH 1FGNH 1M7IA 1NCDL 3QUZD 3X11A 3FT4A 3AS1A 5I30H 1J0ZA 2EDXA 5L2KD 3QIBB 4UIKL 1BEYL 3WO4C 1IGJB 4TTDD 3KYKL 5EIQA 2D31B 3OKNB 4F9PA 5MP6L 2VH5L 3ULUE 1X9QA 4HIXH 3I02B 1OP5H 1EHAA 1MCFA 3GSUB 1KOAA 5DVOA 4MQSB 1FVDA 1E4WL 1DN0A 2PO6C 4OZIE 5TFSL 4Z77B 3W11D 4NZDA 1HILA 4MVBC 4NKDB 5DJCB 3N1MC 5ADOH 3UBXI 1WFTA 1ORSA 1MIML 3KS0H 4P5TD 5D6CB 2OI9C 2PTVA 3QCUH 4F58L 5E4EB 4P2QA 3HG1D 1JPST 2LE9A 1EUTA 2W60B 2MKLC 4HUVB 3QZWA 1W72A 3HI5L 3AREA 1CLYH 4DZ8B 1BBJA 1J11A 1AJ7H 2F74B 3KWWA 2LVEA 4JM2A 4TVSa 3WSQH 1PZ5B 1C5DB 4IBLT 2CKBH 3AVEA 3VXNA 1EIBA 1LE5A 1TDQA 5D7JC 5TF0A 3TZVB 4BFGA 3QDHA 5CEZL 2X4RB 1BD2A 3QHTC 3O2DL 4X7FC 4AM0A 1P6FA 3BVNA 5KANI 4RNRB 1U8IA 1S9KC 3IVKB 4AQOA 4XP1H 4QRQA 1A2YB 3T0BA 5J57B 4JN1H 4PJ7F 2X40A 4HWZB 3H9SE 4XI5D 4RAVB 1XF2A 5JDSA 1U8LA 4OCYL 4BJLA 5LQBL 2C4FT 2E7MA 3CFJB 1NGZB 4X83A 4YNYA 1BOYA 1BX2B 4LCCA 4J3WA 1R3JB 4YGAB 5ADPH 3O3AA 3VE0A 3PWNB 5J0BA 1A3RH 2V5YA 3FCTB 3QEQB 3BP4B 5FA3B 1J5OL 3KPNA 3UTTD 4HQQH 4HKJA 4D9LH 2OJZH 3GIZH 3MFFB 4PTTA 2H9GB 4LCWE 4ZYKB 5IQ9B 2DRUA 1YA5A 4Z0BH 4F7PB 3WNKA 4LGSB 5BXFA 4JREB 1UKQA 5ETUB 4NHUB 1WCQA 5DYOA 1BIIA 2UZYB 3TIEB 3W9DB 4LSDA 5CSZB 3QFJD 4RWYH 2EZ0C 4WFEE 1PG7L 4GKZB 5E6ID 5C9KA 5BZDA 2O5ZH 5KVGL 1UM5H 2DTSA 4X5WB 3EOTH 3TP4A 5E6ZA 2P4AB 5F7LB 3VW3L 4NO0D 2EDOA 4K7FB 3AU1A 3QUYB 2JB6A 4G8GB 2VZUA 5JORB 3IKCA 1S7SB 3HZMB 3VFVA 1A6PA 5FUCC 4YHYB 4M7KL 1OB1B 1WAAA 3H3PL 4MXVE 5GISH 2NZ9D 3MGAA 5KSUA 3RY6A 3CUPB 3SKJH 3DXAD 3H9YA 3B6SA 2VDPL 5JOFB 5E95B 2D7PA 1KN4L 1XGUA 1Z6JT 3QI9A 1QR4A 4HH9A 3G9VA 2FWOA 2W9EL 3BRFA 3O45B 2Z35A 4KJWC 3BFOA 2DQGL 2LVCA 1E6OL 3FQUA 1F4AA 3CC5A 4JKPL 2DQTL 4M7LL 3SPVB 5F3BB 3NA4A 2A74A 4KU1A 3GJEB 2DM4A 4JFEB 3QXAA 1CCZA 1KIQA 5DHVH 3UPRA 1OP3H 2BVPB 2RIKA 3HZVB 4TRPL 3JVGC 1X44A 4HZLB 5EO0B 4LAQH 5HGHA 3VXTB 1ZA3B 2ARJB 3S4SG 4F7CA 1HZHH 1RFDH 5EO9B 3Q0HA 2EDQA 1D6VH 1W0WB 4OCSH 1LP9F 2AJXH 5GZOD 5IMLB 2BCKB 3RVXC 5BMFH 1OQOA 5EUKA 1BFTA 4JRXE 4ODSH 5DMIH 2P5WB 2HH0H 1RIVL 4XCNA 1MRCL 1UYWH 4X80H 3RP1A 1FFPA 1HXMA 1LK2B 3H9SA 1DR9A 5L2JA 5I8EA 1D5IL 1V3KA 4GRLA 4PPTA 5JOPE 1MHHA 4Q58C 1WWCA 3TGXA 3V0VA 4R4NC 2G9HB 5JR1H 3TBVA 1MH5B 1F58L 4KK5D 2C3XA 1HOCB 3CVHH 5CINL 1H3PL 3AS0A 3GRWA 2BHYA 3LEYH 5FGCE 3CVIH 3DVGB 3MOBH 2ADGA 3C8HA 4LSSL 4Y16C 4WW2C 1Q0XH 3G5XA 4AK1A 3VFWA 1FNAA 2GTZA 3O6MH 4LSQH 4EI6A 2A0LC 1N6QL 4ZUUA 1SYVB 4FS0A 3LQAL 4QRTB 3HC4L 1NEZG 4Y5VA 3LEXA 4M7ZB 3ZT6A 5DS8B 3WDHA 3EFFB 5SWZA 1BMGA 4LSVL 2J5LC 4U1HA 1JYVA 4QHMB 4CU8A 3JUZA 2ZOKB 1Q94A 3SDCA 4ODVH 2PYFB 4KMTH 1FFNA 1N7ML 5L8KB 1B3JA 3QDGB 2E27H 5TQ0L 1BF2A 5D2NE 4FFVC 4YK4B 3SO3B 1OAYH 1T21A 4X9GA 5A2LH 1F97A 3P0VH 2BDNH 5EULV 3MUJA 5BV7B 1M05A 2YD2A 5IB3A 1NGYA 2AJVH 5HYSG 2E9IA 3X3FL 5E94A 2DLIA 1QFWH 3DV6B 4J3XA 3GMOB 4PJAF 2UWEF 3SKUD 2NCMA 1RZ7H 3TT1L 1GPOH 3KXFA 1U3ZA 4NP4L 3BW9A 5DVLA 1A9BA 5TQ2H 1JK8A 3PWPB 4KHXL 4KQ4H 3IDNA 4P4KD 1JGLL 1T2JA 3LMJL 3ARDA 5J6HB 