2FEOA

Mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
221
structure length
221
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNMAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title Structural and functional consequences of single amino acid substitutions in the pyrimidine base binding pocket of Escherichia coli CMP kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,transferase
total genus 52
structure length 221
sequence length 221
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2feoA00
3TQCA 3KKOA 1DS6A 3LVQE 5G40A 2XB4A 4KO8A 4A2WA 1T3SA 1COWD 1FL9A 3V9PA 1A1VA 1QDEA 2A78A 4XWOA 4P4SA 2IXGA 3NBZC 1KJYA 3EASA 1FNMA 1G41A 1RIFA 3NEJA 3CPHA 1G20E 2ECKA 5J4YA 3FFAA 4CEHA 1RE0A 4W5JA 1ZINA 3CB4A 4OHYA 1M1YE 2C8VA 4FINA 3X1WA 1VDZA 3REFA 1H8HD 3B85A 2HJVA 1G4UR 4EPXA 1T0HB 3GFTA 4PC2A 4E22A 1IXZA 2CNWD 2HCJB 4Q5IA 4DSOA 5GJCA 1ZU4A 3BD9A 4FIDA 1SXJC 2PH1A 2QAGB 4IFBA 5C46F 2ZEJA 4AKEA 4D4LA 4OQXA 3MJRA 3NXSA 4HSEA 3SNHA 2LCFA 4BWYA 3VTKA 5LD2C 3FE2A 3Q85A 5HTKA 1GILA 1Z0FA 1MRNA 1Q1ZA 4QJ5A 1KNQA 2JIZA 4PX9A 4TTRA 5D3MA 2ZJ5A 2UVQA 3O8DA 2ZAOA 4NYJR 1ZRHA 2OT3B 1E2EA 1XTQA 3F8TA 3QF4A 5DI3A 1RFLA 1GWNA 4UJ5A 1KDTA 4D26A 2JJ8A 1NLZA 4AYXA 1TNDA 1B0UA 1VMAA 3D8BA 1T3LA 3HYTA 1LF5A 2YINC 4FMBB 1G18A 4HDOB 2A5DA 2YWFA 1G7RA 3PG5A 1SGWA 1US8B 3OHMA 4KBFA 5DN6D 1D2NA 1ZNXA 5K8IA 1TADA 2WWGA 4L8GA 2AFIE 1IJFA 4QGHA 3TK1A 4TZ6A 4Q00A 3W5IA 2EFGA 2W6JA 3GD7A 3TRFA 2HCBA 3IIJA 2D62A 5EXPA 2G6BA 5LB2A 1X86B 1G291 3LBHA 3MWJA 5FBRB 4A2QA 2G9NA 2WMOB 4LC0A 3UPUA 2ZE7A 4PR0A 1QHGA 1GTVA 4LHYA 4ARZA 1E32A 5JFGA 2UZ3A 1XMJA 4FMDF 4JLJA 3OEHA 1OFTA 1KI4A 2GVZC 1N5IA 4FW9A 3GMTA 1R10A 1FX0A 1WB9A 3OIVA 2GJSA 5JS8A 2BVNA 4RFSA 4BFWA 2YOGA 2VHUA 3PV0A 4WA7A 