2FECI

Structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Separate ion pathways in a Cl-/H+ exchanger
pubmed rcsb
source organism Escherichia coli
molecule tags Proton transport,membrane protein
total genus 38
structure length 221
sequence length 221
chains with identical sequence J
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fecI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fecI01
3BISA 5EOCH 2YPVL 3J7HA 5DK3A 1VB9A 4GW5A 3S3JA 3SE4C 5EBLA 3DMMB 4NC2B 2H2PD 3FQUB 4HZAA 3RDTA 1D5BA 4NJAH 2B4CC 4O2FB 4Y4HA 2EYRA 4PJEA 5LBSH 1A1NB 1PBYA 3O8XD 2A0LD 1CYGA 1TTUA 4RGNC 1A6PA 4BFGA 1Q0YL 5I19H 1YC8A 4WI8A 5JXEC 1ZHNB 4L3EB 2P7TB 3L5WA 1X44A 3RWJB 4FFZH 4JAMB 3FQTB 5DHVH 4ODSH 4MZ2A 3B9KA 3FCTA 4Z95L 1BVKB 1HIMH 5FDWA 5JLZB 5BRZD 1FCCA 2J3SA 3P4OB 4LCCC 4J7RA 4NN6B 3LH2H 3FAXA 2HLAB 5EZOH 5IQ7H 3VJ6B 3FFCB 4DKAA 3WBDA 4HJGA 2QV2A 4AEEA 3IAGC 2F8OA 5I1GH 3QIUA 4GSDL 1G7PB 5IQ9B 4ODVL 2XWBB 4W6XB 2Q8AH 4HUVB 1LE5A 1VGEL 3HN3A 3P40A 2O26U 3RI5K 4Z0BL 3GBNL 3BEWA 2J88H 1GJIA 4WRLA 1XGUB 4QT5B 2G5BA 2VXTL 1QA9B 3DBXB 4PREB 2G60H 5EIIB 4ZO6A 2LE9A 1FAIL 2H2SD 3VFOA 5LWYH 3L3IA 4DGYH 1ZT7A 1AXSA 3W5NA 2FECL 2X4NB 3NTCL 2H45A 4LPCA 3VWJB 4W4NA 4OCRL 1CFQA 4KK8C 4I18B 3LN9A 2ADFL 2R9HC 1ADQH 1CGSL 1GZQA 3LKPA 3G6JF 3QDJA 1GAFH 4JFEA 4LRIC 1A0QL 2DLIA 2YS4A 4YC2B 4ZFZA 3RA7H 1DVFB 1H3XA 1KIQB 2GJ6D 1NGPL 5A2IH 1FC1A 5JQ6H 5JXEA 4LLQB 1J1PL 4HJ0D 1KCSH 1GPOH 2VMFA 4LSSL 4OB5H 4ODHL 1I1RA 3HMWL 4WI3A 2DDQL 2UY7A 4XVTL 3GMRA 5C0GA 1OM3L 4EXKA 3PWNA 1IC5L 2Z8SA 3I3EA 4C55A 5EC1A 2V2TA 1AGCB 1B0RB 1OGAA 3BEVB 5DHYA 5IK3B 2DM4A 2J5LC 1GYAA 2DQJH 3C6LA 2HG5A 1L9MA 4P4KC 5B39A 2H9GB 1RUPH 3QPQD 4KMLB 3X14A 4ODXA 4OUUB 1UXWB 4GW4B 3W39B 4CADB 3FQRB 3MLVH 1TJIH 2OR9L 4MD5B 4R8WL 5E7FA 1LO2H 2BY1A 3M1BA 3GI9H 1A7RL 3CVHA 4ZO9A 5I74C 4UNUA 4NYLB 1EERB 3MNZA 4R26L 1Z9LA 3D85A 3CVIL 3F7QA 4O5LL 2JELH 1DQLH 1XF5A 4XMLH 5SX5H 5DA4A 2WQ8A 4FQLH 4NQVB 3BGMA 1AO7E 4GRLC 4M5ZH 1JF1B 4UINH 4ZPVA 5C0CE 4YXHL 2ZKHL 5HHPB 1ZT4A 2PYEA 3QXTA 3TO4A 4KHXH 1VFOA 3TWCL 3GJFH 2DM3A 3NZHL 3VG0L 4ZFGL 1Q9LA 1F11A 3PHQB 2M2DA 3ZO0A 1ORSA 4RAHA 3CPLB 2B8OT 3FMGH 4XCCH 4BZ2H 4CGTA 4FQJH 5JIIA 1IAMA 2XZQH 3P9MB 5ACMA 5MP6H 4CJ0A 4GBXC 1A6WL 4QXGL 1FSKC 2VDLH 1E4KC 2GT9B 2Y6SC 2WINB 1UT9A 2X4TA 4UAOC 5ID1A 2P8PB 4XH2A 4FHBD 1QLEL 3V6FB 3MV8D 3ARXA 3Q3GA 1BFVH 3V6ZB 3W11D 1MCKA 3CFBA 4R4NC 5CSGA 1WFUA 3DX6B 4I77L 5ISZA 5HGDB 3WNOA 3QCVH 2YMXH 4L4TA 5I8EA 3RWEB 2P4AB 4JO1L 4LMQE 5HYQB 3BIAX 4HC1H 4P4KA 4HLZG 5F71A 3C6SA 4AEIH 1DZBA 1QFOA 4EDXA 3RVUC 3TPKA 5C0FA 3HS0B 3PGDB 3MRDB 1CICD 4Y5XB 4XBEL 4O51B 5B3NA 3RI5F 4LU5H 5I2IB 4G9FE 4DOHB 3ARVA 1IAOA 1U8IA 1TCRA 5CAYB 4HWZB 4J3SA 3N1PC 5CZXD 3MV9D 5HI4C 1Q9WB 4X9GA 2DQTL 4QRTA 4MDJB 3BZFB 5ESQA 4GRLA 4MMXC 5DEGB 4KVNL 4X4XB 1K4CB 3LN4B 1DQQB 4X5XB 1ONQB 1CT8B 1YEIH 4C56E 1G9EA 3DSFH 3SGJA 3MRNA 3CMGA 3JXAA 1K8IB 5D7LE 4YBQD 3HE7D 5L2JB 1I9IH 4KVCH 3TGXA 5FA3A 5GJTH 4WW2F 1KTDB 1UZ6F 2AK1H 4N0CC 1YEHH 4OLXH 4WO4A 4MWFA 3HR5B 4YR6A 3WCYA 2R2HA 5JW3L 3JTSB 1QBML 1BMGA 4CDHA 3T2QA 2YA0A 2R0WH 4WTZA 1FFNB 5E0QA 3AVEA 3DVNA 4PJBF 4WI4A 2F58H 3WNLA 3DV6A 3RKPA 4ZXBD 1CFTA 3M07A 1I3RA 4PGCB 4HWUA 3R0NA 2DLHA 3MOAL 2CIKB 3T09A 5MI0B 2PXYD 5C0BE 5I1JL 3KR3H 5ITBH 5GGSA 4KI1A 3M17B 1CBVL 2EH7L 2Y7QA 2P5WE 1UVQA 2I24N 5LAXA 2CJUL 4MA7L 3F7YA 4GLRI 3B6SB 2GITB 1D9KC 4HXAL 3MLRH 3EFDH 1REIA 1BOGA 4FNLL 1HH9A 5FK9B 1MEXL 3O3DA 1OTTC 1DQML 3LS5L 2Q86A 3DYPA 5MEPA 4OIIH 1ZVYA 1H5BC 4XX1E 3L3HB 1IC7H 4IEFB 2X89A 1KENL 5L9DH 3RZCC 1CD8A 5C9JB 3C9NA 2FHFA 3BP7A 1P6FA 2OP4H 1JF6A 4PJCE 3U9PH 4F3FA 4V1DB 3LB6D 3SGKC 2F8XC 3OXRB 1BJ1J 3QHFH 3FO9B 5DMJB 4X9FA 4BFIB 1RVFL 1ZLVH 1T1XB 5D1QB 5EU5B 1IAKB 4JB9L 3WIFB 1QACA 1CICB 1C5BL 4LSQL 3T4YB 4TSBL 4WTXA 5FV1L 2ADIA 1IQWH 4YQXL 1FJ1B 3PE9A 4EBQH 2Q6WB 3BPCA 5JO5A 2XKNA 5IHUH 2HFEB 4MGXA 5D6DC 1PYWB 2HKHL 4CUCA 2HT3D 3D0LB 5EUOF 3BD5A 4KFZC 4IRJC 3OHXA 4ZQKA 1CXKA 1HKLL 4LLUB 2VLRE 2NY0C 3OZ9H 4DKDC 1T1WB 1KLGB 4JKPL 4XNMB 5ALBH 1LNUA 4MVBD 1A47A 3ZYJA 1SYVA 3GB7A 1AJ7H 4NO0A 2R0ZL 3LMJH 4Y7MA 3G9VA 1XF2A 1WCQA 1CZ8H 1B6DA 1JL8A 3PDDA 1KBGL 4PJFF 5SV3A 5D5MA 1D9KA 3EOTH 2X4SA 4X9BA 1TQBC 5C8JA 1YEGH 1MNUH 1AO7D 4F37K 2GSGB 5FO8B 1Z9MA 3DX9A 5GS3A 3HNSH 3Q1SL 3LQAH 2X9WA 4ZXBB 5C0CD 4PJDF 1BJMA 2OR8A 1H5BA 3MRQB 1PW3A 2A6JA 2AV7A 3QEQE 4TUOA 2DRUA 1BQUA 4JRYA 1JGUL 3GO1L 2VXSL 1XAUA 4UBDD 4I0PD 1IGJA 3O6ML 2AKRB 3EJYD 5IGXL 3MRMA 3I3DA 1YNTB 2XWTB 4S1RH 3S35H 4DKFL 2R4RL 3AC0A 4Y1AE 3U4EA 3GSVB 3LRSA 3QSKB 1QVOA 3IU3A 5D7IB 4UT6H 2PR4H 1LP9E 2H1PH 2IF7A 3VGBA 2P48B 4TUJA 1BWMA 1NGZA 5B38G 4PUBL 5KSBF 1MRFH 5DQ9B 4JPVH 3SGDH 1U6AL 1FNHA 4CRPA 3FQWB 3RWGA 5DRWA 4U6XA 1KPRB 3DOSA 4M8QB 2OJZL 4ALAH 4WDIB 4CVUA 3INUL 5E24E 5EU4A 2EECA 3K81A 5F97E 5KVFH 1E27A 5B38A 1T2JA 4KQ4L 3VD9A 2IANE 2P1YA 4WIQA 4R90L 1YEJH 4M7ZC 4P59L 4X6CF 3VDCA 4CMHB 1F42A 3IDXH 4O2CA 4NWTH 1SVCP 4NC0B 4G8EA 2UWEE 2IBZY 3GK8H 1EHLH 4G9FD 4JM2F 2IBZX 3ES6B 4Q2ZB 2EDFA 5D70L 1BBDL 1YYMH 5DRNB 3PJSB 