2FEIA

Solution structure of the second sh3 domain of human cms protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELELEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title Solution structure of the second SH3 domain of human CMS and a newly identified binding site at the C-terminus of c-Cbl
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2feiA00
1CKBA 2G6FX 2JW4A 3EG0A 4RTYA 1X69A 1AWJA 2DL8A 3EHQA 5GJWB 1SEMA 2FRWA 4QT7A 1AWWA 1BB9A 2GQIA 4F14A 2JMAA 2JS2A 4EIKA 3GBQA 4A63B 2HSPA 2EBPA 1EFNA 2RN8A 2EQIA 2JS0A 2KRMA 2MIOA 1GCQC 1WA7A 1WDXA 2CT4A 3RBBB 4ZNXA 3VS2A 1T3SA 1GFDA 1UG1A 1I07A 2C0TA 2F2WA 2KROA 1PKTA 4OMPA 2LJ0A 2BTTA 1FMKA 1SPKA 1RLQC 2GBQA 1M3AA 3EG3A 3M0QA 2ROTA 4OMMA 2BZ8A 1AVZC 2KBTA 3LH5A 2GNCA 2EPDA 3M0SA 2JXBA 4JZ4A 3NMZC 4J9EA 2EGAA 4RTZA 2LNHB 2FPFA 2V1QA 1SRLA 1ZLMA 1H8KA 2DE0X 2NWMA 1AD5A 1Y0MA 3EG2A 1GCPA 1AZGB 1U06A 2JM9A 2LMJA 2K7AA 4Z8AA 4D8DA 2X3WD 1PNJA 2EGCA 2CUBA 1KFZA 5IH2A 2KYMA 2CSIA 4AFUC 3QWYA 1B3QA 1PHTA 1SRMA 3UA6A 1ABQA 1VYUA 2EYWA 1UECA 2DVJA 1UGVA 3M0UA 4OMNA 1HSQA 2K6DA 2YUOA 2DL5A 4AFQC 2KRNA 1AZEA 1TUDA 3THKA 2OAWA 1KJWA 1QWFA 1X6GA 4R0KA 2F2VA 2LP5A 1K1ZA 1VYTA 3M0RA 2FPDA 4IIOA 2JMCA 4K11A 2HEQA 1YCSB 2ECZA 2VKNA 2SRCA 1W70A 2DLPA 5FWCA 2DM1A 2KRSA 1ZX6A 1GL5A 3H41A 4LUEA 1JU5C 2CH4A 4AFZC 2DL7A 4IIMA 4RTVA 1WXBA 1H3HA 2HCKA 2DYBA 1RI9A 4JZ3A 1E7OA 1ZSGA 3ZL7C 1CKAA 5I22A 3VS6A 1NYGA 1AEYA 1RLPC 2L3SA 3IQLA 2KT8A 2W0ZA 4ORZA 4E6RA 1GBRA 2CT3A 1X27A 1TUCA 2DF6A 4OMOA 2AZVA 2EW3A 1WLPB 2KEAA 1UJYA 1M8MA 1Z9ZA 4JPBW 1J3TA 2D8JA 2I0NA 2RQVA 1K0XA 2FG0A 2RNAA 2P4RA 3I9QA 1B07A 4CC7A 3PE0A 1AWOA 2DRKA 4OMQA 3TVTA 2H8HA 2AZSA 2JT4A 1BK2A 2OI3A 2LZ6B 5IXFA 1U5SA 5GJVB 1AOJA 3JV3A 5L23A 1X43A 2C0OA 1PKSA 2E5KA 2DJQA 3REAB 1TG0A 2AKLA 1PRLC 3I35A 1HD3A 2GTJA 1T0JA 2FO0A 3TSWA 1YP5A 1OOTA 1QKWA 1YNZA 2RPNA 2HDAA 4Z89A 2IIMA 1QCFA 4J9BA 3EGUA 1JO8A 1GCQA 1N5ZA 2C0IA 4ESRA 2GGRA 2J7IA 2YSQA 2J6KA 1FYNA 2OJ2A 5EC7A 5IHIA 2DL4A 2CH4W 2D1XA 2B86A 2W10A 3SEMA 2KXCA 2VVKA 1WFWA 2J06A 2O9SA 2EYXA 4J9IA 5IHNA 1Y57A 2ESWA 1OPLA 2L0AA 4J9HA 2CUDA 3A98A 2ED1A 5FW9A 5HCKA 2RF0A 2F2XA 1BBZA 2ENMA 2EYYA 2FEIA 2O88A 1M3BA 4HXJA 4CC2A 1ARKA 1UHFA 1Z9QA 3H0FA 3VS5A 1JQQA 3R6NA 1NYFA 1WI7A 3CQTA 3UATA 1UFFA 1T3LA 5ECAA 2VWFA 1K4US 3NHNA 4M4ZA 2A36A 4LUDA 1WIEA 4J9CA 4DEXA 1NG2A 1LCKA 1MV3A 2YUQA 2XMFA 3PVQA 2L3PA 1BU1A 1M3CA 1ZUKA 2K79A 1K76A 2EKHA 3EG1A 5I11A 1K0SA 1YN8A 2X3XD 2EYZA 2SEMA 1QWEA 1KSWA 2DRMA 2L3QA 2A28A 1YWOA 2CSQA 4DEYA 1UE9A 2MOXA 1IO6A 4J9DA 3U23A 2PZ1A 2DMOA 3NPFA 1ABOA 1MV0B 2RQTA 2YUPA 2RQWA 3RNJA 1YWPA 4HVVA 2YT6A 2KXDA 3KFVA 2KNBB 4KRTA 2KYBA 4RUGA 2YDLA 4AG1C 3M0PA 2KE9A 2AKKA 2HBWA 1A0NB 2J6OA 1M27C 2DA9A 1JXOA 1S1NA 2KGTA 4CC3A 1PRMC 4RTUA 3SHWA 1SSHA 1JEGA 2L2PA 5FWBA 4GLMA 1NLPC 1W1FA 4Y92A 2LX7A 2YUNA 2EGEA 2RMOA 2FPEA 4F16A 3VS0A 2RQUA 1X2QA 1UJ0A 4RTTA 3PVLA 2ED0A 2DL3A 2D8HA 2GTOA 1UUEA 1G2BA 4LNPA 4RTWA 4LE9A 1WXTA 4HCKA 1QLYA 4GBQA 1G83A 3M0TA 5IHKA 2O2OA 3H0IA 2RQRA 4AFSC 1KIKA 4HVWA 2V1RA 2A08A 2DNUA 4LN2A 3UF4A 1U3OA 4JJCA 2PTKA 1E6GA 1OPKA 4CC4B 3REBB 1NEBA 2M51A 2ROLA 1E6HA 3VRZA 4JJDA 2DBKA 3VS7A 2EVRA 4J9FA 2J05A 2BZYA 2J6FA 1NEGA 1SHGA 2O31A 3QWXX 1WXUA 2BZXA 2PNIA 1HJDA 5IXBA 1UHCA 1GRIA 3FJ5A 1X2KA 2D0NA 1ZUYA 2DBMA 1ZUUA 1SHFA 1V1CA 3VS4A 2K9GA 2MCNA 1PWTA 1I0CA 2ABLA 3VS3A 3H0HA 4X1VA 2K3BA 1JXMA 2DX1A 3I5SA 2FRYA 3ULRB 1VYVA 1AWXA 2KT1A 4F17A 1XOVA 1NM7A 2O9VA 3UA7A 1MUZA 1GBQA 2JTEA 2DILA 3TSZA 4JJBA 2LCSA 2CDTA 1CSKA 3VS1A 2LQWA 1W6XA 1NLOC 1UDLA 1OEBA 4J9GA 4Z88A 2A37A 2KR3A 2LJ1A 1OV3A 1UTIA 2AK5A 2CREA 1X6BA 4RTXA 4D8KA 2M0YA 4AG2C 2K2MA 1VA7A 3VRYA 4OMLA 2JM8A 1RUWA 2NUZA 3C0CA 4FSSA 3O5ZA 4WCIA 4HVUA 2LQNA 1GFCA 1I1JA 1WX6A 1WYXA 2LJ3A 3NGPA 1H92A 1ZBJA 1K9AA 2QDLA 1T0HA 3EHRA 1M30A 3I5RA 1QKXA
chains in the Genus database with same CATH superfamily
2ZAEA 1Q7YU 1BI1A 2G6FX 3EHQA 2AIRB 3C12A 1OU8A 4QT7A 4BI4A 1M1KR 5CKEA 2JS2A 4EIKA 3GBQA 3I56T 3CCQQ 1VQPA 2EBPA 3CC2Q 5GANh 2O01E 2FZKB 1PM3A 4OF1A 1QCOA 3EH2A 1F1BB 2L8DA 4C92A 5D6XA 3QJ6A 4PJOA 1WDXA 4FM4B 1XTDA 2LQ8A 4ELZC 3BFMA 5GMKm 3G71A 3PT9A 5CKDA 4HCZA 2OTJQ 2F2WA 4XU1A 2KROA 3HFNA 4M7AC 1EX4A 2QEXQ 1YIJQ 2YWWA 1M3AA 3CEYA 3EG3A 1RAIB 4R56A 3M0SA 2K3XA 2JXBA 3JCMX 3RMQA 2RHZA 2MPXC 2M02A 3HFOA 1EZZB 3CD6A 1D3BA 2D9TA 4KH1B 3CCSA 2DE0X 1U1TA 1AD5A 4PFPA 5FROA 4Z8AA 4D8DA 2X3WD 5GAN2 1YJNT 2EYQA 2CUBA 5IH2A 2RHYA 1HYOA 4AFUC 2RHUA 4C8QB 3A8HB 1ABQA 2FZGB 1K73R 2ZCFB 2DIQA 4QVCA 2QASA 1AZEA 3THKA 2QA4A 3CC2T 1O75A 2DTOA 4F7UB 4C8QF 4OGCA 1VQ6Q 1VQ5Q 2E6NA 2F2VA 2PUOB 2LP5A 1K1ZA 3M0RA 4QQGA 3LX7A 1G3YA 1KC8C 4K11A 3V7CA 4KT0E 3M58A 3R6OA 2DM1A 2OTJT 3OMGA 4WTOB 1GL5A 4C8QE 2DK3A 2FZCB 2QEXT 3PMIA 1VQLQ 2L89A 4M7AG 3CCVA 4RTVA 4N0AC 1KQSS 3QUIA 3OYKA 3CCMQ 4F7UE 4JZ3A 2JTMA 1ZSGA 3J81E 1VIEA 1IHVA 5C0MA 3WVEB 1ACMB 3CXCP 3G6EA 3CCLA 5CCAA 2G3RA 4KGVB 4XU0A 1TUCA 4ME7A 2EW3A 1WHHA 1WLPB 2ZPIB 4E7IA 3BDUA 1Z9ZA 4EMKC 1J3TA 2EQKA 2RQVA 1K0XA 2FG0A 2RNAA 1Q7YC 2P4RA 2VGNA 4CC7A 3PE0A 5A0GA 3HP9A 4QW2A 3CPWP 2PUKB 1ZSZC 5LJ5g 1G5VA 3C94A 2QAZA 3LW5E 1TS9A 1WQ7A 5A2QE 4M78B 1VQ5T 3FC3A 1VQ6T 1X43A 1I81A 1PKSA 5GMKe 3REAB 1PRLC 2GTJA 3OYBA 1T0JA 4L6V5 3NTHA 1BIBA 2CP5A 2K3YA 2RH2A 1VQLT 5D6YA 4J9BA 1QCFA 3EGUA 1C0MA 3RERA 3CCMT 1LNXA 4M75B 4M78E 2ZPFB 1VQ9A 4DBRA 4O6JA 2KXCA 2E6ZA 5GAMf 1WFWA 3E9GA 5HKCA 5LJ3e 3EGXA 2EYXA 4M75F 2QTVA 5IHNA 1UGPB 3A8LB 1Y57A 5KYUA 4FSXA 1G8XA 2CUDA 4PJNA 4E2FB 5HCKA 2JZ2A 1D09B 1OZ2A 4OGEA 1OYXA 5GAN5 4M77B 3ME9A 1BBZA 3SB2A 1PD1A 2EFIA 1D0ZA 1Y96B 4A54A 1AT1B 2EYYA 3P8BB 2FEIA 2O88A 3M4GA 4M75E 1SG5A 4CC2A 3AT1B 2XKOC 1JQQA 1NYFA 1MHNA 3UATA 1FWZA 1T3LA 1SF9A 5ECAA 3JB9H 2L3RA 3GLXA 1VQNQ 4OP0A 3RUXA 2A36A 2GQVA 2JUFA 4C5HA 4IUTA 2X4WA 4DEXA 1NG2A 1MV3A 2XMFA 3EGDB 4B9WA 4M77E 1M1KU 1BU1A 1K76A 2RHXA 3PNWC 4BI3A 1N8RU 3EG1A 2YLCA 3NTKA 1IGQA 2OX7A 2CSQA 4DEYA 1UE9A 1IO6A 1RABB 3U23A 1UB4A 3QYGB 2DD4A 1ABOA 2EQUA 3INZA 4HKEA 2YUPA 2COZA 2RQWA 6AT1B 2YT6A 4OB3B 4M7AD 3RMSA 2RB6A 1MMNA 3M0PA 3HHTB 3M55A 2DTHA 2J6OA 1M27C 3OSSC 