2PR4H 2AS5M 3RWEA 4LIQH 1XFPA 2QKIB 4DOHB 5D1ZA 2QQLL 1OSPH 2AVGA 2RR3A 5EN2A 3QUXD 5C8JB 1LE9A 3LN9A 4JFYB 1Z0NA 4NQCA 2R56L 4QHNB 4YR6A 1CGTA 2X7LB 2DYPD 4Z7VB 1GGIH 2YD8A 4PP2A 3BHBA 4J8RB 1YNTB 1DQLL 4HIJA 1CVRA 3C6LC 1KJ2B 5IWLC 1A1NB 3CXHJ 4FQHB 2X2YA 4U1KB 3IDYC 4RGOH 2VRAA 3EDDA 1RHFA 3U9PL 1NFDA 1VGEL 2D4FA 4XPAL 5ECJE 3S9DB 1YJDC 3LKPA 3NFSL 4OLYL 1PEZA 5AAWA 3MLRL 1N5AA 4OFYA 1M6OB 4MXWL 1OAXL 5K9QI 4XP5L 3G04B 5C0BE 4C55A 1A4KB 3KHQA 4LBEA 3U46B 4HBQA 3MCKA 4JFQB 4KRNA 2YUVA 3CXDH 4UAOC 1OGAE 1LO4H 4M61B 4ZTPH 3D87B 3O4LA 3FN0H 3RDTB 5TGBB 3RTQD 1F11A 5IG7B 1IT9H 5EOQH 3FAWA 4RFOH 2XKNA 3VXQB 1MJ7H 2EEAA 1NCDH 3S4SB 1KLGB 2EDBA 4GAGL 3RKDC 1BREA 4M62L 4UIKH 4K71C 1BEYH 5IM7A 1BOGA 4OSUL 3KYKH 2Y06H 3IGAA 3KYAA 4KJQC 2VH5H 1YY8B 2IADB 4D0DA 1EEZB 4P46C 2ADIB 2HG5A 4UT7L 5ALBL 1CN4A 4AIXA 2WBJC 4WO4A 3GMQA 4LDEB 3WHXA 1U8HB 4NO3A 5TFSH 5T5NG 2NY3B 2UVEA 3E2HC 5HI3D 5TDNB 3V95A 5SX4H 2IANE 1T20B 3QWRD 3VXMB 1CDJA 5KG9B 1RK0B 2EDWA 5C0DB 1D6EA 5D1XD 5DFVC 5D1QA 1GRWA 2AK4A 5T1DL 3HI5H 1T3FA 5D2LB 4RGNB 5JA9A 5FKPA 4K23H 5BVPH 5C0FB 3DVFA 2BNUA 2HWZL 2GCYA 5DEZA 1NEZB 4H1LB 5FUCE 3D25B 1X5LA 1FRGL 4JFFB 1LD9A 4HJGB 2HT4C 3MPCA 5CEZH 1EUUA 4U7MA 3T0EA 1HDMB 3O2VL 1ITBB 2NTSP 3MUHL 3ARGC 4XX1E 2NXYD 1HWHB 5K9OA 3CFDA 2DF3A 2DQEL 3KNBA 5KN5A 3BIBX 4GMSL 1X5KA 2IMNA 3HB3C 2GKIA 4L8CB 5HYSB 4UZGA 1S9XA 1KEGL 3OB0H 3WNOA 1WC7B 1YUHA 1FO0A 1FPTL 1B6DA 4JFDA 2Q8AL 4OCYH 5J1TC 5LQBH 3SGDI 5GJSL 4PJGA 2NY1B 1F3JB 2YPLA 5HHOA 5I6XC 3FO9B 4YHZH 5GSRA 3EO1B 4PRPB 4ZUTA 5KVDL 2VIRB 2NY0D 2VXUL 4JO1L 2YBRA 1J5OH 3L5HA 3MNZB 5IT2L 3TBSB 4JHAL 4BM7A 3T04D 5KZCB 2IH1B 2LQRA 3ZYJA 4XVTL 1OAUL 4JANA 3T65A 4P4RB 1OARH 1DANT 2G75A 1SJEA 2X05A 4CNIB 3I6LD 2BXYA 5DC9B 2HRPH 1FNLA 3TPUA 4LLMA 4JGUA 3HAEA 5DMJB 1NLDL 3MRFB 3AY4A 2EIEA 1NMBL 3EOAB 1F2XK 5IFAL 1A0QH 4KRPD 2NY2B 4BSWA 4WNQA 4FQIH 4N0UE 4M7KH 2F53D 3OHXB 3H3PH 4Y4FA 1MAML 15C8L 5C2BL 2X4SB 3PWVA 2VDPH 3VXOA 2Q3AA 3NZHL 3L3IA 1WAAF 2A6DB 4OZGA 2F9BT 4MQXD 4X6FA 5GGSY 5CD5C 1S78C 4HGWA 4MJIA 3O11B 1DBMH 4JKLA 1NUGA 4F7MA 4AIZB 1JUFB 2CRZA 2DQGH 1E6OH 4JKPH 4M7LH 2DQTH 4EI5C 3WLBB 2BSSB 4Y89A 4JZNA 1AGDA 3ULUD 5GXBB 3F12B 4L8BA 3B83A 4WFGE 5T3ZL 4O58L 4ZAKB 2X4OA 4GUPB 1SEQH 2Y1VA 4TUKL 2P47B 3NFPA 3RAJL 5FOBB 5KSAC 2XXCB 3Q6FB 3VGEA 4MAUL 1K6QL 4PJCA 1KCVL 1S7RB 4ELKB 2X1WL 3QUZB 3G5ZA 1INEH 5L2KB 2CIKB 2ARWA 3FONA 2OTUB 5KSBE 1KNOB 1PW3A 32C2A 1RIVH 4M7JL 3GM8A 4OFIA 4OT1L 1MRCH 5LGJB 1UM6H 4LLYB 3GSQA 4PJHA 4DEPC 5CP3H 2X09A 3MRMA 3S35L 1D5IH 4C58B 3PGFH 2E7CA 1FNGB 2C1OA 3AFLA 5F9OL 4WJ5B 4NRXA 5EOCH 1YJDL 5D5MA 1F58H 1ADQL 3NA9L 5FCUL 2I24N 3I6GB 5CINH 3PNWB 4OB5L 3U1SL 3NPSB 3B9KD 3KGRA 1FGVL 4MJ4A 5CJQL 5AUMA 2OR9L 4APQA 2BMKA 3R1GL 4LSSH 3OJ2C 4N5ED 4P5TB 4OF3A 3SGEI 1K2DB 1QBLH 4HUWA 5CEZD 4HS8L 5L6YL 1N6QH 5GSVB 5JXEC 4ZFOB 3CU1A 5F89B 3LQAH 5GGUA 1QRNE 3HC4H 2AV1B 5ITFB 3O9WD 4LOUD 4C4KO 2B4CC 2IAMA 