2FEFA

The crystal structure of protein pa2201 from pseudomonas aeruginosa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
288
structure length
281
Chain Sequence
LTLDNRLAEALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQPFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGAARDSLREQGETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRLLDYLGAAALGLTSASEETFHPRPFGQLRAFFEESDAQALAPYLQSQYREFFQLSPKAQKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Protein PA2201 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PA2201
total genus 112
structure length 281
sequence length 288
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08929 DUF1911 Domain of unknown function (DUF1911)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3920.10 Mainly Alpha Orthogonal Bundle PA2201 C-terminal domain-like PA2201 C-terminal domain-like 2fefA02
1.20.1440.70 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) PA2201 N-terminal domain-like 2fefA01
2FEFA
chains in the Genus database with same CATH superfamily
3UITA 3AJFA 2YFAA 3IAS1 3LJ0A 5HGIA 3DA3A 1U5KA 3JSBA 3P23A 2L1LB 4HFVA 2JB3A 3I9V1 4NV2A 3LJ2A 2A2CA 2JAEA 1YO7A 2MJFB 4GXTA 2ZRRA 2JB1A 2QZGA 2E8GA 2KKMA 2F66B 2JB2A 2RADA 2QGMA 2RIOA 3L0IA 2XTQA 4PL4A 4JCVE 4I1TA 2FUG1 4Z7GA 1W3SA 4G76A 2RLDA 3KP9A 2P22B 4Z7HA 2XMXA 2A2DA 2GSCA 2BL8A 3B55A 4O1OA 4AS3A 3F4MA 1TDPA 4NV5A 4AS2A 2CAZB 3DO9A 4G75A 2JBWA 2FEFA 3DA4A 3FBVA 4YZCA 2HGKA 3FNBA 4U6RA 3SDJA 3IAM1 4O1PA 4OAUC 2K19A 2FU2A 4DWLA 4PL5A 4YZ9A 3FVVA 4OAVB 3LJ1A 1SJ8A 3Q8DA 2BL7A 2V1CC 4PL3A 2F6MB 2YFBA 3VA9A 2ZW3A 2IP6A 4YZDA 2V6EA 1JQOA 2XTRA 5LNK1 2QSBA 2ETDA 4HEA1 4Q9VA
chains in the Genus database with same CATH topology
2FEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEF A; 
#chains in the Genus database with same CATH topology
 3UIT A;  3AJF A;  2YFA A;  3IAS 1;  3LJ0 A;  5HGI A;  3DA3 A;  1U5K A;  3JSB A;  3P23 A;  2L1L B;  4HFV A;  2JB3 A;  3I9V 1;  4NV2 A;  3LJ2 A;  2A2C A;  2JAE A;  1YO7 A;  2MJF B;  4GXT A;  2ZRR A;  2JB1 A;  2QZG A;  2E8G A;  2KKM A;  2F66 B;  2JB2 A;  2RAD A;  2QGM A;  2RIO A;  3L0I A;  2XTQ A;  4PL4 A;  4JCV E;  4I1T A;  2FUG 1;  4Z7G A;  1W3S A;  4G76 A;  2RLD A;  3KP9 A;  2P22 B;  4Z7H A;  2XMX A;  2A2D A;  2GSC A;  2BL8 A;  3B55 A;  4O1O A;  4AS3 A;  3F4M A;  1TDP A;  4NV5 A;  4AS2 A;  2CAZ B;  3DO9 A;  4G75 A;  2JBW A;  2FEF A;  3DA4 A;  3FBV A;  4YZC A;  2HGK A;  3FNB A;  4U6R A;  3SDJ A;  3IAM 1;  4O1P A;  4OAU C;  2K19 A;  2FU2 A;  4DWL A;  4PL5 A;  4YZ9 A;  3FVV A;  4OAV B;  3LJ1 A;  1SJ8 A;  3Q8D A;  2BL7 A;  2V1C C;  4PL3 A;  2F6M B;  2YFB A;  3VA9 A;  2ZW3 A;  2IP6 A;  4YZD A;  2V6E A;  1JQO A;  2XTR A;  5LNK 1;  2QSB A;  2ETD A;  4HEA 1;  4Q9V A; 
#chains in the Genus database with same CATH homology
 2FEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...