2FEKA

Structure of a protein tyrosine phosphatase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
147
structure length
147
Chain Sequence
MFNNILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSLEGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKSRETFAAVYTLLERSARQWAQALNAEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of Escherichia coli Wzb reveals a novel substrate recognition mechanism of prokaryotic low molecular weight protein-tyrosine phosphatases
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Low molecular weight protein-tyrosine-phosphatase wzb
total genus 56
structure length 147
sequence length 147
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fekA00
4Y9TA 2MSLA 6CHYA 2E4VA 4B09A 3A0UA 3Q7TA 3EAFA 1MB0A 1P6QA 1PEAA 1IIBA 2JRLA 1Z18A 3FFTA 3I42A 2E4YA 2WJAA 3LMKA 4S05A 1FFSA 3JPYA 4MAAA 3HDGA 2A9OA 3O21A 4G0OA 4O5AA 3KYJB 1E6LA 4LE2A 1YS6A 1MIHA 3F6PA 3ROTA 3H6HA 3H1GA 2LPMA 2RGYA 3MF4A 5KC8A 2W42A 4NCAA 4PEVA 4MQFB 5FWYB 1USGA 1NATA 4MRMB 3FFXA 2HQOA 3Q9SA 4MPTA 4Z4HA 3OLZA 5FWXA 5CNJA 3QX8A 3CU5A 3JS5A 4EVRA 4MR8A 3M9XA 1ABFA 2FLWA 4RXUA 3TMYA 3HV2A 4HYEA 4MR8B 4ZMSA 2L2QA 4YR7A 3N6VA 4FE7A 3F7NA 4NICA 1VPWA 3RVPA 3KYIB 3GYBA 5C5CA 1BDJA 3BBLA 3OM1A 4O1IA 1ZGZA 2PUFA 4G0QA 3F6CA 3HS3A 5IX8A 4ML3A 4Z0NA 4Z4CA 2QU7A 2LP4Y 4MLCA 2QSJA 5KQPA 3QX9A 3H6GA 5IBQA 4ZJPA 3C6QA 5CNMA 3IP9A 5DCLA 3M6MD 4G97A 3ROFA 3DGEC 3A3KA 5IUKC 3DZDA 5EWLB 3LUHA 4EUKA 3EODA 1E2BA 2A9PA 5IEBA 4NCBA 2MYTA 4RS3A 4RXMA 3RVOA 2QZJA 5DTEA 5IEJA 4N0PA 1ISSA 4P98A 2CD7A 5HM6A 4Z99A 4MGEA 2R47A 2QV0A 4Z9AA 3RH0A 4MS4B 1M5UA 2HPHA 2IYNA 3OO0A 5JNUA 4W5NA 5JNTA 1PNRA 1BVHA 3M9WA 4RK4A 4YLEA 1QMPA 1UDRA 2FQXA 4PYRA 4RWEA 2FMKA 4JA2A 5KC9A 3H1FA 5EWMA 4M88A 3UKJA 1YS7A 3GT7A 1APBA 3N0XA 3CFYA 4KNYA 2GI4A 5EWMB 1L5YA 1TM2A 4MS1B 5IUJC 2TMYA 2WY2D 4KK4A 1B00A 2I6FA 1AB5A 3LUJA 4G0ZA 5C5EA 3CKMA 1PEYA 5DGCA 2FXIA 1SXIA 3T6KA 4LRQA 1YTUA 2HQRA 1ZGGA 4MR9B 3OO1A 3IPCA 1KRXA 1NXWA 3O1HB 4MRMA 3RVQA 2CWDA 3CHYA 3LKVA 4IGAA 5BRAA 1RXIA 4YS6A 1CYEA 4QICA 1BDHA 2OQRA 4RKQA 4GNRA 3NNSA 2HQBA 3HVRA 4DN6A 2JBAB 4H3HB 2FEKA 2R25B 2PUCA 2NT4A 4RY8A 5CHYA 5T3YA 1T34A 5IC5A 4Q6WA 4RK1A 4E7PA 3BRQA 3IDOA 1OXBB 2VUIB 3RVRA 1EWTA 4D6XA 4Z4GA 1XWWA 4QPJC 2ZAYA 3URMA 6ABPA 5TPZD 3DBIA 2GWRA 4LZLA 5EWLA 5GOTA 1YMVA 1Z12A 5FBHA 1DCKA 5HSGA 1OXKB 3OLWA 1YVUA 2JK1A 5JNVA 5JS1A 2PL9A 4F12A 4H60A 4RU1A 3KSMA 4YGXB 5ABPA 1DP4A 3RVMA 1NXTA 1AB6A 2RJOA 3LUCA 5TPWA 2ID9A 2VK2A 1U04A 3OQOA 2IDMA 1QO0A 5TPWB 1RZRA 3H5LA 2PUGA 1CHNA 1Z17A 2LBPA 3OLYA 3QEMA 1DC8A 3JPWA 3H75A 1DJMA 3O1IC 1A2OA 2QVCA 2LUOA 1ISRA 2PMCA 2QVGA 1JDNA 3BREA 1QP0A 2XDYA 2ZWMA 5E3JA 5EWJB 3RVSA 3ILYA 4N47A 3N0RA 3O75A 4S04A 2QW1A 3GBVA 2MYUA 1A04A 3NBMA 1GLGA 4W5RA 5TQ0B 5FBKA 5BR1A 4N0QA 4W5OA 2PE5A 2IPNA 1ZESA 2L18A 1E6MA 1RNLA 2PLNA 3Q41A 3QEKA 4KQCA 5TQ0A 1P6UA 4RK0A 3T38A 3T95A 2E4WA 4RY9A 3NNNA 2H3HA 5B3JA 3SY8A 1VKRA 3O1JC 3EDCA 3IP5A 4LX8A 4KK3A 4WZZA 1K68A 1MB3A 1DBWA 2KYRA 3RVLA 1USKA 2GX6A 5T7BA 2M98A 1DCMA 3SNKA 4NQRA 2FEWB 2A9RA 2NZUG 4ZPJA 4LDZA 4G86A 3SM9A 1YK0A 3VNAA 3BRSA 3MYYA 9ABPA 1ABEA 1Z15A 1D1QA 1M2FA 1LJLA 3CS3A 4KZKA 3VNBA 3EJWA 3LFTA 5F64A 4MQFA 4ETMA 1MVOA 4MQEB 4JB2A 1NXSA 3LUAA 1FQWA 3BILA 4TMYA 2PUBA 3TB6A 3EULA 3QLUA 1WETA 3H5IA 3UK0A 3GRCA 3SAJA 3C3KA 3LOPA 2F8SA 1URPA 1M2EA 2FN8A 1QPZA 2YHAA 4G0YA 4RKRA 3HEBA 3HK2A 2LIVA 4JP1A 4ETIA 3L49A 3T8YA 2WWVD 4EYGA 4O1HA 3GA5A 4G0MA 1D5WA 1JHZA 3TD9A 8ABPA 3GL9A 3MMNA 3IPAA 2IPLA 4RZSA 1E6KA 3RVNA 1JF8A 1ZH2A 4IF4A 1JYEA 4IRXA 1JFTA 2O20A 2E4UA 3A10A 3Q7SA 1P2FA 1Z2DA 4W5TA 1W25A 2JVJA 2R4QA 2FW0A 3KJXA 2FTKE 3OMXA 3FDFA 3D02A 3I45A 1USIA 1K66A 2AYXA 3QELA 1QP4A 1ZAYA 3HJFA 1YIOA 1DRJA 3FMVA 5PNTA 4Z4EA 4P1ZA 4KREA 1NTRA 2WB4A 4KV7A 2CHEA 4TN5A 3MIZA 2WRZA 4JOQA 2IKSA 1MAVA 3HXMA 2PUAA 3CG0A 2FMFA 3HDVA 3NHZA 1JBEA 1L5ZA 7ABPA 2MYPA 2QXYA 1SRRA 2QR3A 1Z25A 4WXEA 4F8JA 4L85A 1JDPA 1ZDMA 3TX6A 4EY3A 4EYKA 2YHBA 3H5OA 2B4AA 3OLVA 5JS2A 3W9SA 2GKGA 2FVYA 2MSWA 1PUXA 4EVQA 1JX6A 3GV0A 1NXPA 3EQ2A 2PJUA 3RVJA 3B2NA 1NXXA 1D2AA 5FWYA 1Z13A 4GPAA 2M1ZA 1M5TA 4OG2A 4YO7A 1QQAA 3O74A 4WXMA 3KCNA 1JLKA 3HZHA 4RK7A 3JVDA 3OM0A 3Q7RA 1QP7A 3C3WA 2H0AA 1GCAA 4KMRA 3E61A 2A9QA 5KQLA 1I3CA 1JH9A 2MYNA 4KFCA 5IULC 3QK7A 3HM9A 3KHTA 1U0SY 1RPJA 3IP7A 2JBAA 4RDCA 4XARA 1F51E 2NUBA 3SG0A 1F4VA 1ZY2A 1YK1A 4N03A 4OLAA 2GBPA 3ILHA 3O2QB 3EGCA 4DQDA 5HQJA 2FLKA 2FMIA 3GWGA 3O2JA 1EWVA 4RV5A 1FFWA 1VRVA 3N75A 3RQIA 1S8NA 3GBPA 1NY5A 3CRNA 1VLZA 1QNLA 2PL1A 3CNBA 2FKAA 4LE0A 5BRJA 2E4ZA 4PICA 4UHJA 4F06A 1RZRD 4F3TA 1NXVA 2P9HA 2FQWA 4ZYLA 4MLDA 1QO0D 3A0RB 5FWXB 4RXTA 2E4XA 2FMHA 4E7OA 4CBVA 3QLVC 3C97A 1P8AA 2IOYA 2IPMA 4FB4A 4KPYA 2WJWA 2AYZA 1TMYA 5DLEA 3L6UA 1TVMA 3E3MA 3DLHA 3CZ5A 2Q5CA 3NHMA 2DRIA 3DGFC 3EQZA 3N53A 4QYWA 4Z9BA 4G0PA 3JTEA 4YRZA 2PUEA 2RJNA 3K9CA 3OMWA 1PNTA 2JCGA 1Z16A 5TQJA 3H5VA 4H3KB 1JFSA 1NXOA 3K4HA 4EYOA 1SXGA 3KG2A 4JB0A 2FSPA 3R0JA 3QEMB 4EYQA 3RVKA 3JY6A 4WUTA 1XHEA 5HKOA 4MS1A 2X7XA 4XASA 5DKFA 3F73A 3UUGA 1W9HA 4YCSA 4JAVC 