3HE7C 4LSVH 1O5DT 4W6WB 4HGMA 5ICZA 3GNML 4DUWA 4X7SL 1NFIA 3X17A 2DKMA 5ISZA 4YXKL 2OZ4A 5F7UA 2ATPB 5TQ0H 2Y7QA 3PUCA 5CZXC 1ZANH 4LCWD 3C5ZB 3ECBB 2AJSH 3L3OA 3O3EB 3OR7A 3X3FH 5IKCB 3MUGA 4HX1B 4JDZB 3TC9A 3TT1H 3VXUE 5CAYB 4JRWA 5J12B 4NP4H 2JK5B 4WFED 2D2OA 3SDDB 1V3LA 1OF2B 4OD3H 1BGXH 1JGLH 4HMCA 1OLLA 1OWWA 4U6VL 3WE6A 4ZNCD 1ZVSB 3KHOA 3DGCR 4L3EB 4L4VE 2QQLH 1M1SA 2DAVA 1W8NA 2DQFA 4FQ1L 5HDBE 1A4JA 3PL6C 5GGTA 5FUOL 1G9MC 3ZE2E 2D03L 5J9PB 3VWKC 2YD4A 1FYTB 4YBQD 5I76B 3QNZB 1JGEB 3HRZA 5E2JA 4GG6E 4LRNL 2OR8A 5I1JL 1G7IA 3ARBA 4U1JA 4KV5E 2X9WA 5E5MB 3VGGA 4RBPK 3QO0B 4OLYH 2VAAB 4OZHE 4V1DA 5FK9B 3UZEA 2DD8L 2XICA 4XH2A 5L0QC 1T7YA 4XVSL 4MXWH 2MKWA 3MV8E 3AMLA 5TDPB 5E24E 1I7RB 4TOYL 5T1LA 1UQSB 1MREH 3ULVC 4M00A 2X4PA 3RVUD 3DXAB 5DMKB 4HC1A 1DEEA 2FECI 5DO2C 3DV4B 4H25A 2NTFA 5F7YC 3PJSB 4PJ9C 2YD1A 1NGWA 2VL5B 3RBGA 4L4JA 1YEDB 5C71A 4JRXD 5A16A 1LO0L 1WTGT 5HYJB 1RJZB 4Z6AT 1VCAA 5DA0B 5HI5D 2OTPA 3IJSB 2J4WL 4FQ2L 4GAGH 4HXBL 4YHKL 4ELMF 4M62H 3GGWB 4OSUH 1JWSA 1AGBB 4LHUA 4HWUA 5JOPD 4L8DA 5EBMA 2VR9A 4UT7H 1ZS8B 5ALBH 1KCUL 5DRZB 5GS3A 1BZ9A 1FVEA 3H9HB 4G9FB 3DX7A 5JMRA 3LSOB 4NO2A 3Q5YA 4ZSOB 4N0CC 5IVZB 3U30C 1I8MA 5K9KA 5MEPB 1A6UL 4NZUL 4G43A 1KLUB 5L7XL 5T5FH 1H15A 3VFMA 2FX9L 1FN4B 5T1DH 1TCRB 1C5CL 2XT1B 3V5HB 1ZHKB 3UTSE 3KLHD 3QUML 4U49A 4G7YL 2HWZH 4S0TD 3TVMA 3W5MA 2A6JB 4ZXBB 3OXRB 5FYKL 5GGRY 2APWA 4R2GC 3MACL 1NMCB 4U6XA 4KPHL 1FL3A 4ZUVB 2IPKA 2L0DA 3KG5A 5LAXA 3MRHA 2DQHL 4UQ3A 3LS5L 1A7PL 1IGIH 2DQEH 1T5WB 1EJ6A 4GMSH 5HHVL 4KQ3H 4WHCA 2K7PA 5EUOE 5FYKE 1NSNH 2PW1B 2X89D 4HS6A 4P9HH 4HIHB 2R2BB 5IROC 2Q8AH 3OX8B 5IB1B 1QBAA 5GJSH 1YNKL 3V4PL 4PRNB 1UC6A 1Z0MA 2ZZUT 3PDDA 3QXVA 4IHOB 1CXHA 4XRCA 5C92A 3KPMB 4X6EA 1OCWH 4I5BB 2YR3A 3RNQB 3QZWG 5T1MA 4PJGF 4LCIL 5I19H 1F4YL 2GJJA 2VXUH 4JO1H 3G6AA 4MVBD 1IFHL 4JQXC 5IT2H 3LHPL 1B88A 1S9YA 4JKMA 3IS1X 1AHWB 3A0OA 1BFSA 1DUYA 3OXSB 5ANMA 4G6FD 3TH2T 1DQQB 1J87A 3V5KA 3VD9A 4GKNA 3OR6B 2GUOB 1RZ8A 4FMKA 3DTXA 1NCNA 3BWAA 1FZJB 4ETQB 3MRKB 2CRMA 3BO8B 1F42A 1Q9WA 4RA0C 3DHJA 2WSKA 5DJXB 3QJFB 2MMXA 5IW1B 5D7JD 4FQCL 4DUXA 3QUXB 4YHNA 5C0BD 4AENB 1TQBB 5IFAH 1ZGLB 5E5RB 1A47A 3B8YA 1SHMA 2FL5A 3QQNA 2UY6A 1FZKA 1OGAD 1KTRL 4UILL 5HVGB 4O51B 1MAMH 5CBAA 1T83C 15C8H 4MDIB 2MQ3A 2B4CL 5E9DB 3E6FA 1AR2A 4JQVA 5T1KB 1AGCA 1PKQA 1MY7A 3BYTA 2VITB 3NZHH 4X9HA 5GRJL 4Y4KC 5FGSA 2ATKA 3PWUB 3UDWA 4B7IA 2FJHA 4QRUA 3AM8C 4JCMA 1NCCL 4S1DC 2DQJL 3OGCB 4YBHA 3M17A 5HHQA 1JYNA 1U3HC 5CGMA 2AKRA 1B4RA 3RWJA 4HUMB 3BIKA 4I2XA 3WD5L 4DGIH 4FG6C 5IHZA 5T3ZH 3X14B 4O58H 5EU7E 4E41B 2E7LA 4TUKH 12E8L 3RTQB 2CO6B 4DGYL 2IAND 2X9YA 4MXQD 2B2XL 2FLRT 2EZ0D 5FYLL 2A9ML 1K6QH 2Q7YB 4ODHL 3KPLB 2FECL 2X4NA 1QG3A 3JSSA 5I1CH 3HPJB 1WSST 1G9ML 1QHPA 5GRUH 4R7NB 3KR3H 4M7JH 4OT1H 1HHGB 2VXSL 5FYLE 4UOW0 2YSSB 2VABB 2ZCKL 3MBED 3S35H 4R96A 4QRRA 2XV6B 2P44B 1I1AA 5HVFB 4QCIA 4Z7UE 1M7IB 2HKFL 5E8EB 