1GFIA 1DAKA 1AA9A 3QPUA 4OKSA 1KAOA 1XEWX 4R9UC 2ZE6A 1G8PA 1FNNA 5HCIA 1XTKA 2GJ8A 1VCMA 2RGGA 3CO5A 1W4RA 1ZM4A 1G64A 1E9EA 2EU8A 1TTTA 2FH5B 3WNBA 2V55B 5LPNA 3DO6A 1GAJA 1QHHB 2MMCA 4Q4AB 2RGNC 2BBTA 4MRNA 2F43B 1OXTA 5L3VA 3HU2A 1FOEB 4IVQA 1F2TB 3LXXA 5EE5B 4JZKA 3W6NA 2N46A 3QG1A 3TLXA 4HLUA 1MKYA 2BWJA 4LHZA 3K70C 5B30A 1XD9A 2Q9CA 3AKDA 5GVSA 2GXUA 5TVKA 1N0UA 2IUSA 3E1SA 2FPKA 4XVRA 4AYWA 4BLRA 2VSXA 3MGCA 3OEHD 3JVUA 1YHNA 4R7ZA 5DE3A 4DRZA 1EXMA 1HE8B 2KBEA 5ELXA 4LYFA 4LJYA 1OHHA 3K9HA 4MRVA 4E03A 4R71A 4ZCMA 5KSOA 2A30A 4US0R 1NG1A 5BYJA 1SKYE 5EXXA 4B43A 5SZIA 3U4QB 4C0AC 1FP7A 1XEWY 3R7WA 3U5ZB 3ZS8A 2VP9A 3VR2A 2O8EB 3K09A 2H18A 1WF3A 2NG1A 1RJ9B 2OO7A 3EZ9A 3BS4A 3Q9LA 4GMXA 1ZYUA 2WJGA 4Q03A 4BZPA 1NSTA 4Q9IA 3U2QA 4A0FA 4CEIA 4GBMA 1NI3A 2FEOA 2FJUA 3TUJC 1VIYA 4LY6A 1N5JA 4RZ3A 4F92B 2FX3A 1QRAA 3HU3A 1DELA 4Q66C 1TQDA 2QN6A 4Q7LA 3QXSA 4FMCB 4M9SA 2D7CA 2RGEA 2HEIA 1KGDA 2F1RA 4C0HA 2GESA 4B44A 3RSOA 4GZMA 1PV4A 4Q9LA 3S1AB 3I62A 2ZJBA 5IK2A 4B2IA 4M1TA 1XTRA 3CRRA 4B2LA 4JLAA 2ONKA 1U0JA 2ZI5A 4NKRA 5EP1A 2RGBA 2BMDA 3QOFA 3WYGA 1LV7A 1MO6A 2GBLA 2V8OA 3U3MA 2R44A 1NJGA 1ETUA 2W0SA 1KSGA 4KYUA 2WPDD 4Q4JB 4HLCA 1P2UA 1XF9A 3IO3A 3A4MA 1R8SA 2OCPA 1L7VC 1KZ7B 4TYPA 4XOIA 4AKIA 3GJXC 1JNYA 4OJKA 3FFBA 3LX8A 1YKSA 3CNOA 2V7QA 5FTMA 2FDCA 3D31A 4FXPA 5CM8B 3BAFA 1XD2B 3EXAA 3A1TA 3GJ0A 3Q8XB 1W5SA 2IYQA 1J99A 2ZI9A 1NG9A 1ZD8A 4OQNA 3TJZA 5KSYA 2YKGA 1JR6A 4BZXA 1IN6A 2WICA 1GIAA 5IK2D 1EK0A 3WYFA 4DZZA 1ESMA 1CR0A 2A5FA 2HXSA 4XH9B 4Z51A 3ZYCA 2Z43A 3GLFA 1HA3A 5DSZA 3T1TA 3KFVA 3ONWA 1OFHA 1NBMA 4MA4A 1R0ZA 5JS7A 3BBPA 1C1YA 4HDCA 1QG4A 4CEJA 1Q1QA 4NYIR 2C9OA 1TQ4A 4RY2A 1HEIA 2G0TA 1N6IA 1YZKA 4YQFA 2BBOA 3V4RA 3C8UA 5TARA 4LBWA 4O0MA 5E95A 3HR8A 