2FEIA

Solution structure of the second sh3 domain of human cms protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELELEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human CMS and a newly identified binding site at the C-terminus of c-Cbl
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords CD2-associated protein
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2feiA00
4KRTA 1ARKA 2SRCA 1GFDA 1CKBA 2CUBA 1M30A 1I07A 2K7AA 2EYYA 3I9QA 2L3PA 3NHNA 4HVVA 2JTEA 4J9IA 3VS2A 3M0PA 2KGTA 4AFSC 1OOTA 1WA7A 1H8KA 1U5SA 1K1ZA 1SEMA 4RTXA 2FPDA 5IXBA 2MIOA 1KJWA 1Y57A 2KR3A 1OPLA 3M0TA 2RNAA 1X27A 1CSKA 2D8JA 2YUPA 2DRMA 2EVRA 1FMKA 3ULRB 3H0IA 1MV0B 1TUCA 1UDLA 2ROLA 2X3XD 1V1CA 2EGCA 1GCQC 3EGUA 1YNZA 4OMMA 2YDLA 2L3QA 2A08A 2J05A 3H41A 4J9BA 4AFQC 1W6XA 3M0RA 1Z9ZA 2K9GA 4J9DA 1NLOC 4JZ4A 3NMZC 1UG1A 1RLQC 1WFWA 2LJ1A 1YCSB 2NUZA 2O88A 1SRMA 2L0AA 1ZLMA 4LE9A 4Z8AA 1ZUKA 2IIMA 2CH4W 2JW4A 2KXDA 1NG2A 1OPKA 1WXTA 1N5ZA 2QDLA 2BTTA 1K9AA 2F2WA 1JXOA 1AWJA 2DL4A 4JPBW 2ABLA 1ABOA 1W1FA 4OMQA 4EIKA 2DL8A 1UUEA 2C0OA 2V1QA 1JXMA 2BZXA 1BBZA 1GBRA 1YWPA 2DRKA 4J9HA 2K3BA 4J9EA 1PKSA 2W0ZA 3EG0A 2H8HA 3I5SA 4LNPA 2GTOA 1WI7A 1I0CA 1AZEA 3VS4A 4OMPA 3RNJA 2CT3A 1PKTA 1X2KA 1QWFA 2DVJA 5FWCA 2J6OA 2AZSA 1WLPB 2OJ2A 3R6NA 3GBQA 1M3CA 2O9SA 1JO8A 2LNHB 1BB9A 2RQUA 1MUZA 2AKLA 4Z89A 3UF4A 2B86A 3VS1A 1QKWA 3KFVA 2BZ8A 2C0IA 1A0NB 1T0HA 3LH5A 2CSIA 1AVZC 3THKA 2DM1A 2EGEA 2GBQA 4OMNA 1KSWA 2DL7A 4J9FA 3VS3A 1RI9A 2ECZA 1JQQA 2L2PA 2D1XA 2DBMA 5IHIA 1WXUA 2RMOA 1Y0MA 2EBPA 1AD5A 1E7OA 1NLPC 2OAWA 2PNIA 2HDAA 3EHRA 1ZX6A 1IO6A 2DE0X 3C0CA 4D8KA 2LMJA 1UHCA 4JJCA 2GGRA 3SHWA 2DMOA 2JS2A 1HJDA 3UA6A 3UA7A 2O31A 2HSPA 1W70A 3CQTA 2DL3A 1E6HA 2LJ0A 3VRYA 2D0NA 2KBTA 3ZL7C 3PVQA 2GTJA 4AFUC 1OV3A 1H3HA 1PRMC 2JMCA 2LP5A 2G6FX 4RTUA 4JJBA 2J6FA 1X2QA 3TSZA 2KROA 5IHKA 4ORZA 2JS0A 3M0UA 2HCKA 2FO0A 5L23A 1HD3A 2KYBA 2LCSA 1UECA 4OMOA 2KRNA 2SEMA 2F2XA 1E6GA 3VS0A 2ED0A 1I1JA 4M4ZA 2FRYA 5EC7A 4RTTA 3QWYA 1WDXA 2F2VA 1X6GA 2L3SA 5I22A 1UGVA 5IH2A 2GQIA 3EG2A 1X43A 1ZBJA 2DBKA 2FRWA 1U06A 1AZGB 1T3SA 4AG1C 1JU5C 2RQRA 1LCKA 2I0NA 4HCKA 2LQWA 1YN8A 2M0YA 4Z88A 2RPNA 2A28A 2RQWA 5IHNA 3REAB 4J9GA 2EQIA 1ZUYA 1K0XA 2HEQA 2PZ1A 1U3OA 1ABQA 2LQNA 1SPKA 2EW3A 3RBBB 5FWBA 1GCQA 4F16A 1CKAA 2DA9A 2JXBA 1GFCA 3M0QA 3H0HA 1NYGA 1TG0A 2DLPA 4HVWA 2ENMA 2X3WD 1K4US 2CUDA 2MCNA 3EHQA 3SEMA 1QCFA 3TVTA 3VS5A 1YP5A 2DJQA 2D8HA 1QLYA 2YSQA 1WXBA 1SRLA 5HCKA 3TSWA 4E6RA 2FEIA 1K0SA 2GNCA 1NYFA 4GBQA 2EGAA 1AEYA 1PNJA 3A98A 5ECAA 4F14A 1M3BA 4F17A 1G2BA 3QWXX 4HVUA 4LN2A 1AWXA 2VWFA 1ZSGA 2CSQA 2E5KA 2YT6A 1AWOA 1H92A 2KNBB 4A63B 1B3QA 4RTVA 1T3LA 4ESRA 1SHGA 3U23A 1VYUA 3EG3A 1NM7A 1PRLC 2ROTA 4DEYA 2PTKA 4IIMA 2JM8A 2EYZA 1RLPC 1T0JA 1YWOA 1JEGA 1EFNA 2CDTA 1UE9A 2K2MA 3I5RA 5GJWB 4D8DA 2JMAA 1SSHA 2O2OA 3REBB 4FSSA 1BK2A 2DF6A 4Y92A 4JZ3A 2EKHA 2K79A 1FYNA 2LJ3A 3UATA 2J7IA 2CH4A 4LUDA 1UTIA 1PWTA 2DNUA 2JM9A 2M51A 2C0TA 4IIOA 2AZVA 1GL5A 1WX6A 2EPDA 1QWEA 3I35A 2LX7A 2VVKA 3M0SA 4JJDA 4OMLA 2CREA 2FPEA 4QT7A 2NWMA 1B07A 1NEGA 4J9CA 1AOJA 3PE0A 2KT1A 1M8MA 3VS6A 1Z9QA 4RTYA 2YUQA 4AG2C 1MV3A 2V1RA 1M27C 3EG1A 2RN8A 1WYXA 2KT8A 1X69A 2BZYA 5GJVB 2CT4A 1XOVA 2A36A 3VRZA 2ED1A 1UJ0A 1SHFA 2AK5A 2DL5A 1S1NA 2KEAA 1OEBA 1NEBA 1K76A 2DYBA 2AKKA 1VA7A 2EYXA 3NPFA 3O5ZA 2YUNA 4AFZC 1QKXA 4R0KA 2VKNA 1TUDA 1X6BA 2RQTA 1GCPA 3NGPA 3IQLA 2KE9A 1ZUUA 1BU1A 2LZ6B 4HXJA 4CC4B 1KIKA 4RTWA 4CC2A 2DILA 4RUGA 2YUOA 2P4RA 4CC7A 3VS7A 2XMFA 1J3TA 1UFFA 2O9VA 2KRMA 2DX1A 4LUEA 2EYWA 5I11A 2FG0A 1UHFA 4RTZA 5FW9A 2K6DA 2RQVA 1G83A 1PHTA 2A37A 4GLMA 2RF0A 1GBQA 3FJ5A 2KXCA 1WIEA 2W10A 2KYMA 3PVLA 3H0FA 5IXFA 1GRIA 2ESWA 4DEXA 2OI3A 4K11A 2JT4A 4ZNXA 4X1VA 4WCIA 1VYTA 2HBWA 4CC3A 2J6KA 1HSQA 3JV3A 1KFZA 2KRSA 2MOXA 2J06A 1RUWA 2FPFA 1UJYA 1VYVA 1AWWA 1M3AA
chains in the Genus database with same CATH superfamily
1TOVA 1JBMA 4C92D 3JB9H 2SRCA 1GFDA 1CKBA 1DJ7B 3PFSA 3DLMA 1VQMT 3JAME 2BE9B 1M30A 2E10A 1M1KR 1B7TA 1K73U 3I9QA 2QTXA 4XU3A 2JTEA 5LJ3h 2GFAA 4AFSC 3M5AA 2RA2A 1JB0E 3HSBA 1U5SA 1NBEB 3R6OA 1SEMA 2CYZB 4RTXA 2DIGA 2DEQA 1KC8U 2Y4YA 1Q7YU 5FRMA 3CCUT 5GMKe 1OPLA 4M75A 3GF5A 3QBYA 1X27A 1RAAB 1CSKA 2D8JA 3I56A 2DIQA 4RCCA 1D1BA 1VQMQ 5GMKl 3RKXA 2EVRA 1FMKA 5CK9A 2GCXA 3H0IA 4C92F 2M02A 1Q82R 1VQNT 1TUCA 2EGCA 3EGUA 3QZ5B 5GAN4 4OMMA 3SFMA 2ZPBB 2RHYA 2J05A 2IPOB 3QPHA 3H41A 3FJPA 4J9BA 2K9GA 3JB9I 4F7UG 2NUZA 2O88A 2L0AA 4OB3B 4RG2A 1ZLMA 3JCMe 4M7DD 1WJQA 2OTJT 4LE9A 1FXXA 4X9DA 2ZPGB 3M55A 2IIMA 2CH4W 3CCLT 1N5ZA 4KULA 1K9AA 4C8QC 3CCSA 1AWJA 5D7UA 4JPBW 2FVUA 5GANf 2JVVA 3HRTA 2C0OA 1RAFB 3PTAA 2A7YA 4C8QD 5FU7C 1BBZA 1K8AU 4J9EA 2RJFA 3CBOA 1KD1U 2H8HA 3I5SA 2LX9A 1WI7A 1I0CA 2YRVA 4M78E 1X2KA 1QWFA 2KMTA 2AZSA 5CVIA 1LPLA 1ZA2B 3GBQA 1JO8A 2LNHB 1IRXA 2AKLA 3M9QA 4J6WA 2ZPHB 4C5GA 2DVEA 2QI2A 1YBYA 3VS1A 1QKWA 4C5HA 2BZ8A 3PIPA 1A0NB 4M78B 3M4YA 1AVZC 3OYHA 2DM1A 3CXCA 4QQDA 2ECZA 1HXDA 1ZSZA 1NPRA 1V76A 2DBMA 5IHIA 4HT9A 1WXUA 1WHLA 5A2QE 3WXMB 5KYXA 1Y0MA 4XTVA 2EBPA 1AD5A 5KYWB 3CBMA 1NLPC 2OAWA 2PNIA 3EHRA 1QVFS 3OYBA 1IO6A 1RI0A 3META 4NOYA 1N9SA 4D8KA 4M77A 5I21A 4ME7A 2M1HA 2QXFA 2DMOA 1VQ7T 1VUBA 1W70A 1Q86R 3J7AF 4M78C 3VJPA 1O9SA 2LJ0A 2KBTA 4M7DE 3V8JA 4FU6A 3JCMb 4ZTJA 2PUKB 3ZBDA 2GF7A 1KHIA 1Y07A 1PRMC 2VXEA 2G6FX 4RTUA 1VQMA 4NL3A 3OBWA 3I56T 3RUXA 2KYBA 1UECA 2FHDA 3I55T 2LC4A 3G4SA 2RHIA 2KRNA 3MO8A 1TU0B 3VUBA 3NTHA 2QK0A 4M77G 3MP6A 4M78F 1SG5A 4A4GA 2RI5A 2F2VA 2L3SA 2V8IA 1S72T 3TREA 5IH2A 5DM7R 2PU9B 1SF9A 2DBKA 1AZGB 3BDLA 3WVDB 2RQRA 4HCKA 5HY6A 4BD3A 2O4XB 2M0YA 2RQWA 4PJOG 3I55Q 3OW2A 3GPLA 1XTDA 4J9GA 4BI8B 2HEQA 3QDRB 2PZ1A 4C0DB 1ABQA 5GAMf 1D1CA 3P8HA 4MMKA 2EW3A 1GCQA 2QASA 3L2ZA 4F16A 2CP6A 2QQAA 2DETA 5AT1B 4E47A 2E41A 3TCJA 1M90C 4EDUA 4RKUE 3JRZA 1TG0A 4HVWA 1IREB 2K3XA 2X3WD 3RESA 1K4US 3A5ZB 3EHQA 3SEMA 2XDDA 1MMNA 5EG2A 2VUBA 2DJQA 1WXBA 1SRLA 3OW2S 3GIBA 3S3NA 2EQKA 4HCZA 4B9WA 3FIFA 3EFSA 1K0SA 2RD1A 4C0FA 4F14A 1M3BA 4J8OA 2EYQA 1VQNQ 3CCET 4A63B 1B3QA 2RJCA 3OA6A 1T3LA 5LJ5d 3CMEQ 3L42A 