2ZUXA 3X11B 3V79C 1QYGL 5MI0B 1ADQH 1FP5A 2A6KA 3NA9H 1MFEL 5FCUH 2FR4A 4OB5H 2YEZB 5CJQH 1FGVH 5JW5B 3QQ4A 2H45A 2OR9H 5F1NA 3R1GH 3IDIA 1MNUL 3UTQB 5D5MF 2YKLL 3S5LA 5IB4A 4PGDB 4P2OC 5D1XB 1NUFA 2HJFA 3QXUA 5FHAH 5L6YH 4GRWE 3C5SB 3ULVL 3B9VA 3VWJC 5I66A 2CUIA 1AQDA 5AEAA 2LV4A 3E6HB 2C3GA 4KK8C 4LNRB 1IAOA 4LVHC 3GNMH 1ORSB 4LAJH 4X7SH 4QT5A 5LGHL 5BQ7B 3N1PC 5EZLA 3ULVE 3MV7D 4YXKH 1IQWL 1WBXA 5CBEA 4PR5A 3RGVA 2W0FA 2VZSA 3N1FC 3CFEB 1W72B 5AZ2L 3AREB 4FXKA 4EIGB 3K4DA 2NXYB 5B39B 1BBJB 3WKML 2X44D 3RVXD 3KWWB 1WBYA 4JM2B 1TENA 4HK3J 4Z0XA 3WS6A 4NDMA 1A8JH 4Y1AA 2CXKA 3DI2B 3VXNB 5B8CA 1LE5B 3RHWF 3TA3A 5FGRA 5EU5A 4POYA 1X5ZA 1A5FL 1XR8A 2DI8A 3BJ91 1BD2B 4J1UA 4YDLC 3BVNB 5DUBA 1N8ZA 4U6VH 1U8IB 3JV6A 4NQSB 4QRQB 1OTUC 2CD0A 5IHUL 2APXA 4R4ND 3SGDH 2NY0B 1CICD 3GSWA 3ZDZF 1IKFL 3ETBF 1DSFL 1KB9J 2OP4L 2PXYC 1V7ML 4FQ1H 4PRAA 1XF2B 5IW6A 2B5IC 2RB8A 5JDSB 4PJEE 4DFIA 1AD0A 1U8LB 2R1XA 5EU6A 5C6WH 3GUTB 3X12A 4ERSL 4QF1A 2WZPD 3LEVL 5CHNA 4YBLB 4LCCB 2A0LD 3SKOB 5TE7L 3SCMA 4LRNH 4WDIA 1YMMA 3PHQA 5A2JH 5I1JH 1E4XL 3O3AB 4NOFA 2V6HA 2F54A 3N50A 3VG0L 4U33A 5IMKA 2A77L 1FC1A 4PTTB 5DD3H 4P57A 4EN3C 4LRIA 5F70A 4PBVC 1LGVA 1UXWA 5DHVA 4R7DA 3HMXL 2DD8H 1NH6A 4YHPA 3EJZC 1NLBL 4FFVD 4NM4L 4XVSH 5DYOB 2ESVA 5JUEL 4WFGD 3R8QA 3O41A 3TEUA 2WMPA 1PAMA 2F53B 2B0SH 4R0LB 4XNZB 2Z8RA 5BZDB 3MXVL 3P9WB 1JTPA 4Z7QF 3F8UB 3CZJA 3P40A 2RQ8A 3BRGC 5E70A 4TSCL 2GY5A 5JW4M 1LQSR 2JB6B 3MLTA 5F7EH 1KT2B 5JIKA 1RUQL 2CGRH 4IOIB 5DC4B 1CYGA 1LO0H 1ODAA 3T1FB 1HKLL 3LV3B 2J4WH 4FQ2H 4HXBH 1RZFL 5KSUB 3JWNC 4EDXA 5J13B 2D0FA 1F5WA 4OF8A 2HTKC 3BXNB 3QI9B 1X6NA 2NW2B 2P43B 4B0MM 4W4OC 1KCUH 3MJ9A 3C6LD 1WBZA 3DRTA 3BE1H 3FQUB 1FJ1A 3CC5B 4F7EA 4XWOD 3TCLA 1JBJA 5D6DC 1LDSA 4ZFFA 3S3SA 2ZCHL 1G84A 1H3XA 2FX8L 3QXAB 4NZUH 4PY7B 4F33A 5L7XH 3UPRB 3G6JE 4JVWA 3BPNB 1QRND 4PB9L 2V2WB 2FX9H 1K5NA 1C5CH 4PJIF 4YFEA 4HV8B 4A6YA 3QUMH 4G7YH 4F7CB 4GAYA 4G6ML 4NWUL 2V5MA 3VRLF 5FGBA 4NN7B 2O61B 3KDMA 4WWKD 2D7NA 1FFPB 1G1CA 5HSFA 3VXUD 3LS5H 3H9SB 4OZ4A 3GMRA 5I8EB 3HNVL 2QQKL 2VZ3A 3CJJA 4OCNC 5HHVH 4CMMA 5DGQA 1IKNA 1I8KA 3RKDD 3V0VB 2ERJB 1TPXC 4NQEE 5KS9E 4KJQD 2YOCA 4R4BB 1YNKH 1T89C 2ZUQB 1ETZA 1TETL 4N1CA 5EOTA 4P46D 5DJ6A 4L4VD 2WBJD 2ZWLT 2CDFA 2OTWA 4OV5A 2YWYA 4LCIH 3OKOB 5DUML 3B2VH 4HWBL 1F4YH 4OFKA 4LCWB 3CX5K 1IFHH 1XGPB 4ZUUB 3HCVA 3LHPH 5K33A 4JY4A 1BJ1H 3VH8A 1FNSL 2QHRH 4Y5VB 3LEXB 4U7SA 5I71C 1G0XA 4PJ8C 3BN9C 5SWZB 3VRJA 3RZWA 4PGCB 4YGVA 5DFVD 1Q94B 1FFNB 4M8QB 4MQ7A 4NNPL 3RWFA 3WNNA 5IP4A 1EFQA 4JG0L 3FB6A 4NYLA 2Y6SC 1T21B 4PJBE 5FO7A 3OG6B 1XH3A 2EDRA 5IMOB 5IB3B 4KMLB 3SGJC 2LU7A 4Q6IC 5E94B 4X99A 4FQCH 1KJMB 2HT4D 4EUPH 3MV8D 2V2XA 2WAHA 1ZE3C 3RZCC 3KXFB 3ZTJH 5DJ0A 5DLMH 4LVOB 1A9BB 3WUZA 1MCRA 1DVFA 2W92A 5DURB 4OFVA 4UILH 1U2HA 1ZLWH 3IDNB 2B4CH 3HB3D 1U95B 3PIQA 3NCYP 4F3FA 3RWEB 1ZSDB 1J0YA 3BT2H 3DHMA 4YHIA 1AC6A 5DZNA 4O2FB 4S1RL 5D1ZB 1KTDA 3AGVA 