3G1WA 3LUFA 3CTPA 3QLVA 3Q15C 4MR9A 5KQMA 1BDIA 3LKBA 4XAQA 1YMUA 1ZVVA 2FQYA 2PUDA 1JFVA 1RXEA 4OTZA 2R48A 4PZ0A 3MQ4A 4F11A 4JASB 1D1PA 2JVIA 4IMIB 3JVIA 3MM4A 5KQGA 1HEYA 4WWHA 2NZVG 3H5TA 1GUDA 1U2QA 4OBBA 4KRFA 4L4UA 1SXHA 5BQ3A 4YV7A 5JNRA 4D74A 3H1EA 4MR7A 1LJUA 1R8JA 1ZHHA 3CZCA 3KKEA 3P9YA 4MYRA 4OATA 4EVSA 1JL3A 4Z4FA 1EWKA 4MS3B 3C3MA 2L19A 4TLMB 5B3JC 5CNIA 2FN9A 3I09A 4MS3A 1GCGA 1PHRA 1BA2A 1Z26A 3SQNA 1SD5A 4Q7EA 5TE9A 4YWHA 2B1JA 4XLTA 4EGSA 1Y1LA 5KWSA 4ZMRA 3HUTA 3FFWA 1FSPA 4RSMA 1DBQA 2V0NA 1TLFA 2L17A 5D2CA 4N41A 1A0OA 4NV3A 3LUDA 3G85A 1KRWA 2VUHB 4UHKA 5JNSA 4KQ9A 1EAYA 4RY0A 5IUNC 2MSKA 2PAFA 4ETNA 3D8UA 3KS9A 4LE1A 3QLUC 2BGGA 1DZ3A 2OENG 2VYCA 1LK0A 1EHCA 4QYMA 3O2SB 3TO5A 1XHFA 1DG9A 3HCWA 3DLBA 4D6YA 4PE5B 1QQBA 2FEPA 3NNDA 4HNQA 3OQMA 3HUUA 3N8IA 4Q6BA 4MQEA 1DRKA 4RK5A 5I4CA 1LBHA 2RDMA 1BAPA 1C0EA 3QELB 3LTEA 1U2PA 2P4UA 1ZH4A 3H5WA 5CNKA 2HSGA 1GUBA 3I5AA 5TQ2A 2IPAB 4TLLB 1ZN2A 3CLKA 2F8TA 4WT7A 5GQSA 1LBIA 2CHFA 1U8TA 2WMYA 3KLNA 5TQ2B 4FE4A 3MA0A 4G0XA 1DC7A 2HJ9A 4LDAA 1ZITA 5TPZA 4IILA 1QKKA 4YP9A 1D4ZA 5ED4A 1TJYA 3QLTA 3KTOA 4IMJB 1JWLA 3KLOA 4HNRA 1FFGA 4Z4IA 4N76A 2PKXA 4KVFA 3FGZA 5KI6A 4XFKA 1J56A 2JB9A 1JYFA 2NT3A 4HNSA 3HO1A 4MR7B 4DADA 4RK6A 5EWJA 1CEYA 4OLBA 1DCFA 2JVKA 1KMIY 1H9CA 2ID7A 1EFAA 3OQNA 2N9UA 1Z2EA 5JNWA 3LUGA 1DBPA 4W5QA 3HSYA 2J48A 4XXHA 3S99A 1C4WA 3OLXA 4MS4A 3IP6A 1KGSA 3LUKA 3CG4A 3N0WA
chains in the Genus database with same CATH superfamily
1G8HA 1P2DA 4L0QA 3V55A 1JSZA 1Z34A 2UYGA 3VDNB 5A7FA 1B8PA 3EH1A 1INLA 3K0AB 1OVGA 4OYYA 4KQIA 4HDAA 3CYFA 5H3CA 3U4IA 4JJIA 1JFFA 2JIMA 3K0AA 1FFXB 2O2IA 3LF2A 2C78A 4J0HA 4TMXA 2IF0A 4O5AA 4RLHA 4B2IA 4C05A 1FFXA 2Z04A 3RK0A 4CEHB 5LP6A 5FLEX 4KWEA 1CUEA 3NRBA 2WJJA 4KSYA 5LC1A 4BX3A 1NBMA 4EG5A 1LNZA 3PXAA 2G3YA 2E5FA 2QI9C 5FWXA 4RVNA 1T0PA 1A5BB 1FUUA 2IHTA 3WIEA 2VDOB 2A5JA 1NVMB 1ABFA 2XGSA 3DMYA 1I4LD 2HWKA 4FFMA 2LD4A 4LNHA 2GAFA 4I4LA 1QZ3A 2C4HA 2EGUA 2PD3A 1ZJ5A 3FCXA 4LHVA 5TF4A 4RHEA 3DULA 4GI2A 2ZIGA 4I9HA 3AUKA 4JL5A 1FCJA 2WWTA 3BXFA 1LXCA 1P1HA 1YH3A 3GVXA 3P9NA 2G1JA 3MJCA 5CU7A 5F5LA 2PUFA 1NXQA 1UIRA 3M34A 5LA6B 3LWNA 1K6XA 1QYRA 2R1VB 5FBZA 3GZ4A 1EX9A 4BNYA 4YY3B 2GA8A 2EKDA 4IDFA 3EGVA 3H6GA 5CNMA 1O2DA 1PDOA 1PE0A 1Q17A 1UPXA 1YS1X 2R1VA 3DGEC 3OE1A 1EFDN 5J2UB 3V1TC 4DR1B 1MHTA 3A3KA 3EZ7A 4FEAA 4J0EA 3O8BA 5EWLB 1Z73A 3S2ZA 1GCOA 4EEKA 3UHJA 1D9XA 3U3RA 4KQHA 4Y9DA 3MRSA 1JIQA 3LQFA 1OH7A 3O4HA 2RB4A 1KMHA 1TO1E 3PQDA 5E1MA 4D8XA 1DKRA 1YKFA 3PXUA 4JX8A 4DR2B 3OOYA 4ND1A 4RSHA 4E4RA 4L74A 3OTQA 5FLXA 1KEPA 3CEAA 3DOEA 2I4TA 3GRPA 3A70A 2W4QA 1JEJA 3NVMB 2FGJA 4YP1A 1JV2B 4IYJA 1P0MA 1QBKC 3D6AA 5DRTA 4D92A 1NVVR 2FQXA 1ZVKA 4DLVA 3ADCA 4IIBA 4UARA 4RKWA 4OM8A 2JLQA 1MVLA 3DQQA 1QVVA 1X1DA 2JDID 3ADOA 3ND7A 3PNMA 4GLFA 2XX3A 1U90A 1RKXA 3JQEA 1RQRA 1YDHA 1ZU4A 1NVWQ 1JZSA 1SULA 3GPDG 3L4BC 3OUUA 4IDDA 4EVRA 4XA8A 1PEYA 1MAUA 1GU0A 4EYSA 2QTCA 4EPRA 1YC5A 2WYHA 2XY4A 3EXHC 2HQRA 3ZD9A 4C87A 5BUSA 4UCFA 3HLYA 1P3Y1 2E2WA 2FZ5A 3LHFA 4E6EA 3T0GA 1UT5A 1T8RA 4HDNB 1GT6A 1E7QA 3CHYA 1M8GA 4IKOA 3D4PA 4KE8A 4YS6A 1E7MA 2YH2A 3B36A 1UJNA 3R4VA 1CRWG 1Z6XA 2Q2WA 5HIJA 2JANA 1XRRA 1KJIA 3EC2A 4O2AA 3P0HA 1HQCA 5EXPA 3E4CA 2JGKA 3TLKA 2GUGA 3OICA 1J7JA 2YNMC 3PX3A 2R25B 3QIAA 3X2SA 3GJZA 4ZKDA 1ZM4A 4PX3A 5J40A 3FLBA 4XPIB 1M67A 5IC5A 2GSWA 1QIFA 2XQFA 3I2KA 3LRTA 4PQYA 5GJCA 3BIJA 4QOGA 2B2XA 5BN3A 1GPNA 7MDHA 1V6CA 3PP8A 2QAGC 2AC7A 4L8YA 5JYEA 1VL0A 4IZOA 2BDUA 3UCFA 4AKGA 1XU4A 2YZKA 3KPUA 4R7GA 5BRNA 1H2BA 5J2TF 5HSGA 2IYRA 4QGHA 4C30A 1ZUNA 3D8BA 3K2QA 4IYRA 2YZ2A 3SX4A 4JLWA 4ZQIA 3SSAA 3WB9A 3NVDA 5M3BA 3A28A 2WM9B 3ZHTA 4DIKA 1GVNB 3RVMA 1LDEA 3R6LA 2H2GA 2JI8A 5F2EA 4Q48A 1CBUA 1GWNA 1NF2A 3GLHB 1J2RA 4PO9A 4Q1EA 2VBCA 2WJZB 4JQOA 3FPBA 1H8HD 2AFVA 3F4BA 2L82A 3GLHA 2XXAA 2X42A 5K7SA 2AFRA 3AGPA 2A86A 5IZ4A 1ESNA 1N2SA 4HAOA 1DC8A 2N75A 2PXCA 1LBSA 1DT3A 5F5NA 1OFVA 1YB4A 1OY1A 2ATVA 2FZKA 4X8OA 3TW6A 1IZYA 1V5IA 3UC9A 2XB2A 5I7UA 4LWOA 2XQVA 2VAXA 1FL9A 4ABTA 4RFSB 3N0RA 4IFTA 3M7IA 3MTEA 4N47A 4BOYA 4J43A 4DV7B 5FPPA 3GVHA 4KQJA 3TG2A 1GLGA 3IHWA 1JXQA 3T3EA 1R4AA 4S12A 5HDQA 2PFGA 3AUTA 4GWGA 5T4EA 2YQ4A 3W2HA 4XQ0A 4X7MA 2MINA 3U7HB 1NAHA 3R77A 1J2JA 2Q5HA 1ZP6A 3P4YA 3W5HA 5JZOA 3LC7O 4P93A 2MINB 4UHCA 3ZCSA 2EJTA 2E7ZA 3OCYA 3FFBA 1AKVA 4KLRA 3ZQUA 3DZBA 2HJGA 5DNEA 1AK9A 1NNUA 3H6KA 4ER3A 1J42A 2NVBA 1FZTA 4QUJA 1LI5A 5JXIA 1XVIA 1Q3TA 1U3VA 5ALYA 3UW1A 5KUTA 3ZCRA 4QOHA 4BMXA 3K0CC 3UNXA 5L9AA 1WU8A 3IE2A 3O4VA 4AU1A 1IK6A 1UPBA 4X8MA 3PZRA 3TLCA 4Q3BA 2EKBA 3B5IA 5EJ4A 1KEKA 1WZIA 2CYCA 3LECA 2EARA 2VTEA 3OLCX 4GAEA 2AQKA 1UJ6A 2YXNA 1J21A 4JHLA 4JLBA 2C00A 2AOXA 3DKRA 1C3VA 4YECA 2DULA 1Q0ZA 2FWJA 2C3MA 3GO4A 1WIWA 5DNDA 4KQFA 1DDIA 1BIFA 2X5XA 4XOIA 3X2FA 1X39A 1CUIA 1I01A 2NVOA 2VKQA 3ECAA 1MQSA 3QLUA 4L0CA 2R65A 3D4OA 2VHYA 1U8CB 3V8VA 2X5KO 1H2RS 1LC0A 4OHXA 1QU2A 4WXYB 1PJZA 2GCPA 2NV0A 3SF8A 4MHOA 3N59A 2PX0A 2HY7A 5AD1A 4QHYA 1JAHA 1E92A 4J16A 2WWVD 1XLTA 3GA5A 2IYYA 1XQ1A 1HDCA 3LPCA 3MMNA 1XK6A 2HZBA 