4ZUUA 4TTDD 1JNHA 4DKEH 4ACPA 1KYOK 2Z92A 1A22B 1KLFA 4M7JL 4EN3B 4WEUD 2D0HA 3GBLA 1RI8A 3HZKB 3I6LE 4MQXC 5C3TA 5C0ND 3SDDD 3PWJB 2DQFB 4U05A 1C7SA 3IAQA 4MA3B 4C56D 2YZ8A 4KAQH 4HCRL 4IRSA 3UJIH 2WWKT 4Q9QH 5D7LD 4HBCL 1T3FA 5HGHB 4NBYB 4XHQA 3QAZB 4WUUB 5F1NA 5JDSB 5I76B 5BVPH 3GSQB 3C5ZA 3HG1A 4R0LC 1C08B 2DTSA 1A7QL 2YPKA 1QSVA 3MXWH 4DTGL 2HKFH 3TJEH 3VWKB 2X4PA 1WQVT 1A3LH 1XGTB 4QOKA 5FO7A 4PJGB 1G6RH 2Y06L 4HS8L 1T03H 4DFIA 1BVZA 1FV1B 5FFLA 1KB5A 2IPKA 2LVEA 5I75C 1AO7B 5IG7A 1IQDB 4AK1A 5HGAB 2WP3O 3FQNB 3QFDA 4P9HC 5C0CB 4YHYC 4PGZA 2HVJB 2FX8H 4GKZA 2CK0L 1G7HA 4U1HA 2NY2C 5C0BD 4G80B 5A40E 3RBSA 5TJWK 3V5DA 3WFBH 1K5NA 3QI9D 4I0PB 3IJYB 5TPWH 2P5WD 1IKNA 2DIAA 3O11A 1PX3A 2YD1A 4Y8DC 4BK5A 1MRDH 4BM7A 1AD9A 1JYNA 3ORJA 3NAAL 2GW5A 3CU7A 4F37F 2RFXB 4BZ1L 4WU7B 5AYQA 1S7TA 5SWSA 3O3EB 1S7XA 1MPAL 5E8NA 1PSKH 4MX7B 4UIMB 5AAWA 4G42A 2AEWA 1CFSA 5ICXA 4GQ9L 3C60A 1RZFL 3FAWA 4M1GH 5C0AA 4NO3B 4OF0A 3BN9C 3AFLA 4YHPB 4J8RB 3NFSH 4JZJA 3HUJF 4PJ7E 3JUYA 2NY5L 1AR1D 5BO1L 1F3RB 1OGTB 3CNKA 4KKAD 5CJQL 3MGOA 5C6PB 3DUSA 3DX8B 3D2UA 3BP4A 1PQZB 4UTAL 5D2NB 4QHUB 4UDUA 4FZEL 4Z7WB 3EOAB 5DEFA 1C16A 2YD4A 4ELME 1OP9A 3MREA 4J3TA 1JV5B 6FABH 4TRPH 5MENE 1S9WA 4F7TB 3GJFB 3U0TA 3O6FA 1CK0H 1VHPA 5F89A 1MCOH 1T89C 1P4BH 2VXUL 2VLRD 4ONOA 1BFSA 1ZHBA 4FQHA 2DQDL 1EK3A 1UKSA 5D1ZC 1DFBL 3MLZL 1KT2A 3GRWL 4LLMA 4C56B 3PXHA 5DJDB 4NJ9L 3AS0A 5BZDB 1IL1B 3X3GH 4NNPL 4FQ1H 5D7LB 3SKMA 3T0EA 1XR9B 5E95B 3ABZA 1RJYA 1S7UB 3BZEA 2Z31A 1TVBB 5DVOA 3VFPB 3IDMA 4QTHB 4YDVA 1RUQH 4HMCA 3OXSB 3BSZH 4N5ED 5DGQA 1KJVB 2XV6B 4D0CA 5EBWA 2BNRE 1F58H 4N0UA 4PJAB 2ZOKB 3BWAA 4GG6F 4I3RH 5D6CA 5GGRA 4F57L 4X6DE 3IKCA 1MHHB 1RFDL 3MV7E 1B6UA 3GMLA 3S35X 5DFVC 4R7NA 3F58H 4YIQA 1NCWL 4AENA 2ZSWB 3THMH 2WUBH 3H2WA 3QEQD 4HDIA 2IGFL 4YEFA 4OD2A 4P2QA 2A6IB 5GSVA 5GZND 3DV4B 5C0BB 2W9DH 3D39B 1RZKL 5DJ0B 1U2HA 2GYSA 1F8TH 4WWKC 5C2BH 3T04D 1S7QB 5KAQG 1K3IA 1X5FA 2J8UE 4PD4J 4GAGH 4Y1AD 4ZNEE 3VFVA 2V6HA 3ETBF 4OCSH 5CFHA 3L9RB 5GGUB 2XXMB 3EHBC 1P5VA 1R3KA 3TA3B 2P5EE 3TLRA 3HPJA 5LQBH 4N1HB 4KK5C 4OZHA 3MCKA 1U2CA 2X1PA 4FQIH 4S0TD 1B3JA 1S7SB 1FNEA 3PV6B 2N1KA 4UILL 3VGEA 4ONFH 1AGBA 5FCUL 3FT4B 3FB6A 1QLRA 1GSMA 4RMVA 2MMXA 3DVFA 1W72H 4XCFH 2IAND 5CCKH 1HEZA 3L3DB 4Z77A 3HZYB 3STBA 5I18H 4FXGB 4XC1H 2HRPL 4NKOA 4HK0A 1T20A 2YD7A 5IB3B 4ZO8A 1ERNA 4ODUB 5JIKA 2VAAB 4MJIA 1ND0A 1Z5LB 3IF1B 1IEAB 1T66C 4EKXA 5F96L 1NCNA 5E2VL 2VE6A 4ZFOB 1JGEA 3GM0A 2VDMH 3CLEL 5DRZB 4OCXL 1S7WB 2YEZA 3I6LD 4AG4H 4K3DH 3SKJL 3SJVE 2VLRB 2ED8A 4FQXD 5D7KE 5DDHA 1TPXC 3WO4B 4KDVA 1F4AA 1UADC 4QRQB 2IAMA 2EIBA 1WUNT 5C0IA 2AJUH 4WVRA 3R1GH 3KPRE 3B3IB 5L7XH 3L3GA 1AC0A 3BUYA 2R0KL 2VSCA 1CWVA 5FAAA 4LAQH 3O6LH 3CH8A 3W0WA 4U6TA 4ZOCA 3VXRA 4ONHA 5DK0A 4I3SL 3TCLA 2DQIL 2RBLA 3HE6A 1EHNA 4JO4H 5D96B 5H94A 4BFBD 1Q72L 1RZ7H 3EJJX 3RIAK 3BD4A 1BQLH 1PG7H 1CLZH 4M03A 4U1MA 2E7BA 5L0QB 5D7JD 2Y1VA 5EWIL 2HH0H 1WT5C 5F9DC 1I8MA 1RIUL 3O9WA 1TZHA 3N9GH 1SY6A 2E6QA 3QEQB 2HFGL 4KWUA 5HGBB 4L4VA 1XCQA 2I07B 4FOMA 1KCKA 3AGVA 3O2WH 2YD6A 3EOBB 2X7LB 3EYSL 4XWGL 1BP3B 3WHE0 4YNYA 1W0WB 4XHJC 1YMME 4IMLA 2R29H 4RFNC 3WE6B 1S9XB 1UXSB 2BVOB 4ENEC 1N26A 2BERA 2VDKH 3OAYK 2EYTB 3FT3A 5EOCL 2Y5TA 2YC1A 1A1OA 5ICZB 1HINL 2WBJD 1U93B 4LLWA 4C4KT 3MYJA 4Z7UF 5KSAC 4NJAL 4RDQG 5TH2A 2RCSH 4MLSA 4XPTH 5LBSL 3QUXB 5IHLB 3U0PB 3TF7C 4K3EH 5F7DA 2IANB 3MBEA 3C8HA 1Z0NA 3JSSA 4J1UB 3S4SG 2B4CH 2J12B 5GISH 5C09E 4FFZL 1Q1JL 3F6LA 2YK1H 1LD9B 1XGPA 3L6FB 5AUMB 1DE4A 1IGTA 4TQEH 4ODSL 1PVHA 1HIML 5DJZA 5HYJA 5MEND 1BF8A 2V2WB 3UYPA 1MRCH 3O81A 3H7BA 3Q6FA 4R6UA 2WLZA 2APVA 2C4XA 3LH2L 5EOCJ 3WL9B 1YEDB 5EZOL 5IQ7L 5DJ8A 1BPVA 3RY6A 2VDQH 3NFPB 4NFDA 1NAMA 1IARB 1BZQK 3NCEB 1KG0A 3H9SB 1TNMA 5GXBB 3REVA 3RWIB 2ATKA 4JE4B 2XY1A 5I1GL 4S1DC 2EDHA 4KRMB 1I1FB 3RU8H 5J13B 4RNRA 3P9LA 4F7MB 3BIBX 4KXZI 4Q6IB 5E8OB 43CAA 4P4RA 2Z93A 4TOYH 1AHWA 5F9WB 4Y4FB 1PEZA 4E41E 3S5LG 4JFOB 1NUFA 1D5ZB 2BNRD 2RQ8A 2AK4A 1DBBH 4JR9H 3VXQB 5E70A 2J88L 3K80A 1YN6B 5I8KH 1A6ZB 1VADB 1EX0A 1RU9H 3TBTB 3V4VH 3IRZA 3MV7D 2MQ3A 1AY1H 1JNLH 2G60L 4ZAKC 3V0VB 4RIRA 3SKUD 5LWYL 1U8LB 4DGYL 5CJXA 3VFMA 1I1AD 3S5LA 1HCFX 3SPVB 1JI1A 1CL7I 2KQNA 1CGTA 4LSDA 2C9AA 2HN7B 5CGYC 4F7PB 3VGAB 2W0FB 5EBMB 3SY0A 2EIZA 3UTOA 1ADQL 4H25A 1U8OA 4KJQD 3RX5A 1GAFL 3JV6B 4RGNE 3RA7L 1G7LB 3HC0A 3X12B 4GKSB 5JQ6L 3N85L 2NY1D 5FOJA 3QEHA 3QUYA 2P5ED 3RIAF 1KCSL 1MCQA 1GPOL 3B9VA 4OB5L 1ZV5A 4PRPE 3DRQB 1G0YR 1HHIB 3LKRA 5MERB 2B7DT 2HT4C 2BY3A 3FTGA 4WW1A 1MCPH 3QJFA 4NNXA 4ZUWA 4OZFA 3VU2A 2DWDA 4JFDA 3MLXH 2DQJL 4U1LA 3V5KA 4U49A 3NA4A 4PG9A 5F1KC 1ZA3B 3PWUA 1N64H 3NIGF 4JN2B 1RUPL 3BDXA 3WLBA 3D87B 4M8VA 1CD1A 4LHJB 5ILTH 3MLVL 1TJIL 1JNJA 1LO2L 1UM6H 4UUJB 3HTLX 2UYLB 3GI9L 1U9KA 2HFFB 1BJ8A 5E1AB 1BIIA 5C6TH 5CGMA 2WM0A 5I9QB 3T4AA 3KJ4C 5HGGS 1II4E 3KLAB 1NC4D 4XMLL 1J12A 3BP6B 1UQSA 5C86A 3M8OH 2BCKB 4FQLL 4Y0GA 3SOBH 4ELMB 4FQ2H 4KROD 4M5ZL 1DUZA 4UINL 2XPGA 3IXAB 2F8VA 4HAGA 5I16B 4QRUB 3ARBA 2P46B 3QDMA 1W0VA 4KHXL 