2WSEE 4IIMA 5A0DA 4XTXA 5GANd 1QW1A 4OB2B 4C5EA 1VQ9A 1T0JA 1VQ6A 5GANe 2H3JA 1EFNA 4M7AG 3EH1A 2E65A 5CAIA 3DB4A 2XHCA 4OMFB 2O2OA 1EIFA 1X01A 2LJ3A 3PMIA 3UATA 3E9FA 1QMCA 1UTIA 4ANJA 2JM9A 2M51A 3M56A 2D9TA 3MEUA 4EMHA 1VQPA 3JCMQ 4JJDA 2JTFA 2L5QA 1B07A 2KDSA 3PE0A 2DEUA 5FU6C 5DLOA 1M1FA 2QA4Q 3DB3A 4M77D 3QO3A 4RTYA 3HRUA 5C6SA 2YUQA 3UT1A 4AG2C 3UPUA 1M27C 1G3WA 4PJOF 2A0FB 3RMSA 1S72A 1PD0A 5HKCA 2ED1A 3MPUB 1SHFA 2AK5A 1NEBA 2O4XA 3KBGA 2DYBA 1VA7A 2EYXA 4AFZC 3O5ZA 4OB1B 2XKOC 3OYLA 4R0KA 4RMOA 3RERA 1XJWB 1WQWA 3CCQT 2V8JA 4J7FA 1Q86C 2EQUA 2XU8A 1ZUUA 2XI9A 1BU1A 2LZ6B 2QYZA 4CC4B 3ASKA 3OQ5A 4II1A 2DXUA 2XMFA 1J3TA 4NS5A 2KRMA 4PFZA 2PVGB 1BIAA 1VQ7Q 2DD5A 1RABB 3C94A 1VQKQ 1PHTA 1D3BA 3QHSA 3FLGA 2A37A 2KXCA 4E7LA 1WIEA 3E2UA 2KYMA 4IUVA 5KYUB 5CR2A 2E64A 2IG0A 1RAIB 1VYTA 4MDWA 2HBWA 2J6KA 3BFMA 3V7CA 1FMVA 1QVGS 2KRSA 3QG1A 2E12A 2JOYA 1AWWA 4HXJA 2QEXQ 3J80E 4M7AD 2ZZDA 2D6FA 1QVFP 2V8KA 4B9XA 1NE8A 5GMKm 1SKUB 4LDUA 2M16A 2CZ6B 1QP3A 3NHNA 4HVVA 4J9IA 5KE2A 4V2SA 3M0PA 2KGTA 1OOTA 1WA7A 3P8BB 1WJSA 3OYJA 5IXBA 2BKDN 3CC7T 2QQSA 4E7ZA 2KAFA 3M0TA 2RNAA 5LJ5j 3S3MA 1YHQQ 3SDZA 4DOVA 4JRQA 1G3YA 2E4HA 4E7IA 3ULRB 3RKYA 1FWZA 2RH2A 1UGPB 2X4JA 1QVPA 2GQVA 4F7UB 1MV0B 2DAQA 2X3XD 2QQBA 3JCMg 4M78D 1Q95G 1YNZA 4E7HA 2L3QA 1V29B 4RCBA 3SWNC 3CXCS 1H641 3JB9J 3QKJA 3NMZC 1HK9A 1UG1A 1RLQC 1WZOA 4JRKA 3SD4A 4A4KA 3QJYA 4ATOA 5D6WA 4LD6A 1YHQT 1GXIE 4F7UF 4Z8AA 5DLQE 3FDRA 5A0GA 1W2BA 2JW4A 4BE0A 1YJWA 3CMET 1WXTA 3CC2T 2K2VA 2OTJA 3CCVT 4C8QB 2F2WA 1JXOA 1ZSZB 2AT1B 1VQLQ 1JJ2P 2ABLA 3OYEA 4JRPA 2Y4XA 4OMQA 4M75F 1KQ2A 1YIJT 4JJNK 3BY7A 2L8DA 1GBRA 3LGFA 4A54A 1N9RA 1KQ1A 1K9MC 4CI0C 1WHKA 2GTOA 4M7DG 3VS4A 3MP1A 2CT3A 3OYIA 2D0QB 5GAMh 3EGXA 5FWCA 2COYA 3CCVQ 3OS0A 1JJ2A 3R6NA 5L8RE 4KH0B 5GAN5 3SB2A 5FROA 1Q82U 1BI3A 5KYYB 2B86A 3KFVA 2C0IA 1T0HA 3LH5A 4X34A 4O5VA 1LVKA 3EG9A 5J39A 3CC7A 4OF1A 4M77E 2YHTA 2DL7A 2FZCB 1C6VX 2VASA 4KBMB 2K57A 2RHUA 3A1PA 3L1AA 1EX4A 2CZ1B 1TTHB 3FB9A 1I81A 3OS5A 1TS9A 5GANh 2HQXA 4M75B 4BUGA 3CXCP 4R56A 2P0KA 4QW2A 1HJDA 2HSPA 4KGVB 5J26A 5LJ3d 3UDCA 2RHXA 5GANj 2OTLT 4VUBA 2FL7A 2D0NA 3ZL7C 1YJWQ 1YITA 2MMPA 5LJ3e 2DYIA 2JN0A 4C92B 2MYSA 4JJBA 2J6FA 1K8AR 5IHKA 3M0UA 2HCKA 5L23A 4MZPA 3DKMA 3TQ7P 1HD3A 2LCSA 2Y90A 3G6ET 2R5AA 3HRSA 4MDXA 3OY9A 1E6GA 1VQPQ 3GP8A 2RI3A 1OZ2A 2KSSA 3MCAB 2HL3A 5IN1A 2X4XA 3X28B 4RTTA 4ZGJB 1OI1A 3V7SA 5I22A 2OTLQ 2GQIA 1ZBJA 2E5QA 2JJ9A 1M2VB 4BDYA 2FRWA 3JCMh 5C0MA 1T3SA 1Q81C 1JU5C 3LH0A 3AT1B 2VV5A 3JCMP 4D6WA 1OX8A 1LCKA 2I0NA 2LQWA 4Z88A 1X6OA 5IHNA 2HMAA 3CCUQ 3JB9D 2JTMA 2EQIA 1IZ6A 1VQPT 4DA4A 3CCVA 2LQNA 4Z02A 4FM4B 5LJ3f 1MMAA 3INZA 1LOJA 2DERA 3CMAA 3A8MB 1U8RA 3ZEHA 4ELYC 4C8QA 1GFCA 3M0QA 3CCQA 4PL6A 1NYGA 2NUTA 3L2UA 1D09B 1QCFA 3TVTA 2NYSA 2D8HA 3OYKA 1QLYA 5HCKA 4FIBA 2DZCA 4M78A 3TSWA 5I2MA 2GNCA 4GBQA 1WPYA 2E1HA 3QWXX 4HVUA 4P5NA 4LN2A 4C0DC 1H92A 1ZSGA 4XK8E 4RTVA 3OS1A 2KK4A 1SHGA 4XTZA 4TVRA 1YHQA 1VYUA 1PRLC 4DEYA 2PTKA 1ZA1B 4QVZA 1IHVA 5KE3A 2E6NA 2ZPEB 1QCNA 2OX7A 1BI2A 3JB9G 3Q1JA 1IXDA 1BK2A 2DF6A 2EKHA 2CKKA 1KK7A 1KC8C 2R5MA 2VYTA 5GAMg 2DO3A 4PJOB 2DTIA 2C0TA 3CCMT 2AZVA 1OU9A 3G71T 3I35A 1OYXA 5GAOm 2LX7A 2VVKA 1M90R 1ZHIA 2WACA 4OP0A 4FW1A 1VQ9T 2BIVA 5GAOn 3VKIA 4J83A 1TXQA 2KT1A 1MGQA 2DTOA 1KQSS 4AMCA 1KHCA 1RL2A 3FC3A 1U1TA 3CCLA 3EG1A 2RN8A 2KT8A 1ZBXA 3V7RA 1ACMB 1R0CB 1X69A 2EIFA 5GJVB 2CT4A 2Z0WA 5GAOq 1VQ8Q 4EMKB 3CD6Q 4FSXA 1VQ5T 4M7DF 1UGRB 3G71Q 1S1NA 1OEBA 2FYKA 4ZN3A 1K76A 1I5LA 1KD1C 3EG9B 4C92G 3NPFA 1VQ6Q 2HL5C 1NJIU 2L3RA 1TUDA 3LW5E 2COZA 3M53A 8ATCB 3CCJT 4DOWA 3NTIA 3WVEB 3HKSA 1D0YA 2YUOA 4HKEA 5GAMe 3I56Q 3CD6T 4CC7A 3TEEA 2DKGA 2HAXA 3C4SA 2DX1A 2DTHA 2EYWA 2ZPFB 4GY5A 5I11A 2FG0A 1UHFA 5FW9A 1OQKA 1D0ZA 4FYXB 3CCSQ 2F5KA 1GBQA 4IURA 3FJ5A 3CCJQ 2LVMA 1B34B 1PM3A 5LJ5h 3PVLA 1M9SA 1VQNA 3NFCA 4A4FA 1RAGB 1QVGA 3QXEB 5CO7A 1M4ZA 2EJGA 2MK5A 4BI3A 1D1AA 1KFZA 2LTOA 1UEBA 1YJNQ 4IUTA 1UJYA 1VYVA 4ZN1A 1KC8R 4KRTA 4KGZB 1ARKA 3E1SA 2QGGA 2YRDA 1P92A 4BACA 9ATCB 2XICA 3LYIA 2EYYA 1MMGA 2KQWA 4C8QF 2ZPIB 3BW1A 4FL6A 1H8KA 2ZCFB 1K1ZA 2FPDA 3EFRA 2MIOA 1XQHA 1KJWA 1Y57A 2KR3A 1G8XA 1I4K1 3G4ST 2XK0A 4LD9K 3CD6A 1OZ3A 2YUPA 2DRMA 5LJ5g 3CCMA 2LCLA 2MWOA 5CKEA 3CCLQ 3OBYA 1D3BB 3FRNA 1V1CA 1GCQC 5AYFA 4OVAA 4Y91A 2M0OA 4JS5A 1MMDA 5LJ3j 1I5OB 3EGDA 1W6XA 3C95A 3M0RA 4UC4A 1PD1A 1NLOC 3G4SQ 5GAMj 4M7AE 5GAN7 2LJ1A 1YCSB 1BI1A 3KUFA 4DQ2A 1SRMA 3DLLA 3RIRA 2P0QA 1K73C 4M75E 4QKUA 4PJOC 3VU3C 2EWNA 1ZUKA 3CBPA 2KXDA 1MHNA 1OPKA 2BTTA 2LQKA 2HZYA 3SWNA 2OAUA 1Q7YC 2DL4A 4PJJA 4A4EA 3QSUA 1W4SA 3OW2P 2DL8A 4L6V5 1UUEA 2V1QA 1M1GA 4Y28E 3V8LA 4N4HA 4M7AF 2DRKA 4J9HA 2K3BA 4WTOB 2W0ZA 3HPWA 3EG0A 4JUVA 4C5IA 4O6JA 4OMPA 4DBRA 3F70A 5KYXB 2EQMA 4N0AA 2CZ7B 3CCMQ 3OSSC 3HFOA 2OJ2A 4FYWB 1YFNA 1MUZA 4MZMA 1YCYA 3THKA 2GBQA 2KY9A 2X35A 3VS3A 1RI9A 2L2PA 3OYNA 1TH7A 4M7AC 2RMOA 1N8RU 1QCOA 1MNDA 2HNIA 4E7JA 1E7OA 5FRNA 2M9UA 3M58A 3CPWP 2HDAA 3UWNA 1UGSB 2QEXA 3OYMA 2DE0X 3C0CA 3CCUA 3VUZA 2LMJA 3OYDA 1VQ6T 1UHCA 4JJCA 1K9MR 2QTVA 2PVOB 4QVCA 2LT1A 3SHWA 1BIBA 3UA6A 2O31A 3JSCA 1S72Q 1BCOA 3CQTA 3VRYA 4XU1A 1TUGB 2GTJA 1OV3A 1H3HA 3OYAA 3CCEA 3MEVA 3C12A 3TSZA 1X2QA 2F5TX 2JS0A 4ORZA 2FO0A 1K9MU 4E7KA 1QVFA 3OB9A 5IAYA 2F69A 4OMOA 2SEMA 2BE7D 1WJRA 4OGEA 2DZ9A 3EGDB 2NUPA 5EC7A 2DXTA 4N0AC 2CP7A 3CCRQ 4M7DA 4M75G 2R57A 4XQ3A 4N4IA 2G3RA 3EG2A 4PK4A 1YITT 3A8LB 2VXFA 2VC8A 1U06A 5GMKj 2E6ZA 3CCRA 4M75C 3ER0A 1YJNT 1WHGA 1YN8A 2RPNA 3CPFA 5GMKh 4XTUA 1M1KU 3JCMJ 3G71A 1ZUYA 1K0XA 4M75D 5CKHA 2QDYB 3OYYA 3H8ZA 1U3OA 3SWNB 4XU2A 2E3IA 1SPKA 3CCRT 2CP5A 5FWBA 4F7UE 4BDZA 2MI6A 1N6AA 1CKAA 5FU6B 3CCEQ 2DFUA 1SSFA 2LCCA 3E9GA 4HCBA 2EQJA 2QA4A 2DLPA 2ENMA 2H3EB 2DJZA 2IVWA 1XNIA 1WNLA 3JB9F 2YSQA 2LT4A 1G3TA 2RI2A 2RJEA 2FEIA 1W2BS 4WF2A 1VQOA 3URGA 1NYFA 2EGAA 4LDXA 1PNJA 2ZGWA 3A98A 5ECAA 1YI2T 2BUDA 4LDVA 2C06A 4N4GA 4F17A 4Q5WA 4L59A 1AWXA 2VWFA 2CSQA 2YT6A 1NJIC 3OYCA 2KNBB 1K8AC 1TWBA 2COWA 2AHJB 4L5GA 2E70A 3CC2Q 2FZKB 3EG3A 1NM7A 2ROTA 1VQ4T 5DY9A 5HK3A 2RK2A 2JM8A 4IUUA 3CC4A 