3CR7A 2NIPA 3WHLA 1I2DA 1LFDB 2ODBA 3RRMA 1BYIA 2ZYTX 3W6OA 2OCYC 1XXHA 4PHFA 2Z6VA 4IXNA 1JJ7A 4OHXA 1E1QA 2IUUA 4LDJA 2GF9A 4DBLC 1R5BA 3LQRA 5AJYA 2QMOA 2CE7A 1UBFA 3TMKA 3RC3A 3DMNA 3GCGA 3SOPA 2MMGA 1ANKA 1F6BA 4C0LA 4D0LB 1Q3HA 2CHGA 1KSFX 2CJWB 1Z8FA 2R65A 4UNQA 3VMFA 2QRZA 2QROA 4LHXA 4JL5A 4LGMA 2J0QA 1E4VA 1NBMD 4L5BA 1T5LA 2J41A 2E87A 1GRQA 2KJQA 3CW2A 4B32A 2AK3A 2J3EA 3WP0A 1DAGA 2ZUBA 1YQTA 3VX4A 3L8YA 2CBZA 2CL7X 4NTZA 3NHBA 4Q7KA 1TUEA 4BZQA 2RGAA 3PUZA 1NSFA 1JR3A 1XEXB 4TMXA 4A0GA 1G3RA 1AJEA 3NWJA 3EARA 3ZZ0A 3W8RA 4Q4HB 2O8BB 1W36D 4RVCA 2OESA 5CJ2A 3QKSB 1E1QD 1G5TA 1NVUQ 3I92A 4QHSA 3EPJA 4A82A 3LBIA 2DCUA 2EYUA 4DB2A 2PCJA 4YXWA 1OSNA 1P9NA 2QP3A 4B74A 2EW1A 2IWHA 2DB3A 4G3XA 4DLWA 3QBTA 3HPRA 3I4LA 2HF9A 3Q7QA 3FKSD 4D25A 5HE9A 4ESHA 2XZOA 3GLGA 4EJSC 4LHVA 1UKYA 3C14C 1U9IC 3CNLA 2HF8A 1Z28A 2QM7A 4I1UA 4MKFA 1M7BA 1YZLA 2GCPA 2I3BA 2XAUA 1RZ3A 4NCHA 2RGXA 4MGIR 1SVMA 3KFXA 1JR3D 1DE0A 1UDWA 1I4LD 3K70D 4OI0A 1AK2A 2GXQA 3U44B 2EQBA 3GFOA 4NL4H 2ZRGA 1UKZA 3NC0C 4XTRA 2V9PA 5AJXA 3KB2A 2FGJA 3T61A 3KJGA 3FWYA 2JJ2A 1VECA 4B6EA 4GPTA 1G7SA 4DLXA 3M4YA 1W36C 1TU3A 3QENA 1DAHA 1PUJA 2FZLA 3WBJA 3ZQJA 1SXJE 1AKYA 3DZDA 2JDIA 2X1VA 3X1XA 2G77B 3KQHA 1K5DA 1CJMA 1E2KA 2JLXA 4DT1A 4PO8A 1DBSA 5HE8A 1Z0AA 1SHZA 1VG1A 4HZUB 4M9XA 5IHPA 4HAYA 1DVRA 5DNYB 2ZJOA 4AD8A 4A15A 4DLZA 3QSYA 3VU9A 1QF9A 3B1WA 3VR4A 2ZR7A 3C41J 1LB1B 3WRXC 3BH6A 5CIWA 5FH9A 5EUMA 2HDNB 3B9PA 3BGWA 1KJWA 1ZU5A 2J87A 2CCJA 4HAVA 4MGYR 3RHFA 8OHMA 3TVDA 2PZEA 2WWHA 2ZU6A 1NY5A 1XJCA 4N0DA 1CULC 1YZNA 2ORVA 4DIEA 3UG7A 4MQBA 4RZ2A 4NBSA 4CT5A 2OSBA 2EVWX 1GZSA 3PR1A 2GJ9A 3LAWA 4YONB 2D2FA 1IN5A 2JJ2D 1QBKC 2DY1A 4ZKEA 4DC9A 4NH0A 1A7JA 3EWSA 4GFDA 1YU9A 2P6UA 3IILA 1KI6A 2O5VA 