3CBOA 2M9UA 4RTUA 2X4YA 4C92C 4OB0B 4PJOC 3OMCA 1KD1U 1JEGA 5CKBA 2DXCA 1BCMA 2CGHA 5GANf 4J6XA 2CZ6B 2YUNA 2EGEA 1VQNT 3VS0A 5GANd 5KYXB 2E1HA 3HTRA 3PVLA 1UUEA 1N9SA 4RTWA 1K73U 1OI1A 5CIUA 2O2OA 4MMLA 1W2BA 3CCEA 4AFSC 1KIKA 2XD0A 2JNGA 2A08A 3V7RA 4IKFA 2LRQA 1U8RA 3V7SA 2XDBA 3F70A 1RAAB 4FYWB 1E6HA 4JJDA 3QZ5B 3CCST 1YHQA 3JCMW 2DBKA 4LDUA 4J9FA 2J05A 1IB8A 1M1FA 2O31A 1Q86U 1Q81U 3E19A 4A4GA 4FT2A 2BZXA 2KVQG 2L5QA 1W2BP 2LC4A 2XHCA 1VQOQ 3V8JA 4FW1A 2OTLA 1ZUUA 3GNGA 1PD0A 4Y28E 1SHFA 4JRIA 2K9GA 1X01A 4D6WA 1QVFP 3QXEB 1IGUA 1P92A 2DX1A 3ULRB 2KT1A 4M7DC 3OYCA 3MCAB 2E41A 4B9XA 5GAOp 1GBQA 3EFOA 3BE3A 1CSKA 3VS1A 2LQWA 1UDLA 4BE1A 2DXUA 5KH6A 1GXIE 1M1KC 4MZMA 3G4SA 1N8RC 1SKUB 4MDXA 4X9DA 2LDMA 1S72A 3C0CA 3O5ZA 4IUQA 1KQ1A 5GAMg 3G6ET 1DJ7B 4HVUA 1YIJA 3L2RA 2EJ9A 2DYIA 1MNEA 5GAN6 1VQKA 3A5ZB 4JS4A 2QDLA 1M30A 2CZ1B 2LX9A 5IT9E 1RACB 1CKBA 1VQOT 2DPPB 1X69A 1AWJA 5GJWB 1AWWA 5L8RE 3X26B 4KGXB 2NUTA 2GQIA 4F14A 4DBHA 3SWNA 4BDZA 3I55Q 3M59A 2HQHA 2M0OA 1KD1C 2V8IA 1EFNA 3OYAA 4M7AF 1YCYA 4ZN3A 5KE3A 3JSCA 1MMDA 3WXMB 3OW2P 1D1AA 3QIIA 5GAOq 3RBBB 4C0DC 4Y91A 1T3SA 5GMKh 4V2SA 1RL2A 3CMAA 4N4HA 2Y4YA 1Q82R 1I07A 2C0TA 3JCMe 1FMWA 3MP1A 2R5MA 1FMKA 1XNIA 4A4KA 2GBQA 1K73C 2ROTA 5HK0A 1H3ZA 4OMMA 1RI0A 2KBTA 4DA4A 2GNCA 1YBYA 4XU3A 4JZ4A 4LDWA 2QYZA 2EGAA 3CXCS 4QVZA 1QP2A 2VUBA 2K57A 2V1QA 3RDVA 3TU4K 1K9MU 1VQ4Q 2QTXA 2YRDA 4IUPA 3JRZA 1AZGB 1Y07A 4OB2B 4RG2A 1WHGA 2HL5C 1KFZA 1Q86C 2AHJB 2CSIA 1Q81C 5LJ3h 1B3QA 3UA6A 2CP0A 3CPWS 4DBQA 4ZTFA 3OYNA 3DB3A 4J8OA 4DQ2A 2K6DA 2DL5A 3I55T 1VQMA 5GANg 4OMFB 2HSEB 5KYNA 2Y4XA 1QWFA 4FIBA 5LJ5d 3L2VA 1Q95G 1VYTA 2FPDA 4IIOA 2R58A 2JMCA 4AMCA 4JLGA 1YITA 3OYEA 5FWCA 3CCJA 1ZX6A 1M90U 3OBWA 1NJIR 3HRTA 4C92D 4AFZC 4PJOD 3FRNA 3HL8A 2CP3A 4IIMA 1EIFA 4O5VA 1WXBA 2HCKA 5KCHA 2HZYA 2DYBA 5GAOn 2WSCE 1VIFA 2P0QA 2L3SA 1WQWA 2GF7A 3A8GB 1VQ4T 2KT8A 2PVOB 3M4YA 1GBRA 2CT3A 3OSVA 3MP6A 1HK9A 3DLMA 2KY9A 1UJYA 1M8MA 4LDVA 3CCRA 2DFUA 2D8JA 4J83A 1M8VA 4F7UA 3S3NA 3I9QA 3OYIA 3TVTA 2K5IA 3FLGA 4FYXB 4JRKA 5GJVB 1AOJA 2DEUA 4ZN1A 2E5KA 3S3OA 1TG0A 2AKLA 3C95A 4NOYA 1B7TA 3I35A 3M54A 4BY6C 4HT8A 1YP5A 1OOTA 2FHDA 2X4JA 3QDFA 2HKNA 3CC4A 5FU7B 2VGMA 1GCQA 1VQ7T 5CKHA 4ESRA 2LNVA 3BDLA 2J6KA 2OJ2A 5IHIA 2DTIA 1M1GA 2CH4W 2RJCA 3MHXA 2D1XA 3LYIA 3SEMA 1OZ3A 2XDPA 3MEWA 2J06A 1K9MC 2O9SA 3QZ9B 3KXTA 2ESWA 1YI2A 2YHTA 2MF2A 3UPUA 4II1A 1D1BA 5KYWA 2RF0A 3FB9A 3QKJA 4IURA 5I21A 4M78A 4BDYA 2DIGA 4IUVA 3QYHB 2EWNA 4BD3A 2DZ9A 1ARKA 4JRPA 3QDRB 3FIFA 2YRCA 1WI7A 1IXDA 3CCUA 2HKQB 3MPUB 2LTOA 2VWFA 1KHCA 1K4US 5FRNA 4LUDA 4J9CA 4M7DA 1LPLA 5LJ5j 3PVQA 4XK8E 4M75A 1M3CA 2KK4A 2D6FA 1M90C 4TVRA 3CMEQ 2QQAA 3LWHA 1KSWA 4PFZA 3C4SA 3QHSA 4PNOA 2MWOA 2DRMA 5GMKi 2XDDA 2CKKA 2CP2A 2KAFA 2PZ1A 1JRIA 4PKCC 4M77A 3DKMA 4PJOF 3RNJA 3SWNC 1YWPA 1Y96A 3O8VA 4HVVA 4HCCA 4LDXA 3E9FA 1W2BS 2KYBA 3OYDA 3SD4A 4FCYA 2KE9A 3QJYA 3JCMP 2AKKA 1WHMA 5GMKl 3DLLA 4QQDA 1JXOA 3OYJA 1QVFS 1VQ8A 1HXDA 1SSHA 3OYLA 2M1HA 4KUIA 1D0YA 7AT1B 2DVEA 1X75C 2QG9B 4Y92A 4FL6A 2FPEA 2P0KA 5DLQE 2RQUA 4RTTA 2GTOA 2DEQA 4LNPA 2P0PA 4LE9A 3M56A 5IHKA 1I5OB 3CMET 1OX9A 3JCMh 1YJ9Q 1JJ2A 2LT1A 1OPKA 1QVGA 3REBB 3EG9B 1NEBA 3VKIA 3VUZA 3CC7A 5GAOm 1FX7A 5HK3A 3VS7A 5CK9A 1MNDA 2FL7A 1SHGA 5GAMd 1BCOA 3QWXX 3RESA 1NJIU 5J3BA 1WJQA 4PK4A 5IXBA 1UHCA 5LJ3f 1X2KA 4ANJA 2DXTA 1Y7XA 2DBMA 1VQPQ 4KH0B 1VUBA 1V1CA 1JJ2P 2HQEA 2BE9B 2D0QB 3FJPA 4E7ZA 1QVGP 3VV0A 5KYXA 3H0HA 4X1VA 1JXMA 2FRYA 3GF5A 1AWXA 4F17A 2Y90A 2P84A 1XOVA 3OW2S 3G71Q 3E2UA 3UA7A 2WSFE 1MGQA 2JTEA 2DILA 4EDUA 2LCSA 2X4XA 3LWIA 5C6SA 4X34A 3OB9A 2NUPB 2CS7A 2A37A 3EFRA 2KR3A 2RI3A 1N9RA 2CREA 4D8KA 4C8QC 2K2MA 5FU6B 1YJ9T 2BIVA 4N4IA 1RUWA 3CCSQ 2QGGA 4XTUA 1G3WA 1PSEA 4BE0A 4E7KA 3RIRA 1WJSA 1WYXA 4XQ3A 2A0FB 2LJ3A 4Z02A 1RAGB 2VYTA 1QP3A 1ZBJA 1YJWA 3EHRA 1QKXA 2C06A 1C1AA 2ZPBB 5D6WA 1B34A 2JW4A 3X24B 2DL8A 1VQPT 1SEMA 2FRWA 1BB9A 1LOJA 2QA4Q 4X9CA 2E65A 5CQXA 4J6WA 4KGZB 3EGXB 4A63B 1M2VA 2HSPA 2E4HA 5HY6A 2KDSA 2VASA 2KRMA 3I56A 2X35A 3G71T 2JOYA 1GCQC 1UGRB 1WA7A 3MEVA 2DERA 2CT4A 2LVMA 5D7UA 1GFDA 5M9OA 3MO8A 2HNIA 1IREB 2BTTA 1ZHIA 4F04B 2BZ8A 1V29B 3LH5A 3CD6T 3CBMA 1ZA2B 2EPDA 1Q7YR 3G6EQ 3CCLQ 2QQBA 2FPFA 4B6MA 3WVDB 4QKUA 1SRLA 2RJFA 3S3MA 4M78C 3EG2A 1GCPA 4F7UG 1U06A 1VOMA 2JM9A 4PLIA 2K7AA 3TEEA 2EGCA 2EQJA 4C5GA 2I2LA 1NJIC 2KYMA 2RJEA 2K5LA 2JJ9A 1O9SA 3QWYA 1WZOA 5GAMj 2QA4T 2QK0A 1YJNA 1VYUA 2H3EB 4C92G 1UECA 3V8LA 1UGVA 4PJOG 4RKUE 2YUOA 4AFQC 4RG8A 2KRNA 8AT1B 1KJWA 3OS2A 2F5KA 1X6GA 4M75C 4R0KA 3CCQA 2RD1A 1BIAA 4MZTA 5CQYA 3CC2A 2CZ7B 3META 2HEQA 1YCSB 2SRCA 2DLPA 2PVGB 3CCVT 5KE2A 3H41A 4LUEA 1JU5C 3EH1A 3HPWA 2CH4A 3G7ZA 2DL7A 2OTJA 4M77C 1H3HA 1RI9A 2QEXA 3VU3C 3CCLT 1W4SA 3E1SA 3ZL7C 1CKAA 2CYZB 3OBYA 1QCNA 1AEYA 2ZZDA 1IZ6A 1U1SA 2W0ZA 2MWPA 4AT1B 3V8KA 3OYYA 3X25B 1X27A 4ZGEB 4XTVA 2GFUA 4OMOA 2AZVA 4M78G 3RKXA 2KEAA 4M7AB 5LJ3g 4FT4A 1QVPA 1SSFA 3QG1A 2I0NA 5J26A 1B07A 2DRKA 4OMQA 2DETA 2KMTA 2H8HA 2AZSA 4MZPA 3L2UA 1QMCA 3AHUA 2E10A 5IN1A 1LJOA 3KBGA 2LZ6B 3P8HA 5IXFA 4JUVA 1BKBA 4M7DG 1WGSA 5L23A 2DJQA 2WACA 1BI2A 4M7AE 2RK1A 1VQ6A 1VQ5A 2ATCB 3GP8A 4GLKA 1NPPA 5GANj 5GAN4 3TSWA 1YNZA 3GOXA 3OS0A 2RPNA 4NS5A 1VQ9T 2C0IA 1NPRA 3JCMf 2VXEA 2V26A 2YSQA 3EFOB 1VQLA 4M77G 5CR2A 3MP8A 3CC7T 4PFOA 4RCCA 3CCMA 2B86A 2VVKA 4OVAA 1ZQ1A 2RO0A 1OU9A 2DAQA 4XU2A 4J9IA 2E5QA 2M16A 2HBPA 2L0AA 4J9HA 3UDCA 1WHJA 1OQKA 2E64A 4MDWA 4Q5WA 2ENMA 5LJ5e 2DJZA 3JCMJ 5J39A 1V76A 2OAUA 4EPCA 2LQKA 1UHFA 1Z9QA 3H0FA 4UC4A 3UWNA 3VS5A 3R6NA 3CQTA 2MYSA 2PQWA 2BE7D 2K5FA 4A4HA 4C0ZA 4BB7A 3NHNA 4EMKB 4M4ZA 4QQ6A 1WIEA 1N6AA 4XAXB 2YUQA 3L2QA 2L3PA 3CCEQ 1VQ7Q 1WHLA 2EKHA 1LVKA 2R5AA 5I11A 1ZSZB 1WPYA 5CAIA 2IPOB 2SEMA 5EG2A 4XTWA 4GY5A 3TREA 1YHQQ 1KHIA 1JB0E 1YWOA 3CPFA 2MOXA 2MAMA 4C8QA 3TQ7P 4J9DA 2WSEE 2CZ0B 5FLXE 3NTIA 4FYVB 2KNBB 2FB7A 4KRTA 2HQXA 2OTLQ 4RUGA 4A53A 2CP6A 2RK2A 1Y71A 2HBWA 1A0NB 2DXBA 1S1NA 1QVGS 3OS1A 4CC3A 2VV5A 1PRMC 3SHWA 2YXYA 1RAHB 2L2PA 3JB9J 4XTXA 1R0CB 4GLMA 4M78D 4LXCA 1N8RR 2A7YA 3MEUA 2LX7A 3L1AA 3BW1A 