3EG5A 3FRIA 1OFIA 3N5KA 3REOA 1E6KA 1O6CA 4YI5A 5DP2A 2I8LA 1D9ZA 4IF4A 1Y48E 4IRXA 1FP1D 2O20A 1K7FB 3W4JA 5T4BA 1IFXA 4N1AA 4W5TA 2JVJA 1BMDA 2ZE7A 2AWNA 1XYGA 3Q3JB 2XJ4A 4IX1A 4R40A 2KQUA 1ZA2A 1NR5A 1YS9A 2WFZA 2OL4A 2VBFA 5FPTA 1W5TA 1I4WA 1TW3A 2CLSA 1E96A 3TS1A 2PXXA 3FHJA 2E18A 1XRLA 3FW1A 2XNDA 4C29A 5L7TA 2OHOA 2E4AA 1JMVA 3CZPA 4I4NA 1BO6A 2GASA 2PX3A 4XFJA 4PBTA 5E6RB 5AW4A 3MELA 2WRZA 3MB5A 3T5MA 4TTJA 5D86A 1HYBA 3CKYA 5E6RA 2FSVA 2OE2A 5L40A 2HHAA 1W36C 4GSYA 1YJXA 1I6KA 1L5ZA 4B83A 1IJFA 1RKUA 1TM7E 3H04A 1EB8A 4Y2SA 1T24A 4D4IA 5I4IA 1A9YA 1R3DA 3PTZA 4I4TF 2EBWA 3NLLA 3ESDA 2V98A 2GCEA 4PS1A 1ZAKA 4BNNA 5I7RA 4US0R 1TIPA 2ZSDA 1D1TA 3QSGA 4QUDA 4PVCA 5AXAA 1Z3IX 5KJ6A 3RAEC 1GZVA 2JKVA 1HE1C 3SSMA 2J31A 4X6LA 2I8AA 2BKUA 1EVKA 1MX9A 3PXCX 4DF3A 2Y93A 3KDPA 2RKBA 3IV7A 4MUHA 4V3CA 2FSIA 3H8JA 5M7EA 1GR1A 3GGSA 1IULA 1V0JA 3JVDA 4EG1A 3QBVA 3DUWA 4GE3A 4AY6A 2C92A 3DZGA 2C5LA 5K3SA 5B2EA 1UAYA 1XMXA 2G5CA 3IOEA 4FZVA 1HRDA 1WY7A 1Z88A 3PGA1 1FRNA 4HWSA 3ER6A 4X8HA 3IP7A 1WBDA 2GXSA 5TV2A 4FFLA 3PJRA 3CLSC 4OLAA 1R00A 4QSHA 1XOIA 2CF6A 4BO9A 2W2KB 1UK6A 4B34A 1L1FA 2BDTA 1BU8A 3M3HA 2VSQA 3DAFA 5M34A 3GBPA 2W2KA 1D2NA 2XKJE 1VLZA 4Z9XA 1DEXA 4B4KA 4ICIA 3KOOA 4RD3A 1KHTA 5CP8A 3HGMA 3HJNA 5HMLA 4MTLA 3FMIA 3ICPA 4CM7A 3GMIA 5BVGA 4Y2XA 2E4XA 1E6WA 1X1TA 3VZBA 5JFTA 4YAUA 1ZIPA 1MRSA 2I33A 3EXAA 3G5TA 3SMQA 3I62A 5J3JA 2JAHA 1P5RA 2V1UA 4R1OA 1Z4QA 2DKNA 3CCCA 1NSFA 4NU6A 4NLLA 5FEMA 5FOUA 2HR1A 2GXUA 4TPKA 2WMNB 4X41A 5DLYA 4DREA 3AY7A 5LBIA 4JLKA 4X60A 1QP8A 2NSLA 2BFFB 2C82A 4WNAB 3PS9A 4I1PA 4H3KB 3AL3A 4INAA 3JU3A 1SOUA 1BXZA 2BFFA 1GN8A 4I8DA 2FSPA 1G8JA 2CE2X 4IDOA 3WX0A 5JS7A 1PZHA 2OPHA 2DLDA 1O7JA 2JS7A 2JZOA 4PTLA 2J3LA 1HDYA 1QX4A 1L7XA 1T1GA 3E03A 1BMTA 1IL0A 2CF5A 3FUVA 4FN4A 5E2IA 2OORC 1LVHA 3WC4A 3M5DA 1ZVVA 4BKOA 4CQJA 1WUYA 2N0SA 5DCYA 5AJUA 2QTWB 1AMOA 2GZ1A 2LZ0A 2QE7D 2WZQA 5HS6A 3S70A 2R48A 5CRIA 5J5VA 1J9GA 3Q5DA 4JI1B 1R0YA 5L95A 1D1PA 4G9EA 3FCCA 1O87A 1OROA 1LDGA 1RXUA 3TSCA 1OWLA 4BO2A 5K99A 2BW0A 2V5UA 2PA3A 5GJWC 1LV7A 3PQCA 2Q5IA 1KDOA 2DBQA 1LA2A 5IXYA 5LMZA 2W2TA 5A1JA 4CKYA 2J0QA 3DXZA 3P2EA 1B93A 1OAOA 1V4NA 3EF0A 3H2BA 4YALA 5JNRA 3O6VA 5GIPE 3QFTA 4F5WA 2AN5A 3WJ2A 3MWDB 1IEVA 1M6HA 1P7YA 2GPJA 1LJUA 3KKEA 3P9YA 1XZCA 1KOGA 5JYCA 1XZDA 4U0JA 1YE5A 2TS1A 2R6CA 4I5IA 2Y1GA 1NN3A 2Z1DA 2Z2ZA 1T5HX 4IDNA 4XYGA 3EZYA 1DAMA 2Q1XA 3AERA 4TWBA 4G1VA 1H4VB 5AVYA 2CE7A 2P68A 2YIJA 2NZWA 1E6EA 2CDBA 3KR9A 3OBIA 3C4QA 1N3IA 1EMDA 3VSAA 3VYSB 1MUUA 3GLKA 4ZMRA 2ZBUA 5DU2A 1F6WA 1R88A 3M2TA 4CCAA 4H6VA 1NBMD 4FFVA 2YFQA 5JAZA 1P60A 1S4MA 3G8BA 4X00A 1TLFA 2IXAA 1TF7A 3ZKWA 4E03A 2OBLA 4WGFA 1PGOA 5JXHA 1AV6A 2YCLA 3VSCA 1A0OA 1MQ8B 4DHWA 1A8IA 3ZKWB 2F3QA 2VUHB 3IBFA 4JBNA 4P34A 3RAJA 1KSFX 2PIDA 1QG6A 2DH5A 4OL9A 1L3CA 1EAMA 4O4JF 5JLAA 2NPFA 2NMVA 1YU6A 1RQNA 2MSKA 3K7EA 4B76A 3HKEB 2GBLC 4CMGA 4C0LA 5BN4B 4GZ3A 4JI7B 1HA3A 1HT0A 1K86A 4WKNA 4HDOB 3T7AA 3WGYA 1RJWA 3TO5A 3SVTA 1J90A 2DY0A 3AKEA 1KI2A 3BEDA 2AHOA 4G41A 7REQB 2QJOA 4YQYA 4HNQA 2OQIA 4L3OA 1TUBA 1JN0A 1TMKA 1RC1A 2DOKA 3E82A 4G09A 3UTCA 3OCJA 4YX9A 5HHTA 1GA1A 1M5RA 2WSLA 2VWGA 3UH1A 1OIXA 3B38A 4H2DA 3T4EA 1QVAA 4LXXA 4WJKB 3TGPA 3K5IA 1NJ6A 2H29A 1K75A 3P9QA 2CMHA 2OM6A 3HKDB 4E6PA 4ALKA 4URHA 5FTNA 2YFHA 3CH4B 4WOPA 2IH2A 1QE5A 2VT7A 2FSHA 3PCXA 1J0AA 4MQLA 5CW1A 4ZJYA 1XMOB 3O8RA 1WHSA 4YP9A 2W6QA 4ND3A 5A5EA 2I9PA 5IP5A 3A4NA 3WGLA 1GTRA 2ZJOA 3RUPA 2BJHA 2FV8A 1QANA 5HG0A 1U1CA 1NVXQ 1WUHS 3TNLA 3L6DA 4ZVRA 1GITA 2VZLA 1E9DA 3T5AA 3OKAA 4UJ5A 3DOCA 2ESRA 3I53A 3QGMA 4L5AA 4DILA 3O26A 3ZHBA 5J2TA 1XD8A 2ODPA 2F8MA 4CIWA 2VP9A 3WNDA 3T52A 1R3UA 1VP3A 4Q9DA 1YQQA 1E9VA 1RCUA 2N9UA 4TKUB 1DPGA 3IVXA 1C8LA 4J9UE 4XM1A 5SY6A 4WN3A 2PQ6A 1L9XA 1GKUB 4UXIA 1FJGB 1II8B 5KTSA 1Q21A 1ZGCA 1CY8A 2PRJA 3TIFA 3RO7A 3LUKA 2JCYA 1HE5A 4BN4A 1VE1A 4Y9TA 3H97A 3Q87B 3RKUA 2HAEA 3SJZA 4GPBA 3ZI4A 4X7PA 3QQPA 3TZ6A 4AROA 3MTDA 3RC7A 1W4ZA 1YE3A 3E5NA 3PHHA 4KDCA 4UBJA 3UB3A 4BNFA 1RJ9A 1Z18A 2ZZNA 1QQ5A 1W47A 2E4YA 3C14C 3T35A 1RHMA 5MFZA 1YRBA 3I64A 5AQ1A 3PNLA 3O21A 4QA9A 5DNWA 4A2QA 4QG7A 2NQ2C 5H3HA 3GJTA 3WBJA 3PI6A 1I10A 3MF4A 1YQTA 2ZDHA 3HXOA 1G5TA 2CL5A 2H1LA 1UC4B 1R9MA 2ZT8A 5FBVB 2R8RA 3BD9A 4QOJA 2CY0A 1YZ3A 1ZHOA 4Q1VA 1FTYA 4PBRA 2P5UA 1T2AA 4B4WA 2HMSA 3GROA 1B0UA 2IIPA 4XM2A 4DBLE 3COVA 2B5WA 2IYTA 4CMEA 4F7WA 2O59A 3AEUA 3QPVA 4IVRA 2QR2A 1C3JA 2IPXA 5GZ1A 2FI1A 2XI4A 2OR3A 5FFMA 4CM8B 4FS8A 3GUZA 4TYNA 4LJLA 3HS3A 1M83A 2NP7A 1N4DA 1EUZA 1MC5A 2R5NA 4TTIA 4E3ZA 1ZOLA 1GADO 1JPNA 1Y9DA 1DT5A 2GZHA 1V3VA 4FT4A 5K8IA 3P9KA 2H4FA 2J0SA 5ELXA 3MMZA 4OA5A 4CG3A 2F64A 2XNHA 1MIOB 2QTRA 1MXHA 2Y1FA 2BFWA 3D0QA 3DZDA 3CY6A 3WNCA 3KTAA 3JVVA 1XWIA 1CUAA 1N7HA 2RGDA 4MUYA 4BP1A 1P8JA 2MYTA 4EA9A 1SOAA 3KTAB 2LV8A 1GG5A 4RS4A 4ZZIA 2P62A 3HP7A 2Y6VA 1H69A 4RHCA 2BELA 3NBZC 3DE2X 1C8BA 2ADMA 1M8JA 5C0OE 1RJGA 1UOQA 3DF9A 3PSAA 4FWIB 4XJVA 4OI0A 5CLQA 3L93A 3ORYA 2CYBA 1DQSA 3QKRB 1UJMA 4LBWA 4ARUA 4W7SA 1MZPA 4M8NE 2WJ6A 3MAAC 3L7OA 3V6MA 1TTPB 4P80A 