1YYLL 5GRJH 1C5BL 2VZOA 1JRHI 1MEXL 4NQCB 4HFWB 4Y5YA 4YR6B 3FOLA 1NCCH 1QBBA 3L9RA 3ZDYE 3QFDB 4IMLA 3INUH 1A7BA 4W6YB 5FHBL 4HIJB 3TLRA 1HH6B 3P9LB 2VLRE 5EBLB 3NH7L 3SJVE 4RSVA 5F8RC 1CL7L 1FG2A 3EZ8A 3WD5H 3GDBA 3HAEG 5FYJL 1NFDB 1XCQA 3S3PA 3W39B 12E8H 3LKPB 4HT1L 5EBWA 2XKSA 2WNGA 2JIXD 4MLSA 4IMKA 5E56A 1L0YA 3VMNA 4ZS6C 2B2XH 3KS0J 4N8CL 5FYLH 2DLGA 4OCMC 3MJ8A 4UOJA 5FYJE 4LBEB 3MCKB 1S7VB 4OLWL 3LQZA 1EGJA 5EZJA 3U4EB 2Q8BL 2VOTA 4NQVA 3UTSD 2MJWA 5D70L 3TN0B 3VXSA 3GSOA 4PRHA 2XZZA 2JB5L 4U3CA 3NIDE 4H20H 3MA7A 3U7YH 1TJHL 1XF3B 1B4JL 3T09A 1GZPA 3P4NA 5GQBA 2HKFH 3WMSA 5FGCB 2LABA 1QYGH 3DI3B 4XPHL 4P2RE 1MFEH 4JFXB 2BNRE 3QXTA 1ZMYA 5DA4A 5IM7B 1OSZB 5CD5D 1S78D 1BOGB 1IM3B 1RUKH 2RAMA 4IRSC 1D9KC 2R4RL 1XMWA 3OF6D 5F9AC 4D0DB 5D4QA 2YKLH 5FYKD 2WWKT 3B43A 5GGRA 2HG5B 1FZOA 2G2RB 4EI5D 1OVZA 1ONQA 4X6CE 2P8MA 4WO4B 3VFSB 2DB8A 3GMQB 3WHXB 1ZHLA 1JE6A 3O6KL 3PDGA 3WN5C 2DMCA 1KPUA 1U8NA 4P3WA 2BVQA 2DQCL 3OJVC 2R2HA 4FQXC 2EC9T 1F4XL 3SDXE 4M6OL 4XP9L 2PCPA 1A7RL 4MA8L 5D2NB 4ORGA 4TUJA 4IRJC 1SY6L 1IQWH 4FTVE 4WY7L 3D85D 5KSAD 5D1QB 4OCWL 4O9HL 5C09E 43CAA 4HPOL 1T3FB 1XIWC 2VLLB 1AIFA 5FKPB 4X6DA 4GXUM 4IJ3C 2P8LA 4X9IA 2GCYB 5F6IB 4MSWA 4MHHG 2BSRB 2AV7A 4JFZL 2X42A 5F71A 1LD9B 1J0JA 1TFHA 5DEGA 1KCLA 2DQIL 3MZTA 4PYHA 1RJLB 5J11C 4C56A 3QDAA 1J8HE 1JWUA 1MUJA 5I75B 1J0KA 5IHUH 2HFEA 5K9OB 3EJJX 3CFDB 2EH7L 4XZUA 1XR9A 2AQ3A 2UUDH 3KNBB 4HIEA 3RU8L 2QADC 1IKFH 4PLKC 2GK0B 4NGHL 3V6FA 1DSFH 2OP4H 1S9XB 4U0QB 3BD3A 4FRWA 1U8JA 2ZUVA 3H42L 4D9RE 3BH8B 3V8CA 4ERSH 5BVJB 3LEVH 4M1DL 4Q97A 4K9EC 3TV3L 5JXED 3STZA 4ZUTB 4JY6A 2FX7H 1H3GA 1E4XH 4WU5A 4F2MA 1U8PA 3TO4C 2A2QT 3HFML 2YBRB 3VG0H 5C0RH 1SJXA 2IFFH 4EDWL 3QIBC 4X9BA 5ICYA 4JO4L 4WI5A 3KPPB 4L9LB 1GHFL 3HMXH 5HDQL 3MA9L 2AGJL 1T2XA 5CZXD 1K8IA 3KYOA 4NO5A 1NDMB 1U6AL 4JANB 2YC1A 3T65B 5JUEH 2VXVL 1OGAB 2BP3A 3FFCA 2G75B 2VLJE 3KVQA 3PQYA 1SJEB 3OSKA 3TBWA 4YC2B 4M4RA 5JQHC 1CG9B 3TPUB 3BH9A 4LVNB 1I9EA 4D0CB 4LLMB 3HAEB 4KDTA 4TSCH 4I77L 1LEKB 5E4EC 4DCQA 2XWBA 2GSIA 1RUQH 1C08A 3NCYS 2XN9A 4WNQB 5CP3A 4Y4FB 1I9IH 4MAYA 1RZFH 3CIQA 4XNXL 5FYLD 1JRHL 4L5FL 3D5OF 3IDGA 1NBYA 3PL6D 3DPBA 2FGWL 1KCKA 4OZGB 3TZVC 4X6FB 4MJIB 4HGWB 4LGRB 4U6HA 1KCRL 3GI8L 3RKPA 4F7MB 4L1HA 3BDBA 2AEPH 5KW9H 3T08A 5E5UB 1LEIA 3S96A 1BBDL 4Y19E 1ZVYA 4NQXA 4JZNB 1AGDB 1CZ8L 2HKHL 1KCSL 2WWMD 4FTVA 2ZCHH 3U6RA 1A7OL 3AUVA 4D8PA 4U05A 4KKAC 4QGTA 2X4OB 4YFLI 1KN2L 8FABA 3NCBB 3RRQA 1XF1A 5EO1A 3MLYL 5GGVL 3ILPA 4JDTH 1OW0A 3MBEB 1FC2D 4PLOB 5JIHA 4PJCB 3ULVD 3MMEB 4DN4H 3QHFL 3BQUA 1KLFA 3G5ZB 3LH2H 4LLQB 4NWUH 3O8XA 3UMTA 3GSNA 5DO2D 3FONB 3QG7H 4LHUG 4PJ9D 3BZ4A 3HE6A 4PJHB 3S36X 2J8UE 1QHOA 2FJGA 2OM5A 2PO6A 1YN6B 3HNVH 2QQKH 3N0PB 3NACL 2J2ZA 1OAKL 3I9GL 1MCDA 3RY5A 4HLJA 1GOHA 1I1RA 1TETH 3NN8B 4APQB 4JFOA 4I3RH 1ITCA 5I2IA 1X5HA 2BMKB 2FH6A 3A6OA 2VZ1A 3HUJE 4QXWA 5D7IA 5DUMH 4YHYC 4HWBH 4F8QA 4FXLA 1KJ3L 