4BY6B 4E7SA 1YWOA 1JEGA 2CDTA 3G6EA 3PMTA 4PKCC 2K2MA 5GJWB 3RDVA 3MKDA 2QA4T 1Y7XA 2JMAA 4IUQA 4MMLA 1RACB 2QG9B 4FSSA 4LXCA 4Y92A 4JZ3A 3VYHB 1YI2Q 4ZGDB 1FYNA 3D7SB 3CEYA 1EZZB 1PWTA 5LJ5f 4AT1B 2K3YA 2YLBA 1VQOT 3HFNA 2P84A 1GL5A 1VQ4Q 2EPDA 1QWEA 1VOMA 4OMLA 2CREA 2FPEA 4QT7A 1AT1B 4EMGA 3QDFA 1KQSA 2PUOB 4J9CA 2QAZA 5KYWA 7AT1B 3VS6A 1WHHA 3X26B 1Z9QA 5GAOr 3OYGA 3A8GB 2GFUA 1TSFA 5KCHA 1WYXA 2CP3A 4J6XA 3L2WA 3L2RA 1XOVA 1VQOQ 2JZ2A 3AHUA 5M9OA 2KEAA 1NZ9A 3HP9A 3I55A 2YWWA 4BI4A 1IB8A 5GAN2 4JS4A 2AKKA 4HCCA 3M57A 1N8RR 2YRCA 2X4WA 2VKNA 2HQHA 4PJMA 1VQKT 5GANg 1X6BA 2HKNA 3A8HB 1AHJB 3A8OB 3NGPA 3IQLA 1FMWA 2PQWA 2KE9A 1Q7YR 2OTLA 1Q82C 2JNGA 3N5BB 1PG5B 2K4YA 1KIKA 2DILA 3EFOB 5I2SA 1PCXA 3VYGA 2X9HA 2VGMA 2CGHA 1K73R 2EJ9A 2QEXT 4M7AB 1WHMA 2EJFA 3EFOA 4RTZA 3JCMd 4YTLA 3CCQQ 2WSCE 1PSEA 1BYMA 3OSVA 2DK3A 5IXFA 1GRIA 2CP2A 2OI3A 4K11A 1I8FA 4PNOA 1M1KC 1BI0A 8AT1B 3H9NA 4CC3A 4JRIA 3JV3A 4BY6C 1RADB 4R55A 2MOXA 5CIUA 1RAEB 2EKOA 3QZ9B 4PFOA 1D0XA 1C0MA 4HT8A 4IUPA 3ME9A 1U1SA 1WHJA 2CUBA 1IGQA 2HKQB 1I07A 2K7AA 2L3PA 3VS2A 1YITQ 5KYUA 4HA8A 4QVDA 1NJIR 4M77C 3EH2A 3QYGB 1Q81R 3GOXA 5FLXE 4XAXB 4M77F 1ZQ1A 2RHZA 5GAN6 1F1BB 1Y71A 3MP8A 5HK0A 2E3HA 3QJ6A 1MNEA 3PIOA 1B34A 3EGXB 4FW2A 1UDLA 2ROLA 1IHWA 5D6YA 5J3BA 1QP2A 2P4TA 2DXCA 4LDWA 4F04B 2YDLA 1N8RC 1UB4A 2MAMA 3QYHB 2A08A 3CC7Q 3RR6A 4AFQC 4M77B 4ELZC 1HYOA 4ZTFA 1Z9ZA 3MEAA 4FYVB 1R8OB 4J9DA 4JZ4A 4MZTA 3TU4K 4FT4A 1WFWA 5IT9E 4QQGA 1JRIA 4C8QG 4BE2A 3M54A 1G5VA 1Y96B 3CMEA 1WGSA 4PFPA 4PJNA 3M4GA 1NG2A 2X51A 2QDLA 3S3OA 3MHXA 1BKBA 5CKBA 4M78G 1ABOA 1W1FA 4XTYA 4EIKA 1C1AA 4EMKC 3J81E 4KUDK 1JXMA 2BZXA 4B6MA 3QIIA 2R58A 4GLKA 3RMQA 1YWPA 1PKSA 1YJ9A 4A53A 4C92A 4DBHA 4LNPA 3JCMc 1AZEA 5D6XA 3RNJA 1PKTA 2DVJA 2RK1A 2J6OA 3LX7A 1WLPB 4M7AA 2HD0A 1Q86U 1VQ8T 1M3CA 1VQLT 2O9SA 1BB9A 2RQUA 4Z89A 1YIJA 2KVQG 3UF4A 1PC0A 1YIJQ 4KGXB 2DXBA 2CSIA 2XIDA 4PJOA 2EGEA 2HSEB 3L2QA 4OMNA 2LQ8A 1KSWA 4J9FA 1JQQA 2I2LA 2D1XA 4BE1A 3G1JA 3PGGA 1YJWT 4EPCA 2F1LA 2V26A 3P8DA 3OS2A 5CCAA 4KT0E 3OMGA 1YJ9T 3LLRA 1W2BP 5CQYA 1ZX6A 1VQ7A 3G6EQ 2AIRB 3BDUA 5KYYA 5LL6S 2PVDB 2GGRA 3CC4T 2WSFE 2VB6A 4PLLA 4C0GA 2QQRA 2JS2A 1M90U 3UA7A 1VQ4A 3OMCA 1O75A 2DL3A 1E6HA 3CCST 3JCMf 3PVQA 4AFUC 5LJ5e 2JMCA 5GMKi 4C92C 3BE3A 2LP5A 1YI2A 1VQKA 2KROA 1KD1R 3VV0A 5KCOA 1N27A 2K5FA 4M7DC 3KXTA 2F2XA 5FU7B 4IKFA 1VQ5A 3VS0A 2ED0A 5GAOp 2NUTB 3T9NA 1I1JA 3CC4Q 2P0PA 1WQ7A 4M4ZA 2FRYA 3QWYA 1WDXA 4CRIA 1X6GA 4J7IA 1UGVA 1X43A 1LNXA 2RM4A 1RAHB 4QQ6A 5GAN3 1Y96A 4AG1C 1ZSZC 2QQ9A 5KYNA 3NTKA 5KH6A 2YXYA 2A28A 3X24B 1KG1A 3REAB 1QVGP 2A3LA 1YJNA 3JCMV 4PJLA 3LWHA 2DPPB 3HTRA 3CPWS 1H3ZA 4PLIA 3CC2A 3RBBB 2DA9A 1R77A 2JXBA 1Q81U 3G7ZA 2CP0A 1M2VA 1M2OA 3H0HA 4X9CA 4J6YA 1KQSP 2CUDA 2MCNA 3VS5A 1NPPA 2ATCB 1FX7A 1YP5A 4OB0B 2LDMA 4DBFA 3EAEA 3X25B 4E6RA 3MJXA 1AEYA 4C92E 3O8VA 3HL8A 4XU0A 1G2BA 2RB6A 2OTJQ 4LDYA 4JLGA 1AWOA 2E5KA 1PSFA 4KH1B 4ESRA 3U23A 2K5LA 3PNWC 4ZGEB 2EYZA 2YLCA 4FT2A 3GNFB 2O01E 1RLPC 4A4HA 5CKFA 4FYYB 4BB7A 1VIFA 1UE9A 3S6WA 4PJOD 3I5RA 2CS7A 4D8DA 4DBQA 4EMKA 1VQ8A 1SSHA 1BCMA 3REBB 3V8KA 5A0LA 3ZFJA 5CKDA 2K79A 2J7IA 2CH4A 3CCJA 2MPXC 2CZ0B 4LUDA 2ZAEA 2NUPB 2DNUA 2QGFB 4IIOA 1WX6A 2XDPA 2MF2A 3M0SA 4M7DB 5CQXA 1OX9A 4KUIA 2NWMA 2FZGB 2K5IA 1NEGA 1AOJA 2KI7A 1VQLA 2HBPA 1M8MA 4NL2A 2RO0A 1M8VA 1LJOA 2FB7A 1MV3A 4XTWA 2V1RA 2RJDA 1IGUA 1R0BG 2BZYA 2A36A 3VRZA 4RG8A 3L2VA 1UJ0A 2DL5A 5GAOl 4E2FB 2XDBA 1UGQB 3H6ZA 3X20B 3JCMW 1VQ9Q 2YUNA 5GAN8 3OYFA 3LWIA 3JCMX 2LNVA 2X4YA 2XD0A 1QKXA 3GNGA 2JUFA 4C8QE 2RQTA 1GCPA 3CMAT 4F7UA 4FCYA 2VGNA 2DD4A 1G3SA 2B8AA 2XG8D 4JLIA 1YJ9Q 4RTWA 4CC2A 6AT1B 2MWPA 4RUGA 3QUIA 2P4RA 4J5YA 2EFIA 2HQEA 1VQ5Q 3VS7A 3LGLA 1VIEA 5GAMd 1UFFA 2O9VA 1QQJA 3E19A 4LUEA 3M59A 3CPWA 4PJOE 2K6DA 2RQVA 1G83A 2LRQA 2L89A 3FEOA 3RKWA 4GLMA 2EAYA 2RF0A 3PT9A 3CMAQ 2W10A 4OGCA 3GLXA 3H0FA 2ESWA 4DEXA 5LJ3g 4C0ZA 2JT4A 4ZNXA 4X1VA 4WCIA 3HHTB 1HSQA 1M5Q1 1X75C 3MEWA 2J06A 1RUWA 2FPFA 1OULA 4JDSA 1JJ2S 2NLUA 1M3AA 1OU8A
chains in the Genus database with same CATH topology
4KRTA 1ARKA 2SRCA 1GFDA 1CKBA 2CUBA 1M30A 1I07A 2K7AA 2EYYA 3I9QA 2L3PA 3NHNA 4HVVA 2JTEA 4J9IA 3VS2A 3M0PA 2KGTA 4AFSC 1OOTA 1WA7A 1H8KA 1U5SA 1K1ZA 1SEMA 4RTXA 2FPDA 5IXBA 2MIOA 1KJWA 1Y57A 2KR3A 1OPLA 3M0TA 2RNAA 1X27A 1CSKA 2D8JA 2YUPA 2DRMA 2EVRA 1FMKA 3ULRB 3H0IA 1MV0B 1TUCA 1UDLA 2ROLA 2X3XD 1V1CA 2EGCA 1GCQC 3EGUA 1YNZA 4OMMA 2YDLA 2L3QA 2A08A 2J05A 3H41A 4J9BA 4AFQC 1W6XA 3M0RA 1Z9ZA 2K9GA 4J9DA 1NLOC 4JZ4A 3NMZC 1UG1A 1RLQC 1WFWA 2LJ1A 1YCSB 2NUZA 2O88A 1SRMA 2L0AA 1ZLMA 4LE9A 4Z8AA 1ZUKA 2IIMA 2CH4W 2JW4A 2KXDA 1NG2A 1OPKA 1WXTA 1N5ZA 2QDLA 2BTTA 1K9AA 2F2WA 1JXOA 1AWJA 2DL4A 4JPBW 2ABLA 1ABOA 1W1FA 4OMQA 4EIKA 2DL8A 1UUEA 2C0OA 2V1QA 1JXMA 2BZXA 1BBZA 1GBRA 1YWPA 2DRKA 4J9HA 2K3BA 4J9EA 1PKSA 2W0ZA 3EG0A 2H8HA 3I5SA 4LNPA 2GTOA 1WI7A 1I0CA 1AZEA 3VS4A 4OMPA 3RNJA 2CT3A 1PKTA 1X2KA 1QWFA 2DVJA 5FWCA 2J6OA 2AZSA 1WLPB 2OJ2A 3R6NA 3GBQA 1M3CA 2O9SA 1JO8A 2LNHB 1BB9A 2RQUA 1MUZA 2AKLA 4Z89A 3UF4A 2B86A 3VS1A 1QKWA 3KFVA 2BZ8A 2C0IA 1A0NB 1T0HA 3LH5A 2CSIA 1AVZC 3THKA 2DM1A 2EGEA 2GBQA 4OMNA 1KSWA 2DL7A 4J9FA 3VS3A 1RI9A 2ECZA 1JQQA 2L2PA 2D1XA 2DBMA 5IHIA 1WXUA 2RMOA 1Y0MA 2EBPA 1AD5A 1E7OA 1NLPC 2OAWA 2PNIA 2HDAA 3EHRA 1ZX6A 1IO6A 2DE0X 3C0CA 4D8KA 2LMJA 1UHCA 4JJCA 2GGRA 3SHWA 2DMOA 2JS2A 1HJDA 3UA6A 3UA7A 2O31A 2HSPA 1W70A 3CQTA 2DL3A 1E6HA 2LJ0A 3VRYA 2D0NA 2KBTA 3ZL7C 3PVQA 2GTJA 4AFUC 1OV3A 1H3HA 1PRMC 2JMCA 2LP5A 2G6FX 4RTUA 4JJBA 2J6FA 1X2QA 3TSZA 2KROA 5IHKA 4ORZA 2JS0A 3M0UA 2HCKA 2FO0A 5L23A 1HD3A 2KYBA 2LCSA 1UECA 4OMOA 2KRNA 2SEMA 2F2XA 1E6GA 3VS0A 2ED0A 1I1JA 4M4ZA 2FRYA 5EC7A 4RTTA 3QWYA 1WDXA 2F2VA 1X6GA 2L3SA 5I22A 1UGVA 5IH2A 2GQIA 3EG2A 1X43A 1ZBJA 2DBKA 2FRWA 1U06A 1AZGB 1T3SA 4AG1C 1JU5C 2RQRA 1LCKA 2I0NA 4HCKA 2LQWA 1YN8A 2M0YA 4Z88A 2RPNA 2A28A 2RQWA 5IHNA 3REAB 4J9GA 2EQIA 1ZUYA 1K0XA 2HEQA 2PZ1A 1U3OA 1ABQA 2LQNA 1SPKA 2EW3A 3RBBB 5FWBA 1GCQA 4F16A 1CKAA 2DA9A 2JXBA 1GFCA 3M0QA 3H0HA 1NYGA 1TG0A 2DLPA 4HVWA 2ENMA 2X3WD 1K4US 2CUDA 2MCNA 