1OFTA 4UVIA 2G7MC 1DWOA 1YVEI 2IOQA 3C39A 4PZAA 5ESXA 1WDLA 3SIPA 2GETA 1X92A 3G13A 1SQSA 5ESWA 3O8QB 4BX0A 1QH0A 3U4GA 5KWIA 1ZWLA 1H1DA 2XLCA 4FDMA 4HNAA 1L7OA 4AQDA 4BMYA 3O8QA 4LY3A 1FVFA 3HR4A 2DFKB 1IM8A 1TM2A 2X2PA 1RYMA 1YNSA 3BZBA 2WY2D 4EB6A 5IUJC 5CD1A 1WDMA 1SUCA 5DFAA 4MO2A 4CEHA 5IH7A 4C4AA 1KHHA 4ZALA 1CY2A 4GSLA 3RREA 4TV9F 2PRZA 1SHZA 3VU1A 3V8PA 3WNVA 3ICOA 2AI2A 2R00A 4MRVA 3TLAA 4M6WB 5FTJA 5IAKA 1B3RA 2JLSA 3A31A 1GGJA 1GPUA 2A2ZA 1XNRB 4XOUA 2ZYWX 1G5HA 4ZHQB 2Z9DA 1DV1A 5J5CA 1YONA 4RJKA 3PT9A 4ZHQA 4E1AA 1PJQA 4TSFA 1TA9A 3S8EA 1XROA 1UBKS 3KR1A 1VL5A 2GFHA 4NARA 4NZ9A 4RKQA 3N2KA 5CLJA 2ZU6A 4GC5A 4QNMA 2PCLA 4XVRA 5I5EA 5JJCA 2QL9A 2AUMA 1L7QA 2C7RA 3DXXA 4PG4A 4RIEA 1IHYA 4POAA 4Q6WA 1O6FA 1KF0A 1U02A 3V7WA 2Q2VA 2B3TA 4B7XA 4QDUA 3W1EA 1KP2A 1D7OA 2B78A 2C8LA 3HL0A 3NS7A 4TSFD 2BGRA 4NX2A 2IXGA 4DIDA 4N39A 2F59A 5EWLA 1XZIA 5FBHA 4A0QA 2B1RA 2OEPA 3L0YA 4H0CA 4EMSA 2G0AA 4BB9A 3CX8A 1DEKA 3IIMA 1KMHB 2AXEA 3GK3A 1I3OA 4HBZA 4ND4A 4R2MA 3R7WB 5A02A 5JV5A 2O52A 1UQUA 3N58A 3EAQA 2EG9A 3E22A 4LDQA 4TOIA 2LKDA 3M1AA 3GN2A 2Q4BA 621PA 1P6XA 3NM6B 1EM8A 5ALPA 3LPLA 1C9YA 1D2RA 3VRHA 5AESA 2ID9A 2VK2A 1KDZA 1V11B 3ETGA 2QS9A 3W8RA 1Z35A 2H52A 3O73A 1Q0SA 2DTEA 2O7VA 3GFOA 5FTMA 3OQOA 1B6GA 2DGDA 4JBHA 1O03A 3N5CA 2VF7A 5KKAA 1BKDR 1MTOA 4TS3A 3QEMA 1MZVA 4BFSA 4BDTA 3AVTA 2QY9A 2VHUA 2R62A 3ZHRA 4HQLA 2IWHA 4C03A 1RI4A 1U0RA 1ISRA 2I7DA 3LXMA 1J06A 1D0IA 1JLRA 1B23P 1Z4NA 2O2EA 1M7BA 2Q4RA 3OZIA 5E7QA 4X7BA 4L9RA 3CF6R 5LIRA 3T3GA 1UZAA 1GQOA 1QFMA 3GDFA 3KWFA 5DM2A 3W1VA 4BMSA 2VNHA 4MMZB 3F71A 3AHFA 2PLNA 1PFWA 3X1XA 3Q41A 3CEHA 2FSUA 1XTVA 4DARA 2QP9X 5EIBC 4B3CA 3BF7A 4GOKA 5JALA 1K68A 4KTTE 4Q9HA 2O3TA 1X19A 2GX6A 3DTTA 4C1BA 3LUPA 3L9WA 4G6ZA 4JQSA 3FDIA 3OFNA 4HATA 1XKXA 1GVHA 2NZUG 4BZXA 2ARKA 4NL4H 4S1NA 1UUFA 1JIKA 4ZYTA 4Q3DA 1RD4A 4PAMA 2GJSA 4OQNA 3RHZA 5KVVA 3WJ7A 1L5FA 1RYDA 1Y1RA 4W8HA 2J30A 3ZWMA 1OR8A 1R0KA 1Y5NA 3RI3A 4F1JA 2BY4A 4F2HA 4G01B 1N7JA 4IVNA 1NYRA 4M4SA 1I2MA 1Z37A 4N7MA 3EXG1 2JIRA 4JB2A 4IV5A 4AYTA 3RUHA 3EA0A 1QM5A 2Y0PA 4CF3A 1P2SA 5KTMA 2DR2A 2J0EA 3FH0A 4XTCS 3UK6A 3F3KA 4EUHA 4O63O 3GRCA 5DHTA 3C3KA 2BUBA 1CVLA 2RGNA 4BO5A 4E5UA 3BMQB 3O2NA 2IH4A 1GZ6A 2J5QA 5FDFA 2D1SA 3KLBA 2XMCA 3K8OE 4R84A 3WG9A 4DJ5X 1NLMA 2VHZA 3BMQA 3VTKA 4NTZA 1AE1A 3KJQA 2PM8A 3VH2A 4QBTA 3FLEA 3L01A 3HVHA 3K3PA 4LHZA 2ZG6A 1UBRS 1QTIA 5ARCA 1AG9A 4XIIA 5F21A 1PTKA 2CJYA 1M2KA 1V2HE 1Y6ZA 3ONVA 1G3IA 1UPTA 4FWBA 4QGFA 4V2UA 3ZWCA 2IPLA 2CT8A 3FZGA 2F4NA 5ADWA 5CJJA 1GO2A 5EUCA 1TECE 2OAEA 5BSTA 1K88A 4AJ9A 4FYXA 3PV0A 3RC9A 3PE6A 4ND8A 3UJCA 1GT91 4IUBS 3K9LA 2OBBA 1ETUA 2OUKA 3GRAA 1BGXT 4P3OA 2FVXA 1CEEA 3V4LA 4ND8B 1EX6A 2SKDA 3TUIC 3HJRA 4Z53A 1DXHA 3GD7A 1K9VF 3R7SA 1FNCA 3RFXA 2BUAA 3OE7D 1EBFA 3CRRA 3ZVRA 2OZEA 3IERA 5JYBA 2C54A 4FTWA 3IIIA 4QOIA 3I58A 1DU4A 2OO3A 2QUBA 2QX6A 4HLQB 4KV7A 4YQFA 4RF2A 4IUDS 3ZVLA 1CUBA 2IKSA 4AB1A 1E9BA 4PSKA 4R1PA 1FYWA 2FOLA 2OKGA 3HDVA 2FE4A 2JH9A 3WGVA 3L82B 1K8RA 2Q28A 4JQYA 2DP4E 1SRRA 2HD4A 2R44A 1K97A 3JSAA 4RDHA 1E4EA 2VYVA 1IPEA 2GB4A 1JDPA 4XWGA 2Z5GA 5F78A 3W34A 2I2DA 4A5OA 1VG0B 3UJ8A 3IV9A 1AF7A 4EYKA 3VJMA 4UNSA 4EHIA 3RS4A 2GYVA 4QUAA 2AMFA 3VYWA 3WLQA 4EVQA 1FSZA 1RRMA 2B25A 3QYJA 1SAYA 2G06A 2QRLA 3B2NA 3LLMA 4N40A 5KYXA 3RIGA 4AULA 3FVRA 4GPAA 1HFWA 1FY2A 4LPSA 2HEGA 4I19A 5KYWB 1WA5A 4EELA 4FUQA 4KXYA 2VPQA 3OM0A 2R2AA 1QP7A 1RJEA 5LZ9A 1I1NA 2G1KA 4NG5A 1KXJA 2O2ZA 3KV3O 4HRXA 3SM3A 5JHGB 3ELYA 4FGUA 4AL4A 1DGQA 3PNSA 1X0XA 2IY7A 2RJ3A 1Z2AA 3JWEA 4ZOBA 5FQNA 1AK2A 3DNMA 3PQ7A 4MINA 1QYVA 2KX7A 2IZ0A 2WYUA 3P4XA 3HR8A 4Y6GB 4E5YA 4I6GA 1L4MA 4HS4A 2GBPA 2X9LA 4GLLA 1N36B 3GZJA 2VJQA 5FFNA 1H6AA 4YRLA 1GTZA 5IC6A 3IUNA 1Q15A 4B6PA 2IDKA 4OKSA 4WCFA 1OKKD 1K8XB 3N86A 4HVAA 2RD2A 2IUFA 4EJSC 5K4AA 4J49A 5DEIA 3RYIA 2I55A 1PYGA 3T5GA 2X7HA 5JAMA 2QPLA 2HPVA 2J5XA 4W7IA 1VMAA 2PBFA 4KVAA 3RYIB 3TOCA 3WLNA 1EUCA 3QLVC 3BGIA 4RIHA 1Q12A 4PGHA 3WIOA 3WVNA 3EBPA 1EUCB 1TVMA 1WQ4A 2V9ZA 1CJTC 1CCWA 4AS3A 1U31A 4RC9A 5IAOA 3IL2A 2R87A 4HEA1 1U2GC 1UM9A 4F2GA 4EVIA 4O4JB 3ZW9A 2WHQA 4PSCA 1B2RA 2XYPA 2PEZA 4MKXA 5B55A 1O57A 4W8OA 4O4JA 4S0ZA 1WUIS 4GYWA 2YYYA 2XGJA 1EP2B 4PCUA 3EG9B 1JU9A 1U1IA 1NOJA 4YPVA 4LOIA 3EHDA 1G4AE 1HKHA 2ZTLA 3L4BA 4P54A 3EX7C 1DTSA 1XHEA 2NP6A 4QQKA 4WZ6A 4ID9A 4MS1A 1HTBA 1ZBDA 4X1YB 3U81A 2BKAA 2CN1A 2EXXA 3K30A 3LSTA 3OQJA 3PHGA 3ER9A 1PR3A 3RPEA 4CDMA 2YOHA 1YMQA 5A7GA 1NJGA 2ON6A 4ZI3A 4H18A 1G1MA 4G1MB 9GPBA 2IEZA 4PLPA 4WL0A 2IS4A 1HSZA 1K92A 4D26A 1MENA 3A6DA 2IRWA 1X1SA 3KWMA 3WHKA 4G4IA 4TRJA 4ER7A 1X70A 3UPUA 1S3GA 3AO0B 4KXFB 2GEUA 2ORYA 1XPOA 1J2YA 4M1KA 2HW8A 2LKCA 1P0IA 3BF8A 1E2NA 4DAOA 5AJZA 1VG9B 4EZEA 3AFOA 3ROXA 3GEGA 2Q4DA 2O1XA 1OZHA 4HEQA 4CW7A 2P9QA 1OH6A 1P1JA 5JW6A 4UUPA 1HQKA 4DRXB 1PJ4A 1BJRE 2B98A 4OATA 1JL3A 2D0DA 2VRCA 3BTOA 1GGFA 4HQ0A 3AL2A 3GAFA 5AI5A 5ENDA 4DRXA 2VWPA 1WPXA 3L0IB 3I09A 2PUTA 3LBYA 5KVQA 3PPVA 1PVOA 3DEFA 4HAUA 2WOOA 2HJWA 2Q0HA 1E20A 2Z1MA 1SD5A 4KC0A 4U4AA 1W6RA 1WNTA 2EF0A 1LUAA 4Y2GA 