4N0CD 4PJFE 1U8KB 3E8UL 2BRRL 1YDPA 1HSBA 4LSUL 2WQRA 2DQDL 3GHEL 1C7SA 1SJHA 4HZAA 5CGYC 5DRWB 2IAMB 4I3SL 2WANA 1J86A 5ICZB 3Q6GH 2P7TB 1GJIA 3T2NL 2VZVA 4Z7NE 1MWAL 2K1MA 4GLRI 4NNPH 2VE6B 2Y7QB 3EDJA 3GJFH 5EA0L 3GMNB 2A38A 4C54A 1GZQB 1MRDL 1JGVL 4XPBH 5DMYA 3L3OB 3OR7B 3M8OH 3PWLB 1CICB 3MUGB 5BJTA 5C08A 4R2GD 2OK0L 3OKEA 3RUGA 2EDLA 4RIRA 3G5YA 4N5UA 1BWMA 1M4KA 5IJVA 3K1KC 3WE6B 3IDXH 1IARB 1GGBH 5EORL 2KUTA 2CXGA 3WIHH 1UFUA 4HIIB 5JQ6L 4HCRL 3ULUF 4UQ2A 1FL6A 1A4JB 1MEXH 3OWEA 5C3TA 1LO2L 1I1FB 1EBPA 1UEMA 3T3PF 2OS7A 2HVJA 2X70B 4XCYB 1JGDA 1YEJL 3L3KB 4YWGH 4OZIF 3HRZB 1JZ6A 4NT6B 4KZEL 1G1YA 4XNUL 2IQ9L 1CL7H 1G7IB 3TYFA 3ARBB 2YA0A 3MRJA 4JN2A 4U1JB 4XXDA 4HKXB 5FFLA 3CAFA 3Q3GA 2R4SL 2FIRT 5IB5B 4V1DB 4N8CH 1VEPA 3TJEL 4OM1H 5I1HL 1TQCB 3RX8A 2OJEB 5HGDB 5TPWH 1JTTA 1OTTC 5KSBB 3TYGL 1J8KA 4OLWH 4M7ZC 3PABA 5CIPH 2LFGA 2Q8BH 2X4PB 1HHJB 2X1QA 4G5ZL 4K9EL 5D70H 3FT2B 4W68A 1AXIB 5JIPA 5MENE 1RK1A 1X3DA 2EDJA 4H25B 4AL8L 2NTFB 2JB5H 1NGWB 3I6KB 1QA9A 3WL9B 1B4JH 5DVMA 5E8NA 2Z4QA 3MNWA 5A16B 3U4BL 4Z7WE 1EMTL 1P2CB 4HUNB 5BV7C 3TCXA 2WIIA 2XWJA 3GKWL 5J3HD 3KPSE 2ZKHL 1T03L 1G6RB 1QSED 2YXFA 1JWSB 4FABH 4KKBC 3W81A 3VRIB 4PJFA 4MMXC 1AGFA 5CJXC 2D9QB 3OKLA 4QXGH 4S1DD 1QRNB 4NQED 1RURL 1BZ9B 1S7UA 1FVEB 2L4OA 3FB7A 4QXTA 2PYEA 3BPCB 1U3HD 1UVQB 4TNVK 3DX7B 3O6KH 5LCVL 5IVXA 4NO2B 5E2UL 2ZG2A 2FEDC 1OAZL 4FG6D 4KI5C 2DQCH 1I8MB 1JNHA 4M6OH 1ZA6B 1A7RH 3QSKB 1KEML 3KLSA 4G43B 5JIIA 1UZ8B 4WWKB 1H15B 2BY1A 2AEWA 4O9HH 4UNVA 4JB9L 1P1ZB 3VXUB 1QBMH 2DL9A 5BS0E 1QSFE 3LKQB 1SEBB 5I74B 1GC1C 5C3LD 5DJ2A 1MCBA 2OL3A 4Y16A 4X6DF 3O6FA 4PJDA 1BQLH 4X8JA 4MS8C 5MEOA 3S5LG 4H0GA 2IPKB 5H94B 4GQ9L 4GW5A 5LAXB 5D96C 5H2BB 2EH7H 3RU8H 1V3JA 3E2HB 1T04A 5I1LA 2YHGA 3QA3A 3W9EA 4QLRA 3CFCL 3RDTC 3H42H 3IFOA 2F15A 1R3KB 5EB9A 4M1DH 5CJOH 4KZDL 3QEHA 5EIIA 3IJHA 4M6NL 3TV3H 3VWJD 1UCTA 5T1MB 1QO3A 4OLZL 4KK8D 3HFMH 3LD8B 1S5HA 3MO1B 1A6AB 4WV1B 1U92A 4YHML 1MCLA 1CFNA 4LLVA 5BRZA 1S9YB 1GHFH 4P3CL 4PJ5A 1DUYB 2PTUA 3MA9H 5ANMB 2AGJH 1J18A 2VLRD 3V5KB 3SJVD 5F6HJ 4PG9B 4GW4B 5F7NC 4FQPA 3L95A 1U6AH 2L7JA 4KDVA 3DTXB 3CZFA 2NY3C 1Z5LA 3OPZL 3ROLA 2XWTA 3TPKA 4BQCA 4PB0L 2YK1H 3JTTA 1J7VR 3MFGB 3V4VH 3QDJE 4EQ2A 4I77H 3MRBA 1JWMB 1TJGL 4YHNB 5FYJD 3V0AC 4G7VL 5I6XB 1XEDA 2ICWI 5E6YA 2FATL 2FL5B 4S2SB 1FZKB 3FOMB 2Z91B 2CUMA 4RGNC 3W0WA 2CJUL 3WBDA 2V17L 4M43L 4XNXH 1NEUA 2NPLX 1JRHH 4L5FH 1DQTA 3NGBB 4ZOAA 4BFBD 1AGCB 5IOPB 1PKQB 2PXYD 3VFUB 1C8PA 1E4KC 2FGWH 4R26L 4HXAL 2L7UA 2MHAA 3K80A 5DI8A 5EOCJ 2ATKB 1KCRH 1CIUA 2FJHB 4ZQKB 4P2RD 4QRUB 4EQ3A 5HYQB 2BNRD 1KPRB 1T7WA 1WFNA 3L7EA 1BBDH 3K46A 4M3JA 3M17B 4ACPA 1CZ8H 3WEXA 2HKHH 5HHQB 1KCSH 2GY7B 2AKRB 1TVHB 3BIKB 3PHSA 1FG9C 1A7OH 2F8VA 1P4IL 5IHZB 2O5XL 4HAFA 4EN3D 1NCBL 2H2PC 1HH9A 1KN2H 4XMLH 4M7LT 3EJZD 4K07A 2MOVA 4ZTOL 5GGVH 3MLYH 3T4YA 3EOBB 2VLME 3AS3A 5ITBL 5IIEB 1UWGL 1MY5A 5DTFB 1QLFA 3QHFH 4EVNB 