3EHQA 3SEMA 1QCFA 3TVTA 3VS5A 1YP5A 2DJQA 2D8HA 1QLYA 2YSQA 1WXBA 1SRLA 5HCKA 3TSWA 4E6RA 2FEIA 1K0SA 2GNCA 1NYFA 4GBQA 2EGAA 1AEYA 1PNJA 3A98A 5ECAA 4F14A 1M3BA 4F17A 1G2BA 3QWXX 4HVUA 4LN2A 1AWXA 2VWFA 1ZSGA 2CSQA 2E5KA 2YT6A 1AWOA 1H92A 2KNBB 4A63B 1B3QA 4RTVA 1T3LA 4ESRA 1SHGA 3U23A 1VYUA 3EG3A 1NM7A 1PRLC 2ROTA 4DEYA 2PTKA 4IIMA 2JM8A 2EYZA 1RLPC 1T0JA 1YWOA 1JEGA 1EFNA 2CDTA 1UE9A 2K2MA 3I5RA 5GJWB 4D8DA 2JMAA 1SSHA 2O2OA 3REBB 4FSSA 1BK2A 2DF6A 4Y92A 4JZ3A 2EKHA 2K79A 1FYNA 2LJ3A 3UATA 2J7IA 2CH4A 4LUDA 1UTIA 1PWTA 2DNUA 2JM9A 2M51A 2C0TA 4IIOA 2AZVA 1GL5A 1WX6A 2EPDA 1QWEA 3I35A 2LX7A 2VVKA 3M0SA 4JJDA 4OMLA 2CREA 2FPEA 4QT7A 2NWMA 1B07A 1NEGA 4J9CA 1AOJA 3PE0A 2KT1A 1M8MA 3VS6A 1Z9QA 4RTYA 2YUQA 4AG2C 1MV3A 2V1RA 1M27C 3EG1A 2RN8A 1WYXA 2KT8A 1X69A 2BZYA 5GJVB 2CT4A 1XOVA 2A36A 3VRZA 2ED1A 1UJ0A 1SHFA 2AK5A 2DL5A 1S1NA 2KEAA 1OEBA 1NEBA 1K76A 2DYBA 2AKKA 1VA7A 2EYXA 3NPFA 3O5ZA 2YUNA 4AFZC 1QKXA 4R0KA 2VKNA 1TUDA 1X6BA 2RQTA 1GCPA 3NGPA 3IQLA 2KE9A 1ZUUA 1BU1A 2LZ6B 4HXJA 4CC4B 1KIKA 4RTWA 4CC2A 2DILA 4RUGA 2YUOA 2P4RA 4CC7A 3VS7A 2XMFA 1J3TA 1UFFA 2O9VA 2KRMA 2DX1A 4LUEA 2EYWA 5I11A 2FG0A 1UHFA 4RTZA 5FW9A 2K6DA 2RQVA 1G83A 1PHTA 2A37A 4GLMA 2RF0A 1GBQA 3FJ5A 2KXCA 1WIEA 2W10A 2KYMA 3PVLA 3H0FA 5IXFA 1GRIA 2ESWA 4DEXA 2OI3A 4K11A 2JT4A 4ZNXA 4X1VA 4WCIA 1VYTA 2HBWA 4CC3A 2J6KA 1HSQA 3JV3A 1KFZA 2KRSA 2MOXA 2J06A 1RUWA 2FPFA 1UJYA 1VYVA 1AWWA 1M3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KRT A;  1ARK A;  2SRC A;  1GFD A;  1CKB A;  2CUB A;  1M30 A;  1I07 A;  2K7A A;  2EYY A;  3I9Q A;  2L3P A;  3NHN A;  4HVV A;  2JTE A;  4J9I A;  3VS2 A;  3M0P A;  2KGT A;  4AFS C;  1OOT A;  1WA7 A;  1H8K A;  1U5S A;  1K1Z A;  1SEM A;  4RTX A;  2FPD A;  5IXB A;  2MIO A;  1KJW A;  1Y57 A;  2KR3 A;  1OPL A;  3M0T A;  2RNA A;  1X27 A;  1CSK A;  2D8J A;  2YUP A;  2DRM A;  2EVR A;  1FMK A;  3ULR B;  3H0I A;  1MV0 B;  1TUC A;  1UDL A;  2ROL A;  2X3X D;  1V1C A;  2EGC A;  1GCQ C;  3EGU A;  1YNZ A;  4OMM A;  2YDL A;  2L3Q A;  2A08 A;  2J05 A;  3H41 A;  4J9B A;  4AFQ C;  1W6X A;  3M0R A;  1Z9Z A;  2K9G A;  4J9D A;  1NLO C;  4JZ4 A;  3NMZ C;  1UG1 A;  1RLQ C;  1WFW A;  2LJ1 A;  1YCS B;  2NUZ A;  2O88 A;  1SRM A;  2L0A A;  1ZLM A;  4LE9 A;  4Z8A A;  1ZUK A;  2IIM A;  2CH4 W;  2JW4 A;  2KXD A;  1NG2 A;  1OPK A;  1WXT A;  1N5Z A;  2QDL A;  2BTT A;  1K9A A;  2F2W A;  1JXO A;  1AWJ A;  2DL4 A;  4JPB W;  2ABL A;  1ABO A;  1W1F A;  4OMQ A;  4EIK A;  2DL8 A;  1UUE A;  2C0O A;  2V1Q A;  1JXM A;  2BZX A;  1BBZ A;  1GBR A;  1YWP A;  2DRK A;  4J9H A;  2K3B A;  4J9E A;  1PKS A;  2W0Z A;  3EG0 A;  2H8H A;  3I5S A;  4LNP A;  2GTO A;  1WI7 A;  1I0C A;  1AZE A;  3VS4 A;  4OMP A;  3RNJ A;  2CT3 A;  1PKT A;  1X2K A;  1QWF A;  2DVJ A;  5FWC A;  2J6O A;  2AZS A;  1WLP B;  2OJ2 A;  3R6N A;  3GBQ A;  1M3C A;  2O9S A;  1JO8 A;  2LNH B;  1BB9 A;  2RQU A;  1MUZ A;  2AKL A;  4Z89 A;  3UF4 A;  2B86 A;  3VS1 A;  1QKW A;  3KFV A;  2BZ8 A;  2C0I A;  1A0N B;  1T0H A;  3LH5 A;  2CSI A;  1AVZ C;  3THK A;  2DM1 A;  2EGE A;  2GBQ A;  4OMN A;  1KSW A;  2DL7 A;  4J9F A;  3VS3 A;  1RI9 A;  2ECZ A;  1JQQ A;  2L2P A;  2D1X A;  2DBM A;  5IHI A;  1WXU A;  2RMO A;  1Y0M A;  2EBP A;  1AD5 A;  1E7O A;  1NLP C;  2OAW A;  2PNI A;  2HDA A;  3EHR A;  1ZX6 A;  1IO6 A;  2DE0 X;  3C0C A;  4D8K A;  2LMJ A;  1UHC A;  4JJC A;  2GGR A;  3SHW A;  2DMO A;  2JS2 A;  1HJD A;  3UA6 A;  3UA7 A;  2O31 A;  2HSP A;  1W70 A;  3CQT A;  2DL3 A;  1E6H A;  2LJ0 A;  3VRY A;  2D0N A;  2KBT A;  3ZL7 C;  3PVQ A;  2GTJ A;  4AFU C;  1OV3 A;  1H3H A;  1PRM C;  2JMC A;  2LP5 A;  2G6F X;  4RTU A;  4JJB A;  2J6F A;  1X2Q A;  3TSZ A;  2KRO A;  5IHK A;  4ORZ A;  2JS0 A;  3M0U A;  2HCK A;  2FO0 A;  5L23 A;  1HD3 A;  2KYB A;  2LCS A;  1UEC A;  4OMO A;  2KRN A;  2SEM A;  2F2X A;  1E6G A;  3VS0 A;  2ED0 A;  1I1J A;  4M4Z A;  2FRY A;  5EC7 A;  4RTT A;  3QWY A;  1WDX A;  2F2V A;  1X6G A;  2L3S A;  5I22 A;  1UGV A;  5IH2 A;  2GQI A;  3EG2 A;  1X43 A;  1ZBJ A;  2DBK A;  2FRW A;  1U06 A;  1AZG B;  1T3S A;  4AG1 C;  1JU5 C;  2RQR A;  1LCK A;  2I0N A;  4HCK A;  2LQW A;  1YN8 A;  2M0Y A;  4Z88 A;  2RPN A;  2A28 A;  2RQW A;  5IHN A;  3REA B;  4J9G A;  2EQI A;  1ZUY A;  1K0X A;  2HEQ A;  2PZ1 A;  1U3O A;  1ABQ A;  2LQN A;  1SPK A;  2EW3 A;  3RBB B;  5FWB A;  1GCQ A;  4F16 A;  1CKA A;  2DA9 A;  2JXB A;  1GFC A;  3M0Q A;  3H0H A;  1NYG A;  1TG0 A;  2DLP A;  4HVW A;  2ENM A;  2X3W D;  1K4U S;  2CUD A;  2MCN A;  3EHQ A;  3SEM A;  1QCF A;  3TVT A;  3VS5 A;  1YP5 A;  2DJQ A;  2D8H A;  1QLY A;  2YSQ A;  1WXB A;  1SRL A;  5HCK A;  3TSW A;  4E6R A;  2FEI A;  1K0S A;  2GNC A;  1NYF A;  4GBQ A;  2EGA A;  1AEY A;  1PNJ A;  3A98 A;  5ECA A;  4F14 A;  1M3B A;  4F17 A;  1G2B A;  3QWX X;  4HVU A;  4LN2 A;  1AWX A;  2VWF A;  1ZSG A;  2CSQ A;  2E5K A;  2YT6 A;  1AWO A;  1H92 A;  2KNB B;  4A63 B;  1B3Q A;  4RTV A;  1T3L A;  4ESR A;  1SHG A;  3U23 A;  1VYU A;  3EG3 A;  1NM7 A;  1PRL C;  2ROT A;  4DEY A;  2PTK A;  4IIM A;  2JM8 A;  2EYZ A;  1RLP C;  1T0J A;  1YWO A;  1JEG A;  1EFN A;  2CDT A;  1UE9 A;  2K2M A;  3I5R A;  5GJW B;  4D8D A;  2JMA A;  1SSH A;  2O2O A;  3REB B;  4FSS A;  1BK2 A;  2DF6 A;  4Y92 A;  4JZ3 A;  2EKH A;  2K79 A;  1FYN A;  2LJ3 A;  3UAT A;  2J7I A;  2CH4 A;  4LUD A;  1UTI A;  1PWT A;  2DNU A;  2JM9 A;  2M51 A;  2C0T A;  4IIO A;  2AZV A;  1GL5 A;  1WX6 A;  2EPD A;  1QWE A;  3I35 A;  2LX7 A;  2VVK A;  3M0S A;  4JJD A;  4OML A;  2CRE A;  2FPE A;  4QT7 A;  2NWM A;  1B07 A;  1NEG A;  4J9C A;  1AOJ A;  3PE0 A;  2KT1 A;  1M8M A;  3VS6 A;  1Z9Q A;  4RTY A;  2YUQ A;  4AG2 C;  1MV3 A;  2V1R A;  1M27 C;  3EG1 A;  2RN8 A;  1WYX A;  2KT8 A;  1X69 A;  2BZY A;  5GJV B;  2CT4 A;  1XOV A;  2A36 A;  3VRZ A;  2ED1 A;  1UJ0 A;  1SHF A;  2AK5 A;  2DL5 A;  1S1N A;  2KEA A;  1OEB A;  1NEB A;  1K76 A;  2DYB A;  2AKK A;  1VA7 A;  2EYX A;  3NPF A;  3O5Z A;  2YUN A;  4AFZ C;  1QKX A;  4R0K A;  2VKN A;  1TUD A;  1X6B A;  2RQT A;  1GCP A;  3NGP A;  3IQL A;  2KE9 A;  1ZUU A;  1BU1 A;  2LZ6 B;  4HXJ A;  4CC4 B;  1KIK A;  4RTW A;  4CC2 A;  2DIL A;  4RUG A;  2YUO A;  2P4R A;  4CC7 A;  3VS7 A;  2XMF A;  1J3T A;  1UFF A;  2O9V A;  2KRM A;  2DX1 A;  4LUE A;  2EYW A;  5I11 A;  2FG0 A;  1UHF A;  4RTZ A;  5FW9 A;  2K6D A;  2RQV A;  1G83 A;  1PHT A;  2A37 A;  4GLM A;  2RF0 A;  1GBQ A;  3FJ5 A;  2KXC A;  1WIE A;  2W10 A;  2KYM A;  3PVL A;  3H0F A;  5IXF A;  1GRI A;  2ESW A;  4DEX A;  2OI3 A;  4K11 A;  2JT4 A;  4ZNX A;  4X1V A;  4WCI A;  1VYT A;  2HBW A;  4CC3 A;  2J6K A;  1HSQ A;  3JV3 A;  1KFZ A;  2KRS A;  2MOX A;  2J06 A;  1RUW A;  2FPF A;  1UJY A;  1VYV A;  1AWW A;  1M3A A; 