2WZBA 3M6WA 1Y1LA 6YASA 4ME6A 1VE3A 2VJDA 3REQB 4O4LF 1JILA 4FC6A 2FR0A 3WSTA 4PINA 2HQSA 2IYWA 3C98A 2PG3A 2V0NA 3R3JA 2PH3A 2JCSA 3EDQA 4GMDA 3ZUPA 1PWHA 2YY5A 3QBTA 4P08A 5TEVA 3NEJA 4DTCA 2Q21A 3LJKA 1UMDA 2LNDA 2P7IA 3GJSA 4G5XA 1YR2A 5L4SA 2VCYA 4QTTB 2AF3C 3AINA 3GDWA 1SUDA 3O83A 4A82A 3MGBA 5EP2A 3BEOA 4ZYWA 1T8TA 1DZ3A 4G89A 1MEEA 1NBME 1NDQA 3DBRA 2IKQA 3BXPA 5JE8A 1OC2A 3VSEA 3EB9A 3HFRA 1DKQA 5DWVA 1ES9A 1PUJA 1T2VA 3HDJA 2Z3ZA 5L3QB 5KCZA 3ZGLA 2O1EA 4C2AA 4F4UA 4MQEA 3DQPA 4RM2A 1F3LA 3JRWA 1IHOA 1TX4B 1OX5A 1YOBA 2AFIE 4OJNA 1QHEA 2V6FA 1WXHA 4RQBA 1GG9A 2G9NA 2CV2A 2YJGA 4ARVA 1ITZA 4BDSA 1M2VB 1MU0A 3FJ1A 4N5DA 1CY1A 1YZQA 5DYTA 1TGVA 1A2BA 3HU2A 4P82A 4PRYA 2XNDD 1N3LA 2P3SA 2G82A 3BA6A 4IO1A 4PLCA 1Q1AA 5EXSA 3KKQA 3TOZA 4IZ6A 3U44B 3WL8A 3L3BA 3MA0A 2HJ9A 2WV9A 1ZITA 3GU3A 3H2SA 3MMSA 4RD6A 5JSYA 4EL0A 2Q5LA 1J97A 4M8IA 5HR5A 5DBGA 4ZQCB 3GJQA 4BQSA 1ECCA 4NCXA 3JQ7A 4HNRA 1SXJC 3EWNA 3IR7A 4GUDA 1SY7A 1WMEA 1BMQA 3ENQA 4WAUA 1FFAA 1EGAA 1IZ9A 4GYJA 4LGVA 4WMLA 4BQFA 3KETA 1J9EA 3M4ZA 4WZAA 5KI6A 1J56A 4HNSA 3MWDA 4HQRA 3SYRA 2GVZC 4UOQA 1QPBA 4URUR 3B82A 5EWJA 1MNAA 1YA6A 2D62A 3OZEA 2FWAA 3MLEA 4RVFA 1DOAA 1K7YA 4IFIA 4K6OA 3RJMA 2WIBA 2ISCA 3DTVB 3SIRA 1LC3A 5JJKA 3TX2A 3S99A 3DMTC 4RMNA 5B2FA 1FEZA 1H4QA 2F1JA 4ZT6A 3DTVA 3B1ZA 1CUUA 1LCIA 4RF5A 5DYGA 3RGWS 4FGJA 4QYIA 1GZSA 1J07A 5K6TA 1NJ8A 4NDAA 1R6UA 3DW1X 3ABSB 1XUOA 2FP4B 1KPIA 4QYIB 2Y1KA 5EHQA 1RM0A 1SIUA 3PE4A 3TIGA 4JNCA 3ZLTA 4RD2A 2XTNA 3UT0A 4M1QA 1XJ0A 4YUXA 1EJ0A 2V7TA 4AZTA 4F4JA 3NHKA 1SMKA 4UBKA 1I8TA 3HKEA 4JITA 3K92A 1MIHA 4JC5A 5IAGA 5CVJA 2I3BA 1TJPB 3BAFA 4A6XA 3OOHA 1AC5A 2YJ5A 4MQFB 1QK3A 4HQ6A 3U7JA 4J0GA 1JNYA 1QHNA 2X9GA 2O3SA 4NYIR 2WDPA 3T3PB 4B47A 5LM3A 4YRTA 2XZOA 2Q5OA 1DKNA 3JQBA 1TUBB 4P33A 2RG1A 3CU5A 1DLJA 4OGFA 5K51A 1HLGA 3DPIA 3M9XA 4YAJA 2RGWA 1D6NA 1P0CA 4JXJA 2SHKA 2N3ZA 3G1UA 2D1YA 5DM60 3P2JA 3KUDA 4Y2QA 5A5GA 3AXSA 3IIKA 3FWZA 2HEIA 4LXHA 1QQ6A 1XCBA 2JLBA 4QUIA 2OWEA 4A8JB 2GHQA 3Q7QA 1KQGA 2VZ8A 3IEIA 1YQXA 3FCAA 1EXMA 4GMGA 4GSKA 1AZSC 1W2HA 4BLWA 2JCXA 4KQKA 3EIFA 3SBDA 2VA9A 4A7PA 1UP7A 4ML3A 5DVZA 1A27A 2ZBDA 2DFDA 3LVQE 5EHGA 1W75A 2OD7A 3E70C 2A30A 3IC5A 4PANA 5E1DA 5KYTA 2QSUA 3OH8A 1WXIA 2GZ2A 3DDSA 1CZUA 1D6SA 2HU5A 4Q39A 1PX2A 3PJFA 5AM5A 4URZR 4X54A 2AOUB 2UVPA 3A6EA 1B8NA 3ANYB 3DVSX 3KPVA 2BCEA 4NOKA 3S6JA 4HUJA 4MEJA 1CQIB 1SHUX 1Y4ZA 3NHJA 1T43A 3HNRA 2I71A 1ECPA 4URFA 3WL4A 5AHOA 5LCXA 2GNAA 3ETLA 4RPHA 3BIXA 3FRHA 2EHJA 4LGMA 3STVA 8OHMA 5TEWA 3FNHA 1YA4A 4LOLA 1SCKA 4N0PA 5G0UA 2BTEA 3ZJTA 4RKFA 2FJUA 2FFRA 3BE4A 3G23A 3GJ6A 1RPAA 5J9FA 1P7CA 4Z9AA 3LLSA 3UWSA 4AWAA 4GPD1 4B4OA 5KX5B 1S9DA 1GYRA 4R1NA 3KVYA 1FNSA 1T9HA 4D3ZA 2QVLA 4BLPA 2KBFA 2PRKA 2XE4A 2QLBA 2JBHA 1SZPA 2B35A 4JOCA 5HCNA 3R5HA 3V3TA 1B16A 4X20B 5KC9A 3BL8A 2FDXA 3UKJA 5D1NA 1PJTA 1XZJA 4X1KA 4CKZA 5HKKD 4YASA 3CMMA 3WSWA 1T9ZA 4IY1A 3SYKA 2ONJA 1PAUA 2IYXA 1Y7HA 2NO6A 2QMUA 5C8VA 1IE3A 1JIJA 4KITB 5K6RA 4EWLA 1JQJC 3GCZA 1RI2A 3B7WA 4ZZ0A 3BMOA 1NM5C 3PUHA 4K87A 2ABWA 1E5QA 4IOLA 3IPRA 5BRAA 3WMWA 1CYEA 4RMHA 1N3YA 1OTYA 3GLSA 1J25A 4QICA 5H0IA 1PVVA 1A8UA 3S3TA 2HSDA 2QUIA 4BXOB 3QEAZ 4N3AA 3AP1A 1RXVA 4CT4B 3NVKI 1JU4A 4NEQA 1E1NA 2CNDA 1X8XA 3LYAA 3PD0A 5G53C 3L7DA 3R7LA 3QE9Y 3SEFA 1RCFA 1ABBA 3IEVA 2O0MA 2OFWA 1JG6A 2MOKA 3ZOKA 1FTWA 2DWPA 4HNVA 3EUEA 4LC1A 1KO1A 3ST7A 4KUHA 4BMPB 1I5OA 5C32A 4X1OA 2NVWA 2B9EA 2OV2A 4HL6A 4BV2A 5L4LA 2VHXA 2ZT6A 1OX6A 3F5QA 3L46A 4WA8A 1HL3A 3NIGB 5HZGA 4FFPA 4KR3A 4B7CA 4QVKA 2V4UA 4DY6A 2JFZA 1YHYA 3HRKA 1TRKA 2VS1A 4RCYA 5BSMA 1E3WB 3OPMA 4WLOA 1TU0A 4II2A 4R9RA 5BV8A 1FYEA 1YBMA 4QYXA 4D43A 2ACVA 1BMFA 3HGQA 5E7JA 2WIKA 1H05A 3MEQA 1NIJA 2C3PA 2ACEA 1RW4A 521PA 1GYQA 2BC9A 2H00A 3Q2OA 4LNAA 3GXBA 3PJGA 4BAUA 2B4TO 2WTBA 2C3UA 4Y1EA 3V8MA 2ZUDA 3HJCA 4N0EA 2ZR9A 4RL6A 5B57C 3JZAA 3H5LA 3IDQA 4X6UA 4HADA 5CA0F 1ZX1A 4R2XA 2ONZA 3AQIA 2NSDA 3KSUA 4R81A 4AUNA 1L5HB 3BUSA 1O94A 3C5HA 4AD8A 1QFSA 5ALIA 4KFRA 3ZWVA 4ED9A 3OTGA 1OJLA 4HNAB 2Y1WA 5CUQA 3DZCA 2CSUA 3S1AB 3GD5A 4OVKA 1W94A 3Q8XB 4BKMA 1A04A 3G8CA 3GPBA 1HXHA 3HY6A 3NBMA 5B36A 1ATIA 2F3PA 2P2LA 5IF9A 4W5OA 2ZZMA 3ZGXA 1G20A 1S9HA 1Z5VA 1SUWA 2NLOA 5C4IA 5I7VA 2QUJA 1FP4B 1PSWA 1ULAA 2HMUA 1B8UA 3PDIA 4A8PA 2AXNA 1TQHA 5BN5A 1HBJA 1UMCB 2YHSA 1ZMRA 5HIKA 4PYJA 4HWTA 4JV5B 2CMFA 2Y0BA 3USCS 4Q9JA 2H57A 1UMCA 5BR7A 1Y3DE 4YRIA 3W3AA 4B8YA 2DFNA 3FWPA 2VCHA 1SBQA 2VTBB 3IKLA 4AX8A 5CGZA 3AR2A 1J0XO 5KHLB 3FR8A 1DMSA 3CX6A 1T0UA 3OM8A 1CY0A 1KR2A 1I0IA 4M0FA 3WRXA 4ROSA 4EI8A 2B3DA 2FPWA 5F7ZA 3GRUA 1N57A 1ZD9A 5ALMA 5B3AA 1YOVA 3VI4B 1TT5B 2UYCA 3BXHA 1GIAA 1AHNA 1AHHA 3LQKA 1FQWA 1NG1A 2PUVA 5CCXA 3I6ZA 4UMVA 2XXBA 5KHOC 4MWZA 2PO7A 1XSEA 1XVUA 3BKWA 2NG1A 3C45A 1XDGA 3R9XB 1NUSA 1UJBA 4N3CA 2AN4A 4HUQA 2EC5A 3KXIA 1JEYA 3PJDA 3NUQA 5C4MA 3HK2A 3E22B 4BNMA 3EDMA 2WFLA 3EW9A 1L5GB 4J90A 1EM8B 2YWHA 5EJ7A 4E88A 4YXFA 2V9CA 3CEJA 5EQDA 4DLWA 1I6MA 2C5SA 5EJ9A 1KR5A 1KEUA 2WF7A 5M5BA 5EMKA 3ZKAA 5HF8A 2FMUA 2HU8A 3RVNA 4YYZA 1JF8A 4XTRA 5JQWA 3VNUA 4KQMA 