4QKXB 4JKKA 4ZPTB 3PV7A 3SJVD 2VQTA 2C3XA 3QIBC 5D7KD 5A2JH 1FNFA 4M61B 1RJLA 1N0LA 1QNZH 1PG7X 1QYGH 1T5WA 4LRNH 4EOWH 3FMGL 2YA1A 4XCCL 2CKBH 4BZ2L 5IEHB 3KPRD 4G7VL 2XA8H 4FQJL 4M9OA 3RNKA 2JB6A 2XZQL 1LEKA 5MP6L 4E42B 3MJ8B 4CKVX 5GZOC 5ELIA 2VDLL 4Y16A 2C1PA 4LHUD 2P24A 2V9QA 1BFVL 3GSWA 1I8IA 2DQUH 3MV7B 3BQUB 5ISZE 4K7PH 1UJ3C 2DQCH 4ZSOE 4HFUL 1J7VR 3QCVL 5JW5B 1S5HB 2YMXL 5GS1B 4YBLC 2BSTB 3LRGA 4BSVA 5IVXB 1WIPA 4HC1L 1J88A 5C07A 2FEEL 4AEIL 1JGVH 4OM0H 4PJ8C 4G6JH 1ZLWH 4LLAA 4F2MB 3Q5YA 2WWMD 3VD5A 1CLYL 3GMQA 2QADC 1YMMD 2R1XA 4J4PA 2YRLA 4XRCB 2AEPH 2FJGB 5JORB 4PIRF 2NXZC 5E94B 3ULVF 2FLRT 5EZLB 3IETA 1YDPB 5HYSG 3ISWA 4ETQA 2E9WA 1CVSC 5HVHB 2C4FU 1TQCB 4P57A 1FN4A 3IB4A 1YEIL 4GFTB 3QDGB 1FFPB 3BPNB 4PRIE 4Y4HD 5GSRB 5E5MA 5T33H 1I9IL 3RGVD 5HYSA 4KRNA 4KVCL 4YZFE 3P77A 2BHZA 4KHTL 3MGTA 2AK1L 3VFNB 1YEHL 4OLXL 4LBEB 2VIRB 1A6TB 1H0DB 1HI6B 3U0WH 5C09D 3MR9A 2R0WL 3TO2B 3QQ3B 3GIVA 1C1EH 1MY7A 3QPXH 1MUJB 4PP1C 4KROB 5EC2A 4JFYB 4XBPA 2MCPH 3AS3A 3P30H 4CN6A 5E8DH 4JY6B 4S10A 3WNMA 4Y5VC 4ZFOL 3NCMA 3FZUD 4KJPD 2F53E 4X6BA 5ITBL 4M7LL 2XACC 3SJVB 3PL6A 5IFHL 5I1DB 1U58A 3QH3B 1J8HE 3TH2T 1N3NA 1U8HB 1KELL 3N06B 4HFWA 1AQKH 3BPLC 3MLRL 3EFDL 1NJ9B 3TJHD 5DMIH 5AZEH 3MCLH 1HHHA 3L3OA 4OD1L 5FO9A 4E41D 5ACLA 4OFIA 3DRTA 4K7FA 3UAJC 4RZCA 2YOCA 4JFQB 1EJOH 1Q38A 4LHUB 2ZZUT 4OIIL 4CVZA 2YA2A 1IC7L 2A38A 2GJJA 4NOBA 3DJ9A 5L2KA 5L9DL 1JZ4A 1AP2A 5E8PA 4RMRA 2P42B 4XZUB 1W72B 3RFZC 3KPTA 2OP4L 3U9PL 4DVBB 3D3VA 2DN7A 3U30C 1OARH 4XNYH 5JPMA 3T0WA 1DQDH 3QHFL 2VC2H 3T1FA 3OKMA 4YGVB 1YY8B 4RFOH 5KN5B 4RGND 5IV2A 2LU3A 1RZIA 4P2OC 4HZLA 5JXED 4G6MH 4ZOBA 1IGCH 4EBQL 4FQCH 5IHUL 4HKZB 3RWHB 4PRPD 4U4BA 1G9NH 1LILA 2BOBB 1Q8MA 2DWEB 3DETC 4RAUA 2VISA 4PJXF 4GW5B 3OZ9L 4WW2C 3I2CH 4NZUH 3GKWH 5ALBL 3HC3H 1D5BB 3RDTB 1OLLA 3LRHA 4Y4HB 5CEZH 2EYRB 4JPIA 4PJEB 5CMAA 1AJ7L 4GT7A 4HH9A 3QCTH 3LMJL 1MIEH 4OKVA 1FO0A 3OBAA 1CZ8L 1NFDF 1CIDA 3RX7A 3TBYA 3D85D 3P0VH 5C6WH 5D5ME 3EOTL 4LKCA 5C09B 4LDEB 4Q97A 2H26A 2C3VA 1LGVA 4I2XA 3UJTH 3ET9F 1YEGL 1MNUL 3IFLH 3B9KB 3FCTB 3HMXH 2MQCA 3KLSA 3HNSL 3V0AC 3LQAL 1U42A 3P4MB 2YPLE 1NMCB 1NSNH 5KZCD 5E4EB 1U8KA 1DSFH 2WLYA 4N8PA 5KVDH 3QT2A 4KDTC 2NW3A 2R69L 1A6UL 2FX7H 3OJDA 5EORH 3X11A 1QBLH 4BJLA 4X9HA 4K7PY 2EDDA 3N1MC 4S1RL 4HJGB 3S35L 3F65A 4K7PX 5ADPH 4KK8D 2C5DC 1AQDA 4UT6L 2R9HD 2PR4L 2H1PL 4GO6B 4OT1H 5F3HA 2FD6H 1DEEA 5EIVA 1LE9A 4P48A 2BVPA 3WEXA 1MRFL 1NBYA 4P2OA 2J1KA 4JPVL 4Y2DC 3CFDA 4YFLF 1OVZA 5GGSY 4IM8A 2DTMH 3H42H 2G5BB 1DL7H 4U6HA 1OAUH 4ZYKA 5E56A 4G6FD 3BKMH 4ALAL 5ISZD 2NZ9C 4QXUH 1A9BA 5D1XC 1LO5B 1KB5H 3L3IB 4XCYA 1ZT7B 1AXSB 2RB8A 1FVEA 3EO1A 3FB8A 5KBNC 1RURH 1YEJL 1CFQB 1YPZA 3VRIA 1C12A 4YHML 3IDXL 3ZT5A 3HZVA 3U7WH 3LKPB 1GZQB 4NWTL 1MJUH 4JFEB 5H8DA 4RGNB 4J12A 4YK4C 3GK8L 5E5UB 1EHLL 2O61B 5IWLC 3NACH 1IGYA 1VEOA 2GUOA 4L1DA 1OT1A 1YYML 4QRSA 1TVDA 4DKEL 1NGYB 4FFVC 1I7UB 1BGXL 2XT1B 4PRPB 5IFJA 3GMRB 3PWNB 1C5DA 3K3QA 4W6WB 4GRLD 1R24A 5DD6A 4WV1C 4G9DA 1KCRH 3C6LB 1AH1A 2HG5B 4KAQL 5IW6A 3HI6H 3UJIL 1MCRA 4PRID 4Q9QL 3TYFA 5B39B 4LCCB 1F13A 3L3KA 1CVRA 3X14B 2M1KA 5DEZA 4ODXB 1N59A 3JWOC 3RBGA 3DVGB 5BVPL 3CVHB 1S3KH 3MXWL 4IOIB 3TJEL 3MNZB 3UC0H 4U1JB 3D85B 1A3LL 3ARGC 1XF5B 1G6RL 2EEDA 1T03L 3FFDA 4GBXD 2DJ4A 3TVMA 1OLZA 2NX5A 3BGMB 1PDKA 3VG9C 3IXTA 4FFYH 3ZL4H 5HYIA 2Y6SD 1X6NA 4Y4KA 3ZSSA 2E7CA 1HH6B 2D0FA 3HI1B 4R4ND 2VB5A 4GXUM 3S36H 5GIRA 2F53D 5I17A 2VDOH 1DP0A 1SJEA 3MNWB 5I1IH 3WFBL 1SHMA 3MRCA 5TPWL 1T83C 1CDBA 4FTVE 1J8HD 1Q9LB 4P9HH 5E6YA 1MRDL 4MCZA 3RVUD 5DQDH 3GMPA 4HF5H 4UV4H 4NKDB 3CFKA 1NH6A 1R5WA 1UWXK 4AL8H 2APXA 3MRKB 1FZMB 4X80H 1U95A 4ESKA 4W6YB 2X4TB 5ID1B 2AEQH 4XH2B 1PSKL 4OLEA 3Q3GB 3V6OC 3B9EA 1WICA 4K8RH 3EYOA 1BF2A 5C0AE 3P0GB 4M1GL 3OQ3B 2EDLA 2VR4A 5ISZB 1XF3B 3SDCA 2HJLA 3NFSL 4ZSOB 4JG0H 4FABH 4OCMC 2K1MA 5FGCE 4L4TB 5I8EB 5J12C 3BT2L 4JM2C 3ARWA 4P4KB 3SE9H 2EDBA 3C6SB 1OTUC 1VCAA 4EDXB 2OI9C 2CH8A 4TULH 1OY3B 4J6RL 1Q9OB 2DYPA 2GAZA 4KJWC 4N0CD 5EA0H 2I9LA 4LFHG 3VXOA 1GL4B 1U8IB 2VDPH 1TCRB 5I74B 1MI5E 4TRPL 6FABL 1NLDL 2WV3A 5SWZA 1N5YH 4OI8A 1CK0L 4JHAH 4QRTB 3TN0C 1MCOL 4CU7A 5T3ZD 1P4BL 3VXPA 4GRLB 1J18A 2WANA 4KK9C 2CR3A 3UBXG 1RQ5A 4K07A 1B0WA 3MRNB 1CTNA 3X3GL 4FQ1L 4N8CH 5DS8A 2XWJB 1OPGH 3ARFA 5T1LA 4BQ8A 5FA3B 5MEOA 1RUQL 1TETL 2J4WH 4QY8A 3BSZL 1N2RA 1B9ZA 4WO4B 3QP3A 2HVKA 3OKKA 3T3PF 1F58L 2R2HB 3AY4A 5IIEA 4I3RL 3SDAC 2P8MB 1YNLH 4P3CH 1L7TH 3DVNB 1OTTD 2W07A 3DV6B 1FSKB 1HK6A 3SE3C 5DO2C 1I3RB 4KGLA 2YPLD 3THML 2WUBL 2YR3A 2X5PA 2NR6C 3MODH 3RZCD 4QGYA 1EAPA 5ICYA 1QKZH 4KQ3H 4ORZC 4LIQH 1AXTH 5GGSB 4X4ME 2W9DL 4J2XA 1F8TL 5C2BL 3U46A 2EE3A 1UH3A 3BH8A 5LAXB 2WUCH 3BMWA 3F7YB 2YWZA 4GAGL 4AY0A 4LVHC 5HI3C 4OCSL 1I1YA 1A1NA 2QJDA 1BOGB 3C09B 5LQBL 1HH9B 4OZHE 1FC2D 1ZA6A 3GEWB 5HHNA 2VLKE 3T65B 1Z3GH 3O3DB 2OR7A 2VZTA 2B5IB 3A67H 4LPUA 5FUOH 2Q86B 5JMRA 5MEPB 1IT9L 1UFUA 3QNYB 4IIQA 4ONFL 1A4JA 2CMRH 1PY9A 1U8NA 4IRJD 3C9NB 4HWBA 4ONGH 3BP7B 1C8PA 1AR2A 2NY0D 3KXFE 1W72L 4P5TC 