#chains in the Genus database with same CATH topology
 1TOV A;  1JBM A;  4C92 D;  3JB9 H;  2SRC A;  1GFD A;  1CKB A;  1DJ7 B;  3PFS A;  3DLM A;  1VQM T;  3JAM E;  2BE9 B;  1M30 A;  2E10 A;  1M1K R;  1B7T A;  1K73 U;  3I9Q A;  2QTX A;  4XU3 A;  2JTE A;  5LJ3 h;  2GFA A;  4AFS C;  3M5A A;  2RA2 A;  1JB0 E;  3HSB A;  1U5S A;  1NBE B;  3R6O A;  1SEM A;  2CYZ B;  4RTX A;  2DIG A;  2DEQ A;  1KC8 U;  2Y4Y A;  1Q7Y U;  5FRM A;  3CCU T;  5GMK e;  1OPL A;  4M75 A;  3GF5 A;  3QBY A;  1X27 A;  1RAA B;  1CSK A;  2D8J A;  3I56 A;  2DIQ A;  4RCC A;  1D1B A;  1VQM Q;  5GMK l;  3RKX A;  2EVR A;  1FMK A;  5CK9 A;  2GCX A;  3H0I A;  4C92 F;  2M02 A;  1Q82 R;  1VQN T;  1TUC A;  2EGC A;  3EGU A;  3QZ5 B;  5GAN 4;  4OMM A;  3SFM A;  2ZPB B;  2RHY A;  2J05 A;  2IPO B;  3QPH A;  3H41 A;  3FJP A;  4J9B A;  2K9G A;  3JB9 I;  4F7U G;  2NUZ A;  2O88 A;  2L0A A;  4OB3 B;  4RG2 A;  1ZLM A;  3JCM e;  4M7D D;  1WJQ A;  2OTJ T;  4LE9 A;  1FXX A;  4X9D A;  2ZPG B;  3M55 A;  2IIM A;  2CH4 W;  3CCL T;  1N5Z A;  4KUL A;  1K9A A;  4C8Q C;  3CCS A;  1AWJ A;  5D7U A;  4JPB W;  2FVU A;  5GAN f;  2JVV A;  3HRT A;  2C0O A;  1RAF B;  3PTA A;  2A7Y A;  4C8Q D;  5FU7 C;  1BBZ A;  1K8A U;  4J9E A;  2RJF A;  3CBO A;  1KD1 U;  2H8H A;  3I5S A;  2LX9 A;  1WI7 A;  1I0C A;  2YRV A;  4M78 E;  1X2K A;  1QWF A;  2KMT A;  2AZS A;  5CVI A;  1LPL A;  1ZA2 B;  3GBQ A;  1JO8 A;  2LNH B;  1IRX A;  2AKL A;  3M9Q A;  4J6W A;  2ZPH B;  4C5G A;  2DVE A;  2QI2 A;  1YBY A;  3VS1 A;  1QKW A;  4C5H A;  2BZ8 A;  3PIP A;  1A0N B;  4M78 B;  3M4Y A;  1AVZ C;  3OYH A;  2DM1 A;  3CXC A;  4QQD A;  2ECZ A;  1HXD A;  1ZSZ A;  1NPR A;  1V76 A;  2DBM A;  5IHI A;  4HT9 A;  1WXU A;  1WHL A;  5A2Q E;  3WXM B;  5KYX A;  1Y0M A;  4XTV A;  2EBP A;  1AD5 A;  5KYW B;  3CBM A;  1NLP C;  2OAW A;  2PNI A;  3EHR A;  1QVF S;  3OYB A;  1IO6 A;  1RI0 A;  3MET A;  4NOY A;  1N9S A;  4D8K A;  4M77 A;  5I21 A;  4ME7 A;  2M1H A;  2QXF A;  2DMO A;  1VQ7 T;  1VUB A;  1W70 A;  1Q86 R;  3J7A F;  4M78 C;  3VJP A;  1O9S A;  2LJ0 A;  2KBT A;  4M7D E;  3V8J A;  4FU6 A;  3JCM b;  4ZTJ A;  2PUK B;  3ZBD A;  2GF7 A;  1KHI A;  1Y07 A;  1PRM C;  2VXE A;  2G6F X;  4RTU A;  1VQM A;  4NL3 A;  3OBW A;  3I56 T;  3RUX A;  2KYB A;  1UEC A;  2FHD A;  3I55 T;  2LC4 A;  3G4S A;  2RHI A;  2KRN A;  3MO8 A;  1TU0 B;  3VUB A;  3NTH A;  2QK0 A;  4M77 G;  3MP6 A;  4M78 F;  1SG5 A;  4A4G A;  2RI5 A;  2F2V A;  2L3S A;  2V8I A;  1S72 T;  3TRE A;  5IH2 A;  5DM7 R;  2PU9 B;  1SF9 A;  2DBK A;  1AZG B;  3BDL A;  3WVD B;  2RQR A;  4HCK A;  5HY6 A;  4BD3 A;  2O4X B;  2M0Y A;  2RQW A;  4PJO G;  3I55 Q;  3OW2 A;  3GPL A;  1XTD A;  4J9G A;  4BI8 B;  2HEQ A;  3QDR B;  2PZ1 A;  4C0D B;  1ABQ A;  5GAM f;  1D1C A;  3P8H A;  4MMK A;  2EW3 A;  1GCQ A;  2QAS A;  3L2Z A;  4F16 A;  2CP6 A;  2QQA A;  2DET A;  5AT1 B;  4E47 A;  2E41 A;  3TCJ A;  1M90 C;  4EDU A;  4RKU E;  3JRZ A;  1TG0 A;  4HVW A;  1IRE B;  2K3X A;  2X3W D;  3RES A;  1K4U S;  3A5Z B;  3EHQ A;  3SEM A;  2XDD A;  1MMN A;  5EG2 A;  2VUB A;  2DJQ A;  1WXB A;  1SRL A;  3OW2 S;  3GIB A;  3S3N A;  2EQK A;  4HCZ A;  4B9W A;  3FIF A;  3EFS A;  1K0S A;  2RD1 A;  4C0F A;  4F14 A;  1M3B A;  4J8O A;  2EYQ A;  1VQN Q;  3CCE T;  4A63 B;  1B3Q A;  2RJC A;  3OA6 A;  1T3L A;  5LJ5 d;  3CME Q;  3L42 A;  2WSE E;  4IIM A;  5A0D A;  4XTX A;  5GAN d;  1QW1 A;  4OB2 B;  4C5E A;  1VQ9 A;  1T0J A;  1VQ6 A;  5GAN e;  2H3J A;  1EFN A;  4M7A G;  3EH1 A;  2E65 A;  5CAI A;  3DB4 A;  2XHC A;  4OMF B;  2O2O A;  1EIF A;  1X01 A;  2LJ3 A;  3PMI A;  3UAT A;  3E9F A;  1QMC A;  1UTI A;  4ANJ A;  2JM9 A;  2M51 A;  3M56 A;  2D9T A;  3MEU A;  4EMH A;  1VQP A;  3JCM Q;  4JJD A;  2JTF A;  2L5Q A;  1B07 A;  2KDS A;  3PE0 A;  2DEU A;  5FU6 C;  5DLO A;  1M1F A;  2QA4 Q;  3DB3 A;  4M77 D;  3QO3 A;  4RTY A;  3HRU A;  5C6S A;  2YUQ A;  3UT1 A;  4AG2 C;  3UPU A;  1M27 C;  1G3W A;  4PJO F;  2A0F B;  3RMS A;  1S72 A;  1PD0 A;  5HKC A;  2ED1 A;  3MPU B;  1SHF A;  2AK5 A;  1NEB A;  2O4X A;  3KBG A;  2DYB A;  1VA7 A;  2EYX A;  4AFZ C;  3O5Z A;  4OB1 B;  2XKO C;  3OYL A;  4R0K A;  4RMO A;  3RER A;  1XJW B;  1WQW A;  3CCQ T;  2V8J A;  4J7F A;  1Q86 C;  2EQU A;  2XU8 A;  1ZUU A;  2XI9 A;  1BU1 A;  2LZ6 B;  2QYZ A;  4CC4 B;  3ASK A;  3OQ5 A;  4II1 A;  2DXU A;  2XMF A;  1J3T A;  4NS5 A;  2KRM A;  4PFZ A;  2PVG B;  1BIA A;  1VQ7 Q;  2DD5 A;  1RAB B;  3C94 A;  1VQK Q;  1PHT A;  1D3B A;  3QHS A;  3FLG A;  2A37 A;  2KXC A;  4E7L A;  1WIE A;  3E2U A;  2KYM A;  4IUV A;  5KYU B;  5CR2 A;  2E64 A;  2IG0 A;  1RAI B;  1VYT A;  4MDW A;  2HBW A;  2J6K A;  3BFM A;  3V7C A;  1FMV A;  1QVG S;  2KRS A;  3QG1 A;  2E12 A;  2JOY A;  1AWW A;  4HXJ A;  2QEX Q;  3J80 E;  4M7A D;  2ZZD A;  2D6F A;  1QVF P;  2V8K A;  4B9X A;  1NE8 A;  5GMK m;  1SKU B;  4LDU A;  2M16 A;  2CZ6 B;  1QP3 A;  3NHN A;  4HVV A;  4J9I A;  5KE2 A;  4V2S A;  3M0P A;  2KGT A;  1OOT A;  1WA7 A;  3P8B B;  1WJS A;  3OYJ A;  5IXB A;  2BKD N;  3CC7 T;  2QQS A;  4E7Z A;  2KAF A;  3M0T A;  2RNA A;  5LJ5 j;  3S3M A;  1YHQ Q;  3SDZ A;  4DOV A;  4JRQ A;  1G3Y A;  2E4H A;  4E7I A;  3ULR B;  3RKY A;  1FWZ A;  2RH2 A;  1UGP B;  2X4J A;  1QVP A;  2GQV A;  4F7U B;  1MV0 B;  2DAQ A;  2X3X D;  2QQB A;  3JCM g;  4M78 D;  1Q95 G;  1YNZ A;  4E7H A;  2L3Q A;  1V29 B;  4RCB A;  3SWN C;  3CXC S;  1H64 1;  3JB9 J;  3QKJ A;  3NMZ C;  1HK9 A;  1UG1 A;  1RLQ C;  1WZO A;  4JRK A;  3SD4 A;  4A4K A;  3QJY A;  4ATO A;  5D6W A;  4LD6 A;  1YHQ T;  1GXI E;  4F7U F;  4Z8A A;  