2RMOA 5DY9A 4HA8A 4F16A 5DLOA 3G1JA 2R57A 2H3JA 3X28B 2ED0A 3CCET 2DL3A 4IUUA 1VQNA 5GAOr 4HCKA 3G4SQ 3M0TA 2O4XB 3H0IA 4M7DD 2RQRA 1S72Q 2V1RA 1YHQT 2DNUA 2ZPHB 4LN2A 1U3OA 2QQSA 2PTKA 4M75D 1E6GA 2B8AA 4CC4B 1PCXA 2ROLA 2LCLA 3LGLA 3VRZA 1VQKQ 2E3HA 2EVRA 2BZYA 2J6FA 2V8KA 2QQ9A 4CRIA 4E7LA 1NEGA 1KD1R 2VC8A 2EQMA 1TWBA 2OTLT 1BI0A 2BKDN 3KUFA 4FU6A 5CO7A 1HJDA 1R77A 1GRIA 1JBMA 9ATCB 5KYYB 4M77D 2D0NA 3SFMA 4BACA 1IHWA 4ELYC 3VS3A 4JJNK 2K3BA 3OYFA 3CCQT 2VB6A 4PJJA 2DKGA 4MMKA 3JB9I 2O9VA 3LGFA 4JS5A 3CMAQ 3TSZA 4JJBA 2CDTA 1W6XA 3CXCA 3G4ST 1BYMA 4ZGJB 4F7UF 3PIPA 2ZGWA 2LJ1A 3EG9A 1OV3A 4C92B 3JCMg 4PJOB 1S72T 1Q86R 4RTXA 1Q81R 2XG8D 3GNFB 4BUGA 1YIJT 1ZA1B 3PTAA 1VA7A 3VRYA 1TOVA 2NUZA 2JVVA 2EJGA 1VQKT 1ZBXA 4C92F 4WCIA 1Q82U 3OA6A 5KCOA 3HKSA 3JB9D 1TSFA 1GFCA 3CPWA 1I1JA 4HT9A 2DZCA 5IAYA 3NGPA 1K9AA 3I5RA 3TCJA 2XIDA 1D3BB 1NZ9A 2LT4A 4RTYA 4C92E 3EG0A 5A0LA 4PJOE 4JRQA 3PMTA 2QQRA 1VQMQ 1IRXA 2E70A 3EAEA 3OYMA 2JMAA 3L2ZA 2QI2A 1VQOA 4C5EA 3EGDA 1K8AR 3NFCA 2RN8A 2F1LA 3JCMV 1M2OA 2EQIA 1TTHB 2JS0A 1YITQ 5KYWB 2MIOA 2X9HA 3CMAT 2NUPA 3CCJQ 1R0BG 2GCXA 4KBMB 4ZNXA 3VS2A 2XI9A 1UG1A 1H641 1PKTA 1UEBA 4OMPA 1PSFA 2LJ0A 4ATOA 2NLUA 4M78F 1SPKA 1RLQC 3M0QA 3URGA 4DOWA 1AVZC 4C5IA 3HSBA 2PU9B 5GAMe 4M7DB 3NMZC 4J9EA 2EAYA 1PG5B 4RTZA 2LNHB 1BI3A 4YTLA 1ZLMA 1H8KA 2NWMA 1Y0MA 3CCRQ 2LMJA 1AHJB 3M53A 4M7DF 4E7JA 1PNJA 5GAN3 3VYHB 5FRMA 1N27A 1PHTA 1UGSB 1VQMT 3HRUA 1SRMA 2E3IA 5LJ3d 2EYWA 2DVJA 3M0UA 4OMNA 5FU7C 1HSQA 1RADB 4M7DE 3FDRA 1TUDA 3EFSA 2OAWA 3RKWA 5LJ5h 3BY7A 1YITT 4N4GA 3I55A 2CP7A 2RM4A 3CCJT 4J6YA 3QO3A 3LLRA 4JLIA 4M77F 2ECZA 3J80E 2KSSA 2VKNA 1RAFB 1W70A 3CC4Q 4J5YA 2XICA 2KRSA 2PVDB 4C0FA 1K9MR 1XQHA 1KG1A 4XTYA 3RKYA 2XU8A 3CD6Q 3QSUA 1E7OA 3PFSA 4PLLA 5I22A 3VS6A 1NYGA 1RLPC 3IQLA 1WNLA 4L5GA 1FMVA 4ORZA 4BE2A 1YI2Q 2MK5A 3OQ5A 2K4YA 4C0DB 4E6RA 3CCRT 1Q82C 3N5BB 1NE8A 3L2WA 1KC8R 2DF6A 1VQ4A 4A4EA 3MEAA 4JPBW 2FYKA 2RI2A 2HD0A 5GAN8 4WF2A 4C0GA 3OYHA 5GANe 1AWOA 5CVIA 5KYUB 3JB9F 1PC0A 2JT4A 1BK2A 1M90R 3CCUQ 2OI3A 1U5SA 1R8OB 3JV3A 1KQSA 2RA2A 2C0OA 4CI0C 3S6WA 5GAOl 3CCVQ 3CC4T 2RI5A 1HD3A 2Z0WA 2FO0A 1QQJA 1M4ZA 1I8FA 3JCMQ 1QKWA 2HDAA 2YRVA 4Z89A 2JN0A 4L59A 2IIMA 1JO8A 1N5ZA 4C8QG 2GGRA 3UT1A 2J7IA 1FYNA 5EC7A 5GMKj 1TUGB 2DL4A 1KQSP 1VQ7A 4E7HA 4M7AA 2W10A 2YLBA 1YI2T 3OYGA 1QVFA 5I2MA 2KI7A 3LH0A 1OPLA 3RR6A 3A98A 2ED1A 5FW9A 1VQ8Q 3A8MB 1TXQA 2F2XA 1X6OA 2VXFA 3M57A 3PGGA 3OY9A 2AT1B 1M3BA 2E12A 4HXJA 3CCUT 2FVUA 5LJ3j 1B34B 1NBEB 1UFFA 4EMGA 1M5Q1 4E7SA 2EJFA 4LDYA 5A0DA 1LCKA 3ASKA 3VJPA 1M2VB 2ZPGB 2HAXA 1VQ9Q 2X51A 1ZUKA 2GFAA 2K79A 3DB4A 1K0SA 1YN8A 2X3XD 4PJLA 1K8AU 2EYZA 1QWEA 3CC7Q 4JDSA 4LD9K 3FEOA 5LL6S 2QGFB 4PL6A 2L3QA 2MI6A 2A28A 2XK0A 2JTFA 3ZBDA 2DMOA 3QPHA 4FYYB 3NPFA 4P5NA 2QDYB 4BY6B 4N0AA 1MV0B 2RQTA 8ATCB 2BUDA 2KXDA 3KFVA 4J7IA 5GAN7 2F69A 2A3LA 3T9NA 1I4K1 1XJWB 2YDLA 4DOVA 4AG1C 1VQ8T 4NL3A 1TU0B 2DA9A 3OW2A 2RJDA 2DO3A 2HL3A 2KGTA 4A4FA 1G3SA 2HMAA 3H9NA 3VUBA 5DM7R 5FWBA 4EMKA 3H8ZA 5FU6C 5AYFA 4M75G 1NLPC 3MKDA 3OS5A 1W1FA 3HRSA 2F5TX 4KULA 2KQWA 1M9SA 4J7FA 3D7SB 3CBPA 1ZSZA 1X2QA 2RHIA 1UJ0A 2D8HA 1G2BA 3X20B 2IVWA 1OX8A 3L42A 1WXTA 3A8OB 1QLYA 4GBQA 1G83A 4BI8B 3P8DA 4RCBA 4ZTJA 2COWA 4HVWA 4E47A 3JCMc 3VYGA 3UF4A 3JCMd 4JJCA 2QXFA 2COYA 1QW1A 3CMEA 4DBFA 2M51A 1D0XA 3H6ZA 2P4TA 1I5LA 3ZEHA 1YJWQ 3J7AF 5GAMh 3GPLA 4ZGDB 1MMGA 4HCBA 4VUBA 4OB1B 1D1CA 4C8QD 1WXUA 3JCMb 2PNIA 4NL2A 4R55A 1C6VX 3FJ5A 3ZFJA 1OULA 2EIFA 2DD5A 1ZUYA 2K2VA 4LD6A 4FW2A 3MJXA 3VS4A 2MCNA 1PWTA 1I0CA 3PIOA 2ABLA 2V8JA 3I56Q 2EKOA 1YFNA 3Q1JA 1KQ2A 3ER0A 1TH7A 5LJ5f 1WHKA 3I5SA 2LCCA 2IG0A 1G3TA 2NUTB 1VYVA 1KC8U 1UGQB 4PJMA 3SWNB 1NM7A 1MUZA 3JB9G 3A1PA 2ZPEB 4RMOA 2O4XA 2MMPA 1NLOC 4EMHA 2NYSA 1OEBA 5CKFA 4J9GA 4Z88A 1FXXA 3M9QA 3SDZA 1UTIA 3QBYA 2AK5A 3M5AA 1X6BA 2M0YA 4AG2C 1KK7A 1WJRA 4KUDK 1K8AC 4OMLA 2JM8A 1MMAA 5I2SA 4FSSA 1RAEB 1YJ9A 2LQNA 1YJWT 1WX6A 5KYYA 4QVDA 3JAME 4XTZA 5AT1B 1H92A 3GIBA 1T0HA 1JJ2S 1YJNQ
chains in the Genus database with same CATH topology
1CKBA 2G6FX 2JW4A 3EG0A 4RTYA 1X69A 1AWJA 2DL8A 3EHQA 5GJWB 1SEMA 2FRWA 4QT7A 1AWWA 1BB9A 2GQIA 4F14A 2JMAA 2JS2A 4EIKA 3GBQA 4A63B 2HSPA 2EBPA 1EFNA 2RN8A 2EQIA 2JS0A 2KRMA 2MIOA 1GCQC 1WA7A 1WDXA 2CT4A 3RBBB 4ZNXA 3VS2A 1T3SA 1GFDA 1UG1A 1I07A 2C0TA 2F2WA 2KROA 1PKTA 4OMPA 2LJ0A 2BTTA 1FMKA 1SPKA 1RLQC 2GBQA 1M3AA 3EG3A 3M0QA 2ROTA 4OMMA 2BZ8A 1AVZC 2KBTA 3LH5A 2GNCA 2EPDA 3M0SA 2JXBA 4JZ4A 3NMZC 4J9EA 2EGAA 4RTZA 2LNHB 2FPFA 2V1QA 1SRLA 1ZLMA 1H8KA 2DE0X 2NWMA 1AD5A 1Y0MA 3EG2A 1GCPA 1AZGB 1U06A 2JM9A 2LMJA 2K7AA 4Z8AA 4D8DA 2X3WD 1PNJA 2EGCA 2CUBA 1KFZA 5IH2A 2KYMA 2CSIA 4AFUC 3QWYA 1B3QA 1PHTA 1SRMA 3UA6A 1ABQA 1VYUA 2EYWA 1UECA 2DVJA 1UGVA 3M0UA 4OMNA 1HSQA 2K6DA 2YUOA 2DL5A 4AFQC 2KRNA 1AZEA 1TUDA 3THKA 2OAWA 1KJWA 1QWFA 1X6GA 4R0KA 2F2VA 2LP5A 1K1ZA 1VYTA 3M0RA 2FPDA 4IIOA 2JMCA 4K11A 2HEQA 1YCSB 2ECZA 2VKNA 2SRCA 1W70A 2DLPA 5FWCA 2DM1A 2KRSA 1ZX6A 1GL5A 3H41A 4LUEA 1JU5C 2CH4A 4AFZC 2DL7A 4IIMA 4RTVA 1WXBA 1H3HA 2HCKA 2DYBA 1RI9A 4JZ3A 1E7OA 1ZSGA 3ZL7C 1CKAA 5I22A 3VS6A 1NYGA 1AEYA 1RLPC 2L3SA 3IQLA 2KT8A 2W0ZA 4ORZA 4E6RA 1GBRA 2CT3A 1X27A 1TUCA 2DF6A 4OMOA 2AZVA 2EW3A 1WLPB 2KEAA 1UJYA 1M8MA 1Z9ZA 4JPBW 1J3TA 2D8JA 2I0NA 2RQVA 1K0XA 2FG0A 2RNAA 2P4RA 3I9QA 1B07A 4CC7A 3PE0A 1AWOA 2DRKA 4OMQA 3TVTA 2H8HA 2AZSA 2JT4A 1BK2A 2OI3A 2LZ6B 5IXFA 1U5SA 5GJVB 1AOJA 3JV3A 5L23A 1X43A 2C0OA 1PKSA 2E5KA 2DJQA 3REAB 1TG0A 2AKLA 1PRLC 3I35A 1HD3A 2GTJA 1T0JA 2FO0A 3TSWA 1YP5A 1OOTA 1QKWA 1YNZA 2RPNA 2HDAA 4Z89A 2IIMA 1QCFA 4J9BA 3EGUA 1JO8A 1GCQA 1N5ZA 2C0IA 4ESRA 2GGRA 2J7IA 2YSQA 2J6KA 1FYNA 2OJ2A 5EC7A 5IHIA 2DL4A 2CH4W 2D1XA 2B86A 2W10A 3SEMA 2KXCA 2VVKA 1WFWA 2J06A 2O9SA 2EYXA 4J9IA 5IHNA 1Y57A 2ESWA 1OPLA 2L0AA 4J9HA 2CUDA 3A98A 2ED1A 5FW9A 5HCKA 2RF0A 2F2XA 1BBZA 2ENMA 2EYYA 2FEIA 2O88A 1M3BA 4HXJA 4CC2A 1ARKA 1UHFA 1Z9QA 3H0FA 3VS5A 1JQQA 3R6NA 1NYFA 1WI7A 3CQTA 3UATA 1UFFA 1T3LA 5ECAA 2VWFA 1K4US 3NHNA 4M4ZA 2A36A 4LUDA 1WIEA 4J9CA 4DEXA 1NG2A 1LCKA 1MV3A 2YUQA 2XMFA 3PVQA 2L3PA 