2PTUA 4G8FA 3QUZA 5CCKL 1MH5A 5GS2D 3TNNA 3VD7A 3MACH 5I18L 4DVRH 4L9DA 4N0YH 4YHKH 2Y9RT 1QBAA 2W38A 2A0LC 2ADIB 3GBMH 1IEHA 1D5IH 3UEZA 1A7PL 2KKQA 2DIJA 3BPCB 3HFMH 1CE1H 1G7PA 1UH4A 2XKNB 4YGAB 4YJZL 4G8GE 2VDML 4PLOB 3NIDF 1TVHA 1GRWA 3OHXB 5F8QC 3EYUH 4XPAH 3S7GA 5IVNA 4AG4L 5K9OA 4K3DL 4OZGA 4ZQKB 1I8LC 3U82B 4JJ5A 4M6OH 1XGUA 4QT5A 3QA3B 5J0BA 1LNUB 4PREA 3MRBA 4XC3H 1MCSA 1SYVB 2AJUL 3OAZH 5I8OH 3CX5J 3V8OA 4NO0B 2O5YH 3ZYOA 1FNSH 5L7XL 2DLEA 1XF2B 4HUNB 4OUOA 2FZ3A 3PQYA 2X4NA 3PABA 4IOFC 2RJMA 3TT1H 4LAQL 3VWJA 3S36X 3O6LL 3DURA 4ZMAT 5D5MB 4OIAA 1D9KB 3D5OF 2X4SB 4JO4L 4W4OC 1RZ7L 3BHBB 4Y5YA 1HILA 1BQLL 1NCDH 1PG7L 4HWEH 3WJLC 1CLZL 3E1F1 2DF3A 5LGJA 2HH0L 1KJ3H 4Y19E 1H5BB 2YPLB 2AV7B 3N9GL 4TUOB 1EBPA 3NMEA 4JRYB 3RZCB 5J89A 3OMZA 5FKAA 2AJXH 1IGJB 4FN0A 4RISH 5IK3A 3O2WL 4HCRA 4NNYA 4FTVD 5GGRY 4OZIA 1VFBA 1NAMH 1A21A 3VXSE 5GGQH 1T2XA 1Q0XH 3BPOC 3U4EB 3LRSB 3OX8A 3DI2B 2D7NA 2H9GA 1QVOB 3O0RH 5BW7C 2R29L 4PD4K 4KI5E 4CADA 4MD5A 3O8XA 1X5XA 4TUJB 1NGZB 1UGNA 2D7PA 2VDKL 3DXAE 3F12A 4FQPA 4MJ2A 4NN5B 3RY4A 3RWGB 5C0AD 5DRWB 4U6XB 1FGVH 5DJXA 2YD8A 3VMOA 2ADJB 2FIRT 4NUGH 4JY4A 2RCSL 4XPTL 1MLCA 4MQXD 2RR3A 1NANH 5EU4B 2YRZA 1E27B 4JO2H 5B38B 2NY4B 4K3EL 2IH1A 3PWLB 3STZA 2FHBA 5BRZA 3D2UD 5D71H 1X4ZA 3UCRA 3DGCR 1KCUH 5K59E 5LGHL 2CGRH 4O2CB 5FYJU 5GISL 4G8EB 4MNGA 2YK1L 4U31A 1BIHA 3ARPA 3L1OH 3O2VH 4TQEL 1KN2H 1PKQE 3I50H 3CPLA 1W0YT 1MI5D 5HHQA 1E6OH 3UTSE 1D6VH 1MRCL 2Z92B 2LAGB 4KJYA 4W4OA 3P9MA 4EUPG 2XY2A 3RVTC 2DMCA 2CDEA 2GT9A 4H8WC 2VDQL 4JRXE 3V6FA 4KUCD 4OZFH 2DI9A 4IRSB 1ZHKB 2IPTH 2NY2D 2VQ1A 1T2QH 3JWNC 5F1NB 5HGDA 4EUPA 3RU8L 1ACYH 3HG1B 5CEXA 3HZMA 2BJMH 4TOYL 5HYQA 2YPKB 3ZT6A 1DBBL 4JR9L 4C58B 5HHXH 2X4PB 5I8KL 4QOKB 5FO7B 1RU9L 5F3BA 3V4VL 1R3JB 4OLZH 3ZDZF 4Y5XA 1AY1L 1JNLL 3BGFB 1KB5B 2IPKB 1J11A 1RK0A 2NYYC 5EUKB 5IG7B 1L6ZA 5D2LE 5FHBH 2GJ6A 5DT1H 4HWZA 3QFDB 1BX2A 4GKZB 5CJBA 1GVIA 2ADGA 5T1KD 1JI2A 4U1HB 1I3UA 3BN9D 3ZKNC 5GRUH 4KV5E 5BS0E 3BZFA 1PJ9A 5DEGA 3GRWA 1OAKH 1DQQA 3O11B 5H2BA 1WEJH 2W9LA 2APWA 3BUTA 1N7ML 4I0CC 4X5WA 2NZIA 5L2JA 1AD9B 3VI4E 1UZ8A 1RHFA 1IM3A 2PO6C 2ZUYA 2VLKD 2BXZA 4XMKH 1A9EA 3SDXA 1S7XB 5C71A 1MCPL 5I6XC 4ZO7A 5E8NB 3UZEA 3CH1A 4KRLB 1CFSB 5ICXB 3MLXL 3C60B 3DTXB 3HA0A 2GIYA 5C0AB 2JCCA 1N64L 5IBTH 3FJTA 1JCKA 2GHWB 4QNPE 4JZJB 3KXFD 5ILTL 5FGCB 2OLDA 5D1ZD 3D6GA 3MGOB 1D3CA 1UM6L 2FSEA 5E2JA 5HYFA 1YJDH 3DUSB 5FGBC 3AS1A 3D2UB 3BP4B 1IZKA 4UDUB 5C6TL 3M17A 2C3HA 3M8OL 1C16B 4HG4K 1N5AA 3SOBL 1VSCA 1H8OA 4FQ2L 3MREB 3B6SA 3UROR 3KLDA 4MD0A 1JZ6A 1MI5B 4G8GD 1MFCH 1S9WB 1OCWH 3LAFA 4YPGA 5DFVD 5F89B 2V5MA 3RPKA 1AD0B 5I75B 2E3VA 5IHBA 4LARH 1ZHBB 4FQHB 4NM8H 4YHYB 1KT2B 4LLMB 5FF6A 3MV8A 2DMBA 2HMIC 1QNZL 4OCLC 1RZ8A 1QYGL 4LRNL 1GZPA 3SKMB 5GRZA 4PJIE 3T0EB 2JLLA 4EOWL 3WDIA 1RJYB 2QQKH 2CKBL 2Z31B 5F7MC 2XA8L 2V5RA 3IDMB 4WWKD 5ALCL 1K8DA 4YDVB 1T7WA 5F7UA 5L6YH 4JGJA 3MUZ1 1AI1H 4G3YH 3E2HC 3MJ6A 4N0UB 4K2UH 1A1MB 4HUWA 1PD6A 3EHBD 3BWAB 4F58H 3O3BA 1DBMH 1T1XA 5D6CB 5GGRB 1ZVHA 3RUGA 3WIFA 3IKCB 5KVGH 1CICA 3NA9H 4WHYG 2DQUL 3T4YA 4PGBA 5ACZB 3QWRD 4K7PL 4AYFA 4R7NB 2JKXA 1GGIH 3E0GA 1FJ1A 4Y19D 5I8CA 2QL1A 4AENB 2L4OA 3WD5H 4KKLC 1PYWA 4OD2B 5GSVB 3D0LA 1X5KA 3MV9A 4HUKB 4Z7VF 1H8NA 4PP2A 1JGVL 4OM0L 1X5ZA 2RIKA 2DB8A 5D72H 4G6JL 4L1HA 3ULSB 2AGJH 1HDMB 1NCCH 1J87A 3VXSD 3MFGB 3CFCH 5FGBA 3VFVB 4KI5D 2AEPL 3HE7A 1R3KB 1U3HD 1WWAX 4OZHB 3MCKB 3DXAD 5F9OH 1NUGA 4XCEA 2Q3AA 1FNEB 1T66D 3L95A 3BAEH 1W8OA 1AIFA 1YEFH 2OTUA 5JOFA 2X10A 1AGBB 3NZ8B 3R4DA 2ZUQC 1ODAA 4HPOH 5DXWA 3H0TB 5T33L 4J3XA 3LEYH 4TNWK 3O6KL 4ZXBA 3KXFB 4WI9A 5HVGB 5C0DA 1E4XI 5ECJE 4Z77B 4AIXA 3U0WL 2JJTC 3DHJA 4JQXC 4Q9RH 2PXYA 4NKOB 4HK0B 1T20B 2IBGA 1U91A 3K8KA 2NXYC 1C1EL 3QPXL 4OJFH 4MJIB 1ND0B 4MNQE 5IJKC 1X7QB 1ZLSH 2VE6B 3T0BA 3UTSD 2MCPL 3NFNB 5E8DL 3WNKA 1IVLA 1F90H 1CI5A 2YEZB 3G6JE 3AU1A 4JRXD 3CAFA 4D9RE 5DDHB 1BLNA 3PIQB 5FYLH 3NCYS 5KSUA 3NCJH 3LPGA 2IAMB 4WDIA 5JHDE 5C0IB 4MXVF 4R7DA 1AQKL 5DJYA 1T5XA 4P3WA 1RY7B 3MFFA 5DMIL 5AZEL 3L3GB 3MCLL 3BUYB 4XP1H 4WWKB 2IJ0C 3ME0A 3G5YA 3GNMH 4H0HB 4N0FB 5IMMA 4XHJD 3W0WB 1EJOL 1FO0H 4ONHB 3VXRB 3TCLB 1OP5H 5H94B 1Q9KB 5D7IF 4OLUH 5L2KE 5DHVA 1DQJA 4ENED 4KTDH 3WFZA 3AUVA 4ZTOH 5SX5K 4U1MB 4YH6A 2VZOA 1QFUL 3ES6A 3QG6B 1I8MB 3O9WB 3D3VE 5DRNA 2ZCHL 4LEOB 1OARL 3O45B 2VDNH 2AXJA 4XNYL 5KSAD 4QRPE 3U1SH 1DQDL 5BS0D 2VC2L 3K0WA 4ZDHA 3ULVC 4RFOL 3GJFK 2I5YH 4MA3A 3LQZA 1SM3H 4L8BA 3QZWG 4M6AA 1CXEA 4YNYB 5IMLA 4EJ1C 5IB5A 4G6ML 1IGCL 2CPCA 1IMHC 2VZ1A 4FQCL 4LQFH 2WQRA 4DW2H 4NBXB 1G9NL 1XFPA 2CUIA 2D7QA 2PETA 4WWID 3DXAB 2GEEA 3BIKB 5M95B 3B9DA 5FYLE 4R96A 3QZWA 2Y5TB 2YC1B 1JGDB 3I2CL 4LLWB 4NZUL 1NANI 3MYJB 3GKWL 3PGCA 4R97C 3HC3L 4HT1H 4RX4D 3PG2A 3BWUC 5CEZL 1JUFA 5TH2B 1AO7A 1MIMH 3QCTL 3FQNA 2LAAA 1MIEL 2X70A 5C0CA 2ZCKH 5F7DB 2D3VA 2Q76A 1OWRM 3MBEB 3C5SB 4BQCA 3P0VL 1YN7B 2YD3A 4S1DD 4O02H 3IJYA 1C5CH 4I2XE 4S1SH 1XGPB 3JWDH 3UJTL 1XMWA 5IF0B 1DE4B 1IGTB 3IFLL 1J5OH 4XVJH 3HMXL 5C92A 1WLHA 5DJZB 3UTSB 4POYA 