5DLQ E;  3FDR A;  5A0G A;  1W2B A;  2JW4 A;  4BE0 A;  1YJW A;  3CME T;  1WXT A;  3CC2 T;  2K2V A;  2OTJ A;  3CCV T;  4C8Q B;  2F2W A;  1JXO A;  1ZSZ B;  2AT1 B;  1VQL Q;  1JJ2 P;  2ABL A;  3OYE A;  4JRP A;  2Y4X A;  4OMQ A;  4M75 F;  1KQ2 A;  1YIJ T;  4JJN K;  3BY7 A;  2L8D A;  1GBR A;  3LGF A;  4A54 A;  1N9R A;  1KQ1 A;  1K9M C;  4CI0 C;  1WHK A;  2GTO A;  4M7D G;  3VS4 A;  3MP1 A;  2CT3 A;  3OYI A;  2D0Q B;  5GAM h;  3EGX A;  5FWC A;  2COY A;  3CCV Q;  3OS0 A;  1JJ2 A;  3R6N A;  5L8R E;  4KH0 B;  5GAN 5;  3SB2 A;  5FRO A;  1Q82 U;  1BI3 A;  5KYY B;  2B86 A;  3KFV A;  2C0I A;  1T0H A;  3LH5 A;  4X34 A;  4O5V A;  1LVK A;  3EG9 A;  5J39 A;  3CC7 A;  4OF1 A;  4M77 E;  2YHT A;  2DL7 A;  2FZC B;  1C6V X;  2VAS A;  4KBM B;  2K57 A;  2RHU A;  3A1P A;  3L1A A;  1EX4 A;  2CZ1 B;  1TTH B;  3FB9 A;  1I81 A;  3OS5 A;  1TS9 A;  5GAN h;  2HQX A;  4M75 B;  4BUG A;  3CXC P;  4R56 A;  2P0K A;  4QW2 A;  1HJD A;  2HSP A;  4KGV B;  5J26 A;  5LJ3 d;  3UDC A;  2RHX A;  5GAN j;  2OTL T;  4VUB A;  2FL7 A;  2D0N A;  3ZL7 C;  1YJW Q;  1YIT A;  2MMP A;  5LJ3 e;  2DYI A;  2JN0 A;  4C92 B;  2MYS A;  4JJB A;  2J6F A;  1K8A R;  5IHK A;  3M0U A;  2HCK A;  5L23 A;  4MZP A;  3DKM A;  3TQ7 P;  1HD3 A;  2LCS A;  2Y90 A;  3G6E T;  2R5A A;  3HRS A;  4MDX A;  3OY9 A;  1E6G A;  1VQP Q;  3GP8 A;  2RI3 A;  1OZ2 A;  2KSS A;  3MCA B;  2HL3 A;  5IN1 A;  2X4X A;  3X28 B;  4RTT A;  4ZGJ B;  1OI1 A;  3V7S A;  5I22 A;  2OTL Q;  2GQI A;  1ZBJ A;  2E5Q A;  2JJ9 A;  1M2V B;  4BDY A;  2FRW A;  3JCM h;  5C0M A;  1T3S A;  1Q81 C;  1JU5 C;  3LH0 A;  3AT1 B;  2VV5 A;  3JCM P;  4D6W A;  1OX8 A;  1LCK A;  2I0N A;  2LQW A;  4Z88 A;  1X6O A;  5IHN A;  2HMA A;  3CCU Q;  3JB9 D;  2JTM A;  2EQI A;  1IZ6 A;  1VQP T;  4DA4 A;  3CCV A;  2LQN A;  4Z02 A;  4FM4 B;  5LJ3 f;  1MMA A;  3INZ A;  1LOJ A;  2DER A;  3CMA A;  3A8M B;  1U8R A;  3ZEH A;  4ELY C;  4C8Q A;  1GFC A;  3M0Q A;  3CCQ A;  4PL6 A;  1NYG A;  2NUT A;  3L2U A;  1D09 B;  1QCF A;  3TVT A;  2NYS A;  2D8H A;  3OYK A;  1QLY A;  5HCK A;  4FIB A;  2DZC A;  4M78 A;  3TSW A;  5I2M A;  2GNC A;  4GBQ A;  1WPY A;  2E1H A;  3QWX X;  4HVU A;  4P5N A;  4LN2 A;  4C0D C;  1H92 A;  1ZSG A;  4XK8 E;  4RTV A;  3OS1 A;  2KK4 A;  1SHG A;  4XTZ A;  4TVR A;  1YHQ A;  1VYU A;  1PRL C;  4DEY A;  2PTK A;  1ZA1 B;  4QVZ A;  1IHV A;  5KE3 A;  2E6N A;  2ZPE B;  1QCN A;  2OX7 A;  1BI2 A;  3JB9 G;  3Q1J A;  1IXD A;  1BK2 A;  2DF6 A;  2EKH A;  2CKK A;  1KK7 A;  1KC8 C;  2R5M A;  2VYT A;  5GAM g;  2DO3 A;  4PJO B;  2DTI A;  2C0T A;  3CCM T;  2AZV A;  1OU9 A;  3G71 T;  3I35 A;  1OYX A;  5GAO m;  2LX7 A;  2VVK A;  1M90 R;  1ZHI A;  2WAC A;  4OP0 A;  4FW1 A;  1VQ9 T;  2BIV A;  5GAO n;  3VKI A;  4J83 A;  1TXQ A;  2KT1 A;  1MGQ A;  2DTO A;  1KQS S;  4AMC A;  1KHC A;  1RL2 A;  3FC3 A;  1U1T A;  3CCL A;  3EG1 A;  2RN8 A;  2KT8 A;  1ZBX A;  3V7R A;  1ACM B;  1R0C B;  1X69 A;  2EIF A;  5GJV B;  2CT4 A;  2Z0W A;  5GAO q;  1VQ8 Q;  4EMK B;  3CD6 Q;  4FSX A;  1VQ5 T;  4M7D F;  1UGR B;  3G71 Q;  1S1N A;  1OEB A;  2FYK A;  4ZN3 A;  1K76 A;  1I5L A;  1KD1 C;  3EG9 B;  4C92 G;  3NPF A;  1VQ6 Q;  2HL5 C;  1NJI U;  2L3R A;  1TUD A;  3LW5 E;  2COZ A;  3M53 A;  8ATC B;  3CCJ T;  4DOW A;  3NTI A;  3WVE B;  3HKS A;  1D0Y A;  2YUO A;  4HKE A;  5GAM e;  3I56 Q;  3CD6 T;  4CC7 A;  3TEE A;  2DKG A;  2HAX A;  3C4S A;  2DX1 A;  2DTH A;  2EYW A;  2ZPF B;  4GY5 A;  5I11 A;  2FG0 A;  1UHF A;  5FW9 A;  1OQK A;  1D0Z A;  4FYX B;  3CCS Q;  2F5K A;  1GBQ A;  4IUR A;  3FJ5 A;  3CCJ Q;  2LVM A;  1B34 B;  1PM3 A;  5LJ5 h;  3PVL A;  1M9S A;  1VQN A;  3NFC A;  4A4F A;  1RAG B;  1QVG A;  3QXE B;  5CO7 A;  1M4Z A;  2EJG A;  2MK5 A;  4BI3 A;  1D1A A;  1KFZ A;  2LTO A;  1UEB A;  1YJN Q;  4IUT A;  1UJY A;  1VYV A;  4ZN1 A;  1KC8 R;  4KRT A;  4KGZ B;  1ARK A;  3E1S A;  2QGG A;  2YRD A;  1P92 A;  4BAC A;  9ATC B;  2XIC A;  3LYI A;  2EYY A;  1MMG A;  2KQW A;  4C8Q F;  2ZPI B;  3BW1 A;  4FL6 A;  1H8K A;  2ZCF B;  1K1Z A;  2FPD A;  3EFR A;  2MIO A;  1XQH A;  1KJW A;  1Y57 A;  2KR3 A;  1G8X A;  1I4K 1;  3G4S T;  2XK0 A;  4LD9 K;  3CD6 A;  1OZ3 A;  2YUP A;  2DRM A;  5LJ5 g;  3CCM A;  2LCL A;  2MWO A;  5CKE A;  3CCL Q;  3OBY A;  1D3B B;  3FRN A;  1V1C A;  1GCQ C;  5AYF A;  4OVA A;  4Y91 A;  2M0O A;  4JS5 A;  1MMD A;  5LJ3 j;  1I5O B;  3EGD A;  1W6X A;  3C95 A;  3M0R A;  4UC4 A;  1PD1 A;  1NLO C;  3G4S Q;  5GAM j;  4M7A E;  5GAN 7;  2LJ1 A;  1YCS B;  1BI1 A;  3KUF A;  4DQ2 A;  1SRM A;  3DLL A;  3RIR A;  2P0Q A;  1K73 C;  4M75 E;  4QKU A;  4PJO C;  3VU3 C;  2EWN A;  1ZUK A;  3CBP A;  2KXD A;  1MHN A;  1OPK A;  2BTT A;  2LQK A;  2HZY A;  3SWN A;  2OAU A;  1Q7Y C;  2DL4 A;  4PJJ A;  4A4E A;  3QSU A;  1W4S A;  3OW2 P;  2DL8 A;  4L6V 5;  1UUE A;  2V1Q A;  1M1G A;  4Y28 E;  3V8L A;  4N4H A;  4M7A F;  2DRK A;  4J9H A;  2K3B A;  4WTO B;  2W0Z A;  3HPW A;  3EG0 A;  4JUV A;  4C5I A;  4O6J A;  4OMP A;  4DBR A;  3F70 A;  5KYX B;  2EQM A;  4N0A A;  2CZ7 B;  3CCM Q;  3OSS C;  3HFO A;  2OJ2 A;  4FYW B;  1YFN A;  1MUZ A;  4MZM A;  1YCY A;  3THK A;  2GBQ A;  2KY9 A;  2X35 A;  3VS3 A;  1RI9 A;  2L2P A;  3OYN A;  1TH7 A;  4M7A C;  2RMO A;  1N8R U;  1QCO A;  1MND A;  2HNI A;  4E7J A;  1E7O A;  5FRN A;  2M9U A;  3M58 A;  3CPW P;  2HDA A;  3UWN A;  1UGS B;  2QEX A;  3OYM A;  2DE0 X;  3C0C A;  3CCU A;  3VUZ A;  2LMJ A;  3OYD A;  1VQ6 T;  1UHC A;  4JJC A;  1K9M R;  2QTV A;  2PVO B;  4QVC A;  2LT1 A;  3SHW A;  1BIB A;  3UA6 A;  2O31 A;  3JSC A;  1S72 Q;  1BCO A;  3CQT A;  3VRY A;  4XU1 A;  1TUG B;  2GTJ A;  1OV3 A;  1H3H A;  3OYA A;  3CCE A;  3MEV A;  3C12 A;  3TSZ A;  1X2Q A;  2F5T X;  2JS0 A;  4ORZ A;  2FO0 A;  1K9M U;  4E7K A;  1QVF A;  3OB9 A;  5IAY A;  2F69 A;  4OMO A;  2SEM A;  2BE7 D;  1WJR A;  4OGE A;  2DZ9 A;  3EGD B;  2NUP A;  5EC7 A;  2DXT A;  4N0A C;  2CP7 A;  3CCR Q;  4M7D A;  4M75 G;  2R57 A;  4XQ3 A;  4N4I A;  2G3R A;  3EG2 A;  4PK4 A;  1YIT T;  3A8L B;  2VXF A;  2VC8 A;  1U06 A;  5GMK j;  2E6Z A;  3CCR A;  4M75 C;  3ER0 A;  1YJN T;  1WHG A;  1YN8 A;  2RPN A;  3CPF A;  5GMK h;  4XTU A;  1M1K