1ZIPA 3VX3A 3BOSA 1P2TA 1BMFA 1KO7A 1T6NA 1JQLB 2AKAB 1EX7A 1PLJA 1U81A 3VQTA 4LOAA 3N70A 1RRPA 2J0UB 3PFIA 1OW3B 4C0SA 3K9GA 3IPYA 4CZ2A 2IYUA 1HURA 3IKJA 2QUZA 1XP8A 1TF7A 1DARA 3MCAA 4JLPA 3WP1B 3GLIA 3K0AB 5TMPA 1XXHE 4HUQA 3BRWD 4MRSA 1Q12A 3SHFA 1XMVA 3AVXA 1WP9A 4NYMR 1P73A 5FBVB 4LZZA 3TR5A 4WXPA 4BFXA 3A37A 2JCSA 1R5OA 5HZHA 2HT1A 3AF4A 2QPOA 1HUQA 1EESA 4X8OA 5DGXA 1SKYB 2IX3A 4LPSA 4IOKA 2O8DB 3I3SR 4BLPA 4IOMA 1W0JA 2EWVA 2R8RA 3THXA 2ZJZA 4B2PA 1KO5A 2BHRA 5KPDA 2WKQA 1CIPA 3MLEA 1BMFD 5A5GA 4CDGA 3BWDD 1W46A 3Q5DA 1JJVA 1BKDR 1E9RA 1YZTA 4RZXA 2WAYA 2WWWA 3LWNA 2QA5A 2OCBA 521PA 1XMIA 2CE2X 3GLHA 4B3FX 2IS2A 4RSGA 3SJZA 4DCUA 3OAAD 4YMVA 1N6KA 2A2ZA 2R9VA 5L3RA 2ZRNA 3OIUA 1Z6AA 4AG6A 1H8EA 2F1JA 4V03A 1UAAA 2IS1A 1GKIA 3W3ZB 2VP0A 3VFDA 1OYWA 3A4NA 2ZJ8A 1Z06A 2C2HA 2E9SA 2NO1A 3VNVA 5E7JA 3SI7A 1NLYA 4E07A 1OH7A 2R62A 1W4CA 1RRFA 4OJQA 1M8PA 2MSCB 2OLKA 3UKDA 5EE3A 2PT5A 2PMKA 2R6GA 3NBYC 4V0LA 2OUKA 1IOZA 5G3YA 5AR1A 1UKEA 2QP4A 3B5JA 4LV8B 3LVRE 3UIEA 2TMKA 4ZKDA 2F1IA 3VKGA 4TL9A 3R9IA 1Z08A 4V02A 2CLCX 1OKKD 1CJTC 3TSOA 1CBUA 1R0YA 3PJRA 5DLQC 4WIAA 4F4IA 2XB2A 2IYRA 1G7CA 2NPFA 4EJSA 1EFTA 2XNDA 5JJLA 3ZZUA 1XU4A 2VP6A 3L2OB 4A8JB 1IY0A 1KO8A 2QZ4A 1EFRA 3DMDA 1XPUA 4AC9A 1E79A 3FVQA 3IQXA 1R6BX 4Q1EA 1FUKA 4MDEA 3SFVA 2ZRDA 4F93B 1II8A 2IYVA 4DDTA 1IN7A 2BKUA 5BQ5A 4PPGA 3KDSE 3X1ZA 1XCMA 2RKOA 4IDQA 3AKYA 4JLOA 4TTQA 2J0SA 3NIBA 1YR8A 5C4GB 3E2IA 5CDFA 1P4SA 2VH5R 1X3SA 2NO6A 4GZLA 4Z8YA 3W34A 3KXLA 3P26A 3P32A 4EFLA 3BIFA 4PC7A 4W7SA 2A5GA 2P6RA 4DSUA 2OM2A 1JBKA 2ZRIA 1G5PA 1OV4A 2VHCA 3LNCA 4Y0VA 4M1MA 1WDTA 2QEQA 3Q5EA 4LSGA 1YR7A 5CJPA 1FX0B 2BBWA 1IXRC 3B13B 1S8FA 1Z29A 2C95A 2JATA 4HLUC 1UKVY 4YMSA 5TY0A 3AH8A 2ZREA 4Q18A 4Q7MB 4OI1A 