2V5SA 5C09D 5TF1H 5KVFL 4TQEL 3ARQA 4CU6A 4YXLL 3BKML 2AJUL 2P5WE 3EUUA 2DBLH 4EI5B 4R96B 1U0QA 3BP5A 1JMZA 3NACH 4KKLC 5GIRA 4QCIB 1OAKH 3I9GH 1F6AA 4XBPA 2F5AL 2HTKD 1J8HD 2A73A 3QQ4B 5F1NB 4MNQA 4FFWD 3IDIB 7CGTA 3T2OA 2NY2C 3FT3A 3DUHA 3S5LB 5IB4B 5KBNC 4HLZH 3D85B 3NABL 5KSAB 1FZMA 1KIRB 2E6PA 4I9WE 1UB6A 2HJFB 3ALPA 4H0IA 1DBJL 3E8UH 4U1IA 2NW3A 4TPRL 4D9RD 4X5XA 5JLZB 1AQDB 2NY6B 3GHEH 1XAUA 3DRQB 4UTBL 4R3SA 2M8XA 1DN2A 3KPRD 4Q2ZA 3PGDA 4QT5B 3SKNA 4KGJA 1OWRM 1MWAH 5EZLB 1RJYB 3ARGA 5DMGC 3O4OC 4CAGA 5BV7L 3WLWC 3RGVB 3HZYA 1CXKA 3FB8A 3RWDA 5EA0H 1N2RA 2V7HA 2YA2A 3Q48A 1T0NA 5M7QA 4BUGA 1MRDH 1JGVH 4PJXE 5B22A 3VCLA 3MCG1 3VFOA 4TUOA 4YFDB 3GMLB 1WBYB 4Z0XB 5C6TL 2OK0H 4Y1AB 4ZAKC 5B8CB 5FF6A 3TA3B 3I75A 2VLJD 2X41A 5EU5B 2Y9RT 2DWEA 1XR8B 3QG6B 4FN0A 1QLEL 3CH8A 3BZFA 2D4DA 2A9NL 1N8ZB 4MNGA 3JV6B 1BWWA 5KAQG 4F80A 4MYWB 4P5MA 2W59A 4QWWC 1A6ZA 3RWGA 5DQDL 5DT1L 3VFGL 3QUZC 1YN7A 3VH8G 4ONHA 4HCRH 4PRAB 4BZ2L 5E2TL 5GZND 4DOHE 1LO2H 1AD0B 2R1XB 4KI5E 1R5WB 3OBAA 2C4FU 4QF1B 5DEFB 1YEJH 2EDTA 4NJAL 1KF9B 3S34L 2OMBA 4Q7DA 5SWSA 1WZKA 1GC1L 1MLBA 3SCMB 1G7JA 3RNKB 4KZEH 4WDIB 1U58B 1YMMB 2P46B 5D72H 4XNUH 2IQ9H 2JCCF 1PSKH 2ZPKL 3K4ZA 5IF0B 2F54B 1IGYB 4O4YH 4PJ8D 3BN9D 4KY1L 2VO5A 2ZUTA 3WNMA 3U0TA 4Y19D 1ZT7A 3NFNA 4IIQA 5E8PA 4P5TC 4P57B 1UXWB 4R7DB 4POUB 4YHPB 3SKMA 4X4XA 8CGTA 3TJEH 4Y88A 1TZIA 2V7NB 2Y6SD 3D69A 4LCYA 3O41B 3TYGH 5FDWB 1P7QD 2DWDA 1GGTA 2I9TB 1VFMA 3RZCD 1D5MB 2CK2A 4G5ZH 3MRPA 3G5VA 4AL8H 3BGMA 1LK3L 4GOSA 3D0VA 4Z7UB 3FQRB 3MLTB 3ARTA 4U1GB 3U4BH 4GRMA 1EMTH 3C5ZC 2IPTL 3RQ3A 3P30H 5HYFA 3SE4C 4ODXB 2ZKHH 1S7WB 5F3HA 1T03H 1QUNA 5J12C 3MV01 3SGKC 1NKRA 5JOEA 5F93C 4I0PA 2Y36H 4GRWB 4IS6B 3ZHLA 3B2UC 3EZJB 3MC0A 3SDDC 4QOKA 3IAQA 3OG4B 4K3GA 4W6XB 4PYGA 3UC0H 4JPIB 1R3LA 1WBZB 2OMNA 5LCVH 4F7EB 3MLPA 5E2UH 4XPTL 3RWIA 1OAZH 4OV6F 4H88H 4ZFFB 4ZUSA 4HG4K 1MF2H 4XCFL 4G3YL 2W9LA 3ILQC 1ZT1A 2IBBA 3GKZA 1EK3A 4ZS6D 3VXME 3N06B 2Q1EA 1K5NB 3ELAT 5EG6C 1QP1A 4BH7A 4AJ0A 1ACZA 5ABDE 4A6YB 4PGBB 4NKIL 2D7QA 5F7DA 4JR9L 1ZGLM 5D2LE 2FJFA 4DJMA 4RGNE 1A7QL 4L29A 3P4OA 4MA3A 3IU3A 1CR9L 1ZLUH 4RQQB 4EUPA 4PG2C 5DVKA 3F65A 3KDMB 4HUUA 1AFVL 5IBLC 4NNYA 4WW2F 5J7CC 3BESR 4OZ4B 4C57C 1I7UA 2NNAA 4MD5A 4NFBA 5JHDA 4MJ6B 3CXHK 4CMMB 4PRIA 3WS3A 4R8WL 2NZ9C 3HE7A 2PN5A 3MX0A 1BFOA 1NAML 2BNQD 1ZGLP 3LKSA 4NBYB 3CFCH 4IRSD 1D9KD 3EO0B 4ETYA 1ETZB 5FO8A 5DJ6B 4OIBA 4KZDH 3B9DA 4M6NH 4XBEL 2CDFB 2OTWB 3G08A 2FEEI 4OLZH 4AQ1B 1KBGL 3HCVB 1UM4L 4YHMH 5HVHB 4N90E 2H1PL 5ESQA 4FQXD 3VH8B 3MRIA 5I0ZA 2I25N 4IRJD 5GHWL 1KG0B 3VRJB 4NN6B 1BAFH 2XQBL 3EGSA 4NFCA 2GW5A 1XIWD 5F1IA 3RWFB 4QGYA 3GHBL 3FB6B 4NYLB 3SE3A 2ADJA 3H6JA 5FO7B 4PB0H 3Q1SL 4BFIA 3D0LA 1F6LL 2HN7A 3Q2CA 3FO1A 4X99B 3O3DB 4Z9KB 1TJGH 2BY2A 2V2XB 3VWKA 2XZAL 1MHEB 3SDYL 2ICWA 4NSKA 5DJ0B 4UI2A 1BFVL 5CILH 2CJUH 2PW2A 4LPCA 2V17H 4M43H 5MEND 2HFGL 2QADD 2A83B 2J88H 4JM4L 1HIML 4PLKD 