U;  3JCM J;  3G71 A;  1ZUY A;  1K0X A;  4M75 D;  5CKH A;  2QDY B;  3OYY A;  3H8Z A;  1U3O A;  3SWN B;  4XU2 A;  2E3I A;  1SPK A;  3CCR T;  2CP5 A;  5FWB A;  4F7U E;  4BDZ A;  2MI6 A;  1N6A A;  1CKA A;  5FU6 B;  3CCE Q;  2DFU A;  1SSF A;  2LCC A;  3E9G A;  4HCB A;  2EQJ A;  2QA4 A;  2DLP A;  2ENM A;  2H3E B;  2DJZ A;  2IVW A;  1XNI A;  1WNL A;  3JB9 F;  2YSQ A;  2LT4 A;  1G3T A;  2RI2 A;  2RJE A;  2FEI A;  1W2B S;  4WF2 A;  1VQO A;  3URG A;  1NYF A;  2EGA A;  4LDX A;  1PNJ A;  2ZGW A;  3A98 A;  5ECA A;  1YI2 T;  2BUD A;  4LDV A;  2C06 A;  4N4G A;  4F17 A;  4Q5W A;  4L59 A;  1AWX A;  2VWF A;  2CSQ A;  2YT6 A;  1NJI C;  3OYC A;  2KNB B;  1K8A C;  1TWB A;  2COW A;  2AHJ B;  4L5G A;  2E70 A;  3CC2 Q;  2FZK B;  3EG3 A;  1NM7 A;  2ROT A;  1VQ4 T;  5DY9 A;  5HK3 A;  2RK2 A;  2JM8 A;  4IUU A;  3CC4 A;  4BY6 B;  4E7S A;  1YWO A;  1JEG A;  2CDT A;  3G6E A;  3PMT A;  4PKC C;  2K2M A;  5GJW B;  3RDV A;  3MKD A;  2QA4 T;  1Y7X A;  2JMA A;  4IUQ A;  4MML A;  1RAC B;  2QG9 B;  4FSS A;  4LXC A;  4Y92 A;  4JZ3 A;  3VYH B;  1YI2 Q;  4ZGD B;  1FYN A;  3D7S B;  3CEY A;  1EZZ B;  1PWT A;  5LJ5 f;  4AT1 B;  2K3Y A;  2YLB A;  1VQO T;  3HFN A;  2P84 A;  1GL5 A;  1VQ4 Q;  2EPD A;  1QWE A;  1VOM A;  4OML A;  2CRE A;  2FPE A;  4QT7 A;  1AT1 B;  4EMG A;  3QDF A;  1KQS A;  2PUO B;  4J9C A;  2QAZ A;  5KYW A;  7AT1 B;  3VS6 A;  1WHH A;  3X26 B;  1Z9Q A;  5GAO r;  3OYG A;  3A8G B;  2GFU A;  1TSF A;  5KCH A;  1WYX A;  2CP3 A;  4J6X A;  3L2W A;  3L2R A;  1XOV A;  1VQO Q;  2JZ2 A;  3AHU A;  5M9O A;  2KEA A;  1NZ9 A;  3HP9 A;  3I55 A;  2YWW A;  4BI4 A;  1IB8 A;  5GAN 2;  4JS4 A;  2AKK A;  4HCC A;  3M57 A;  1N8R R;  2YRC A;  2X4W A;  2VKN A;  2HQH A;  4PJM A;  1VQK T;  5GAN g;  1X6B A;  2HKN A;  3A8H B;  1AHJ B;  3A8O B;  3NGP A;  3IQL A;  1FMW A;  2PQW A;  2KE9 A;  1Q7Y R;  2OTL A;  1Q82 C;  2JNG A;  3N5B B;  1PG5 B;  2K4Y A;  1KIK A;  2DIL A;  3EFO B;  5I2S A;  1PCX A;  3VYG A;  2X9H A;  2VGM A;  2CGH A;  1K73 R;  2EJ9 A;  2QEX T;  4M7A B;  1WHM A;  2EJF A;  3EFO A;  4RTZ A;  3JCM d;  4YTL A;  3CCQ Q;  2WSC E;  1PSE A;  1BYM A;  3OSV A;  2DK3 A;  5IXF A;  1GRI A;  2CP2 A;  2OI3 A;  4K11 A;  1I8F A;  4PNO A;  1M1K C;  1BI0 A;  8AT1 B;  3H9N A;  4CC3 A;  4JRI A;  3JV3 A;  4BY6 C;  1RAD B;  4R55 A;  2MOX A;  5CIU A;  1RAE B;  2EKO A;  3QZ9 B;  4PFO A;  1D0X A;  1C0M A;  4HT8 A;  4IUP A;  3ME9 A;  1U1S A;  1WHJ A;  2CUB A;  1IGQ A;  2HKQ B;  1I07 A;  2K7A A;  2L3P A;  3VS2 A;  1YIT Q;  5KYU A;  4HA8 A;  4QVD A;  1NJI R;  4M77 C;  3EH2 A;  3QYG B;  1Q81 R;  3GOX A;  5FLX E;  4XAX B;  4M77 F;  1ZQ1 A;  2RHZ A;  5GAN 6;  1F1B B;  1Y71 A;  3MP8 A;  5HK0 A;  2E3H A;  3QJ6 A;  1MNE A;  3PIO A;  1B34 A;  3EGX B;  4FW2 A;  1UDL A;  2ROL A;  1IHW A;  5D6Y A;  5J3B A;  1QP2 A;  2P4T A;  2DXC A;  4LDW A;  4F04 B;  2YDL A;  1N8R C;  1UB4 A;  2MAM A;  3QYH B;  2A08 A;  3CC7 Q;  3RR6 A;  4AFQ C;  4M77 B;  4ELZ C;  1HYO A;  4ZTF A;  1Z9Z A;  3MEA A;  4FYV B;  1R8O B;  4J9D A;  4JZ4 A;  4MZT A;  3TU4 K;  4FT4 A;  1WFW A;  5IT9 E;  4QQG A;  1JRI A;  4C8Q G;  4BE2 A;  3M54 A;  1G5V A;  1Y96 B;  3CME A;  1WGS A;  4PFP A;  4PJN A;  3M4G A;  1NG2 A;  2X51 A;  2QDL A;  3S3O A;  3MHX A;  1BKB A;  5CKB A;  4M78 G;  1ABO A;  1W1F A;  4XTY A;  4EIK A;  1C1A A;  4EMK C;  3J81 E;  4KUD K;  1JXM A;  2BZX A;  4B6M A;  3QII A;  2R58 A;  4GLK A;  3RMQ A;  1YWP A;  1PKS A;  1YJ9 A;  4A53 A;  4C92 A;  4DBH A;  4LNP A;  3JCM c;  1AZE A;  5D6X A;  3RNJ A;  1PKT A;  2DVJ A;  2RK1 A;  2J6O A;  3LX7 A;  1WLP B;  4M7A A;  2HD0 A;  1Q86 U;  1VQ8 T;  1M3C A;  1VQL T;  2O9S A;  1BB9 A;  2RQU A;  4Z89 A;  1YIJ A;  2KVQ G;  3UF4 A;  1PC0 A;  1YIJ Q;  4KGX B;  2DXB A;  2CSI A;  2XID A;  4PJO A;  2EGE A;  2HSE B;  3L2Q A;  4OMN A;  2LQ8 A;  1KSW A;  4J9F A;  1JQQ A;  2I2L A;  2D1X A;  4BE1 A;  3G1J A;  3PGG A;  1YJW T;  4EPC A;  2F1L A;  2V26 A;  3P8D A;  3OS2 A;  5CCA A;  4KT0 E;  3OMG A;  1YJ9 T;  3LLR A;  1W2B P;  5CQY A;  1ZX6 A;  1VQ7 A;  3G6E Q;  2AIR B;  3BDU A;  5KYY A;  5LL6 S;  2PVD B;  2GGR A;  3CC4 T;  2WSF E;  2VB6 A;  4PLL A;  4C0G A;  2QQR A;  2JS2 A;  1M90 U;  3UA7 A;  1VQ4 A;  3OMC A;  1O75 A;  2DL3 A;  1E6H A;  3CCS T;  3JCM f;  3PVQ A;  4AFU C;  5LJ5 e;  2JMC A;  5GMK i;  4C92 C;  3BE3 A;  2LP5 A;  1YI2 A;  1VQK A;  2KRO A;  1KD1 R;  3VV0 A;  5KCO A;  1N27 A;  2K5F A;  4M7D C;  3KXT A;  2F2X A;  5FU7 B;  4IKF A;  1VQ5 A;  3VS0 A;  2ED0 A;  5GAO p;  2NUT B;  3T9N A;  1I1J A;  3CC4 Q;  2P0P A;  1WQ7 A;  4M4Z A;  2FRY A;  3QWY A;  1WDX A;  4CRI A;  1X6G A;  4J7I A;  1UGV A;  1X43 A;  1LNX A;  2RM4 A;  1RAH B;  4QQ6 A;  5GAN 3;  1Y96 A;  4AG1 C;  1ZSZ C;  2QQ9 A;  5KYN A;  3NTK A;  5KH6 A;  2YXY A;  2A28 A;  3X24 B;  1KG1 A;  3REA B;  1QVG P;  2A3L A;  1YJN A;  3JCM V;  4PJL A;  3LWH A;  2DPP B;  3HTR A;  3CPW S;  1H3Z A;  4PLI A;  3CC2 A;  3RBB B;  2DA9 A;  1R77 A;  2JXB A;  1Q81 U;  3G7Z A;  2CP0 A;  1M2V A;  1M2O A;  3H0H A;  4X9C A;  4J6Y A;  1KQS P;  2CUD A;  2MCN A;  3VS5 A;  1NPP A;  2ATC B;  1FX7 A;  1YP5 A;  4OB0 B;  2LDM A;  4DBF A;  3EAE A;  3X25 B;  4E6R A;  3MJX A;  1AEY A;  4C92 E;  3O8V A;  3HL8 A;  4XU0 A;  1G2B A;  2RB6 A;  2OTJ Q;  4LDY A;  4JLG A;  1AWO A;  2E5K A;  1PSF A;  4KH1 B;  4ESR A;  3U23 A;  2K5L A;  3PNW C;  4ZGE B;  2EYZ A;  2YLC A;  4FT2 A;  3GNF B;  2O01 E;  1RLP C;  4A4H A;  5CKF A;  4FYY B;  4BB7 A;  1VIF A;  1UE9 A;  3S6W A;  4PJO D;  3I5R A;  2CS7 A;  4D8D A;  4DBQ A;  4EMK A;  1VQ8 A;  1SSH A;  1BCM A;  3REB B;  3V8K A;  5A0L A;  3ZFJ A;  5CKD A;  2K79 A;  2J7I A;  2CH4 A;  3CCJ A;  2MPX C;  2CZ0 B;  4LUD A;  2ZAE A;  2NUP B;  2DNU A;  2QGF B;  4IIO A;  1WX6 A;  2XDP A;  2MF2 A;  3M0S A;  4M7D B;  5CQX A;  1OX9 A;  4KUI A;  2NWM A;  2FZG B;  2K5I A;  1NEG A;  1AOJ A;  2KI7 A;  1VQL A;  2HBP A;  1M8M A;  4NL2 A;  2RO0 A;  1M8V A;  1LJO A;  2FB7 A;  1MV3 A;  4XTW A;  2V1R A;  2RJD A;  1IGU A;  1R0B G;  2BZY A;  2A36 A;  3VRZ A;  4RG8 A;  3L2V A;  1UJ0 A;  2DL5 A;  5GAO l;  4E2F B;  2XDB A;  1UGQ B;  3H6Z A;  3X20 B;  3JCM W;  1VQ9 Q;  2YUN A;  5GAN 8;  3OYF A;  3LWI A;  3JCM X;  2LNV A;  2X4Y A;  2XD0 A;  1QKX A;  3GNG A;  2JUF A;  4C8Q E;  2RQT A;  1GCP A;  3CMA T;  4F7U A;  4FCY A;  2VGN A;  2DD4 A;  1G3S A;  2B8A A;  2XG8 D;  4JLI A;  1YJ9 Q;  4RTW A;  4CC2 A;  6AT1 B;  2MWP A;  4RUG A;  3QUI A;  2P4R A;  4J5Y A;  2EFI A;  2HQE A;  1VQ5 Q;  3VS7 A;  3LGL A;  1VIE A;  5GAM d;  1UFF A;  2O9V A;  1QQJ A;  3E19 A;  4LUE A;  3M59 A;  3CPW A;  4PJO E;  2K6D A;  2RQV A;  1G83 A;  2LRQ A;  2L89 A;  3FEO A;  3RKW A;  4GLM A;  2EAY A;  2RF0 A;  3PT9 A;  3CMA Q;  2W10 A;  4OGC A;  3GLX A;  3H0F A;  2ESW A;  4DEX A;  5LJ3 g;  4C0Z A;  2JT4 A;  4ZNX A;  4X1V A;  4WCI A;  3HHT B;  1HSQ A;  1M5Q 1;  1X75 C;  3MEW A;  2J06 A;  1RUW A;  2FPF A;  1OUL A;  4JDS A;  1JJ2 S;  2NLU A;  1M3A A;  1OU8 A; 