1BU1A 1M3CA 1ZUKA 2K79A 1K76A 2EKHA 3EG1A 5I11A 1K0SA 1YN8A 2X3XD 2EYZA 2SEMA 1QWEA 1KSWA 2DRMA 2L3QA 2A28A 1YWOA 2CSQA 4DEYA 1UE9A 2MOXA 1IO6A 4J9DA 3U23A 2PZ1A 2DMOA 3NPFA 1ABOA 1MV0B 2RQTA 2YUPA 2RQWA 3RNJA 1YWPA 4HVVA 2YT6A 2KXDA 3KFVA 2KNBB 4KRTA 2KYBA 4RUGA 2YDLA 4AG1C 3M0PA 2KE9A 2AKKA 2HBWA 1A0NB 2J6OA 1M27C 2DA9A 1JXOA 1S1NA 2KGTA 4CC3A 1PRMC 4RTUA 3SHWA 1SSHA 1JEGA 2L2PA 5FWBA 4GLMA 1NLPC 1W1FA 4Y92A 2LX7A 2YUNA 2EGEA 2RMOA 2FPEA 4F16A 3VS0A 2RQUA 1X2QA 1UJ0A 4RTTA 3PVLA 2ED0A 2DL3A 2D8HA 2GTOA 1UUEA 1G2BA 4LNPA 4RTWA 4LE9A 1WXTA 4HCKA 1QLYA 4GBQA 1G83A 3M0TA 5IHKA 2O2OA 3H0IA 2RQRA 4AFSC 1KIKA 4HVWA 2V1RA 2A08A 2DNUA 4LN2A 3UF4A 1U3OA 4JJCA 2PTKA 1E6GA 1OPKA 4CC4B 3REBB 1NEBA 2M51A 2ROLA 1E6HA 3VRZA 4JJDA 2DBKA 3VS7A 2EVRA 4J9FA 2J05A 2BZYA 2J6FA 1NEGA 1SHGA 2O31A 3QWXX 1WXUA 2BZXA 2PNIA 1HJDA 5IXBA 1UHCA 1GRIA 3FJ5A 1X2KA 2D0NA 1ZUYA 2DBMA 1ZUUA 1SHFA 1V1CA 3VS4A 2K9GA 2MCNA 1PWTA 1I0CA 2ABLA 3VS3A 3H0HA 4X1VA 2K3BA 1JXMA 2DX1A 3I5SA 2FRYA 3ULRB 1VYVA 1AWXA 2KT1A 4F17A 1XOVA 1NM7A 2O9VA 3UA7A 1MUZA 1GBQA 2JTEA 2DILA 3TSZA 4JJBA 2LCSA 2CDTA 1CSKA 3VS1A 2LQWA 1W6XA 1NLOC 1UDLA 1OEBA 4J9GA 4Z88A 2A37A 2KR3A 2LJ1A 1OV3A 1UTIA 2AK5A 2CREA 1X6BA 4RTXA 4D8KA 2M0YA 4AG2C 2K2MA 1VA7A 3VRYA 4OMLA 2JM8A 1RUWA 2NUZA 3C0CA 4FSSA 3O5ZA 4WCIA 4HVUA 2LQNA 1GFCA 1I1JA 1WX6A 1WYXA 2LJ3A 3NGPA 1H92A 1ZBJA 1K9AA 2QDLA 1T0HA 3EHRA 1M30A 3I5RA 1QKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKB A;  2G6F X;  2JW4 A;  3EG0 A;  4RTY A;  1X69 A;  1AWJ A;  2DL8 A;  3EHQ A;  5GJW B;  1SEM A;  2FRW A;  4QT7 A;  1AWW A;  1BB9 A;  2GQI A;  4F14 A;  2JMA A;  2JS2 A;  4EIK A;  3GBQ A;  4A63 B;  2HSP A;  2EBP A;  1EFN A;  2RN8 A;  2EQI A;  2JS0 A;  2KRM A;  2MIO A;  1GCQ C;  1WA7 A;  1WDX A;  2CT4 A;  3RBB B;  4ZNX A;  3VS2 A;  1T3S A;  1GFD A;  1UG1 A;  1I07 A;  2C0T A;  2F2W A;  2KRO A;  1PKT A;  4OMP A;  2LJ0 A;  2BTT A;  1FMK A;  1SPK A;  1RLQ C;  2GBQ A;  1M3A A;  3EG3 A;  3M0Q A;  2ROT A;  4OMM A;  2BZ8 A;  1AVZ C;  2KBT A;  3LH5 A;  2GNC A;  2EPD A;  3M0S A;  2JXB A;  4JZ4 A;  3NMZ C;  4J9E A;  2EGA A;  4RTZ A;  2LNH B;  2FPF A;  2V1Q A;  1SRL A;  1ZLM A;  1H8K A;  2DE0 X;  2NWM A;  1AD5 A;  1Y0M A;  3EG2 A;  1GCP A;  1AZG B;  1U06 A;  2JM9 A;  2LMJ A;  2K7A A;  4Z8A A;  4D8D A;  2X3W D;  1PNJ A;  2EGC A;  2CUB A;  1KFZ A;  5IH2 A;  2KYM A;  2CSI A;  4AFU C;  3QWY A;  1B3Q A;  1PHT A;  1SRM A;  3UA6 A;  1ABQ A;  1VYU A;  2EYW A;  1UEC A;  2DVJ A;  1UGV A;  3M0U A;  4OMN A;  1HSQ A;  2K6D A;  2YUO A;  2DL5 A;  4AFQ C;  2KRN A;  1AZE A;  1TUD A;  3THK A;  2OAW A;  1KJW A;  1QWF A;  1X6G A;  4R0K A;  2F2V A;  2LP5 A;  1K1Z A;  1VYT A;  3M0R A;  2FPD A;  4IIO A;  2JMC A;  4K11 A;  2HEQ A;  1YCS B;  2ECZ A;  2VKN A;  2SRC A;  1W70 A;  2DLP A;  5FWC A;  2DM1 A;  2KRS A;  1ZX6 A;  1GL5 A;  3H41 A;  4LUE A;  1JU5 C;  2CH4 A;  4AFZ C;  2DL7 A;  4IIM A;  4RTV A;  1WXB A;  1H3H A;  2HCK A;  2DYB A;  1RI9 A;  4JZ3 A;  1E7O A;  1ZSG A;  3ZL7 C;  1CKA A;  5I22 A;  3VS6 A;  1NYG A;  1AEY A;  1RLP C;  2L3S A;  3IQL A;  2KT8 A;  2W0Z A;  4ORZ A;  4E6R A;  1GBR A;  2CT3 A;  1X27 A;  1TUC A;  2DF6 A;  4OMO A;  2AZV A;  2EW3 A;  1WLP B;  2KEA A;  1UJY A;  1M8M A;  1Z9Z A;  4JPB W;  1J3T A;  2D8J A;  2I0N A;  2RQV A;  1K0X A;  2FG0 A;  2RNA A;  2P4R A;  3I9Q A;  1B07 A;  4CC7 A;  3PE0 A;  1AWO A;  2DRK A;  4OMQ A;  3TVT A;  2H8H A;  2AZS A;  2JT4 A;  1BK2 A;  2OI3 A;  2LZ6 B;  5IXF A;  1U5S A;  5GJV B;  1AOJ A;  3JV3 A;  5L23 A;  1X43 A;  2C0O A;  1PKS A;  2E5K A;  2DJQ A;  3REA B;  1TG0 A;  2AKL A;  1PRL C;  3I35 A;  1HD3 A;  2GTJ A;  1T0J A;  2FO0 A;  3TSW A;  1YP5 A;  1OOT A;  1QKW A;  1YNZ A;  2RPN A;  2HDA A;  4Z89 A;  2IIM A;  1QCF A;  4J9B A;  3EGU A;  1JO8 A;  1GCQ A;  1N5Z A;  2C0I A;  4ESR A;  2GGR A;  2J7I A;  2YSQ A;  2J6K A;  1FYN A;  2OJ2 A;  5EC7 A;  5IHI A;  2DL4 A;  2CH4 W;  2D1X A;  2B86 A;  2W10 A;  3SEM A;  2KXC A;  2VVK A;  1WFW A;  2J06 A;  2O9S A;  2EYX A;  4J9I A;  5IHN A;  1Y57 A;  2ESW A;  1OPL A;  2L0A A;  4J9H A;  2CUD A;  3A98 A;  2ED1 A;  5FW9 A;  5HCK A;  2RF0 A;  2F2X A;  1BBZ A;  2ENM A;  2EYY A;  2FEI A;  2O88 A;  1M3B A;  4HXJ A;  4CC2 A;  1ARK A;  1UHF A;  1Z9Q A;  3H0F A;  3VS5 A;  1JQQ A;  3R6N A;  1NYF A;  1WI7 A;  3CQT A;  3UAT A;  1UFF A;  1T3L A;  5ECA A;  2VWF A;  1K4U S;  3NHN A;  4M4Z A;  2A36 A;  4LUD A;  1WIE A;  4J9C A;  4DEX A;  1NG2 A;  1LCK A;  1MV3 A;  2YUQ A;  2XMF A;  3PVQ A;  2L3P A;  1BU1 A;  1M3C A;  1ZUK A;  2K79 A;  1K76 A;  2EKH A;  3EG1 A;  5I11 A;  1K0S A;  1YN8 A;  2X3X D;  2EYZ A;  2SEM A;  1QWE A;  1KSW A;  2DRM A;  2L3Q A;  2A28 A;  1YWO A;  2CSQ A;  4DEY A;  1UE9 A;  2MOX A;  1IO6 A;  4J9D A;  3U23 A;  2PZ1 A;  2DMO A;  3NPF A;  1ABO A;  1MV0 B;  2RQT A;  2YUP A;  2RQW A;  3RNJ A;  1YWP A;  4HVV A;  2YT6 A;  2KXD A;  3KFV A;  2KNB B;  4KRT A;  2KYB A;  4RUG A;  2YDL A;  4AG1 C;  3M0P A;  2KE9 A;  2AKK A;  2HBW A;  1A0N B;  2J6O A;  1M27 C;  2DA9 A;  1JXO A;  1S1N A;  2KGT A;  4CC3 A;  1PRM C;  4RTU A;  3SHW A;  1SSH A;  1JEG A;  2L2P A;  5FWB A;  4GLM A;  1NLP C;  1W1F A;  4Y92 A;  2LX7 A;  2YUN A;  2EGE A;  2RMO A;  2FPE A;  4F16 A;  3VS0 A;  2RQU A;  1X2Q A;  1UJ0 A;  4RTT A;  3PVL A;  2ED0 A;  2DL3 A;  2D8H A;  2GTO A;  1UUE A;  1G2B A;  4LNP A;  4RTW A;  4LE9 A;  1WXT A;  4HCK A;  1QLY A;  4GBQ A;  1G83 A;  3M0T A;  5IHK A;  2O2O A;  3H0I A;  2RQR A;  4AFS C;  1KIK A;  4HVW A;  2V1R A;  2A08 A;  2DNU A;  4LN2 A;  3UF4 A;  1U3O A;  4JJC A;  2PTK A;  1E6G A;  1OPK A;  4CC4 B;  3REB B;  1NEB A;  2M51 A;  2ROL A;  1E6H A;  3VRZ A;  4JJD A;  2DBK A;  3VS7 A;  2EVR A;  4J9F A;  2J05 A;  2BZY A;  2J6F A;  1NEG A;  1SHG A;  2O31 A;  3QWX X;  1WXU A;  2BZX A;  2PNI A;  1HJD A;  5IXB A;  1UHC A;  1GRI A;  3FJ5 A;  1X2K A;  2D0N A;  1ZUY A;  2DBM A;  1ZUU A;  1SHF A;  1V1C A;  3VS4 A;  2K9G A;  2MCN A;  1PWT A;  1I0C A;  2ABL A;  3VS3 A;  3H0H A;  4X1V A;  2K3B A;  1JXM A;  2DX1 A;  3I5S A;  2FRY A;  3ULR B;  1VYV A;  1AWX A;  2KT1 A;  4F17 A;  1XOV A;  1NM7 A;  2O9V A;  3UA7 A;  1MUZ A;  1GBQ A;  2JTE A;  2DIL A;  3TSZ A;  4JJB A;  2LCS A;  2CDT A;  1CSK A;  3VS1 A;  2LQW A;  1W6X A;  1NLO C;  1UDL A;  1OEB A;  4J9G A;  4Z88 A;  2A37 A;  2KR3 A;  2LJ1 A;  1OV3 A;  1UTI A;  2AK5 A;  2CRE A;  1X6B A;  4RTX A;  4D8K A;  2M0Y A;  4AG2 C;  2K2M A;  1VA7 A;  3VRY A;  4OML A;  2JM8 A;  1RUW A;  2NUZ A;  3C0C A;  4FSS A;  3O5Z A;  4WCI A;  4HVU A;  2LQN A;  1GFC A;  1I1J A;  1WX6 A;  1WYX A;  2LJ3 A;  3NGP A;  1H92 A;  1ZBJ A;  1K9A A;  2QDL A;  1T0H A;  3EHR A;  1M30 A;  3I5R A;  1QKX A; 