4F3FB 3EYOA 2IQAA 3CPLA 4ZXBC 4XBGB 4R26H 2ZSVB 2HFFB 4HXAH 4Y2DD 1EFXA 1KTDB 2HTLC 2J6EL 3MGTA 3BEVA 5J06A 2FCBA 5CUSL 3UPAA 4LMQI 1NMCC 2AXFA 5EWIL 1IAIM 3KPSD 3L9RB 1P5UA 1WV7T 2J12B 3GMMA 4U1SA 4IMLB 2QSCH 3TO4D 3O2WL 4UB0H 1FLRH 4J3TA 1WZMA 1GYAA 1FG2B 2O5XH 1NC4D 3QNXA 4Z7OE 2KKQA 3DVNA 1GVIA 1XCQB 3OAZH 4M9OA 2H32A 1VACB 4CJ0A 3BP6A 5GRZA 3CNKA 1SM3H 5T3XH 3VGDA 5ITBH 2DL2A 2LAGB 3MJ8B 3QXWA 4J4PC 1UWGH 4ZDHB 1X5YA 1U91B 1FLTX 2HLFC 1AHWC 1CTOA 2NY7L 5EZJB 4X0KA 4NQVB 5J6GB 5BS0D 4MLIA 4JG1L 3QPXL 5DK3A 4OF6A 1QSFD 1TJIH 4YXLH 3VXSB 3WDJA 3BPOC 3GSOB 4PRHB 1MCKA 1R3HA 5KS9B 3C60A 4OUUA 1GZPB 3U2SB 1U3HB 3OJDB 4N8VA 1VEMA 2F5AH 3P0GB 3T3MF 4NQDE 5HDBF 5C0AE 3OKKA 1YPZA 4UDUA 3QIUA 3QUXC 4XC3L 3PGCA 3P9MA 4NUGL 1TQBC 1Y6NR 2AJYH 4ZFOL 1S7XB 1TCMA 5DHYB 3NABH 4GG6F 4CW1A 1NANI 3UJTL 2P8MB 1MRFL 1DBJH 1MCOH 3QDME 1D5ZA 3T1WA 1DBAL 5DJAB 1OD7A 4UTBH 5MERA 2YN5A 1WZLA 4KV5F 1UADC 3V6ZA 4BUHA 4WFHE 2BVQB 1TVBB 3GK8H 2R2HB 1P69B 2Q7NA 4OZHF 1I1YA 4ORGB 4TUJB 4J12A 2Z92A 3R06B 5BV7H 3HMXA 1C7TA 4R4FL 1BVKA 1TTUA 1MHCB 4YDVB 4G6AC 1CE6B 4PP1C 2HLAB 3EW3B 1RVFL 4MSWB 1EO8L 3LRSA 3VA2C 2VJXA 2AV7B 5L8LB 5ICXA 2E9WA 5C6TH 1DBKL 4QXUH 4KGLA 2I5YL 4Z95L 4XHJC 3RTQC 1QLEH 3CH1A 4XPFL 2A9NH 5LXGH 3EO9H 2EKSA 1JV5A 3D2UD 3ZMRA 3QDJD 1JWUB 4NKOA 4M5YH 5DQDH 3VFGH 4XZUB 4MZ3A 4AEHL 5BOPA 1FORL 2RGSA 4LVHB 5EPMA 1KTLA 3V6FB 4L3EE 4BZ2H 1MCIA 4WU7B 1KJ2H 2FEEL 5ERWB 4XGZB 1YC7A 4NJAH 2VLRB 4JKKA 2ITCA 1MI5E 3WKNA 1OQXA 3STZB 1AE6L 1A1MA 4JY6B 4WU5B 1U8PB 2VDKH 3WXWL 2BK8A 5MI0C 5CGYD 4KY1H 4UBDD 3NCCB 2YUWA 1UB5B 2GK2A 3ARFA 1KJVA 4KTEL 2R0KL 4XMPL 4CRPA 5ICYB 4J6RL 1EDQA 3AB0B 3MGOB 4F9PC 5DQJA 3OGOE 2R1WB 4JDVA 1O7SA 1FE8H 4NO5B 5E08L 1Z9LA 5DRNA 1HXYA 5L88L 5DUPL 3RVVD 3FFCB 1DANU 3PQYB 2E5EA 3TBWB 4HWEL 2EC8A 3JZ7A 5LVEA 2VLMD 4OKDA 4Y4KA 3DBXA 1T66C 5J56B 3T2QA 4LCUB 1CXLA 3AM8A 3RWHA 1HI6A 4DCQB 1C08B 4LP5A 4JVPA 4YAQA 2BNRB 1OP9A 5C0AA 2O5YL 1NMAH 3AREC 2IPTH 2XN9B 4RAHA 5EUOF 3GIVB 4N68A 2ICEB 3HI1A 1MCPL 4JM2C 5HYJE 5GJTL 3IDGB 4HEME 1NBYB 2P5WD 3FMGL 3DUUA 3ESUF 5HY9B 3FHAA 1Q1JL 2VC2L 4G80A 1CFQB 2YD3A 3ALXA 5IFHL 2Q6WB 3WFEH 4LMQE 3S96B 4XPTH 2NY0C 5I0DA 4NQXB 3O3BA 4G9FE 2LU3A 4FTVB 4GW1A 3MODL 5C0EA 4XCFH 4G3YH 3U6RB 4HKZB 4I9WD 4OCRL 1ACYL 4QNPF 2Y07L 5C09B 1OT1A 1E28B 4GFTB 4Y4HA 2QEJA 4YBLC 3ILPB 4LCCC 4DZBA 1PY4A 1H0DA 3D18B 4H1LH 1OTTD 3DUSA 4FMFA 4DVBA 4MWFA 3GJFA 4NKIH 3KAAA 4RFEA 2FH8A 4JR9H 1LP9E 3ZE1F 1YQVL 1WTLA 3BQUB 3TNNB 3R0MA 5L8JB 3GSNB 1J8HB 5IR1B 1RUAL 1QR1B 4GBXA 4P2OA 4OQTL 3BZ4B 4PJ7A 4UUJA 2CDEA 1AFVH 1R5IA 1W0YT 3HE6B 1N5YL 3DIFB 1CVSC 3V9FA 3L3JA 4R8WH 4R0LC 4XNZC 4MB3A 2VMFA 4FOMA 1JF5A 4QY8A 3GBML 1ZEAH 1LEGB 4QHUA 4KKBD 4KFZC 1H5BA 3D3VA 1MI5A 3WIHA 3WYRA 3WJLC 2DN7A 4GXUN 2QV2A 4RX4A 4XBEH 3MR9B 4WTWA 5F97E 5D7IB 1A6VL 4F57L 4CMHB 1KBGH 2FEDD 2XPGA 5IMMB 4KI5D 1UM4H 3LRGA 5J13C 4OD2A 1YDPB 1HSBB 5IJKA 3RY6C 5DC0A 2DIBA 1FH5H