#chains in the Genus database with same CATH homology
 4KRT A;  1ARK A;  2SRC A;  1GFD A;  1CKB A;  2CUB A;  1M30 A;  1I07 A;  2K7A A;  2EYY A;  3I9Q A;  2L3P A;  3NHN A;  4HVV A;  2JTE A;  4J9I A;  3VS2 A;  3M0P A;  2KGT A;  4AFS C;  1OOT A;  1WA7 A;  1H8K A;  1U5S A;  1K1Z A;  1SEM A;  4RTX A;  2FPD A;  5IXB A;  2MIO A;  1KJW A;  1Y57 A;  2KR3 A;  1OPL A;  3M0T A;  2RNA A;  1X27 A;  1CSK A;  2D8J A;  2YUP A;  2DRM A;  2EVR A;  1FMK A;  3ULR B;  3H0I A;  1MV0 B;  1TUC A;  1UDL A;  2ROL A;  2X3X D;  1V1C A;  2EGC A;  1GCQ C;  3EGU A;  1YNZ A;  4OMM A;  2YDL A;  2L3Q A;  2A08 A;  2J05 A;  3H41 A;  4J9B A;  4AFQ C;  1W6X A;  3M0R A;  1Z9Z A;  2K9G A;  4J9D A;  1NLO C;  4JZ4 A;  3NMZ C;  1UG1 A;  1RLQ C;  1WFW A;  2LJ1 A;  1YCS B;  2NUZ A;  2O88 A;  1SRM A;  2L0A A;  1ZLM A;  4LE9 A;  4Z8A A;  1ZUK A;  2IIM A;  2CH4 W;  2JW4 A;  2KXD A;  1NG2 A;  1OPK A;  1WXT A;  1N5Z A;  2QDL A;  2BTT A;  1K9A A;  2F2W A;  1JXO A;  1AWJ A;  2DL4 A;  4JPB W;  2ABL A;  1ABO A;  1W1F A;  4OMQ A;  4EIK A;  2DL8 A;  1UUE A;  2C0O A;  2V1Q A;  1JXM A;  2BZX A;  1BBZ A;  1GBR A;  1YWP A;  2DRK A;  4J9H A;  2K3B A;  4J9E A;  1PKS A;  2W0Z A;  3EG0 A;  2H8H A;  3I5S A;  4LNP A;  2GTO A;  1WI7 A;  1I0C A;  1AZE A;  3VS4 A;  4OMP A;  3RNJ A;  2CT3 A;  1PKT A;  1X2K A;  1QWF A;  2DVJ A;  5FWC A;  2J6O A;  2AZS A;  1WLP B;  2OJ2 A;  3R6N A;  3GBQ A;  1M3C A;  2O9S A;  1JO8 A;  2LNH B;  1BB9 A;  2RQU A;  1MUZ A;  2AKL A;  4Z89 A;  3UF4 A;  2B86 A;  3VS1 A;  1QKW A;  3KFV A;  2BZ8 A;  2C0I A;  1A0N B;  1T0H A;  3LH5 A;  2CSI A;  1AVZ C;  3THK A;  2DM1 A;  2EGE A;  2GBQ A;  4OMN A;  1KSW A;  2DL7 A;  4J9F A;  3VS3 A;  1RI9 A;  2ECZ A;  1JQQ A;  2L2P A;  2D1X A;  2DBM A;  5IHI A;  1WXU A;  2RMO A;  1Y0M A;  2EBP A;  1AD5 A;  1E7O A;  1NLP C;  2OAW A;  2PNI A;  2HDA A;  3EHR A;  1ZX6 A;  1IO6 A;  2DE0 X;  3C0C A;  4D8K A;  2LMJ A;  1UHC A;  4JJC A;  2GGR A;  3SHW A;  2DMO A;  2JS2 A;  1HJD A;  3UA6 A;  3UA7 A;  2O31 A;  2HSP A;  1W70 A;  3CQT A;  2DL3 A;  1E6H A;  2LJ0 A;  3VRY A;  2D0N A;  2KBT A;  3ZL7 C;  3PVQ A;  2GTJ A;  4AFU C;  1OV3 A;  1H3H A;  1PRM C;  2JMC A;  2LP5 A;  2G6F X;  4RTU A;  4JJB A;  2J6F A;  1X2Q A;  3TSZ A;  2KRO A;  5IHK A;  4ORZ A;  2JS0 A;  3M0U A;  2HCK A;  2FO0 A;  5L23 A;  1HD3 A;  2KYB A;  2LCS A;  1UEC A;  4OMO A;  2KRN A;  2SEM A;  2F2X A;  1E6G A;  3VS0 A;  2ED0 A;  1I1J A;  4M4Z A;  2FRY A;  5EC7 A;  4RTT A;  3QWY A;  1WDX A;  2F2V A;  1X6G A;  2L3S A;  5I22 A;  1UGV A;  5IH2 A;  2GQI A;  3EG2 A;  1X43 A;  1ZBJ A;  2DBK A;  2FRW A;  1U06 A;  1AZG B;  1T3S A;  4AG1 C;  1JU5 C;  2RQR A;  1LCK A;  2I0N A;  4HCK A;  2LQW A;  1YN8 A;  2M0Y A;  4Z88 A;  2RPN A;  2A28 A;  2RQW A;  5IHN A;  3REA B;  4J9G A;  2EQI A;  1ZUY A;  1K0X A;  2HEQ A;  2PZ1 A;  1U3O A;  1ABQ A;  2LQN A;  1SPK A;  2EW3 A;  3RBB B;  5FWB A;  1GCQ A;  4F16 A;  1CKA A;  2DA9 A;  2JXB A;  1GFC A;  3M0Q A;  3H0H A;  1NYG A;  1TG0 A;  2DLP A;  4HVW A;  2ENM A;  2X3W D;  1K4U S;  2CUD A;  2MCN A;  3EHQ A;  3SEM A;  1QCF A;  3TVT A;  3VS5 A;  1YP5 A;  2DJQ A;  2D8H A;  1QLY A;  2YSQ A;  1WXB A;  1SRL A;  5HCK A;  3TSW A;  4E6R A;  2FEI A;  1K0S A;  2GNC A;  1NYF A;  4GBQ A;  2EGA A;  1AEY A;  1PNJ A;  3A98 A;  5ECA A;  4F14 A;  1M3B A;  4F17 A;  1G2B A;  3QWX X;  4HVU A;  4LN2 A;  1AWX A;  2VWF A;  1ZSG A;  2CSQ A;  2E5K A;  2YT6 A;  1AWO A;  1H92 A;  2KNB B;  4A63 B;  1B3Q A;  4RTV A;  1T3L A;  4ESR A;  1SHG A;  3U23 A;  1VYU A;  3EG3 A;  1NM7 A;  1PRL C;  2ROT A;  4DEY A;  2PTK A;  4IIM A;  2JM8 A;  2EYZ A;  1RLP C;  1T0J A;  1YWO A;  1JEG A;  1EFN A;  2CDT A;  1UE9 A;  2K2M A;  3I5R A;  5GJW B;  4D8D A;  2JMA A;  1SSH A;  2O2O A;  3REB B;  4FSS A;  1BK2 A;  2DF6 A;  4Y92 A;  4JZ3 A;  2EKH A;  2K79 A;  1FYN A;  2LJ3 A;  3UAT A;  2J7I A;  2CH4 A;  4LUD A;  1UTI A;  1PWT A;  2DNU A;  2JM9 A;  2M51 A;  2C0T A;  4IIO A;  2AZV A;  1GL5 A;  1WX6 A;  2EPD A;  1QWE A;  3I35 A;  2LX7 A;  2VVK A;  3M0S A;  4JJD A;  4OML A;  2CRE A;  2FPE A;  4QT7 A;  2NWM A;  1B07 A;  1NEG A;  4J9C A;  1AOJ A;  3PE0 A;  2KT1 A;  1M8M A;  3VS6 A;  1Z9Q A;  4RTY A;  2YUQ A;  4AG2 C;  1MV3 A;  2V1R A;  1M27 C;  3EG1 A;  2RN8 A;  1WYX A;  2KT8 A;  1X69 A;  2BZY A;  5GJV B;  2CT4 A;  1XOV A;  2A36 A;  3VRZ A;  2ED1 A;  1UJ0 A;  1SHF A;  2AK5 A;  2DL5 A;  1S1N A;  2KEA A;  1OEB A;  1NEB A;  1K76 A;  2DYB A;  2AKK A;  1VA7 A;  2EYX A;  3NPF A;  3O5Z A;  2YUN A;  4AFZ C;  1QKX A;  4R0K A;  2VKN A;  1TUD A;  1X6B A;  2RQT A;  1GCP A;  3NGP A;  3IQL A;  2KE9 A;  1ZUU A;  1BU1 A;  2LZ6 B;  4HXJ A;  4CC4 B;  1KIK A;  4RTW A;  4CC2 A;  2DIL A;  4RUG A;  2YUO A;  2P4R A;  4CC7 A;  3VS7 A;  2XMF A;  1J3T A;  1UFF A;  2O9V A;  2KRM A;  2DX1 A;  4LUE A;  2EYW A;  5I11 A;  2FG0 A;  1UHF A;  4RTZ A;  5FW9 A;  2K6D A;  2RQV A;  1G83 A;  1PHT A;  2A37 A;  4GLM A;  2RF0 A;  1GBQ A;  3FJ5 A;  2KXC A;  1WIE A;  2W10 A;  2KYM A;  3PVL A;  3H0F A;  5IXF A;  1GRI A;  2ESW A;  4DEX A;  2OI3 A;  4K11 A;  2JT4 A;  4ZNX A;  4X1V A;  4WCI A;  1VYT A;  2HBW A;  4CC3 A;  2J6K A;  1HSQ A;  3JV3 A;  1KFZ A;  2KRS A;  2MOX A;  2J06 A;  1RUW A;  2FPF A;  1UJY A;  1VYV A;  1AWW A;  1M3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...