#chains in the Genus database with same CATH topology
 2ZAE A;  1Q7Y U;  1BI1 A;  2G6F X;  3EHQ A;  2AIR B;  3C12 A;  1OU8 A;  4QT7 A;  4BI4 A;  1M1K R;  5CKE A;  2JS2 A;  4EIK A;  3GBQ A;  3I56 T;  3CCQ Q;  1VQP A;  2EBP A;  3CC2 Q;  5GAN h;  2O01 E;  2FZK B;  1PM3 A;  4OF1 A;  1QCO A;  3EH2 A;  1F1B B;  2L8D A;  4C92 A;  5D6X A;  3QJ6 A;  4PJO A;  1WDX A;  4FM4 B;  1XTD A;  2LQ8 A;  4ELZ C;  3BFM A;  5GMK m;  3G71 A;  3PT9 A;  5CKD A;  4HCZ A;  2OTJ Q;  2F2W A;  4XU1 A;  2KRO A;  3HFN A;  4M7A C;  1EX4 A;  2QEX Q;  1YIJ Q;  2YWW A;  1M3A A;  3CEY A;  3EG3 A;  1RAI B;  4R56 A;  3M0S A;  2K3X A;  2JXB A;  3JCM X;  3RMQ A;  2RHZ A;  2MPX C;  2M02 A;  3HFO A;  1EZZ B;  3CD6 A;  1D3B A;  2D9T A;  4KH1 B;  3CCS A;  2DE0 X;  1U1T A;  1AD5 A;  4PFP A;  5FRO A;  4Z8A A;  4D8D A;  2X3W D;  5GAN 2;  1YJN T;  2EYQ A;  2CUB A;  5IH2 A;  2RHY A;  1HYO A;  4AFU C;  2RHU A;  4C8Q B;  3A8H B;  1ABQ A;  2FZG B;  1K73 R;  2ZCF B;  2DIQ A;  4QVC A;  2QAS A;  1AZE A;  3THK A;  2QA4 A;  3CC2 T;  1O75 A;  2DTO A;  4F7U B;  4C8Q F;  4OGC A;  1VQ6 Q;  1VQ5 Q;  2E6N A;  2F2V A;  2PUO B;  2LP5 A;  1K1Z A;  3M0R A;  4QQG A;  3LX7 A;  1G3Y A;  1KC8 C;  4K11 A;  3V7C A;  4KT0 E;  3M58 A;  3R6O A;  2DM1 A;  2OTJ T;  3OMG A;  4WTO B;  1GL5 A;  4C8Q E;  2DK3 A;  2FZC B;  2QEX T;  3PMI A;  1VQL Q;  2L89 A;  4M7A G;  3CCV A;  4RTV A;  4N0A C;  1KQS S;  3QUI A;  3OYK A;  3CCM Q;  4F7U E;  4JZ3 A;  2JTM A;  1ZSG A;  3J81 E;  1VIE A;  1IHV A;  5C0M A;  3WVE B;  1ACM B;  3CXC P;  3G6E A;  3CCL A;  5CCA A;  2G3R A;  4KGV B;  4XU0 A;  1TUC A;  4ME7 A;  2EW3 A;  1WHH A;  1WLP B;  2ZPI B;  4E7I A;  3BDU A;  1Z9Z A;  4EMK C;  1J3T A;  2EQK A;  2RQV A;  1K0X A;  2FG0 A;  2RNA A;  1Q7Y C;  2P4R A;  2VGN A;  4CC7 A;  3PE0 A;  5A0G A;  3HP9 A;  4QW2 A;  3CPW P;  2PUK B;  1ZSZ C;  5LJ5 g;  1G5V A;  3C94 A;  2QAZ A;  3LW5 E;  1TS9 A;  1WQ7 A;  5A2Q E;  4M78 B;  1VQ5 T;  3FC3 A;  1VQ6 T;  1X43 A;  1I81 A;  1PKS A;  5GMK e;  3REA B;  1PRL C;  2GTJ A;  3OYB A;  1T0J A;  4L6V 5;  3NTH A;  1BIB A;  2CP5 A;  2K3Y A;  2RH2 A;  1VQL T;  5D6Y A;  4J9B A;  1QCF A;  3EGU A;  1C0M A;  3RER A;  3CCM T;  1LNX A;  4M75 B;  4M78 E;  2ZPF B;  1VQ9 A;  4DBR A;  4O6J A;  2KXC A;  2E6Z A;  5GAM f;  1WFW A;  3E9G A;  5HKC A;  5LJ3 e;  3EGX A;  2EYX A;  4M75 F;  2QTV A;  5IHN A;  1UGP B;  3A8L B;  1Y57 A;  5KYU A;  4FSX A;  1G8X A;  2CUD A;  4PJN A;  4E2F B;  5HCK A;  2JZ2 A;  1D09 B;  1OZ2 A;  4OGE A;  1OYX A;  5GAN 5;  4M77 B;  3ME9 A;  1BBZ A;  3SB2 A;  1PD1 A;  2EFI A;  1D0Z A;  1Y96 B;  4A54 A;  1AT1 B;  2EYY A;  3P8B B;  2FEI A;  2O88 A;  3M4G A;  4M75 E;  1SG5 A;  4CC2 A;  3AT1 B;  2XKO C;  1JQQ A;  1NYF A;  1MHN A;  3UAT A;  1FWZ A;  1T3L A;  1SF9 A;  5ECA A;  3JB9 H;  2L3R A;  3GLX A;  1VQN Q;  4OP0 A;  3RUX A;  2A36 A;  2GQV A;  2JUF A;  4C5H A;  4IUT A;  2X4W A;  4DEX A;  1NG2 A;  1MV3 A;  2XMF A;  3EGD B;  4B9W A;  4M77 E;  1M1K U;  1BU1 A;  1K76 A;  2RHX A;  3PNW C;  4BI3 A;  1N8R U;  3EG1 A;  2YLC A;  3NTK A;  1IGQ A;  2OX7 A;  2CSQ A;  4DEY A;  1UE9 A;  1IO6 A;  1RAB B;  3U23 A;  1UB4 A;  3QYG B;  2DD4 A;  1ABO A;  2EQU A;  3INZ A;  4HKE A;  2YUP A;  2COZ A;  2RQW A;  6AT1 B;  2YT6 A;  4OB3 B;  4M7A D;  3RMS A;  2RB6 A;  1MMN A;  3M0P A;  3HHT B;  3M55 A;  2DTH A;  2J6O A;  1M27 C;  3OSS C;  3CBO A;  2M9U A;  4RTU A;  2X4Y A;  4C92 C;  4OB0 B;  4PJO C;  3OMC A;  1KD1 U;  1JEG A;  5CKB A;  2DXC A;  1BCM A;  2CGH A;  5GAN f;  4J6X A;  2CZ6 B;  2YUN A;  2EGE A;  1VQN T;  3VS0 A;  5GAN d;  5KYX B;  2E1H A;  3HTR A;  3PVL A;  1UUE A;  1N9S A;  4RTW A;  1K73 U;  1OI1 A;  5CIU A;  2O2O A;  4MML A;  1W2B A;  3CCE A;  4AFS C;  1KIK A;  2XD0 A;  2JNG A;  2A08 A;  3V7R A;  4IKF A;  2LRQ A;  1U8R A;  3V7S A;  2XDB A;  3F70 A;  1RAA B;  4FYW B;  1E6H A;  4JJD A;  3QZ5 B;  3CCS T;  1YHQ A;  3JCM W;  2DBK A;  4LDU A;  4J9F A;  2J05 A;  1IB8 A;  1M1F A;  2O31 A;  1Q86 U;  1Q81 U;  3E19 A;  4A4G A;  4FT2 A;  2BZX A;  2KVQ G;  2L5Q A;  1W2B P;  2LC4 A;  2XHC A;  1VQO Q;  3V8J A;  4FW1 A;  2OTL A;  1ZUU A;  3GNG A;  1PD0 A;  4Y28 E;  1SHF A;  4JRI A;  2K9G A;  1X01 A;  4D6W A;  1QVF P;  3QXE B;  1IGU A;  1P92 A;  2DX1 A;  3ULR B;  2KT1 A;  4M7D C;  3OYC A;  3MCA B;  2E41 A;  4B9X A;  5GAO p;  1GBQ A;  3EFO A;  3BE3 A;  1CSK A;  3VS1 A;  2LQW A;  1UDL A;  4BE1 A;  2DXU A;  5KH6 A;  1GXI E;  1M1K C;  4MZM A;  3G4S A;  1N8R C;  1SKU B;  4MDX A;  4X9D A;  2LDM A;  1S72 A;  3C0C A;  3O5Z A;  4IUQ A;  1KQ1 A;  5GAM g;  3G6E T;  1DJ7 B;  4HVU A;  1YIJ A;  3L2R A;  2EJ9 A;  2DYI A;  1MNE A;  5GAN 6;  1VQK A;  3A5Z B;  4JS4 A;  2QDL A;  1M30 A;  2CZ1 B;  2LX9 A;  5IT9 E;  1RAC B;  1CKB A;  1VQO T;  2DPP B;  1X69 A;  1AWJ A;  5GJW B;  1AWW A;  5L8R E;  3X26 B;  4KGX B;  2NUT A;  2GQI A;  4F14 A;  4DBH A;  3SWN A;  4BDZ A;  3I55 Q;  3M59 A;  2HQH A;  2M0O A;  1KD1 C;  2V8I A;  1EFN A;  3OYA A;  4M7A F;  1YCY A;  4ZN3 A;  5KE3 A;  3JSC A;  1MMD A;  3WXM B;  3OW2 P;  1D1A A;  3QII A;  5GAO q;  3RBB B;  4C0D C;  4Y91 A;  1T3S A;  5GMK h;  4V2S A;  1RL2 A;  3CMA A;  4N4H A;  2Y4Y A;  1Q82 R;  1I07 A;  2C0T A;  3JCM e;  1FMW A;  3MP1 A;  2R5M A;  1FMK A;  1XNI A;  4A4K A;  2GBQ A;  1K73 C;  2ROT A;  5HK0 A;  1H3Z A;  4OMM A;  1RI0 A;  2KBT A;  4DA4 A;  2GNC A;  1YBY A;  4XU3 A;  4JZ4 A;  4LDW A;  2QYZ A;  2EGA A;  3CXC S;  4QVZ A;  1QP2 A;  2VUB A;  2K57 A;  2V1Q A;  3RDV A;  3TU4 K;  1K9M U;  1VQ4 Q;  2QTX A;  2YRD A;  4IUP A;  3JRZ A;  1AZG B;  1Y07 