4RSGA 3HBLA 1X38A 3ZE1B 4UUOA 4RHFA 1RM5A 4M9RA 4B6RA 1KOLA 1C9JA 4M53A 1A7UA 1JDJA 1X9IA 1VCIA 2WSIA 4TXMA 3RKSA 3BD6A 2AYXA 4PU0A 4A9AA 1ZAYA 4OBEA 1HE2A 5PNTA 1CE8B 3OJOA 1DADA 2H51A 1ZO8A 2ZYVX 3K35A 2WIDA 3L8GA 4MKZA 2D2FA 4U5XA 3VOTA 1E66A 5D8DA 4JYZA 4BO1A 3ZZUA 4PTZA 3VA7A 5IK2D 4JLPA 1GAWA 5C8YA 1EBBA 2GM4A 2AOTA 2BSXA 2QXYA 2W93A 1YR7A 2YVQA 2YS6A 1G19A 2OHJA 2ZSEA 4M46A 4RKYA 1E8MA 2AOTB 2VH1A 3NXKA 2V3WA 3IE1A 4V0RA 2AB0A 2YHBA 4X0EA 3FX2A 2B4AA 2VPXA 3OLVA 4R9SA 3D3EA 4DEXA 5C8ZA 2VUSA 2XMRA 2JLXA 1OI2A 2X4IA 1OYOA 3GV0A 2Q6KA 3MNFA 3NUGA 2W4IA 4EK9A 1VE7A 2ZULA 1UAAA 2V7PA 3P71T 3HR7A 2GYYA 3ZWOA 5JG7A 2CXSA 1JEEA 1FNDA 2RHMA 3A1FA 2AN1A 1SD2A 3FDXA 4FFRA 1WULS 3V1NA 5ARBA 1GDDA 1BCSA 3A7EA 3QH4A 3N2GB 4L22A 4F2WA 3H5RA 3L7YA 4Z9YA 1JVBA 3RVBA 2O7RA 2V59A 5AI0A 4GDFA 4GKVA 4NPAA 3I5UA 5TX7A 1BKYA 1VIYA 2M2IA 3HJTA 1KK3A 1VM6A 4O4HA 4RDCA 4I9UA 4D7AA 3GLGE 4DLZA 1YK1A 3KJFA 4N03A 4C4PA 5I3ZA 3ILHA 1BHQ1 5K0TA 2VLBA 2ZROA 1ZXLA 2P67A 3GLGB 2ORIA 1EP3B 2IOFA 2OMKA 4PZDA 3V1MA 4DGQA 5JMOA 1W49A 2PKQO 2CLOB 2MR6A 2RI6A 1Q22A 3KJEA 2HT6A 2C2ZA 4MVWA 1W59A 2P9EA 1I1HA 2ENUA 2DBRA 4PO3X 4QL3A 1I7NA 2QDKA 5EJMA 1G3UA 4QGBA 2VRNA 3Q40A 3FRJA 1AX9A 1Q1QA 3ODGA 2SKCA 3TTWA 2HYIC 4EFKA 1HE8B 4G81A 5ITWA 5JJBA 2R6ZA 3IP3A 2G88A 3RRNA 4L9AA 5ESRA 5TMPA 2Q5CA 4ZOAA 3NONA 4Q15A 4Z9BA 3QKSA 1TB4A 3WLAA 2A1TS 1NKSA 1GXSB 1MDBA 3K9CA 3DQZA 1J8QA 3UT5A 4IDBA 3ZXIA 4EF5A 2WUVA 3KQPA 3L7IA 3COSA 1SKMA 1P19A 1ZWKA 3FCEA 4KSCA 3TMKA 3RQSA 3V4SA 3VC3A 1I7QB 1E9FA 4RORA 2CUKA 1O9BA 2Q6LA 3U7EB 4OQPA 2F8LA 3FVVA 1UC8A 1J2TA 1EFRD 4A2WA 2WG1A 2X7XA 3RIMA 1AUXA 4DPMA 2XYGA 1B4DA 3PFCA 4N4AA 1UBUS 1LRJA 721PA 1M2OB 2NYVA 1BDIA 3OEYA 1DAEA 2EHDA 4I1RA 4PAGA 4HBGA 2GWHA 1RXEA 4J1QA 5DX0A 1VKZA 3BSYA 2BBTA 1XCMA 3IPLA 4GEGA 5KYWA 3GLFE 1P77A 1QAQA 1QHHB 1MJFA 2P79A 1QGAA 2Q27A 1U4SA 3GOQA 4IMIB 1KFKB 1YJBA 3F90A 4AF7A 2O6LA 3EVAA 3QEOA 3U1VA 4GVXA 3CNEA 4L08A 2VK8A 3IAM1 1U0JA 1F2TB 2QI9F 3MWLA 5AKEA 2VDPB 4G23A 5JEDA 5FUXA 4FHGA 4S2EA 3UBTA 2GEDA 4HS9A 3T0FA 2FPGA 2J3IA 1DQYA 1XDWA 4GMHA 3ZK8A 4CDRA 1XCLA 5D6OA 4NENA 4MYRA 5EUBA 2IL1A 3LFUA 2OFOA 4WCFB 2BONA 2IVZA 3D7LA 1W88A 5IWCA 2VSYA 1M75A 2QM7A 4NJMB 4RFSA 5JISA 4V0QA 2I2AA 3DG9A 3N7AA 3W7AA 1W88B 4ZQGA 1E6CA 1JLMA 1EA7A 4MPDA 3FTQA 1JE0A 5DMHA 1NL3A 4KGDA 1DS6A 1SK9A 3JQQA 3T5DA 1GZ7A 4FJ1A 2WLSA 3HI6A 1YDGA 1NYLA 3VR2A 2AZDA 5EIFA 5AW7A 1IHDA 1G55A 1G66A 2FRDC 3E35A 2H9IA 5DGHA 3ZZMA 1QH8B 3RC1A 4XWKA 1PDWA 4D9IA 2PAFA 2LWIA 3QE3A 3EG9A 5CA1F 3C4JA 4HX9A 1SCQA 2OCIA 2QAJA 1KA9H 3KOMA 1G21A 4I9GA 1FPQA 4V0MA 4D02A 1E1RD 2YWJA 1PJSA 1JBQA 3WLRA 5JAOA 4TWJA 2R96A 5EXDA 4JBYA 4WFKA 4ZARA 4NU8X 4B9AA 1G21E 3D6HA 3LKZA 1H0SA 4LBZA 4TZKA 4KAFA 2RDMA 1QZTA 3CINA 1ZIDA 1VRCA 3BZWA 1R0CA 3SC3A 1H5UA 1GSAA 3C24A 4R1LA 1U8YA 2VHJA 4OYRA 3UMGA 1HZZA 2Q6IA 1G7RA 4G5HA 1OZ0A 3DV0B 4OJKA 5FPQA 1U8TA 4UFPA 3I28A 3KBBA 4PS0A 1VFPA 3L7KA 1H42A 4E07A 3DV0A 1XD2B 3N6XA 4BBZA 4ENQA 4WXPA 1KZHA 4X64B 4RTOA 1P9OA 1NMSA 3RTCA 2I1QA 3Q8WA 4R69A 3PXXA 1GNLA 4P7JA 2OYRA 3ZYCA 1CIVA 3RD5A 3CZ4A 2GD1O 4QUKA 5EZYB 2DHDA 1H5QA 1J5XA 2D3TA 2PSHA 5EZYA 1T2DA 5ED0A 1W96A 4X61A 4CZ2A 3UGJA 4B3MB 4OLBA 1CEYA 4MRNA 2N1BA 4J07A 4N3NA 4E51A 2XUQA 3GT0A 4G1BA 3LNCA 4JBIA 3EEIA 3A14A 1WP9A 1LQ2A 4KR2A 2ZSAA 2FJ0A 4C3UA 1C9NA 3IEPA 3IP6A 2Y1LA 3I23A 4LX0A 4RKEA 5KDDA 1MLDA 1HFEL 2ZJ4A 3MS4A 3G9QA 4JLMA 2Q7DA 4PX9A 1W44A 5NLLA 1IRXA 1F14A 2APJA 5FNVA 1RWBA 3AUSA 1EDDA 4C4SA 4CKEB 4KPEC 2JRLA 2WMDA 1YZTA 3D5EA 2WFMA 1UIMA 5JPCA 3WDLA 2Q4TA 1KBQA 5IYZA 4DGSA 5KU1A 3AG5A 2BTOA 3FETA 3JYOA 2D5AA 4U5QA 5INTA 5K3BA 3H6HA 1RWVA 5AUNB 2C97A 1KMCA 2XODA 5TGDA 4Q21A 2WWIA 2YZ7A 4MCJA 3DBRB 4L7QA 5SZJA 5K8CA 4ABYA 4FCWA 3QWBA 2HA0A 4LSWA 3EWIA 3OOJA 4MPTA 2K2QB 4B7AA 4BQEA 2Q3JA 2J6HA 1AH2A 2V97A 5CNJA 5ALJA 3R6WA 3H84A 1X7XB 2NXNA 2XCTB 1ZI8A 4C89A 3IMFA 4IS2A 3GDOA 1MRNA 2WT4A 3U7QB 3NAMA 4KR7A 4IHKA 1CJKC 4CG0A 3IKVA 4J4HA 4EFNA 4MW0A 2AX4A 3T1NA 3EIQA 5KREA 1BDJA 5TF0A 4ACBA 4XCXA 1DZIA 2ERXA 3MCUA 2IH5A 4G0QA 2VBGA 2VWHA 1T5OA 4NBSA 2B7LA 3OTOB 2BBWA 4EG0A 4M54A 3W7VA 1GPDG 4DCUA 3QRWA 2HJVA 3QXCA 5I9SA 3WGJA 1R8QA 4MIYA 3UO8B 2R751 4H1HA 2H1CA 2HSJA 4ZJPA 4ZK2A 1EVYA 2C2KA 2UYYA 5DCLA 5FUWA 2JLWA 1YDFA 2P5YA 2Y0EA 1LPOA 1G8GA 1WCIB 1UBHS 4AXBA 2VVTA 3RC8A 5EHXA 1W6UA 2NXEA 2PMKA 2FU5C 3NHWA 2XCQA 4OO3A 3EODA 3DE6X 1EINA 3UAZA 3EPKA 4HTFA 1XKQA 1YGPA 3MD9A 4JL6A 1KYQA 2PCJA 3K0EA 4UMEA 1P5HA 3SIWA 1Z83A 1E79D 2QZJA 1C4XA 2PZLA 4L6IA 1WW8A 1HEIA 1LZKA 3DKKA 2Q3HA 1Q2UA 1QGDA 1L9KA 4KBFA 1SBIA 5H4GA 5HYVA 1B15A 4A73A 1LS1A 1M6NA 3OC6A 4ZVLA 4EF4A 4X62B 2ZTVA 2BGMA 3R3UA 1E5VA 1RHRA 1G8MA 3D31A 4IV8A 1A4XA 3TDKA 3F1KA 3GEBA 5TJHA 4DPKA 1TYDE 5LU9A 2I34A 3TG8A 4RWEA 3AETB 4BUJA 2FMKA 4H4DA 2CLKB 2G1AA 3FY4A 1STOA 2H5IA 3AI2A 1AQLA 3G0GA 2QRVB 4I8IA 1GGVA 1PT6A 3X3HA 3VKHA 2HGSA 1E98A 4DHEA 2C07A 4TKMA 4Y2YA 1BX0A 3R40A 2Z2XA 3VKVA 2AD1A 3NMUF 3QWAA 4EUSA 3F3MA 3GHHA 4BFXA 4DQLA 3SXUA 2BFNA 2EJUA 4M98A 5ICSA 3CSUA 1TYAE 4D81A 3TPZA 3RRYA 3SXUB 1M8FA 2J87A 1HLDA 