2MWCA 2R1YA 1DSFL 4PJGF 3H7BB 5JOEA 5KVDL 4TNWF 4ZAKD 5A16A 5E2TH 5DJ8B 1DLHA 4MX7A 2FX7L 5EORL 1NAMB 1HE7A 3VXUE 1YA5A 2YHGA 5B4MC 2GSIA 5CGYD 4OV5A 4OV6F 3VCLB 5ADPL 3REVB 2ATKB 5GRVL 2KDGA 4O2EB 4J8RA 4YHLH 5E9DE 4PJ5E 4OT1L 2VWEC 2IH3A 4RNRB 3P9LB 1KNOA 2FD6L 5FYKE 2F74B 5F7NC 2Z93B 3REWB 1AHWB 5B8CC 4DUVA 5TE7H 3DX8A 4Z76B 4HHAA 2D7OA 3EO9H 4P49A 3H42L 1KCVH 2DTML 2ED9A 2MSPA 2VN7A 3FHAA 4HSQA 1CGYA 1OAUL 2CSPA 2G2RA 1B90A 3BKML 1WVZA 1JRHH 2HT4D 4QXUL 1MF2H 4RIRB 4G9FA 1KB5L 3PXJA 3VFMB 3S5LB 5JR1H 1UZ6E 3ZZ1A 3ZT7A 1RURL 3D18A 1TTGA 3SY0B 2EZ0C 2EIZB 2JJSC 1GGUA 4YX2L 3U7WL 5DUBA 4H25B 4HULB 1FL3A 1MJUL 1U8OB 4MMZC 3SDDA 3OF6D 5DC4B 4CDGC 4PJBE 4C56A 4EXPX 3MQIA 3MOBH 1IL1A 1LDPH 2X4QA 3HC0B 5D7LA 3IDYC 3QEHB 3QUYB 4GKNB 3VFPA 4QTHA 4Z7WF 3LKRB 3MUGB 3FB5A 2JJWA 4XWOC 3K1DA 2HAZA 4MSWB 4NNXB 4ZUWB 4DN3H 4OZFB 5TDOA 2DWDB 4JFDB 1KCRL 4U1LB 1OT2A 3V5KB 3K4DA 5F9JA 3HI6L 1MHHA 4PG9B 1OSZA 3PWUB 1FNLA 4MYWB 3B5HA 5EB9A 3MV01 3UMTA 3WLBB 4FA8A 3QIBD 4QRRE 1P1ZA 2ZSWA 5TE4H 1OAZH 4X4ZA 2AEIT 1S3KL 1BIIB 5C0BA 1X5YA 3GUTB 3UC0L 2AJZA 3RPIB 3T4AB 1MCJA 1ZLVK 4D8PA 3QI9A 5J1AB 1UQSB 2P5WA 3JWOH 1S7QA 3E8UH 5GZOD 4XX1G 4FFYL 3ZL4L 4MNQD 2G9HA 1DUZB 4JANA 1GGBH 2XPGB 3L9RA 4U6VH 3EYFB 2F5BH 4PJAF 1EHAA 2Y25A 4UT7H 4RBPH 3S36L 3CC5B 3OAUH 3QDMB 4LAJH 3KS0H 2VDOL 4RFEB 3DYOA 3S98A 4XXCA 4D9RD 5DD0H 1RJLB 1V7NH 1WFOA 3JV4A 3JVGC 4XAKE 5I71C 1CXLA 2J7LA 4P9HL 5JHDD 4PJIB 5DQDL 4OIBA 2XOTA 4HF5L 1A3RH 2CUHA 4UV4L 4PJ8D 5JW4N 3RNKB 4PJCA 5EUOE 1I8KA 2JB6B 4AL8L 4Y16B 2C1PB 4X80L 3VXTA 2P24B 2AEQL 2NXZD 4K8RL 4ZS6C 5L2KD 1KOAA 4YXLH 5CJOH 1I8IB 2N7BA 4EIZC 3ILQC 2CIIA 1CDCA 4OF8A 3WYRA 3D3VD 2FJFB 4ZFOA 1RV6X 5DJCB 4BSVB 5KW9L 4QRPD 4WFEE 3SE9L 4PJFE 1S7WA 2Z9TA 4O4YH 3LVEA 4TULL 2VR9A 4HS6A 2VLRA 3F6IA 3GMQB 5EA0L 1ORQA 4I5BA 2VDPL 4PJDE 32C2B 5FB8A 1KEMH 2XKSA 4Q9BA 1S8DA 3KJ4B 3SCMC 3IETB 4ODWA 1TENA 1HHKB 2AQ3A 3KLHC 5F6HJ 4ETQB 4JHAL 4PP1D 1JHTB 1LK2A 1D6EB 5FYLD 1NMAH 4P57B 4ZUVB 1FN4B 1IAIH 1DR9A 3EBAA 2IFGA 2LV4A 1NCTA 5E5MB 4M3KB 4QYOA 5TF1H 4OCWH 4N8CL 1OPGL 4HWBH 2J4WL 3MGTB 5KSBE 3QEQA 1CDUA 5LKNA 5A1AA 5KTEH 4NKMA 5HGBA 4IRZH 1I9RH 5KJRH 1WC7A 2ICWJ 3MR9B 1JPFA 1P69B 1EGJH 4P23C 3TCXA 1KULA 4PPTA 2X7LA 1YNLL 3W82A 4P3CL 3C87A 3UAJD 1L7TL 1QR4A 3GMOB 5FOBB 1RHHA 1P84J 4Y1AA 1W0WA 1SJXA 5EC2B 4QEGA 4MS8C 1I4FA 4XBPB 1LP9A 3V6OE 3WIHH 2BSSA 3MODL 1MVFA 4X6CE 5IB4B 2X44D 4JDTH 1RZGA 1QKZL 5D7JC 5B21A 1F02I 4KQ3L 1MCWW 4LIQL 1AXTL 1SEQH 3PL6B 3VXUD 4YWGH 4OCNC 3ARYA 1U58B 1EPFA 4K71C 2WUCL 4O9HH 1N3NB 4HFWB 2ORBH 4QWWC 5C08E 4LCIH 5E9DD 4PJ5D 4S1QH 5FYKD 3U0PA 3V7MA 2X4UA 4N9OB 5DVMA 3L3OB 1XEDA 5FO9B 2FL5A 4TTGA 3C8DA 4P2OD 1Z3GL 4K7FB 1U3YA 4RZCB 2QADB 3A67L 5FUOL 3TH3T 4P5MB 1CGUA 3RVXC 4CVZB 4L9LC 2EC9U 4NPYA 5L2KB 1XGRA 1AP2B 2CMRL 2UWEA 5J57B 3KPQA 3DETD 5KS9F 1GH7A 4ONGL 4Q9CA 4UDTA 3UTTE 4JKWA 3QG7H 3D3VB 2A6KB 5DUMH 2VZVA 2WBJC 4BQ9A 3OSKA 2BHYA 5JPMB 3LQMA 3MACL 2E5EA 4DVRL 3WN5C 4N0YL 3T1FB 3OKMB 3WL9A 1YEDA 4UIKH 4YHKL 2X40A 4LNRA 3VFSA 4HPYH 5IV2B 2NLJA 4FQXA 5FGSA 1RZIB 2R2CA 4Z7OF 1KLUA 3IJSA 3CGTA 3GBML 1D5IL 43C9B 3RWIA 4PV9B 4HQQH 5E99L 5HPMA 3HFML 2BNUA 2D2OA 1CE1L 4JQIH 1UENA 5E8OA 4A2LA 4P23A 4Z0XB 5EZIH 1T7ZA 3T0VA 3EYUL 3GHEH 4RAUB 3WJJA 2VISB 4H0GA 2P44B 4M6OL 3KPOA 1A6ZA 2EXWC 1OAXH 5CBEA 4L3CB 4XC3L 3RL2A 1L0XA 2UZIH 3V79C 3OJMB 5CMAB 5D7JA 3G5XA 4HH9B 1OL0A 1U8LA 4QRRD 1FNSL 3DI3B 5I1CH 4OKVB 3S37H 2R8SH 1FO0B 1JPTH 1HOCA 3TT1L 4F7PA 2I60H 5HDBF 3TBYB 3KPLA 3JTTA 3BPLB 5KSVA 1NBZB 4HXBH 4LKCB 4Z7NF 1P7KB 3BE1H 3JV6A 2H26B 2C3VB 1JBJA 4I2XB 1NCDL 4D0DA 2X4OA 2BY0A 3HUJE 4Y2DD 5FM8A 3UJJH 1KJ3L 1UB5A 5BV7C 3B5GA 1U8KB 1WFTA 5FGRA 3I84A 2NZ9D 3QXVA 5D1XD 1PEWA 2AJXL 4RISL 3X11B 5IOPA 1IEBA 4XAKD 1RIHL 2XQYK 1NAML 2WBJA 4MA1C 5GGQL 4NHUB 2ZUTA 1Q0XL 5ADOH 3QXDA 2BVTA 4JN2A 3O0RL 1AQDB 3FN9A 2PTTA 4PJ7A 3MUHL 2LTQC 1J1XH 1DEEB 1EEQA 1JVKA 3LOWA 1LE9B 1H3VA 3PGFH 2BVPB 4P9MH 4M93B 3WEXB 1NBYB 4P2OB 4JG1H 4PRNA 4LGSB 3CFDB 3WHE1 1G6RA 5FYKU 1MCCA 4FFVD 2HP4A 3ARDC 4XB8A 4U6HB 4JPWH 4ZYKB 5CD3A 4MJ5A 1FGVL 1FH5H 2BCKA 4NUGL 4ELMA 1A9BB 5JIPA 3ZKMC 4TVPH 4GAYA 4XCYB 4JO2L 3WLWC 4PY8J 2PNDA 3FB8B 5MENA 4P46C 4WFED 1HHJA 5D71L 1J0JA 3VRIB 2GK2A 4GG6E 4ZPTA 2CGRL 4K9EC 1NMBH 3AAZB 1H8SA 1KFAH 1EFXD 4MQTB 3L1OL 1ZEAH 5ESVA 3MCG1 3O2VL 4PJBB 1KN2L 1IGYB 3HC4H 1VPOH 1TJHH 3I50L 2GUOB 4XP4H 2AI0H 4QRSB 3ARGD 4P2CG 1E6OL 3F7VB 3MMEA 4OLYH 2IQAA 4E42A 1C5DB 4NN6C 4OBRA 3MLYH 4RWYH 4HUUA 1R24B 1J9CT 5DD6B 1W2KT 2BNRA 3SGEI 3ZSTA 2BK8A 2MCG1 4G9DB 3EO0B 4HX1A 5IW6B 2IQ9L 4X6DA 4HEME 3TYFB 2QHRH 3MV7A 3L3KB 1T2QL 2NY7H 1FZKA 3DGGA 4UMGA 5DD3H 4QXWA 1ACYL 1S5HA 5JW5A 4H1LH 3T77A 1I1AA 2BJML 2C4FT 3MZGB 1T0MA 4PB9H 1FBIH 2K7PA 5T5NG 2CXKA 4F33A 3IDJA 4OLZL 3TBSA 2XQYG 1NGXB 4TVPE 4KRPB 1ED3B 2NX5B 2J8UA 3IXTB 5E2UL 4ZNEA 4Y4KB 1ACZA 5FHBL 5DT1L 4XRCA 4QHLB 5J3HC 5HD8C 2HT2C 1LVEA 2P5EA 3RRQA 5EZLA 1YDPA 5GIRB 2Q8BH 2J2ZA 5I17B 1SJEB 5GRUL 4I18C 4C83A 4D0BB 4LLVA 5C0EA 1OAKL 3CCHA 4JM2D 4P46A 1FFPA 3SE8H 