1COWA 4DLYA 3W6PA 1EFRD 5FUVA 1Q57A 3W5JA 2B8WA 4DLRA 3QY0A 5JECA 4M1KA 1MH1A 2WJYA 3CF2A 2KB0A 4YMWA 1N6RA 4WBSA 3RDPA 1OIVA 3TQFA 4DB4A 1I4DD 3ICEA 5AJWA 2XTMA 1MV5A 4JJZA 2XGJA 1Z2CA 4EPWA 3GJ5A 2JLYA 2V1XA 5CB8A 3I5XA 4NP6A 2J1LA 2K5UA 2G1KA 3BC1A 3K09C 3SYKA 6Q21A 4URVR 4M22A 2ANCA 5KTYA 1XCGB 4ZI3A 4PO9A 1VKJA 1TL7C 3AF3A 4G01B 4YDSA 2WSMA 2PLFA 3T5DA 3W3AA 1KK3A 1XZQA 2XJ4A 1NMYA 1UEJA 1EGAA 2FOLA 3ND8A 4NCNA 3TIFA 3VKWA 4D81A 4ASUA 1PJRA 1JB1A 4HB0A 1QHNA 4NMMA 4KFSA 2IF2A 3R7WB 3KQKA 2J45A 3T1OA 4BFTA 3CH4B 3WNDA 5M04A 4RKEA 4YDHB 1P62B 3HP1A 2PT7A 2PJRA 2ZIAA 4TMZA 2YJTD 4JLVA 5IT5A 2ZJ2A 4ACBA 2OFXA 4MRRA 2R6DA 4HYYA 2W6ID 3DZ8A 4MRPA 4OQFA 3PVSA 3LDAA 4LX0A 5DN6A 3LH5A 1X8KA 3X1DA 2IF0A 3H2YA 4TN1A 4F91B 2KSQA 3CONA 1CJKC 4RD3A 3K0FA 3B1VA 2VSOA 5DI9A 5JZVA 2NGRA 3RYTC 3BH0A 1VCOA 1ZD1A 2GBLC 1S2MA 2B6HA 3EG5A 5H1YA 2CCGA 4MYHA 4M1WA 2GNOA 5AUQA 4ASUD 4ERNA 2KI5A 1O3YA 3EPLA 1HYQA 4LYJA 4KXFB 3CX7A 1DO2A 2JEOA 4PSVA 4UNRA 4IEEA 2GVDC 4TWZA 5KSZA 1OXSC 2CEAA 2F9MA 3FKQA 1GNPA 4GP6A 1SXJB 4TYQA 3SJBA 4JBXA 2AHOA 1FMJA 4DHEA 2YNMA 1KSJA 4NYMQ 1Q3TA 1SKQA 2GEVA 5FPSA 5JRZA 2QG6A 1W2HA 1IAQA 3UMSA 1TPZA 1R8QA 5EXTA 5LD2B 4GDFA 3U7FB 2ODWA 2F3RA 3U3KA 4DEYA 2IXEA 3HDTA 2HT6A 3JZAA 4AG5A 3I32A 1HE1C 1CF4A 5KDLA 2FGKA 4AKGA 1E2NA 1GL9B 2CVHA 3UG6A 1VG8A 5BN4A 2OBLA 1KAGA 5UKDA 4KHZA 1E9BA 2X77A 2CL0X 4H1VA 4N0EA 1W4AA 3I73A 4S35A 4L4UA 1SVWA 1WRBA 4OHVA 1L8QA 2BMJA 1TF2A 3VAAA 3KQLA 4BFZA 3VR3A 4FCWA 3RRZA 2QY9A 1ZNWA 1Q44A 1P7CA 3DEFA 4X8MA 1VCNA 1A82A 1SVIA 4BEBA 3LX5A 2GDJA 4PZLA 1E9CA 5JJIA 1E3MA 2NQ2C 4AYTA 5JI3E 2UZIR 5KHOC 4ILEA 1FTSA 2FFQA 3P1JA 5EQTA 1BIFA 4F38A 2QBYA 1AGRA 2B92A 2GZAA 3RS2A 4FMCF 1ZW6A 5FBWB 3CF0A 1Z0JA 4GOXA 1OXUA 3AVUA 3M0EA 1JXOA 3B2EA 