4M1WA 4UQOA 3AG6A 5CAEB 3OPQA 4EHAA 4QECA 4LTNA 3DL2A 4B74A 4LUCA 2OSVA 3GCDA 2H8KA 3KPYA 4PNZA 4XDYA 2B34A 3ZJ5A 3C1TA 4Y2TA 5ALVA 3QIVA 4DN6A 1OREA 4Z1MD 1CB0A 1P2BA 2HCBA 3AF0A 3DE3X 2VBIA 3H3FA 4J94A 3W2GA 4A8JA 5CK5A 4B8ZA 1QGED 1VRWA 3L1VA 4IOJA 3Q2IA 1HDRA 3C41J 3DLIA 4NECA 3OJEA 4N0DA 2WVJA 4JUIA 1JJBA 4IH9A 4ZYUA 1OAKA 3A1WA 2PMFA 3NANA 4KO3S 2VUIB 4RGQA 3RS9A 1Z9BA 4PYNA 3ISJA 2AOUA 5AM0A 5HF6A 4IVQA 2HDWA 2I22A 2J3EA 3C3PA 3GXOA 4QDTA 5JECA 4UC0A 4CMAA 4WK0B 3AF5A 3V97A 2B69A 1KAQA 2FWBA 1CQIA 3RROA 3DOJA 5JNVA 2O5RA 4JBLA 4QT0A 3FIJA 5EGNA 1QIDA 1RJFA 3BXEA 5I4BA 1WZCA 1R74A 3EVNA 1PQ4A 4BLVA 1XLUA 2OHFA 1QKJA 3N05A 1U2ZA 2Z6UA 2EBUA 3ZTTA 5F23A 1AB6A 3SC2A 1RRFA 3E2IA 4NABA 4S2UA 4WLFA 2P6PA 2A0FA 2C31A 1A7JA 1PJ8A 1R27A 4KOAA 4WCDA 4DSUA 1KFCB 6REQA 2RAUA 1RZRA 1CUHA 4H9GA 3MG9A 3NCHA 4J3NA 3KQLA 4WNCA 2DWOA 3IVRA 1KS9A 3PEEA 1FXWF 3QPWA 4CHGA 4EM6A 2LUOA 1Q7BA 3KKMA 3C3AA 3Q3HA 5FBLB 2O1WA 2AG5A 1JDNA 4PC3A 2FWRA 3IXMA 4J0KA 1UFVA 4R1QA 3SC6A 1Z6ZA 3AUJB 4FHZA 1Z2OX 3CEPB 1TEHA 4YB8A 5TRTA 2XYHA 3U37A 3VR0A 5AI8A 2J41A 1KMMA 1MF7A 4AJHA 4QPZA 3OKPA 3WLHA 2PE5A 4RJJA 2FH5B 4HJXA 3IR6A 1KEZA 1P3DA 2P9ZA 1KNQA 5EKUA 1XAHA 2B0CA 4DE5A 2COUA 5J4VA 4C78A 5EERA 2HJRA 1DIHA 3FNFA 2VXYA 5BNWA 1MNQA 2LIPA 3W9BA 1Z4PX 3H11A 2UYOA 3PEWA 4L4ZA 3HKDA 2YJ4A 4AN4A 3KUXA 1TK9A 3OQIB 1PHPA 4OI1A 4BXOA 2WAYA 2A9RA 2JAXA 1S3FA 3TK1A 3SZMA 1B0ZA 1YRAA 3BXZA 8ATCA 3CNLA 1H85A 4H77A 2G4CA 4MP8A 2G77B 3WICA 3WNBA 1PR2A 3ENNA 4U7PB 1KXZA 3D3KA 4TLAA 2LXNA 5KYYB 1Z6PA 3RWOA 3U1TA 4XEHA 3VNBA 1BEZA 3KUUA 2QX7A 1OI4A 3E23A 1P18A 5J2TB 1B2LA 1RVV1 4ETMA 3L06A 3OFND 3USZA 1VECA 3LUAA 5AKIA 4ZC8A 2G5PA 1F0NA 2IODA 4II3A 2VCEA 1P0PA 4MUBA 5BV0A 1KJYA 4PPQA 1R8XA 4HX5A 4C2TA 1SIBE 2J46A 3UK0A 5C7OO 3G02A 2FN8A 4QASA 1GG2A 1I4EB 1LFDB 1V45E 1DAIA 3LI2A 4B7UA 2QMHA 5KHAA 1LF5A 3AUYA 1EEHA 4BNDB 5BT8A 1U63A 1GRNA 2FW8A 1JJVA 1U5BA 1Y1SA 1JHZA 3HJHA 1ULUA 4BE7B 5JXJA 1NDHA 1C50A 2HRRA 3AJEA 1YT5A 3CF0A 4KN6A 1TE2A 1U65A 1Z74A 1T0BA 3DMPA 3VPBA 1RPNA 4UQLA 4LHWA 4X1IB 1ZH2A 4UTRA 2BF7A 1XLTC 3LGAA 4U2FA 1GRRA 4XE5A 2BRUA 4BY9E 4N9WA 1T9KA 2ZUCA 2R84A 4CIYA 2VH2A 2ZATA 3D4LA 5HS4A 3TYXA 5JOQA 1KK1A 1QC5B 4NJOA 4X84A 1BGWA 5BWLA 2R4QA 3DNFA 1TQ2A 4JOBA 4R1TA 2QQFA 3FPJA 5J47A 4JKOA 5THQA 4B6EA 221PA 3QE4A 3PITA 2PX8A 2P30A 5DNCA 1NBAA 4LXYA 3W05A 1CRQA 3CSSA 4KKVA 3GRYA 3HCNA 1L7BA 2AN3A 4Q4LA 4WBSA 1P73A 2JI6A 6Q21A 2VXCA 1JAZA 1WVMA 2M1XA 3O38A 4KE6A 1FP4A 4YMSA 3FYCA 3DNPA 2HDOA 4A2CA 3NJ4A 4HDQB 3FNGA 1RAFA 2O05A 2W0SA 4BFWA 1A76A 4K6MA 4WXEA 2O3RA 3JXEA 1QUFA 4MQBA 3F1LA 3UHFA 4MEBA 4QBFA 1P1RA 1PP4A 1RDFA 1XBTA 3FNRA 3RHSA 5KYGA 1DI0A 3TRJA 4N48A 2KE5A 1ECJA 2AG6A 1JX6A 2PGJA 1E5XA 2NXCA 1UWLA 3IQHX 4ITUA 4J3JA 4ZV7A 4QGAA 4O1MA 1GQSA 1PR5A 3D6JA 3ZDBA 2I3GA 1E3SA 2FFBA 4QREA 4X66B 2YV4A 3QJGA 4HB4A 1QNFA 4KXUA 4UM9B 3PNVA 1K89A 4H7HA 2II6A 1RWNA 2QMZA 1EHIA 5BN1A 5ITZA 2O5CA 3NWJA 5FOQA 3WLTA 3FSEA 5AP9A 4M2LA 2OGZA 3TM4A 1G2OA 1TJ3A 1IUKA 4Z9FA 2JFHA 3W2IA 3ZE7A 3R9XA 3OEWA 2ZIEA 4U2GA 4R83A 5DK4A 3T7DA 3HM9A 2PRIA 2Q5QA 5L45A 1RPJA 4MI1A 4C7OA 3BG5A 3UV7A 5B64A 2BI8A 3GDGA 4CRWB 2C77A 3ZWQA 4E1VA 3G0CA 2C99A 4FIDA 3G88A 3S7TA 4BIIA 3I0ZA 2FMIA 1AM4D 3AJ9A 4FYHA 1EWVA 2ADFA 4NH0A 4XQCA 4DV2B 1YJ8A 3OI7A 4XSVA 4MV1A 5EL0A 1J8FA 1K6EA 2PL1A 2X4GA 4TGLA 4D9CA 4EW3A 5LP6B 4L57A 2B7BA 3KXLA 2AC4A 2I0FA 3QVVA 3HACA 2I2BA 4OOEA 1WXEA 2AHRA 3RV3A 2PVPA 4Z5XA 3LG2A 3SYLA 4Q3LA 2QNBA 4MV4A 5D7NA 1L7VC 1H1TA 1T10A 4PYMA 4P4LA 1CZNA 5FWXB 1K98A 3NG1A 4IGFA 4M6WA 2WHPA 1CNMA 2OV3A 4JGGA 4NAUA 5KTNA 1HDGO 3WV4A 2EZ9A 1EFVB 2VEOA 3E3MA 2C2HA 1J22A 1UPAA 5KJEA 5WRFA 1MGPA 2WSYB 2KS6A 4YRZA 4YMHA 2N42A 4LMRA 5TVKA 3A37A 4QBHA 1YS4A 1SUAA 3ZX4A 5JATA 4C4RA 1R50A 3H5VA 4CM9D 3BE5A 4E4YA 3EIOA 3NYWA 4AI6A 1RQXA 1PJAA 1IONA 1EVEA 2ALJA 1TUEA 2H54A 5JYDA 1D6JA 4ND7A 2QNIA 2OV8A 4GRAA 1R15A 2OZPA 2XA9A 1H23A 5EKXA 3I9V1 4OA8A 5A6SB 1R0SA 1W93A 2R85A 1IWPB 3EVFA 2FSSA 3FWYA 2X58A 3EBLA 3FR7A 4NU0A 5TDHA 1DQZA 2B99A 1W7AA 4TROA 1HWYA 1LLCA 3QLVA 3LT1A 4B3IA 4A36A 1NVFA 1ULBA 4GBJA 5D00A 2VJAA 4MVJD 4DWJA 4WD3A 1DARA 1EFKA 1BCSB 3T3DA 2OORA 2YY7A 2Y1XA 3SS8A 4BN0A 3F2IA 2VFAA 1I3LA 1U8FO 2FZLA 2V5VA 1VHQA 3H18A 1ZI6A 4I55B 2F2TA 4JASB 3V7UA 2ZM6B 2IYPA 1KJNA 4BLQA 5CVTA 1DWUA 5LQRA 2XOEA 3VR6H 3M5WA 4Q7LA 1U2QA 5EESA 3RLFA 6AT1A 2XRMA 4FMDF 2CEAA 4OQMA 3RSSA 1Z0FA 2EQAA 1F5SA 4MRAA 2RG7A 2ZAGA 5A62A 3RU3A 1P80A 5HZMA 2PX5A 1GFSA 3AF4A 3DFKA 3GLGA 3G9ZA 3NAQA 4DCCA 1TQ8A 1X7HA 4TV9B 3ILXA 3D6TB 2XB8A 1H0RA 1TGYA 3SVLA 1FBTA 1HSOA 2AOWA 2MCFA 4UTPA 1L8AA 1IM5A 1S1CA 1T9BA 5DXAA 4I99A 4FOSA 3V32A 1TKRA 5ICEA 2C2OA 3CLSD 5KJ1A 1Z7YA 4HDNA 4AG6A 3LYUA 2FZCA 3FKJA 1QR6A 2A0UA 2FPIB 4E5NA 4GI7A 4Z0PA 4Q16A 1DBQA 4WCVA 2CVFA 2ZYGA 1MTZA 2JHGA 5IW8A 3PGKA 1VLVA 1TD9A 1V71A 3EFOB 2OCDA 4NV3A 1EVZA 4O2AB 2OGTA 1PG2A 1PFVA 3TOVA 3PD7A 4LCJA 4R3UC 4C07A 5AIBA 1SN7A 4KQ9A 1H9BA 1O94C 5AVSA 5IFKA 3KAPA 2XUZA 5D7BA 3VYUB 3V33A 2QGNA 4PLFA 5TGZA 4KXQA 3O93A 1NV8A 1LBEA 4ZAZA 3JSXA 4EARA 1P7VA 1SC6A 4YK7A 