1DVFC 1OTUD 1WWBX 1CGWA 1K2DB 1UA6H 4MCZB 5IVXF 5C08D 1PLGH 3OGOE 1EEUA 1BZ9A 5F7HA 1AC6A 3CFKB 4HS3B 4KJWD 5EUOB 3UBXI 4XMKL 3SDXE 1BZ7B 3FOMA 2VIRA 1A6TA 1H0DA 3HB3C 3MPCA 2APTA 1HQ4A 4M6NH 3T2NH 5BQ7B 2W1NA 5F1IA 3EYOB 1NC4A 2VITA 4MA8H 3TN0D 5IBTL 3SDCB 1V3KA 3UZQA 2HJLB 3UTTD 4OD3H 2WBKA 4KK9D 4WV1B 4NOFA 2DL2A 3WUWG 2EDYA 1YJDL 3QNZB 3EFFB 2AV1A 3GZKA 5J1SC 4PJFB 5HDOA 3P0YH 2NMSA 3CJJA 5GRWA 4JFPA 2MHAB 1EFXB 2GAZB 3QH3A 2OL3A 4LHUG 4XPBH 3VXOB 1U8HA 3WUWA 4PJDB 4M4PA 4PFEA 4CL7A 5SWZB 3SDAD 3KPRA 3FKUS 1MFCL 1NKRA 3S37X 1MQKH 1OCWL 4F9LA 1UYWH 3LKNA 4PY7A 3DPBA 1WTLA 4IJ3C 1J05A 4FMKA 1QHOA 3VXPB 1KACB 5DO2D 5GRYA 4LARL 4LHUA 3IT8D 4PLKD 5HY9B 2NR6D 3VFUA 5DMGC 2QQKL 2X1OA 5DS8B 3L7FA 5ANMA 5T1LB 1WAAF 1QBBA 2FHCA 4QY8B 5L6YL 1N2RB 1UACH 5C3LD 1AI1L 4G3YL 2HVKB 3OKKB 5HI3D 1KJ2A 4K2UL 5E4IA 4F58L 1DBML 3OR7B 5KVGL 1MWAH 2Y07H 3NA9L 4Z7UE 1JZ7A 4EI6A 2ZUWA 4BFEA 4O00A 1GGIL 5C0RH 1YMMA 3H3PH 3WD5L 4Z9KB 1F6LL 3BW9A 3QO0A 5EG6C 2EDTA 5CLWA 3TP4A 4X6CB 3VI3F 3M45A 5DSCA 4A6YA 5F1SA 4R3SA 5D72L 4P5TD 5EU6E 3U46B 2AGJL 3BH8B 1NCCL 3KJ6H 3CFCL 1T4KA 4CVXA 5BVJB 2HLFC 1CU4H 1I1YB 2E9JA 2OI9B 3RGVA 3B5TA 1ZA6B 5HHNB 5F9OL 1OWWA 4OLWH 3BAEL 1YEFL 4RWHA 4IMKC 1HXYA 1XIWC 4XI5C 4IIQB 5C09A 3B8YA 1M1SA 1A4JB 1GCFA 4HPOL 1U8NB 2UZYB 2VR5A 4RMSA 4KU1A 4CNIA 1JJUA 2ARWA 3LEYL 3UTTB 5IW1B 4HIEA 3P4MA 4G8FB 3QUZB 2C1OA 1MH5B 3TNNB 4HH8A 4OKDA 3FO1B 4WI6A 5IROC 4JQVA 4PJEF 1WBXA 1F4WH 4IOFD 3FN3A 4KZDH 3IFOA 4L8SA 3OAYH 4OJFL 3QXAA 1ZLSL 4M5YH 2EO1A 3QDAA 1AFVH 3SDAB 5DUPH 3PWVA 1HZHH 1TVHB 2UVEA 1F90L 1MCBA 4E41A 3FHQA 5K9OB 4OZGB 1JK8B 4WEBH 4RMQA 4JJ5B 5FYLL 3NCJL 2A1WH 3MRBB 1FYTA 5T3XH 1LO5A 4ZFFA 5I1LB 4XP1L 2FZ3B 3PQYB 1WBZA 3PABB 5F9AC 5IP4A 1YMHA 3GNML 3SE4A 3LDBC 3DURB 3BN3B 1FO0L 4LVHB 4I3GA 4X7EC 4XTRC 1SVZA 5BJTB 2BOCA 4OLUL 1JN6A 4Y5YB 1HILB 1BQHG 4KTDL 3NIGE 4TVPD 4ZTOL 3BFOA 2O61A 3HUJB 1S7VB 5LGJB 4WEMB 1WF5A 1GOFA 5B39G 4U0QB 1NGYA 3QO1A 3T3MF 4PJ9C 5HDQH 2VDNL 1I7UA 3KYNB 4PRPA 1FNGA 1N4XL 3U1SL 4LEXH 5FKAB 3IAPA 5E08H 5DYOA 1BQHA 5INCA 5D1QC 5F21B 2I5YL 4NNYB 4OZIB 1SM3L 1VFBB 3RNQB 2WAHA 4HV8A 5IBLC 4LCCA 3OX8B 5ETUA 1NUNB 3TBWB 3DVGA 4Y89A 3O8XB 4DW2L 4LSVH 2XN9E 3ULVH 3LPFA 3F12B 4IOIA 4U1SA 4U1JA 3P4NA 2CO6B 4BUGA 5T3XE 5DJXB 1EO8H 4HT1L 4NGHH 3RVTD 4NCC2 2F54E 4JY4B 1TTFA 2L7JA 1MLCB 3RHWK 5LXGH 1FPTH 1BVLA 1HH6A 2ZCKL 2ESVE 2IH1B 3HI1A 3STZB 3KGRA 1MCFA 5BRZB 5ITFA 4CVWA 2R56H 3BKCH 1O0VA 1JGLH 3MNWA 3NCYP 4O02L 4UZGA 1CGXA 2A73B 2Y23A 3TPUA 1C5CL 3VE0B 2VOTA 4MNGB 4S1SL 3Q5OA 3JWDL 1ZLWK 1X3DA 1PAMA 4UV7L 3P2TA 2E6PA 1J5OL 4XVJL 4EVNB 3MRPB 3ILPA 5HHQB 4NKDA 4KJYB 3OG4B 4LRIA 1UM4H 2NYYD 4XMPH 5F93C 3ZTJH 3MRKA 1FZMA 2P45B 1PFCA 2CDEB 5E2TL 2QQQA 1KTRL 3HAEG 1MHEA 4APQD 4PJ9A 5EU3A 1G9MC 1I7RA 2ITCA 1XF3A 2VQ1B 3ZKND 1V5JA 2FATH 3PDOB 4YHLL 4ZSOA 3ULVE 4EUPB 3RTQC 3U4BH 2CDGB 4G8IA 5CEXB 2IFFH 3HZMB 5JW4R 5FEBA 1LO0H 4LL9A 4H0IA 5TE7L 3HAEA 1IFHH 2ZOLA 3BPOB 5KVEH 1JYXA 1I3GH 3EO9L 1KCVL 1NGWB 2EDJA 5F3BB 2XTJC 2PO6D 2BSED 1Q9OA 4YDJB 1JRHL 1RK0B 1MF2L 3RVWC 4JDVB 2GJ6B 3ARSA 1BX2B 5JR1L 2W91A 4OF7A 1DN0A 2OXHA 2ADGB 4XCNA 1NFIB 2A9NH 5EULV 4EI5C 1OAYH 5EU6D 2R4SH 4NQCE 1DEDA 5H2BB 3MOBL 4DGIH 2FBJH 3MRIA 4PRIA 2CKBA 1LDPL 4X5WB 4WTZG 1T1ZB 1UZ8B 2PW1A 2ZPKH 2XWJA 4MQ7A 5DTFA 1IM3B 4UU9A 4KDWA 4WI7A 2DM7A 1A4KB 1A9EB 4EN3C 3SDXB 5DRXA 4DN3L 4EQ3A 2C3WA 3CH1B 2P8MA 4AQ1B 2JCCB 1HN1A 2DJUA 2ED7A 3EYQC 4GBXA 4AEHH 4H1LB 1WZLA 1TLKA 1E4KA 4NSKB 4GRMA 5TE4L 2HMID 2FSEB 1MCNA 1UG9A 3BOVA 3HHRB 3WNPA 5IB2A 3LPWA 2D4FA 2IG2H 2F53A 3VWKC 1Z2KA 1CXIA 1RIVH 2A77L 2VWEE 3EGSA 4LSTH 5CZKA 5F1OB 4I9WE 2AERT 3JWOL 3ROOA 3E8UL 1J8HA 1N5AB 1VGEH 5I73B 5IB1A 3DX7A 1GGBL 4MD0B 3O4OB 4U6VL 2BRQA 3TC9A 3N1QC 2YBRB 1EBAA 2F5BL 2O5ZH 3RGHA 3OAUL 1G7JA 2ZG2A 4YPGB 5LG1A 4PYHA 3T65A 2BVQA 4L3AA 5F6IB 1H3PH 4X6EA 1T22A 1G7MA 4KKLD 4KGJA 5DD0L 1V7NL 3QNYA 5FF6B 3MV8B 1KIRA 3NTCH 1RZ8B 1GZPB 5F8RC 3KPPA 4PGEA 3UXFA 1A3RL 4EI5A 2CK2A 3BZDA 1K8DB 1IC1A 1RUKH 3CFEB 3TT3H 1ZANH 1TITA 1CE6A 1D7FA 4GRWB 4PJXE 3I9GL 4HUWB 4NT6B 4G5ZH 5HHME 1CTOA 1FP5A 3O3BB 3RUGB 1P9MC 5A43C 3AREC 4YXLL 5CJOL 4PGBB 4YDLC 3BMVA 1B88A 3UPAA 1IJ9A 1NCAH 1IC5H 1KIPA 3GM8A 1P4IH 3T1WA 5I8CB 4Q58C 4Q74A 3UDWC 2GK0A 1ZAGA 1AGEB 5J7CC 4NRZB 1NFDE 3KS0J 3MV9B 2IWGA 4O4YL 4PP2B 5D2NC 3BVNB 3I02B 1M71B 3LKSB 3QA3A 5E6ZA 5IJVB 2FJHA 3S6CA 1GXEA 1JWUA 3A0OA 3HE7B 4O5LH 1QFWH 5BOZG 2XN9D 5HPOA 3TYGL 2NXYD 4XCEB 3L95B 1FG2A 1NMAL 5IFAH 1AIFB 1FAKT 1IAIL 2OTUB 2JE8A 5JOFB 3BHBA 1D5XB 5T3XD 4F15B 1K6QL 3IKKA 1LK3H 2F54D 5TF1L 4OCWL 4EDWH 2X1XR 4DWHA 4HWBL 2ESVD 5C0DB 2NY6C 2YPLA 3I75A 2VLJE 2EXYC 3R8BB 5KTEL 3RZCA 3WUZA 3QIWC 2PXYB 4CU6A 3GI8L 1I9RL 1MWAB 4IRZL 5KJRL 4L8CB 1EGJL 1U91B 1CFVH 5GS0C 3SGKA 3E2HB 5J8OA 1HYRC 3QRGH 3ZKSD 3UPCA 1P9MA 1N6QH 3PP3K 1P7HL 1B0GA 4JDTL 5KANG 3OKOA 3STLA 3VDBA 1DTUA 1SEQL 4PR5B 3AU1B 2FO1A 4YWGL 1BLNB 4QF1A 1FHGA 5E6IC 5KSUB 2VERN 3MLTA 4TSCH 4O9HL 5D6DA 4OF3A 1MCIA 2FLBT 7FABH 2ADJA 3CDYA 2ATPB 2CXGA 2ORBL 4JHBA 4R7DB 3CX2A 