4QRHA 1N6OA 4V0MA 2IXFA 3WMFA 5B57C 3FTQA 3OZXA 1TMKA 3KL4A 3ZH9B 1XXHB 5L3QA 2ZS7A 3EPKA 3GJ6A 5G41A 1KYIA 2WVJA 4WZ6A 5IF9A 2E1RA 2J46A 3ADCA 2ZRJA 3PUYA 4KCGA 2ZS8A 4TQUS 1U8AA 2DFTA 2H8KA 1JAHA 4M2LA 2BMEA 2RMKA 5AWFC 1S0UA 4I4LA 1N6LA 4KU4A 4DDUA 2ZVQX 4JLBA 2O8CB 4M8NE 1N2CE 5FI0B 1P75A 2HYDA 4TLBA 2XSZD 4LBZA 1R0XA 1MR3F 1MO4A 1NVVQ 4O3MA 4B71A 3F0TA 3BB3A 2FSFA 3ECCA 3RAPR 1Z83A 4XVQA 3SDZA 2ZYUX 4QXAA 3EC1A 3G5UA 3BJIC 4QBHA 4TZ0A 2C78A 3B1ZA 5E7IA 3DM5A 4IDHA 1OH5A 2GEDA 4B34A 1N25A 5E4FA 1R5NA 1L4UA 3NHAA 4M21A 5EUQB 5KNDA 3KTAB 2WWXA 4B3CA 1E2HA 4Q48A 2V6IA 3N2IA 1M74A 5HR5A 1QG2A 3A1SA 4QOSA 2D3WA 2GZDA 3BE4A 5FPKA 1VG0B 2GCOB 3HJNA 2O52A 1ESNA 3GQBA 4FD2A 4IDNA 2ZJAA 3L8ZA 2VIIA 3X1YA 1LY1A 2XEXA 4P3YA 2G88A 1WMSA 2WPDA 4PO1A 1NIJA 1YZUA 2A5JA 1N0WA 1E4YA 2W00A 3UK6A 3H4MA 4IRUB 3U60B 4FN5A 4Q4LA 4B33A 1DG3A 1E2JA 4C9BA 4URYR 1L4YA 2IHBA 1G8GA 2ERYA 2YVUA 4LBYA 4YMTA 4O2LA 4W9MC 4Q1BA 1E0SA 4IOJA 1LF0A 2ONJA 3RWMB 4BFUA 2V54A 5TXGA 2NZ8A 2ORIA 2P3SA 3EX7C 2QAGA 1KK1A 5JBQA 3C15C 4IJMA 2B7BA 2IA5A 1ZUIA 2GK6A 4OL0A 2VP4A 1GNRA 2C96A 2OG2A 3T5GA 1GSIA 1X1RA 2IW3A 3CRVA 3B60A 5F9FA 3PXGA 2FEMA 1KSHA 3T06B 2D06A 3ZJYA 5J47A 1OB5A 1D2EA 2O0HA 1JPJA 4MKHA 1B23P 4KVAA 1KI8A 2Q21A 3QNUA 2XZPA 4QC2A 1ZUHA 1T9HA 3RS0A 1G3QA 4DT1B 1IONA 2QM8A 4DDVA 2BEKA 1KI2A 4TLDA 1D9ZA 4DLUA 3VU9B 4P4TA 3CZQA 4RZUA 3T34A 1NIPA 2OBMA 5FL3A 1RYFA 2P5TB 3CIOA 1F2UA 2XNSA 3UWKA 4RKFA 2WOOA 2QT1A 3ZQ6A 1R4AA 4J0QA 4UNNA 3BFVA 2QQEA 1VYTA 3AVOA 4EAQA 4A2PA 4DEXA 3TVTA 1S3GA 4HB3A 4LCBA 4AK9A 1AQUA 1LTQA 3EIQA 2WKPA 3P4XA 5JWRA 3FOZA 3KUCA 2W83A 1I2MA 1VYVA 1XFAA 2FWRA 1ZM3A 4P4UA 1SQ5A 3LA6A 1TU4A 1ZJ6A 1KI6B 4HB4A 3VKHA 5FPTA 1JEDA 4GSYA 4LRWA 4Q19A 2Z4SA 5JSZB 4TYWA 3SFZA 4D80A 