A;  4OB2 B;  4RG2 A;  1WHG A;  2HL5 C;  1KFZ A;  1Q86 C;  2AHJ B;  2CSI A;  1Q81 C;  5LJ3 h;  1B3Q A;  3UA6 A;  2CP0 A;  3CPW S;  4DBQ A;  4ZTF A;  3OYN A;  3DB3 A;  4J8O A;  4DQ2 A;  2K6D A;  2DL5 A;  3I55 T;  1VQM A;  5GAN g;  4OMF B;  2HSE B;  5KYN A;  2Y4X A;  1QWF A;  4FIB A;  5LJ5 d;  3L2V A;  1Q95 G;  1VYT A;  2FPD A;  4IIO A;  2R58 A;  2JMC A;  4AMC A;  4JLG A;  1YIT A;  3OYE A;  5FWC A;  3CCJ A;  1ZX6 A;  1M90 U;  3OBW A;  1NJI R;  3HRT A;  4C92 D;  4AFZ C;  4PJO D;  3FRN A;  3HL8 A;  2CP3 A;  4IIM A;  1EIF A;  4O5V A;  1WXB A;  2HCK A;  5KCH A;  2HZY A;  2DYB A;  5GAO n;  2WSC E;  1VIF A;  2P0Q A;  2L3S A;  1WQW A;  2GF7 A;  3A8G B;  1VQ4 T;  2KT8 A;  2PVO B;  3M4Y A;  1GBR A;  2CT3 A;  3OSV A;  3MP6 A;  1HK9 A;  3DLM A;  2KY9 A;  1UJY A;  1M8M A;  4LDV A;  3CCR A;  2DFU A;  2D8J A;  4J83 A;  1M8V A;  4F7U A;  3S3N A;  3I9Q A;  3OYI A;  3TVT A;  2K5I A;  3FLG A;  4FYX B;  4JRK A;  5GJV B;  1AOJ A;  2DEU A;  4ZN1 A;  2E5K A;  3S3O A;  1TG0 A;  2AKL A;  3C95 A;  4NOY A;  1B7T A;  3I35 A;  3M54 A;  4BY6 C;  4HT8 A;  1YP5 A;  1OOT A;  2FHD A;  2X4J A;  3QDF A;  2HKN A;  3CC4 A;  5FU7 B;  2VGM A;  1GCQ A;  1VQ7 T;  5CKH A;  4ESR A;  2LNV A;  3BDL A;  2J6K A;  2OJ2 A;  5IHI A;  2DTI A;  1M1G A;  2CH4 W;  2RJC A;  3MHX A;  2D1X A;  3LYI A;  3SEM A;  1OZ3 A;  2XDP A;  3MEW A;  2J06 A;  1K9M C;  2O9S A;  3QZ9 B;  3KXT A;  2ESW A;  1YI2 A;  2YHT A;  2MF2 A;  3UPU A;  4II1 A;  1D1B A;  5KYW A;  2RF0 A;  3FB9 A;  3QKJ A;  4IUR A;  5I21 A;  4M78 A;  4BDY A;  2DIG A;  4IUV A;  3QYH B;  2EWN A;  4BD3 A;  2DZ9 A;  1ARK A;  4JRP A;  3QDR B;  3FIF A;  2YRC A;  1WI7 A;  1IXD A;  3CCU A;  2HKQ B;  3MPU B;  2LTO A;  2VWF A;  1KHC A;  1K4U S;  5FRN A;  4LUD A;  4J9C A;  4M7D A;  1LPL A;  5LJ5 j;  3PVQ A;  4XK8 E;  4M75 A;  1M3C A;  2KK4 A;  2D6F A;  1M90 C;  4TVR A;  3CME Q;  2QQA A;  3LWH A;  1KSW A;  4PFZ A;  3C4S A;  3QHS A;  4PNO A;  2MWO A;  2DRM A;  5GMK i;  2XDD A;  2CKK A;  2CP2 A;  2KAF A;  2PZ1 A;  1JRI A;  4PKC C;  4M77 A;  3DKM A;  4PJO F;  3RNJ A;  3SWN C;  1YWP A;  1Y96 A;  3O8V A;  4HVV A;  4HCC A;  4LDX A;  3E9F A;  1W2B S;  2KYB A;  3OYD A;  3SD4 A;  4FCY A;  2KE9 A;  3QJY A;  3JCM P;  2AKK A;  1WHM A;  5GMK l;  3DLL A;  4QQD A;  1JXO A;  3OYJ A;  1QVF S;  1VQ8 A;  1HXD A;  1SSH A;  3OYL A;  2M1H A;  4KUI A;  1D0Y A;  7AT1 B;  2DVE A;  1X75 C;  2QG9 B;  4Y92 A;  4FL6 A;  2FPE A;  2P0K A;  5DLQ E;  2RQU A;  4RTT A;  2GTO A;  2DEQ A;  4LNP A;  2P0P A;  4LE9 A;  3M56 A;  5IHK A;  1I5O B;  3CME T;  1OX9 A;  3JCM h;  1YJ9 Q;  1JJ2 A;  2LT1 A;  1OPK A;  1QVG A;  3REB B;  3EG9 B;  1NEB A;  3VKI A;  3VUZ A;  3CC7 A;  5GAO m;  1FX7 A;  5HK3 A;  3VS7 A;  5CK9 A;  1MND A;  2FL7 A;  1SHG A;  5GAM d;  1BCO A;  3QWX X;  3RES A;  1NJI U;  5J3B A;  1WJQ A;  4PK4 A;  5IXB A;  1UHC A;  5LJ3 f;  1X2K A;  4ANJ A;  2DXT A;  1Y7X A;  2DBM A;  1VQP Q;  4KH0 B;  1VUB A;  1V1C A;  1JJ2 P;  2HQE A;  2BE9 B;  2D0Q B;  3FJP A;  4E7Z A;  1QVG P;  3VV0 A;  5KYX A;  3H0H A;  4X1V A;  1JXM A;  2FRY A;  3GF5 A;  1AWX A;  4F17 A;  2Y90 A;  2P84 A;  1XOV A;  3OW2 S;  3G71 Q;  3E2U A;  3UA7 A;  2WSF E;  1MGQ A;  2JTE A;  2DIL A;  4EDU A;  2LCS A;  2X4X A;  3LWI A;  5C6S A;  4X34 A;  3OB9 A;  2NUP B;  2CS7 A;  2A37 A;  3EFR A;  2KR3 A;  2RI3 A;  1N9R A;  2CRE A;  4D8K A;  4C8Q C;  2K2M A;  5FU6 B;  1YJ9 T;  2BIV A;  4N4I A;  1RUW A;  3CCS Q;  2QGG A;  4XTU A;  1G3W A;  1PSE A;  4BE0 A;  4E7K A;  3RIR A;  1WJS A;  1WYX A;  4XQ3 A;  2A0F B;  2LJ3 A;  4Z02 A;  1RAG B;  2VYT A;  1QP3 A;  1ZBJ A;  1YJW A;  3EHR A;  1QKX A;  2C06 A;  1C1A A;  2ZPB B;  5D6W A;  1B34 A;  2JW4 A;  3X24 B;  2DL8 A;  1VQP T;  1SEM A;  2FRW A;  1BB9 A;  1LOJ A;  2QA4 Q;  4X9C A;  2E65 A;  5CQX A;  4J6W A;  4KGZ B;  3EGX B;  4A63 B;  1M2V A;  2HSP A;  2E4H A;  5HY6 A;  2KDS A;  2VAS A;  2KRM A;  3I56 A;  2X35 A;  3G71 T;  2JOY A;  1GCQ C;  1UGR B;  1WA7 A;  3MEV A;  2DER A;  2CT4 A;  2LVM A;  5D7U A;  1GFD A;  5M9O A;  3MO8 A;  2HNI A;  1IRE B;  2BTT A;  1ZHI A;  4F04 B;  2BZ8 A;  1V29 B;  3LH5 A;  3CD6 T;  3CBM A;  1ZA2 B;  2EPD A;  1Q7Y R;  3G6E Q;  3CCL Q;  2QQB A;  2FPF A;  4B6M A;  3WVD B;  4QKU A;  1SRL A;  2RJF A;  3S3M A;  4M78 C;  3EG2 A;  1GCP A;  4F7U G;  1U06 A;  1VOM A;  2JM9 A;  4PLI A;  2K7A A;  3TEE A;  2EGC A;  2EQJ A;  4C5G A;  2I2L A;  1NJI C;  2KYM A;  2RJE A;  2K5L A;  2JJ9 A;  1O9S A;  3QWY A;  1WZO A;  5GAM j;  2QA4 T;  2QK0 A;  1YJN A;  1VYU A;  2H3E B;  4C92 G;  1UEC A;  3V8L A;  1UGV A;  4PJO G;  4RKU E;  2YUO A;  4AFQ C;  4RG8 A;  2KRN A;  8AT1 B;  1KJW A;  3OS2 A;  2F5K A;  1X6G A;  4M75 C;  4R0K A;  3CCQ A;  2RD1 A;  1BIA A;  4MZT A;  5CQY A;  3CC2 A;  2CZ7 B;  3MET A;  2HEQ A;  1YCS B;  2SRC A;  2DLP A;  2PVG B;  3CCV T;  5KE2 A;  3H41 A;  4LUE A;  1JU5 C;  3EH1 A;  3HPW A;  2CH4 A;  3G7Z A;  2DL7 A;  2OTJ A;  4M77 C;  1H3H A;  1RI9 A;  2QEX A;  3VU3 C;  3CCL T;  1W4S A;  3E1S A;  3ZL7 C;  1CKA A;  2CYZ B;  3OBY A;  1QCN A;  1AEY A;  2ZZD A;  1IZ6 A;  1U1S A;  2W0Z A;  2MWP A;  4AT1 B;  3V8K A;  3OYY A;  3X25 B;  1X27 A;  4ZGE B;  4XTV A;  2GFU A;  4OMO A;  2AZV A;  4M78 G;  3RKX A;  2KEA A;  4M7A B;  5LJ3 g;  4FT4 A;  1QVP A;  1SSF A;  3QG1 A;  2I0N A;  5J26 A;  1B07 A;  2DRK A;  4OMQ A;  2DET A;  2KMT A;  2H8H A;  2AZS A;  4MZP A;  3L2U A;  1QMC A;  3AHU A;  2E10 A;  5IN1 A;  1LJO A;  3KBG A;  2LZ6 B;  3P8H A;  5IXF A;  4JUV A;  1BKB A;  4M7D G;  1WGS A;  5L23 A;  2DJQ A;  2WAC A;  1BI2 A;  4M7A E;  2RK1 A;  1VQ6 A;  1VQ5 A;  2ATC B;  3GP8 A;  4GLK A;  1NPP A;  5GAN j;  5GAN 4;  3TSW A;  1YNZ A;  3GOX A;  3OS0 A;  2RPN A;  4NS5 A;  1VQ9 T;  2C0I A;  1NPR A;  3JCM f;  2VXE A;  2V26 A;  2YSQ A;  3EFO B;  1VQL A;  4M77 G;  5CR2 A;  3MP8 A;  3CC7 T;  4PFO A;  4RCC A;  3CCM A;  2B86 A;  2VVK A;  4OVA A;  1ZQ1 A;  2RO0 A;  1OU9 A;  2DAQ A;  4XU2 A;  4J9I A;  2E5Q A;  2M16 A;  2HBP A;  2L0A A;  4J9H A;  3UDC A;  1WHJ A;  1OQK A;  2E64 A;  4MDW A;  4Q5W A;  2ENM A;  5LJ5 e;  2DJZ A;  3JCM J;  5J39 A;  1V76 A;  2OAU A;  4EPC