4IRJA 4LCIL 5DJYB 3ULVD 1T5XB 3MFFB 4LSPH 3TA3C 1N0XH 3E6FA 3G5YB 5DZOA 3PWLA 4LGPB 4KMQA 3MLSH 2VL5A 5IMMB 5T1DH 4K3JH 3ZDXF 4B0MM 1RMFH 3QFJE 1J86A 1FFOA 3O2DH 4X0KA 3RWCB 5DHVB 1DQJB 1F5WA 2BY2A 3HMXA 3SBWC 4LKXA 2OCFD 3LS4H 5IMKA 3QG7L 2GTWB 3V6BR 1IKFL 2X4RA 5AD0B 4ZOEA 3P9WB 4W68A 4ZDHB 4UIKL 3DVIA 4HPYL 4NQCD 3LQZB 4L8BB 1U92A 3TZVD 1ZHKA 5IMLB 4QXTA 3QXWA 5HVFB 5IB5B 4HQQL 2VAJA 3RL1B 1GC1H 1UEMA 3KYAA 4JQIL 5FA4B 3QHTC 4R4FH 4LMQI 1F97A 3GHEL 5LCVH 4R96B 3QZWB 4PTTA 5IVZA 2QTEA 1JPSH 1G7IA 4DCQA 4UOJA 3RWFB 3WO4C 1R3JA 1MFDH 1OAXL 1X5HA 3PGCB 1TCMA 1IZJA 5EUKA 1G0DA 2UZIL 1JUFB 4F8QA 2F54B 5I1JH 3CUPB 4WHCA 3AM8C 1CD0A 2X70B 5A3ID 4WI2A 3CXHJ 5B4MD 3S37L 2R8SL 1JPTL 2Q76B 2I60L 1EH9A 3HLAB 1ZSDB 5BCAA 1JP5A 2JIXA 4KZEH 1U8PA 4HXBL 4GAJH 3BE1L 4I9WD 1QO3A 4FTVA 5L0QC 1DLFH 4NN7B 4ZOAA 3UJJL 5L8JB 1I1CA 3MYZA 3IDNA 4TN9A 4U2YA 1P84K 1R3IH 2R1YB 3I6KB 4NQUA 2W60A 3Q48A 2AP2A 3SBWA 5A16B 5IR1A 1DLHB 4OLVH 2XTLA 3DTXA 2GSIB 5C1MB 1S9YA 5BV7H 4OV5B 5ADOL 3LV3A 2EZ0D 4GUPA 1RVFH 4JEGB 2IH3B 1BFTA 1KNOB 2FEEI 1J1XL 1YYLH 1X5JA 3PGFL 4PRHE 4P9ML 2F5AH 3EZ8A 4GG8A 5DVNA 4JG1L 5HHMD 4HHAB 4JJHA 5CWSA 4JPWL 1BBJB 1G7QA 2G2RB 1FH5L 2VUOA 4XWOD 4NQEA 4R0LA 1WISA 3JV5A 4G9FB 2EE6A 4TVPL 1A5FH 1JF5A 2BXYA 4C54A 5EO0A 3QUXC 1CS6A 4DZBB 1MI5A 2BFVH 4N0RA 4OQTA 4PJHF 1CDYA 3T3PE 3D18B 4KK6C 1AD0A 2YWYA 5DUBB 1NMBL 4ZUTA 1FL3B 2A74B 1KFAL 3SDDB 1IAIM 1TIUA 4X7FC 1H3WM 1ZEAL 2EDEA 4OGAC 4P3DA 4U0RC 3HC4L 3LQAC 1VPOL 1TJHL 2X4QB 4XP4L 2AI0L 2C26A 3MBXH 3QULA 1ZGLM 5HI5C 1P5UA 4OLYL 4K9EH 2OSLA 3FB5B 1I85C 1NPUA 4RWYL 3MLYL 2FH6A 4UTBH 5TDOB 5I1KH 1A1MA 3HCVA 2E9BA 5F9JB 1OSZB 2QHRL 1O5DT 5ACZA 3K46A 1JGUH 2YKLH 3R0MA 2NY7L 5TE6H 5DD3L 4DGVH 5J13C 1P1ZB 4K94H 2FH8A 4WI5A 5ID0A 5IGXH 4Q6IC 4D94A 2VLJD 6CGTA 4Y4FC 5T1KA 4PB9L 4POUB 5SV4A 2AJZB 1FBIL 3MNVA 2ICWA 4X4MA 3C2SA 1E0OB 2JK5B 4D8PB 3QI9B 3QCUH 2ZSVA 3ULSA 1HDMA 2P5WB 1WZ1H 2OL3H 4XPFH 2G9HB 4JANB 1VFMA 2AABH 4J3WA 4ZS6D 3V4UH 3WS6C 4RAVB 4PGJA 2Q8BL 3OPZH 5TQ2H 1XT5A 3VGAC 2VLKA 2CDFA 3ILQD 2WZPD 4O58H 2J8HA 3JV4B 4NIKB 4LCWE 1WSST 1WCBA 4AH2B 1DBJH 2W65A 3NZ8A 4PGDB 3SE8L 1SQ2N 3MLWH 1UA6L 3H0TA 3DIFA 1PLGL 4WCYH 4L3EE 1T89A 5IBUG 3OAZK 3NIDE 3KXFA 4NDMA 4PJCB 1I8KB 3DHMA 4JREB 5D1ZA 2G75A 4YUEH 2B2XH 5FV2A 4Y2OA 3VXTB 3DECA 5FM5O 1MVUA 2VXQH 3IDYB 4BQ6A 1H3GA 1F6AA 4KI5C 3T2NL 4MAUH 1KJ2H 1BBDH 3KDMB 3QFJD 3SCMD 3NN8B 1U3HC 1GGYA 3KLHD 4JVPA 4MA8L 3VFRA 4UT9H 4XP6H 2CIIB 4OD3L 1IGIH 1X7QA 4F9PC 3KPSE 1KTKE 2XQBH 3I3BA 3NFNA 5KAQF 2ARJB 4G8GA 1EEZB 2HRLA 1RULH 4U1GB 3VGGA 4MDIA 3T2OA 3P0YL 3SKOA 4HS6B 3OG6B 4A6YH 3PIQA 3U4AA 5JOPE 4XPBL 2DL9A 2XNAA 1ORQB 4I5BB 1QFWI 2LU4A 4X8JA 4WFGE 5FB8B 1S8DB 4P23D 1ULVA 4ODWB 4WWKA 1MQKL 3CFIC 1UYWL 2OS7A 4N0FA 1LK2B 4LDLB 1RK1A 1IGMH 3P11L 4MS8D 5BZWB 1Q9KA 3QHZH 1TXKA 5EOQH 4Z6AT 5BXFA 2R15A 3QWRA 4QYOB 2EDQA 2FR4A 3BP5A 1Y6MR 5ANME 5FUZH 3K8LA 3QG6A 4Y19A 1SJVA 4ZS7H 4U33A 4LEOA 3VMPA 3O45A 5AAMA 1UACL 2VLJB 2W0PA 2XICA 4NKMB 3C5JA 4QWWD 2E7MA 4TPRH 3EDJA 1WC7B 3BZ4A 1JPFB 1MLBA 1MWAL 4S11A 5EU7C 3BQUC 4BZ1H 1RHHB 3VXSA 4Y1AB 5HXMA 2LFGA 5C0RL 3H3PL 3RVXD 1I4FB 5GS1C 4PLJC 3ROLA 4PG2C 3MLUH 1LP9B 2D9QB 2XZCH 2BSSB 5D8JH 3NCFB 4K55A 3SGDI 1U3HA 1X6LA 4HJJH 1RZGB 3DXAA 4JVWA 1WV7T 1ZT1A 4F7CA 5CKGA 3BIKA 4MB3A 5JHLH 4PRDB 1JGDA 5E7BA 2CO7B 1FVDA 3KJ6L 2QR0B 3EYVA 2D0GA 1CU4L 2O93L 1FL5B 5DJ2A 1FL6A 2X4UB 2ZP0T 4PRHD 4JCMA 4HGKC 4ZUSB 2FL5B 3IU4H 3R06B 1OTSC 4OGZA 3C5SA 5I19L 4OLWL 5MHSE 1TQCC 2R2BA 1YN7A 1OW0C 3BGAA 4NRXA 4NPYB 3DROA 2ZG3A 3AMKA 2DD8H 1XGRB 3LKQA 2UWEB 4TUKH 5IHZB 4NQDE 5IF0A 4TYUA 3KPQB 2YN5A 1MAKA 3X17A 1PKQA 4UDTB 2X41A 3U2SA 3NPSB 3W9DA 2A6DA 2X9XA 3UTSA 2EXWD 15C8H 3VRJB 4IHOB 3LSOA 2APBA 1P2CA 4LNRB 3VFSB 3ZDZE 1WT5A 1AE6H 1F4WL 2NLJB 4JRXA 4FQXB 4DAGH 1F4YH 1QTYT 1KLUB 3IJSB 4KZDL 4FRWA 3VCLA 3B2VH 5HPMB 4O2EA 4M5YL 2O5XH 2BNUB 4LLYA 2DM2A 1AFVL 2Q8AL 5J56B 2F74A 5DUPL 4P23B 4MB4A 4HK3J 1HZHL 4C59B 4RDQF 5CP7A 3REWA 2V7HA 4Z76A 4WEBL 2A83B 4YBHA 3KPOB 1QSEE 1JFQH 4Z7QF 1EVTC 1MFBH 3BDYH 5CBEB 2A1WL 4QHNB 1FYTE 1X5GA 3RL2B 3V52H 4KPHH 5D7JB 5T3XL 5SWQA 2QQLH 3G5XB 5D2LA 2XZAH 1QSZA 3L3JA 2WBWB 2EE2A 1JZ3A 4WU5B 4B7LA 1VESA 3GSUA 1AGDA 1RZJC 1HOCB 3S97C 4Q6YA 4LVOB 4J3VA 1G0XA 3KPLB 5KSAA 3JTTB 4L29A 5BS0A 5KSVB 1J8KA 1QEWA 5AYUH 1RUMH 2G5RA 2KH2B 4OZFG 3GGWA 5GRXG 4D0DB 2X4OB 3BD3A 1N6UA 1JE6A 1QLFA 2HWZH 1UB5B 4YEEA 2WP3T 3ZKQD 3MRGB 3ARDD 3MLPA 4GKNA 4L9LB 5AWNH 4JKMA 5HDQL 3FRUB 3Q0HA 3MUGA 5H37H 4LEXL 3ZKMD 2BMKA 4MSWA 5E08L 1G1CA 3LKOA 5IOPB 1X5LA 4M9PA 3WLWD 1Q94A 4LCWD 1IEBB 3E6HA 4P46D 4J3OC 5ERWB 1YQ2A 2WBJB 1X5AA 3JUZA 3QXDB 4RX4A 4L3ED 4XBGA 4ELKB 2PTTB 4PJ7B 4L4JA 2HRPH 5IUSA 1SYSA 3FQXA 4LSVL 2IBBA 2K9UA 1MHPH 4NQSA 1VEPA 4X7DC 5I1EH 5KG9B 4PRNB 2E7HA 5GRJH 1G6RB 3GUTA 3HAEH 3RPIA 2JELL 3HPLA 4WUKH 1DQLL 1K3ZA 3KYOA 5JW4M 5J1AA 5CD3B 4MJ5B 1EO8L 4ORGA 4NGHL 5FXCH 3OKNB 3RDTC 5K9QG 1WAAA 4GAYB 1FPTL 4CW1B 5LXGL 3KPSD 3NH7H 3BXNB 3PHOB 5JNYA 3EYFA 3FFCD 5E1HB 5ESAA 5MENB 1ZE3C 3V4PH 1ES0B 