2PCLA 4U02A 3FMIA 2QT0A 2RHMA 4U00A 4C4PA 4M1SA 2OV2A 1XTIA 2P6NA 1OLOA 1KDPA 2A7QA 1Y3AA 3WXMA 3ZGXA 1S9HA 2H16A 2DYKA 1MO5A 3PEYA 3CX6A 5E3HA 1GL6A 1VHLA 1W5TA 1ZIOA 3GJ7A 3CPJB 4V0ME 5J40A 2W0MA 3MWKA 2FG5A 4ZCLA 4I81A 4OI4A 3KJIA 3AM1A 3KX2A 3BORA 3SJAA 1T0JB 2MSDB 2WSSA 3MMPA 1E2LA 1G5RA 2QAJA 2QMUA 5K8LA 1C4OA 1OPXA 4G5SA 3CNNA 5EZ5A 2HLDD 1KKMA 4B73A 3IHWA 3RC8A 1RRCA 3QKTA 1D8TA 3IBYA 1G3MA 2IEZA 4QGGA 2RH5A 3FKSA 3SN6A 4JL8A 2J7KA 1FPMA 1QHHA 3KQUA 4Q4AA 4IFEA 3A1WA 2F43A 1YR6A 1OJLA 3KKQA 1F2TA 2JJ1A 3CM0A 3THXB 3U7HB 4KSCA 4OQMA 2GA8A 1BOFA 5P21A 2BOVA 4XSGA 1VCIA 5B64A 2ZSFA 3C16C 2OCAA 4IXMA 4Q01A 4DCNA 1ZP6A 3LY5A 1V5WA 4UNSA 5AJVB 5JJKA 3J81k 5FOUA 5E7MA 5JEDA 4DWJA 3GLHB 3QXCA 1WQ1R 2YWEA 1E2QA 1X1SA 2IHYA 1S1CA 2HJGA 2WJVA 3U4QA 2GWHA 2WSSD 1RYHA 2IYSA 3ASYA 1D5CA 3DHWC 1EWRA 2NZJA 2YOFA 3ND9A 1Z63A 4DVGA 1JPNA 1U0HC 4KJZA 621PA 1RJ9A 3AUXA 4PC6A 4WVFA 1G8FA 4H1UA 3SBDA 4PXAA 4B75A 1RVDA 3QUSA 4WZAE 3RS4A 4NZYA 4ZPXA 1KO1A 2IS6A 1KI1A 2JJ1D 1Q1EA 1BH2A 3KB1A 1ZM2A 1YZQA 3EWAA 4B6FA 1JAIA 1F3OA 3SU8A 4MKIA 5C1BA 2WJIA 4BLOA 4QM7A 5F9HA 5HKKA 2Z4RA 3LXRA 3E5HA 2JLZA 4KV9A 2CLSA 2DWQA 4MYUA 2ZYVX 1JXMA 3KKNA 3GP8A 3I8XA 2FPMA 5L3SB 1DEKA 3AEZA 4JLDA 2QORA 5KO2A 1GNQA 1Q21A 3O8CA 1SZPA 2J9RA 1G3IA 1KIMA 1ZCBA 1JECA 3AF1A 3DVLA 1W44A 3L0SA 4JKIA 5EXSA 2ZE8A 3S1AA 3RANA 1FUUA 1E2DA 3LBNA 3NBXX 4QFMA 5BYKA 4G0NA 2FU5C 5FTKA 4XVUA 4ZDIA 4L9WA 2QTHA 4L16A 3EZFA 3BXZA 4D2IA 5F3WB 2GHIA 2P67A 3OIYA 4JL6A 3IIMA 1IBRA 2UKDA 3H86A 1KO4A 4JSYA 2QMEA 1N5LA 2FPLA 2WV9A 2I4IA 3CWQA 4EJSB 1UBCA 1GDDA 3K0SA 1E0JA 2NO7A 3SYLA 3TW8B 4PQYA 4GL2A 4R98A 2PEYA 3THYB 4NCKA 3U3RA 5HKKD 4RD4A 1M2OB 3A1UA 2A9KA 3REGA 4Z54A 1Z6GA 4JBYA 5DH9A 1MABB 3OEED 5FOVA 5KSPA 1TX4B 1NVXQ 