A;  2LQK A;  1UHF A;  1Z9Q A;  3H0F A;  4UC4 A;  3UWN A;  3VS5 A;  3R6N A;  3CQT A;  2MYS A;  2PQW A;  2BE7 D;  2K5F A;  4A4H A;  4C0Z A;  4BB7 A;  3NHN A;  4EMK B;  4M4Z A;  4QQ6 A;  1WIE A;  1N6A A;  4XAX B;  2YUQ A;  3L2Q A;  2L3P A;  3CCE Q;  1VQ7 Q;  1WHL A;  2EKH A;  1LVK A;  2R5A A;  5I11 A;  1ZSZ B;  1WPY A;  5CAI A;  2IPO B;  2SEM A;  5EG2 A;  4XTW A;  4GY5 A;  3TRE A;  1YHQ Q;  1KHI A;  1JB0 E;  1YWO A;  3CPF A;  2MOX A;  2MAM A;  4C8Q A;  3TQ7 P;  4J9D A;  2WSE E;  2CZ0 B;  5FLX E;  3NTI A;  4FYV B;  2KNB B;  2FB7 A;  4KRT A;  2HQX A;  2OTL Q;  4RUG A;  4A53 A;  2CP6 A;  2RK2 A;  1Y71 A;  2HBW A;  1A0N B;  2DXB A;  1S1N A;  1QVG S;  3OS1 A;  4CC3 A;  2VV5 A;  1PRM C;  3SHW A;  2YXY A;  1RAH B;  2L2P A;  3JB9 J;  4XTX A;  1R0C B;  4GLM A;  4M78 D;  4LXC A;  1N8R R;  2A7Y A;  3MEU A;  2LX7 A;  3L1A A;  3BW1 A;  2RMO A;  5DY9 A;  4HA8 A;  4F16 A;  5DLO A;  3G1J A;  2R57 A;  2H3J A;  3X28 B;  2ED0 A;  3CCE T;  2DL3 A;  4IUU A;  1VQN A;  5GAO r;  4HCK A;  3G4S Q;  3M0T A;  2O4X B;  3H0I A;  4M7D D;  2RQR A;  1S72 Q;  2V1R A;  1YHQ T;  2DNU A;  2ZPH B;  4LN2 A;  1U3O A;  2QQS A;  2PTK A;  4M75 D;  1E6G A;  2B8A A;  4CC4 B;  1PCX A;  2ROL A;  2LCL A;  3LGL A;  3VRZ A;  1VQK Q;  2E3H A;  2EVR A;  2BZY A;  2J6F A;  2V8K A;  2QQ9 A;  4CRI A;  4E7L A;  1NEG A;  1KD1 R;  2VC8 A;  2EQM A;  1TWB A;  2OTL T;  1BI0 A;  2BKD N;  3KUF A;  4FU6 A;  5CO7 A;  1HJD A;  1R77 A;  1GRI A;  1JBM A;  9ATC B;  5KYY B;  4M77 D;  2D0N A;  3SFM A;  4BAC A;  1IHW A;  4ELY C;  3VS3 A;  4JJN K;  2K3B A;  3OYF A;  3CCQ T;  2VB6 A;  4PJJ A;  2DKG A;  4MMK A;  3JB9 I;  2O9V A;  3LGF A;  4JS5 A;  3CMA Q;  3TSZ A;  4JJB A;  2CDT A;  1W6X A;  3CXC A;  3G4S T;  1BYM A;  4ZGJ B;  4F7U F;  3PIP A;  2ZGW A;  2LJ1 A;  3EG9 A;  1OV3 A;  4C92 B;  3JCM g;  4PJO B;  1S72 T;  1Q86 R;  4RTX A;  1Q81 R;  2XG8 D;  3GNF B;  4BUG A;  1YIJ T;  1ZA1 B;  3PTA A;  1VA7 A;  3VRY A;  1TOV A;  2NUZ A;  2JVV A;  2EJG A;  1VQK T;  1ZBX A;  4C92 F;  4WCI A;  1Q82 U;  3OA6 A;  5KCO A;  3HKS A;  3JB9 D;  1TSF A;  1GFC A;  3CPW A;  1I1J A;  4HT9 A;  2DZC A;  5IAY A;  3NGP A;  1K9A A;  3I5R A;  3TCJ A;  2XID A;  1D3B B;  1NZ9 A;  2LT4 A;  4RTY A;  4C92 E;  3EG0 A;  5A0L A;  4PJO E;  4JRQ A;  3PMT A;  2QQR A;  1VQM Q;  1IRX A;  2E70 A;  3EAE A;  3OYM A;  2JMA A;  3L2Z A;  2QI2 A;  1VQO A;  4C5E A;  3EGD A;  1K8A R;  3NFC A;  2RN8 A;  2F1L A;  3JCM V;  1M2O A;  2EQI A;  1TTH B;  2JS0 A;  1YIT Q;  5KYW B;  2MIO A;  2X9H A;  3CMA T;  2NUP A;  3CCJ Q;  1R0B G;  2GCX A;  4KBM B;  4ZNX A;  3VS2 A;  2XI9 A;  1UG1 A;  1H64 1;  1PKT A;  1UEB A;  4OMP A;  1PSF A;  2LJ0 A;  4ATO A;  2NLU A;  4M78 F;  1SPK A;  1RLQ C;  3M0Q A;  3URG A;  4DOW A;  1AVZ C;  4C5I A;  3HSB A;  2PU9 B;  5GAM e;  4M7D B;  3NMZ C;  4J9E A;  2EAY A;  1PG5 B;  4RTZ A;  2LNH B;  1BI3 A;  4YTL A;  1ZLM A;  1H8K A;  2NWM A;  1Y0M A;  3CCR Q;  2LMJ A;  1AHJ B;  3M53 A;  4M7D F;  4E7J A;  1PNJ A;  5GAN 3;  3VYH B;  5FRM A;  1N27 A;  1PHT A;  1UGS B;  1VQM T;  3HRU A;  1SRM A;  2E3I A;  5LJ3 d;  2EYW A;  2DVJ A;  3M0U A;  4OMN A;  5FU7 C;  1HSQ A;  1RAD B;  4M7D E;  3FDR A;  1TUD A;  3EFS A;  2OAW A;  3RKW A;  5LJ5 h;  3BY7 A;  1YIT T;  4N4G A;  3I55 A;  2CP7 A;  2RM4 A;  3CCJ T;  4J6Y A;  3QO3 A;  3LLR A;  4JLI A;  4M77 F;  2ECZ A;  3J80 E;  2KSS A;  2VKN A;  1RAF B;  1W70 A;  3CC4 Q;  4J5Y A;  2XIC A;  2KRS A;  2PVD B;  4C0F A;  1K9M R;  1XQH A;  1KG1 A;  4XTY A;  3RKY A;  2XU8 A;  3CD6 Q;  3QSU A;  1E7O A;  3PFS A;  4PLL A;  5I22 A;  3VS6 A;  1NYG A;  1RLP C;  3IQL A;  1WNL A;  4L5G A;  1FMV A;  4ORZ A;  4BE2 A;  1YI2 Q;  2MK5 A;  3OQ5 A;  2K4Y A;  4C0D B;  4E6R A;  3CCR T;  1Q82 C;  3N5B B;  1NE8 A;  3L2W A;  1KC8 R;  2DF6 A;  1VQ4 A;  4A4E A;  3MEA A;  4JPB W;  2FYK A;  2RI2 A;  2HD0 A;  5GAN 8;  4WF2 A;  4C0G A;  3OYH A;  5GAN e;  1AWO A;  5CVI A;  5KYU B;  3JB9 F;  1PC0 A;  2JT4 A;  1BK2 A;  1M90 R;  3CCU Q;  2OI3 A;  1U5S A;  1R8O B;  3JV3 A;  1KQS A;  2RA2 A;  2C0O A;  4CI0 C;  3S6W A;  5GAO l;  3CCV Q;  3CC4 T;  2RI5 A;  1HD3 A;  2Z0W A;  2FO0 A;  1QQJ A;  1M4Z A;  1I8F A;  3JCM Q;  1QKW A;  2HDA A;  2YRV A;  4Z89 A;  2JN0 A;  4L59 A;  2IIM A;  1JO8 A;  1N5Z A;  4C8Q G;  2GGR A;  3UT1 A;  2J7I A;  1FYN A;  5EC7 A;  5GMK j;  1TUG B;  2DL4 A;  1KQS P;  1VQ7 A;  4E7H A;  4M7A A;  2W10 A;  2YLB A;  1YI2 T;  3OYG A;  1QVF A;  5I2M A;  2KI7 A;  3LH0 A;  1OPL A;  3RR6 A;  3A98 A;  2ED1 A;  5FW9 A;  1VQ8 Q;  3A8M B;  1TXQ A;  2F2X A;  1X6O A;  2VXF A;  3M57 A;  3PGG A;  3OY9 A;  2AT1 B;  1M3B A;  2E12 A;  4HXJ A;  3CCU T;  2FVU A;  5LJ3 j;  1B34 B;  1NBE B;  1UFF A;  4EMG A;  1M5Q 1;  4E7S A;  2EJF A;  4LDY A;  5A0D A;  1LCK A;  3ASK A;  3VJP A;  1M2V B;  2ZPG B;  2HAX A;  1VQ9 Q;  2X51 A;  1ZUK A;  2GFA A;  2K79 A;  3DB4 A;  1K0S A;  1YN8 A;  2X3X D;  4PJL A;  1K8A U;  2EYZ A;  1QWE A;  3CC7 Q;  4JDS A;  4LD9 K;  3FEO A;  5LL6 S;  2QGF B;  4PL6 A;  2L3Q A;  2MI6 A;  2A28 A;  2XK0 A;  2JTF A;  3ZBD A;  2DMO A;  3QPH A;  4FYY B;  3NPF A;  4P5N A;  2QDY B;  4BY6 B;  4N0A A;  1MV0 B;  2RQT A;  8ATC B;  2BUD A;  2KXD A;  3KFV A;  4J7I A;  5GAN 7;  2F69 A;  2A3L A;  3T9N A;  1I4K 1;  1XJW B;  2YDL A;  4DOV A;  4AG1 C;  1VQ8 T;  4NL3 A;  1TU0 B;  2DA9 A;  3OW2 A;  2RJD A;  2DO3 A;  2HL3 A;  2KGT A;  4A4F A;  1G3S A;  2HMA A;  3H9N A;  3VUB A;  5DM7 R;  5FWB A;  4EMK A;  3H8Z A;  5FU6 C;  5AYF A;  4M75 G;  1NLP C;  3MKD A;  3OS5 A;  1W1F A;  3HRS A;  2F5T X;  4KUL A;  2KQW A;  1M9S A;  4J7F A;  3D7S B;  3CBP A;  1ZSZ A;  1X2Q A;  2RHI A;  1UJ0 A;  2D8H A;  1G2B A;  3X20 B;  2IVW A;  1OX8 A;  3L42 A;  1WXT A;  3A8O B;  1QLY A;  4GBQ A;  1G83 A;  4BI8 B;  3P8D A;  4RCB A;  4ZTJ A;  2COW A;  4HVW A;  4E47 A;  3JCM c;  3VYG A;  3UF4 A;  3JCM d;  4JJC A;  2QXF A;  2COY A;  1QW1 A;  3CME A;  4DBF A;  2M51 A;  1D0X A;  3H6Z A;  2P4T A;  1I5L A;  3ZEH A;  1YJW Q;  3J7A F;  5GAM h;  3GPL A;  4ZGD B;  1MMG A;  4HCB A;  4VUB A;  4OB1 B;  1D1C A;  4C8Q D;  1WXU A;  3JCM b;  2PNI A;  4NL2 A;  4R55 A;  1C6V X;  3FJ5 A;  3ZFJ A;  1OUL A;  2EIF A;  2DD5 A;  1ZUY A;  2K2V A;  4LD6 A;  4FW2 A;  3MJX A;  3VS4 A;  2MCN A;  1PWT A;  1I0C A;  3PIO A;  2ABL A;  2V8J A;  3I56 Q;  2EKO A;  1YFN A;  3Q1J A;  1KQ2 A;  3ER0 A;  1TH7 A;  5LJ5 f;  1WHK A;  3I5S A;  2LCC A;  2IG0 A;  1G3T A;  2NUT B;  1VYV A;  1KC8 U;  1UGQ B;  4PJM A;  3SWN B;  1NM7 A;  1MUZ A;  3JB9 G;  3A1P A;  2ZPE B;  4RMO A;  2O4X A;  2MMP A;  1NLO C;  4EMH A;  2NYS A;  1OEB A;  5CKF A;  4J9G A;  4Z88 A;  1FXX A;  3M9Q A;  3SDZ A;  1UTI A;  3QBY A;  2AK5 A;  3M5A A;  1X6B A;  2M0Y A;  4AG2 C;  1KK7 A;  1WJR A;  4KUD K;  1K8A C;  4OML A;  2JM8 A;  1MMA A;  5I2S A;  4FSS A;  1RAE B;  1YJ9 A;  2LQN A;  1YJW T;  1WX6 A;  5KYY A;  4QVD A;  3JAM E;  4XTZ A;  5AT1 B;  1H92 A;  3GIB A;  1T0H A;  1JJ2 S;  1YJN Q; 