1VACA 1HHJB 2R56L 3BKCL 3CC5A 3QUKA 1JGLL 4RFEA 4ZAKA 2DBLH 4ZNCD 3I85A 4M6MH 3ULUF 1YQVH 1T7YA 5ESVB 5JOPD 1KB9J 3G9AB 3SO5A 5CD5D 1EVUA 1A7OH 3B9KC 1JMXA 4PJIA 4WFGD 1EO5A 4HIHA 1UCTA 4YHOH 4JRWA 1NMCC 3MMEB 3ZE2F 2APFA 2IQAB 4NP4H 4Z7VE 5K9KB 3O4LA 1UM4L 4XMPL 3OTTA 4G7YH 4HUUB 1INEH 2W9EH 4UNVA 2BNRB 4OFPA 3ESUF 5J3HD 5B3JE 5HD8D 2HT2D 4MCYB 1WIUA 5BV7B 4YDIH 4HX1B 3MUY1 4V1DE 1H15B 4X6DB 1A7NH 2EYSB 5M7QA 4BH8A 1FZKB 2FATL 4N5UA 3DGGB 1LEIA 3QIUC 3U4BL 2KQMA 3T77B 2FJFA 4OZ4A 3RQ3A 2IFFL 2J8OA 5DJCA 1I1AB 3H6JA 4XWGH 3TV3H 1LO0L 1DVFD 1T0MB 1IFHL 2JJVA 4XGZA 5KVEL 3V5HB 4PRBA 1G9MH 1FYHB 4F33B 3IDJB 3J8F7 4X8XA 3TBSB 1YECH 4PRAA 1H9VA 3OF6A 4LU5L 1BFOB 2J8UB 3HB3D 1MCWM 1CCZA 32C2A 4X4YA 1LO3H 2NY1B 3MA7A 5JZ7C 2P5EB 1NL0H 3ARDB 2CLZA 1HINH 4X7TA 1HHKA 5HHVH 2ICCA 2VZUA 5DWUH 2A9NL 1R5IA 4WENB 2E8YA 5TGBA 1JHTA 1VGKA 1D6EA 4XP9H 4NKIH 4C83B 1A3QA 4ZUVA 1OAYL 4LLVB 5C0EB 2R4SL 3CCHB 3WSQH 4LCWB 1NAKH 1UWGH 2OK0H 4P46B 3DSFL 4DGIL 2FBJL 1S9KC 1U8JA 4YAQA 2ZPKL 1BZ9B 2EDRA 1FRGH 3QIBA 5GJTL 1Q1JH 4ERSH 3FOMB 3VA6A 5MHSD 1HQ4B 5F1IB 3C6LC 4GW1B 1OP5K 4NC1C 3VH8B 1ZGLP 3I6GA 1NC4B 2VITB 4NQDD 4GS7B 4U6YA 4MXVE 3C8KA 4AEHL 1IGFH 2F58L 3ARZA 3GMOA 1CXHA 2ILLA 5FOBA 1Y6KR 4MNQA 1DDHA 5J6GB 3BKYH 3KPSB 1ZXQA 3KG5A 1L4IA 3GSNA 3SO3B 2R23A 3KWWB 5DMGD 2AV1B 3N50A 5IB4A 5JTWA 1UJ3A 2EC9T 2IG2L 3KR3L 5IVOA 3FO0H 3JZ7A 1RIVL 5D7IE 3G6JA 1VFUA 1L0QA 4X6FA 4LSTL 4JFPB 2OJEB 5T3ZH 2OL3B 2EDWA 2UUDH 3WUWB 1XGQA 5JHDA 1KIUA 1VENA 1HSBA 1WWWX 3KPRB 2O5ZL 4OTXH 2XTJE 4PJ8A 4MXWH 5EFIA 1D5MA 5EO1A 3LKNB 4PY7B 1UB6A 3TO4C 1J05B 2E27H 1H3PL 7CGTA 2F9BT 2XRAH 2YN3A 2XYCA 5TF0A 4P5MA 5DFTA 2QHLA 1QSED 1T6WA 5F7KC 3VFUB 3FN0H 1FYTD 1OOAA 3LZFH 5FDYA 3PF2A 3KPMA 3L7FB 5ANMB 2CLRA 2FDBP 2D9CA 1RUKL 3TT3L 2A6KA 1ZANL 3EUUA 5JXAH 2WWKO 1G84A 1YUHA 1KJ2B 4QRPA 2HLFD 4G5ZL 3N85H 1IC4H 1MFEH 5E5RB 3G6DH 4KUZH 1SBSH 1ZVSB 2DI8A 1PZ5A 1MFNA 3LEXB 4EI6B 1FFRA 1X4XA 2R2EA 1JTPA 2JB5H 3VFWA 1NCAL 1OP3H 1IQWL 3E3QC 43C9A 1P4IL 3ECBA 4PB0H 1YMMB 5DMYA 5CUSH 4PV9A 1XIWD 3BW9B 4XI5D 3QO0B 4YHNA 4JZNA 2VDRH 1ITBB 4Z0XA 1OAQH 4LOUC 5GQBA 4V2BA 4DN4H 4CAGA 5DSCB 4XPHH 4A6YB 4AMKH 4WUUE 5T3ZE 1TZIA 3ARUA 4R3SB 4M43H 4Y5VA 2UY6A 4L3CA 2X09A 4BH7A 1T4KB 4CVXB 2R1WA 5LGKA 2F19H 4MAYC 3RGVB 1QFWL 4PJGE 3K7UA 4D9LH 5FYJH 4JPKH 5J4MA 2ITDB 5IFAL 5GS2H 1DBAH 1HXYB 1NBZA 2KL6A 1P7KA 2PYFB 3SGJC 4NQDB 1LK3L 5DLMH 3K2MC 4LDOB 4EDWL 4IJ3B 4CNIB 4HIEB 4ODTH 1EEYA 3H9HB 2C1OB 1DN2A 4WO4C 4QHMB 1BQSA 4OGYH 2D03H 1T6VN 5E00B 1L6XA 4G7VH 1WBXB 2FB4H 2B0SH 3VXUA 1ETZB 4QCIA 1CFVL 2YUVA 3IFOB 4L8SB 5C9KA 4NHUA 3QXAB 1T1YB 4XTRD 1JWSA 3UTPE 3QRGL 3EIFA 1I9JH 5E9DA 4PJ5A 5DZNA 2P8LB 1J1OH 1TDQA 1N6QL 3PWVB 4KMTH 2Q87A 4E41B 1M6OA 4X98A 1S7RB 5HBBA 2EDNA 4LCYA 4HFUH 1DANU 5GS0H 2PCPB 4NZRH 4V1DD 4PJ9D 1QSEB 4HEPG 4TSCL 9CGTA 2ZWLT 3T0XA 7FABL 2W92A 1FYTB 5CINH 1MJJA 1MY5A 4CMMB 4KKCC 5D1QD 5D2NE 4ZFFB 5KVFL 3SKNA 4LSPL 1KC5H 4XNQA 4XNXH 4Z7WE 3C09C 5FYJE 4WW2A 1N0XL 1WBZB 5C0JA 3MLSL 1YMHB 4JFFA 1CLYH 5INDA 5IBLD 1TJGH 3TNMA 1E4WH 4OSUH 1U8MA 3BJLA 2B5IC 5T1DL 3MO1A 4K3JL 3HR6A 3VXMA 2OXGA 1EMTH 1RMFL 3AAZA 5DMKA 5CP3A 2BOCB 3BRDA 4MAYA 3O2DL 4WHDA 3OKDA 1JN6B 4PJBA 2BSRA 2Y4SA 5CEYB 3RY5A 3UP1A 5FCSH 1MOEA 3KYMB 4N8VB 3LS4L 2GI7A 2GY5A 4JFXA 3F7VA 3QO1B 1XIWB 2YXMA 2OMBA 1FNGB 1HQRB 3MRRA 2DQHH 2X2YA 4RBPK 1T21B 5IW3A 1VFAB 1L7IH 5DYOB 5I15H 1BQHB 5INCB 2FGWH 4DJMA 2M26A 1T0NB 3EO0A 1FDLH 5DHXB 2ICEA 4KHTH 5D93C 4HV8B 3ZTNH 3G5VA 2VH5H 5ETUB 4NQTA 3VFTA 2NTSP 1GC1L 1YPZF 4WNQA 4PJAE 4KDTA 3IJHA 4XPGH 4QRRA 1F3JB 2DQGH 4R4FL 2C3GA 2HJKA 5LCVL 2HKFL 4U1SB 3P4NB 3FT2A 1XR8A 1JPSL 3K1KC 4OFVA 4Q7DA 1MFDL 1NGXA 3WS3B 1ED3A 4OFDA 4HLJA 1GHFH 4Y2DA 3G08B 4HBQA 1BVLB 3D39E 4M7LH 3D9AH 3GJEA 3QNXA 4QHLA 5TFSH 4B7IA 2FX8L 4ZTPH 5IFHH 4QLRA 5KZCB 5ITFB 3MTRA 4OQTH 3OGCB 1KELH 2ZCLH 3U48A 5D1XA 3RTQD 4KZEL 4D0BA 3TPUB 2WNGA 4GAJL 4BSWA 3WDHA 3TIDB 5C70A 4OD1H 2XKUA 4LLDB 1T80A 1DLFL 3VGHA 3LDBB 3VRLF 1K2DA 1MCEA 4DZ8A 3ILPB 1FIEA 5F7LB 1R3IL 2XTJD 4M62H 1XGYH 5B22A 4HS3A 5EUOA 4Z7VB 5LJYH 3RVWD 1BZ7A 2V5YA 5IWLA 3PP4H 1KN4H 5J9PB 5BQ7A 1R6VA 4OLVL 1MHEB 2FRGP 4K3HA 4PJ9B 2DI7A 1ZLUH 4URTB 5EU3B 5BV7L 1I7RB 4G6FB 2ITCB 3S88H 4IBLT 4EI5D 4RMTA 2FNBA 4YPJA 1EXUA 1G9NC 4WV1A 4G8IB 2J5LB 4H88H 1YYLL 4I4WA 5EZJA 4BKLA 3OB8A 3RX8A 1NC2A 1F2QA 3QNZA 3EFFA 3HAEB 2F5AL 2ZOLB 1KEGH 4NN5C 4PJFA 1QPXA 4OFYD 3CDGA 4ZG1A 2DLGA 2FO4A 3CU1A 4PV8B 2MHAA 1EFXA 2W59A 4EN3D 4NQEE 1G1YA 2PKDA 3PHSA 4H20H 4LQ1A 1BHGA 1FVCA 1MELA 1A5FL 4PJDA 1E28A 1VA9A 2BFVL 2XFXA 2NY4C 3ARGA 1QFWM 1DN0B 4XCNB 3EYQD 3ALWA 1NDGB 1RAMA 4DUXA 4WUUD 4YXKH 3NIFE 3W9EB 5C2UB 4IOSD 5CHNA 3H3KA 5HY9A 3ZHKA 1YY9C 3MRIB 1PG7W 2CKBB 4PRIB 1P7QD 2BNQA 5CSZA 3MBXL 3VWKD 1WFNA 8CGTA 2PW1B 3MJ7A 4MQ7B 5DTFB 1CXFA 3WFDH 4HIIA 4UU9B 4DFHA 3BH9A 1T83A 1M05B 2OQJB 4G6KH 4J23A 4K9EL 4KH2A 2X9YA 3F5WA 2D7TH 5KSBA 3IYLW 5DRXB 4UTBL 5I1KL 4LF3A 3OR7A 3W81A 2V5SA 4AM0A 4IRSC 4GBXB 2YKLL 1HSAA 5TE6L 2VQUA 3F58L 3OR6A 1KGCE 4UAOB 1EDQA 4DGVL 4PLKC