2FEFA

The crystal structure of protein pa2201 from pseudomonas aeruginosa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
288
structure length
281
Chain Sequence
b'LTLDNRLAEALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQPFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGAARDSLREQGETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRLLDYLGAAALGLTSASEETFHPRPFGQLRAFFEESDAQALAPYLQSQYREFFQLSPKAQKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA2201
publication title The Crystal Structure of Protein PA2201 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 112
structure length 281
sequence length 288
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08929 DUF1911 Domain of unknown function (DUF1911)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3920.10 Mainly Alpha Orthogonal Bundle PA2201 C-terminal domain-like PA2201 C-terminal domain-like 2fefA02
1.20.1440.70 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) PA2201 N-terminal domain-like 2fefA01
2FEFA
chains in the Genus database with same CATH superfamily
2HGKA 2BL7A 3LJ0A 4I1TA 2IP6A 3DO9A 3AJFA 4U6RA 2BL8A 2YFBA 2FEFA 3IAS1 4AS3A 5LNK1 2FUG1 2YFAA 2RIOA 4HEA1 4PL5A 2RLDA 3P23A 2ZW3A 3B55A 2P22B 4O1PA 3IAM1 2GSCA 2ZRRA 4Z7GA 4AS2A 2JAEA 2JB2A 2ETDA 4GXTA 2L1LB 2A2DA 4JCVE 3SDJA 2KKMA 2XTRA 2JB3A 2V1CC 3LJ1A 4YZDA 3L0IA 2V6EA 4O1OA 2QGMA 3KP9A 4HFVA 4NV2A 3I9V1 2XTQA 4OAVB 2JBWA 4Z7HA 1U5KA 1JQOA 3DA4A 2RADA 2FU2A 4OAUC 3F4MA 3UITA 1SJ8A 4YZ9A 2F66B 4DWLA 3DA3A 4Q9VA 4G75A 2MJFB 2CAZB 2QSBA 4NV5A 5HGIA 3FBVA 4G76A 4PL3A 4YZCA 1TDPA 2A2CA 3VA9A 2JB1A 2XMXA 3Q8DA 2QZGA 2K19A 4PL4A 3FVVA 2E8GA 1W3SA 2F6MB 3FNBA 3JSBA 3LJ2A 1YO7A
chains in the Genus database with same CATH topology
2FEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEF A; 
#chains in the Genus database with same CATH topology
 2HGK A;  2BL7 A;  3LJ0 A;  4I1T A;  2IP6 A;  3DO9 A;  3AJF A;  4U6R A;  2BL8 A;  2YFB A;  2FEF A;  3IAS 1;  4AS3 A;  5LNK 1;  2FUG 1;  2YFA A;  2RIO A;  4HEA 1;  4PL5 A;  2RLD A;  3P23 A;  2ZW3 A;  3B55 A;  2P22 B;  4O1P A;  3IAM 1;  2GSC A;  2ZRR A;  4Z7G A;  4AS2 A;  2JAE A;  2JB2 A;  2ETD A;  4GXT A;  2L1L B;  2A2D A;  4JCV E;  3SDJ A;  2KKM A;  2XTR A;  2JB3 A;  2V1C C;  3LJ1 A;  4YZD A;  3L0I A;  2V6E A;  4O1O A;  2QGM A;  3KP9 A;  4HFV A;  4NV2 A;  3I9V 1;  2XTQ A;  4OAV B;  2JBW A;  4Z7H A;  1U5K A;  1JQO A;  3DA4 A;  2RAD A;  2FU2 A;  4OAU C;  3F4M A;  3UIT A;  1SJ8 A;  4YZ9 A;  2F66 B;  4DWL A;  3DA3 A;  4Q9V A;  4G75 A;  2MJF B;  2CAZ B;  2QSB A;  4NV5 A;  5HGI A;  3FBV A;  4G76 A;  4PL3 A;  4YZC A;  1TDP A;  2A2C A;  3VA9 A;  2JB1 A;  2XMX A;  3Q8D A;  2QZG A;  2K19 A;  4PL4 A;  3FVV A;  2E8G A;  1W3S A;  2F6M B;  3FNB A;  3JSB A;  3LJ2 A;  1YO7 A; 
#chains in the Genus database with same CATH homology
 2FEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...