4E3WA 4L95C 4PR3A 2ZRGA 3OETA 4CR6A 4BRZA 4IIGA 3FWNA 3HN7A 1Z29A 4FFOA 5THKA 4QXOA 1GZ3A 1YI0A 1F2VA 2BTQA 3FHCB 5I4CA 4NHOA 2P41A 4PPFA 3MD0A 1E2DA 2BHNA 2PS0A 1LBHA 2BP7A 2Y05A 2QVBA 4CM4A 1R6VA 1JQKA 5ICMA 1M2OA 3OWHA 2Z4RA 1T35A 4LVCA 4JK3A 4BVEA 3PLNA 3RS2A 2JJ1A 1YIAA 4UNIA 4TZTA 1VMDA 1JIUA 1FE8A 3F6EX 4JZYA 5BWBA 5GQSA 3FAKA 1YRWA 1IAQA 1OB5A 3OEEA 1J8YF 3UH0A 3M70A 4WY8A 2AK2A 4U2EA 2NU6A 1IQPA 3RU9A 3COZA 1GTSA 4OHMA 1OX4B 1NX6A 2VQSA 2H2HA 2I65A 2VTVA 4GX0A 3W6NA 1SXJE 3HWSA 4INZA 4F9EA 1EE2A 3A9CA 1OX4A 1BWRA 3PICA 2JIDA 2G72A 2Y92A 3LFHA 4MLPA 1YCHA 3K2IA 4PXSA 4L2IA 1KI8A 4Q3AA 3ROGA 1N4AA 1KAOA 3OJCA 2I4OA 1VGQA 2BGTA 4K6CA 2ZETA 4HUTA 2VK4A 3FMOB 3KC2A 3N8KA 3A6FA 1E3TA 3OUZA 4UE2A 4BMOB 1LI4A 2MHCA 4CI0B 3RS7A 2G1UA 4I08A 3RKRA 4DMHA 2CXTA 3PQFA 3PFIA 1I24A 3GNSA 2R4TA 3LPMA 1DBPA 4U8HA 3TVYA 3OE7A 2AMLA 4LRXA 2J48A 2NV6A 1LPMA 1PZFA 3A1EA 4H3SA 4B4VA 4GE0A 3RWBA 4XQ9A 3RYFB 4X5OA 3PNBA 1Y1KE 2OGUA 2Q2QA 5JROA 1AKUA 1PS8A 1VOTA 5FI5A 1BNCA 1A5ZA 2E4VA 5CM9C 3RYFA 3BE6A 5JZ9A 3CZ9A 3IP1A 3OJWA 3RWMB 1T0HB 2H2IA 4B32A 4AUEA 2ZSJA 3OZSA 1PEAA 1SUPA 2X15A 3KHSA 1JPUA 4H4CA 5DGCA 4DMKA 4XRGA 1X2EA 1CSEE 2VPTA 4MAAA 4DZTA 3RBZA 1Q14A 1E3IA 1QH8A 4KAJA 2P2SA 4NMWA 4UHEA 4LDJA 2HH9A 5FTKA 5IXSA 1EXVA 3PC4A 3PK0A 1KYWA 1HNXB 2D7DA 4QQNA 1RXWA 4GVLA 5IVPA 3UWPA 1QOZA 1XQYA 3VVMA 5FPYA 2VP0A 2DLCX 2QYHA 1VLJA 3V2HA 3M3PA 3OZAA 3DMDA 4MRMB 2HQOA 3P9IA 4EZIA 3G2LA 2XECA 1SM4A 4MVXA 3NTXA 2JIBA 8ADHA 1G6HA 3FTDA 5G4LA 4OH1A 2GPNA 2P2ZA 2BT4A 2HUPA 1Z0DA 4BV9A 2BISA 3M1IA 1TM4E 3KK0A 1CZHA 1P9LA 4FE7A 3AF2A 3F7NA 4YR7A 3BH0A 4DCVA 3DEAA 5ALFA 1PNVA 3K5HA 3MB8A 4BO3A 2WZDA 4P6VF 1E99A 4MI3A 1E1CA 5JVDF 4WDQA 3UAWA 2JHAA 1I7LA 4RVOA 4EY8A 4UTVA 3KHKA 2WJ3A 4MUMA 1T29A 5IKOA 1IXZA 3EEQA 1UEIA 2I66A 5FUMA 1K4KA 2YQ5A 3GG9A 1ECFA 3TQIA 3EOZA 4KH1A 1EBUA 4RJLA 2VF5X 4WK6A 3E5RA 2GZDA 2GM9A 3I3OA 5FA5A 4CDGA 4LF9B 4QC2A 2V7QD 1Q0HA 2CVPA 3P27A 5DTQA 4LG1A 3NDIA 3P0JA 1LFAA 4EUKA 1E2BA 1ZMOA 1T3ZA 5DHPA 1F2UA 2JGFA 4LK2A 2BLNA 2GM5A 3HEMA 4DNXA 3QW4B 4OGLA 5FB3A 2BM8A 1L7DA 1KVQA 5G3YA 1XA0A 1V8OA 4C3VA 1ISSA 1GL7A 2QLFA 2ONCA 3L4SO 1W9MA 3AP2A 2GJ4A 4MW1A 4ZVQA 3TLBA 5CEEA 1HOTA 1SG0A 1M5UA 2CXHA 5A4JA 4JN6B 2VJYA 4EHFA 3OPYB 2B0JA 4I4TB 4C7XA 3AEKB 4TZ0A 1N2JA 3RSLA 1CF9A 2W58A 2VJKA 3GRKA 4FYVA 3KOZA 2C4KA 3LL7A 3T5PA 4EHKA 3ZD8A 2FUG1 1PJ3A 2XF2A 2ZITA 1NT2A 1AMNA 4FEEA 3UGQA 3P19A 2DQZA 2J8ZA 4G4GA 4MS1B 4QWWA 3WOVA 3UZUA 2CDNA 4GO1A 1ISIA 4J2TA 4L3WA 2CLHB 5EE5B 1Y7PA 2PLFA 1BD4A 3OSUA 3SBOA 2HUNA 1SXIA 2WKQA 2XMQA 2Y2VA 4N3GA 1ZR4A 4M1ZA 1TKBA 2H17A 4CV2A 4MMYB 3DE5X 2R6FA 1H0HA 4UHFA 3TCNA 3RUCA 5BQOA 1H4SA 1X7XA 2GD0A 1FFYA 1UC5B 2HIHA 2I4RA 4LWPA 4MVJG 4B6SA 3WADA 3P9PA 2WYWA 2YS7A 5CVDA 1MT0A 2J7PA 1IVYA 2DEUA 1JJ7A 4KIGA 5AXDA 3WE7A 2DYKA 2YXLA 3AI3A 3GRFA 4TLDA 4FCTA 4PYLA 3G68A 8AT1A 2VHWA 3U2QA 5CDGA 4XCQA 1KARA 4MHTA 4NZYA 1ZM2A 2HYDA 2Q9UA 3P26A 3P0RA 4OHUA 5DW0A 5HTKA 2ECPA 2B61A 3P32A 3L5KA 1R6AA 3MJVA 4DM3A 2IHJA 1FDIA 2H7XA 1R1DA 3BRQA 1RXYA 3CISA 3RRMA 2ICAA 4D6XA 4DPLA 4F91B 1Y81A 2WJ4A 3N8HA 1MD9A 1MQ9A 2ZAYA 5KYVA 2X0DA 4WNYA 4D41A 3DHEA 5HP4A 4FOLA 5B4UA 2KJQA 1NKVA 1WCIA 4FEYA 3I8OA 1RE1A 3PQ6A 4CCSA 5IFLA 3OX3A 5ERXA 2IS6A 1NPTO 1K5GA 1PRYA 2QRHA 2XWJI 3JASA 3SYMA 4HTFB 4XGQA 5C46F 2FETA 2XUKA 1NMYA 3ZLJA 4UUQA 3REQA 1ZK2A 4R0NA 4CLRB 4K81B 1MH1A 1BX1A 1CB7A 1FYDA 5JDIA 3OVMA 4YAFA 1ADCA 3FPKA 4NC9A 1SUSA 4QYSA 4RADA 4MITA 5FL3A 5TPWA 3NTUA 4KQXA 5EIHA 3ELDA 3F7MA 1U04A 4MV3A 4XJXA 4RAOA 1GG8A 1M34E 2A67A 3ZYZA 1K8ZB 3AHCA 5TPWB 2PH7A 4XVHA 3KFLA 1OU4A 1EXWA 3EIUA 1YFJA 3EGIA 3TAHA 2LBPA 2DERA 2ZRLA 1TEXA 3COPA 3M1YA 2QAIA 4Y1RA 4D9EA 4DR6B 1A9OA 1DJMA 4JCCA 1Z5GA 4ALMA 1SOMA 2HDNB 1V4VA 3KRTA 4OGGA 4TS1A 3JWIA 5J59A 3G2KA 3GLRA 5KYUA 5LYYA 5KKCA 2E3JA 3FHOA 4M0EA 4AF8A 4OAQA 4WY5A 1GPKA 1RHKA 2R9VA 3G0IA 4JYBA 5E3HA 5L3QA 2EW1A 3BHIA 4S35A 4B80A 3HC7A 1LI7A 2Z1NA 4HGRA 1JEQA 5B1YA 1WW2A 4G9BA 3PJEA 3I04M 1FYFA 5KSOA 2A7XA 3ZVMA 1RYHA 1XCJA 4EA6A 3L6OO 3Q3CA 2ZDQA 1GLNA 1PYOA 1SCUA 1OIVA 3E6AA 1S3IA 3PHLA 3WK9A 2MWMA 4CFSA 1N2HA 2XD4A 2V7QA 1BD3A 2RGAA 4E2XA 4RABA 2X6TA 5T7BA 3KXDA 2I2CA 4R2WA 3VPXA 2FMTA 1EWYA 4ZGBA 1IIRA 4PZ9A 4BVJA 3JVEA 1FNNA 3PR1A 2Z09A 3CVOA 2WTUA 3ONFA 1UWVA 4NZOA 1BRMA 3CLTC 3NBAA 1U7DA 2W70A 2PT6A 5JCJA 3VR5D 4YT4A 1ADBA 3BK2A 5KSPA 4B48A 1L8XA 1AQ6A 4UZEA 3OPNA 1E18A 4RD0A 3ZE9A 3GG2A 1QG2A 3HPQA 2IT1A 2XDQA 5F64A 1ENZA 1X80A 1YCFA 1FJ2A 1MVOA 3R6TA 4ZQHA 4V0KA 1UPUA 2C95A 4ZEXA 2LW7A 3AERB 3V00A 4V1CB 4AIRA 3SSNA 1JSLA 4G0WA 1KI7A 3BFPA 5TMEA 3EULA 5J1TB 2PLAA 2Y4NA 4V1CA 3H2YA 2GEVA 2H3EA 1KI6B 3LOPA 1QDEA 2V3CC 2R8BA 3ND5A 3JAWA 4U6SA 5F3RA 4QU9A 2EEPA 2B8JA 5AO9A 1WCWA 3JAWB 3ONDA 4L72A 3CLVA 2QNRA 4RPLA 3ZHZA 1Y3AA 1QUEA 4QLBA 4FT2A 4QJBA 5AK4A 2UXCB 1WXXA 2FCAA 3OPXA 4GFDA 3S29A 4DFDA 5LDDC 4IOKA 3W06A 4LTDA 2NUTB 5H9WA 4BASA 3QUQA 5A2GA 2R6R1 2NO1A 2PIAA 4RZSA 3QXGA 2NUTA 1GKYA 1GOTA 4DYVA 1XVVA 4C0AC 3KEGA 5LNK6 3TXAA 1WXFA 4GOND 1T36B 1WZNA 3ZGZA 1WABA 3CIFA 2BFAA 7REQA 2J3HA 4AJPA 2X8AA 4HWOA