#chains in the Genus database with same CATH homology
 1CKB A;  2G6F X;  2JW4 A;  3EG0 A;  4RTY A;  1X69 A;  1AWJ A;  2DL8 A;  3EHQ A;  5GJW B;  1SEM A;  2FRW A;  4QT7 A;  1AWW A;  1BB9 A;  2GQI A;  4F14 A;  2JMA A;  2JS2 A;  4EIK A;  3GBQ A;  4A63 B;  2HSP A;  2EBP A;  1EFN A;  2RN8 A;  2EQI A;  2JS0 A;  2KRM A;  2MIO A;  1GCQ C;  1WA7 A;  1WDX A;  2CT4 A;  3RBB B;  4ZNX A;  3VS2 A;  1T3S A;  1GFD A;  1UG1 A;  1I07 A;  2C0T A;  2F2W A;  2KRO A;  1PKT A;  4OMP A;  2LJ0 A;  2BTT A;  1FMK A;  1SPK A;  1RLQ C;  2GBQ A;  1M3A A;  3EG3 A;  3M0Q A;  2ROT A;  4OMM A;  2BZ8 A;  1AVZ C;  2KBT A;  3LH5 A;  2GNC A;  2EPD A;  3M0S A;  2JXB A;  4JZ4 A;  3NMZ C;  4J9E A;  2EGA A;  4RTZ A;  2LNH B;  2FPF A;  2V1Q A;  1SRL A;  1ZLM A;  1H8K A;  2DE0 X;  2NWM A;  1AD5 A;  1Y0M A;  3EG2 A;  1GCP A;  1AZG B;  1U06 A;  2JM9 A;  2LMJ A;  2K7A A;  4Z8A A;  4D8D A;  2X3W D;  1PNJ A;  2EGC A;  2CUB A;  1KFZ A;  5IH2 A;  2KYM A;  2CSI A;  4AFU C;  3QWY A;  1B3Q A;  1PHT A;  1SRM A;  3UA6 A;  1ABQ A;  1VYU A;  2EYW A;  1UEC A;  2DVJ A;  1UGV A;  3M0U A;  4OMN A;  1HSQ A;  2K6D A;  2YUO A;  2DL5 A;  4AFQ C;  2KRN A;  1AZE A;  1TUD A;  3THK A;  2OAW A;  1KJW A;  1QWF A;  1X6G A;  4R0K A;  2F2V A;  2LP5 A;  1K1Z A;  1VYT A;  3M0R A;  2FPD A;  4IIO A;  2JMC A;  4K11 A;  2HEQ A;  1YCS B;  2ECZ A;  2VKN A;  2SRC A;  1W70 A;  2DLP A;  5FWC A;  2DM1 A;  2KRS A;  1ZX6 A;  1GL5 A;  3H41 A;  4LUE A;  1JU5 C;  2CH4 A;  4AFZ C;  2DL7 A;  4IIM A;  4RTV A;  1WXB A;  1H3H A;  2HCK A;  2DYB A;  1RI9 A;  4JZ3 A;  1E7O A;  1ZSG A;  3ZL7 C;  1CKA A;  5I22 A;  3VS6 A;  1NYG A;  1AEY A;  1RLP C;  2L3S A;  3IQL A;  2KT8 A;  2W0Z A;  4ORZ A;  4E6R A;  1GBR A;  2CT3 A;  1X27 A;  1TUC A;  2DF6 A;  4OMO A;  2AZV A;  2EW3 A;  1WLP B;  2KEA A;  1UJY A;  1M8M A;  1Z9Z A;  4JPB W;  1J3T A;  2D8J A;  2I0N A;  2RQV A;  1K0X A;  2FG0 A;  2RNA A;  2P4R A;  3I9Q A;  1B07 A;  4CC7 A;  3PE0 A;  1AWO A;  2DRK A;  4OMQ A;  3TVT A;  2H8H A;  2AZS A;  2JT4 A;  1BK2 A;  2OI3 A;  2LZ6 B;  5IXF A;  1U5S A;  5GJV B;  1AOJ A;  3JV3 A;  5L23 A;  1X43 A;  2C0O A;  1PKS A;  2E5K A;  2DJQ A;  3REA B;  1TG0 A;  2AKL A;  1PRL C;  3I35 A;  1HD3 A;  2GTJ A;  1T0J A;  2FO0 A;  3TSW A;  1YP5 A;  1OOT A;  1QKW A;  1YNZ A;  2RPN A;  2HDA A;  4Z89 A;  2IIM A;  1QCF A;  4J9B A;  3EGU A;  1JO8 A;  1GCQ A;  1N5Z A;  2C0I A;  4ESR A;  2GGR A;  2J7I A;  2YSQ A;  2J6K A;  1FYN A;  2OJ2 A;  5EC7 A;  5IHI A;  2DL4 A;  2CH4 W;  2D1X A;  2B86 A;  2W10 A;  3SEM A;  2KXC A;  2VVK A;  1WFW A;  2J06 A;  2O9S A;  2EYX A;  4J9I A;  5IHN A;  1Y57 A;  2ESW A;  1OPL A;  2L0A A;  4J9H A;  2CUD A;  3A98 A;  2ED1 A;  5FW9 A;  5HCK A;  2RF0 A;  2F2X A;  1BBZ A;  2ENM A;  2EYY A;  2FEI A;  2O88 A;  1M3B A;  4HXJ A;  4CC2 A;  1ARK A;  1UHF A;  1Z9Q A;  3H0F A;  3VS5 A;  1JQQ A;  3R6N A;  1NYF A;  1WI7 A;  3CQT A;  3UAT A;  1UFF A;  1T3L A;  5ECA A;  2VWF A;  1K4U S;  3NHN A;  4M4Z A;  2A36 A;  4LUD A;  1WIE A;  4J9C A;  4DEX A;  1NG2 A;  1LCK A;  1MV3 A;  2YUQ A;  2XMF A;  3PVQ A;  2L3P A;  1BU1 A;  1M3C A;  1ZUK A;  2K79 A;  1K76 A;  2EKH A;  3EG1 A;  5I11 A;  1K0S A;  1YN8 A;  2X3X D;  2EYZ A;  2SEM A;  1QWE A;  1KSW A;  2DRM A;  2L3Q A;  2A28 A;  1YWO A;  2CSQ A;  4DEY A;  1UE9 A;  2MOX A;  1IO6 A;  4J9D A;  3U23 A;  2PZ1 A;  2DMO A;  3NPF A;  1ABO A;  1MV0 B;  2RQT A;  2YUP A;  2RQW A;  3RNJ A;  1YWP A;  4HVV A;  2YT6 A;  2KXD A;  3KFV A;  2KNB B;  4KRT A;  2KYB A;  4RUG A;  2YDL A;  4AG1 C;  3M0P A;  2KE9 A;  2AKK A;  2HBW A;  1A0N B;  2J6O A;  1M27 C;  2DA9 A;  1JXO A;  1S1N A;  2KGT A;  4CC3 A;  1PRM C;  4RTU A;  3SHW A;  1SSH A;  1JEG A;  2L2P A;  5FWB A;  4GLM A;  1NLP C;  1W1F A;  4Y92 A;  2LX7 A;  2YUN A;  2EGE A;  2RMO A;  2FPE A;  4F16 A;  3VS0 A;  2RQU A;  1X2Q A;  1UJ0 A;  4RTT A;  3PVL A;  2ED0 A;  2DL3 A;  2D8H A;  2GTO A;  1UUE A;  1G2B A;  4LNP A;  4RTW A;  4LE9 A;  1WXT A;  4HCK A;  1QLY A;  4GBQ A;  1G83 A;  3M0T A;  5IHK A;  2O2O A;  3H0I A;  2RQR A;  4AFS C;  1KIK A;  4HVW A;  2V1R A;  2A08 A;  2DNU A;  4LN2 A;  3UF4 A;  1U3O A;  4JJC A;  2PTK A;  1E6G A;  1OPK A;  4CC4 B;  3REB B;  1NEB A;  2M51 A;  2ROL A;  1E6H A;  3VRZ A;  4JJD A;  2DBK A;  3VS7 A;  2EVR A;  4J9F A;  2J05 A;  2BZY A;  2J6F A;  1NEG A;  1SHG A;  2O31 A;  3QWX X;  1WXU A;  2BZX A;  2PNI A;  1HJD A;  5IXB A;  1UHC A;  1GRI A;  3FJ5 A;  1X2K A;  2D0N A;  1ZUY A;  2DBM A;  1ZUU A;  1SHF A;  1V1C A;  3VS4 A;  2K9G A;  2MCN A;  1PWT A;  1I0C A;  2ABL A;  3VS3 A;  3H0H A;  4X1V A;  2K3B A;  1JXM A;  2DX1 A;  3I5S A;  2FRY A;  3ULR B;  1VYV A;  1AWX A;  2KT1 A;  4F17 A;  1XOV A;  1NM7 A;  2O9V A;  3UA7 A;  1MUZ A;  1GBQ A;  2JTE A;  2DIL A;  3TSZ A;  4JJB A;  2LCS A;  2CDT A;  1CSK A;  3VS1 A;  2LQW A;  1W6X A;  1NLO C;  1UDL A;  1OEB A;  4J9G A;  4Z88 A;  2A37 A;  2KR3 A;  2LJ1 A;  1OV3 A;  1UTI A;  2AK5 A;  2CRE A;  1X6B A;  4RTX A;  4D8K A;  2M0Y A;  4AG2 C;  2K2M A;  1VA7 A;  3VRY A;  4OML A;  2JM8 A;  1RUW A;  2NUZ A;  3C0C A;  4FSS A;  3O5Z A;  4WCI A;  4HVU A;  2LQN A;  1GFC A;  1I1J A;  1WX6 A;  1WYX A;  2LJ3 A;  3NGP A;  1H92 A;  1ZBJ A;  1K9A A;  2QDL A;  1T0H A;  3EHR A;  1M30 A;  3I5R A;  1QKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...