2IC5A 1YZGA 2VEDA 1CEEA 1G19A 1ZC4A 4JLKA 5C18A 3L0IB 5CITA 4JVNA 4Z1MD 3THWA 1G8HA 1NLFA 4ON9A 5G3ZA 3GLFE 2IBMA 1NNEA 1NBME 4HEJA 4TLEA 4HATA 3LV8A 1OXXK 4Z8XA 1TQ2A 2G3YA 4JVSB 1A2BA 1UADA 2GETA 3QKRB 1ZM9A 2IYXA 1R2QA 3QKUA 3ZS9A 2X19A 5DYGA 4OBEA 3B9QA 4EQ6B 1D9XA 3KQNA 4MDFA 3H1TA 4UNPA 4JVLA 1SVOA 2GF0A 5FTNA 2VA8A 2V4ZA 3PENA 4C3ZA 3OAAA 1LVGA 4DLSA 1ZUNB 2JASA 5CLLA 1AIPA 3BFKA 5C2JB 3RRYA 1FQJA 1QZXA 4DCSA 2O8FB 1Q20A 2PL3A 1IY2A 2WWFA 1G6HA 3ZD7A 1JEEA 4PHHA 1CR4A 2REXB 1Z6YA 1N3BA 1UBGA 2BEJA 2EFCB 2WZQA 3FMPB 2AXPA 4PHGA 4YLGA 2BDTA 4OHZA 3A6PC 4PAMA 2A5YB 4MYTA 1UPTA 3VR5A 3RLFA 4ZV4A 2IYTA 3SBEA 1GRNA 5FI1B 1K6MA 2FV8A 4FCTA 4LJ9A 2CHQA 2OFWA 4P4SB 4G5GA 3ZLJA 4O2RA 1W49A 2AL7A 1Z2AA 4NE2A 4LV6A 3I61A 1CXZA 2OLJA 2RGDA 4CEHB 1U8YA 2BV3A 1OKKA 2ATVA 4CGZA 1JR3E 1E0KA 1GM5A 1JI0A 5LB4A 4PPQA 1XDBA 1NMXA 3WNCA 1XPRA 3ZDQA 1XBTA 1Z3IX 2RGCA 4UXHA 1E98A 3EZ7A 3QXJA 5SZJA 2A3RA 3FMFA 4MH0R 1XEXA 4D82A 2WM9B 1K8RA 2PZFA 1O87A 1S3SA 1YJ5A 2KWIA 3K0FB 3FHTA 4QGAA 2BJVA 2O8BA 1IHUA 1UBEA 2G0NA 3LLUA 5ANRB 2WAXA 4C30A 1FP6A 1UJ2A 2JLSA 2ZUCA 1W48A 2VPPA 2GJAA 3ADBA 2BM0A 2YWGA 2GEUA 1P61B 2OZEA 2R6CA 4PQRA 3GLGE 5F98A 5J4HA 2F6RA 2W58A 3N2EA 1Z22A 2IYYA 5KNCA 2I1QA 3A1VA 2DHRA 4KODA 5D3MB 5FL7A 4NONA 3TBKA 1E2MA 4JIMA 1KZGB 3AF0A 2P0EA 2P65A 3QF4B 5DI3B 5KDDA 4JJKA 2ZM5A 3VHLB 1U2RA 3DL0A 4QBIA 2J7PA 1EFCA 4YMUA 1IQPA 1NP6A 2C04A 1XNJA 1NVVR 1X8JA 4MGKR 4JSTA 4C2TA 2ZETA 3D3QA 2NO9A 2HV8A 2ZRKA 421PA 4QM6A 4ZDJA 1DAEA 2WMNB 4ZIRA 1AS2A 3B6EA 4M53A 2O0KA 4BGDA 1DO0A 1PVOA 3JVVA 2WHXA 3U44A 2PX3A 3LW7A 4PC3A 4KLNA 2D4HA 4UXIA 2AWNA 4GT1A 3AKCA 3BH7A 3SYNA 2XXAA 1LW7A 3U61B 1DAMA 1Z5ZA 4GNKA 4WW0A 4A6XA 4F4CA 4KLZA 1W1WA 2FMXA 1V43A 4ABYA 3QE0A 4NCJA 3W90A 3FHCB 1VTKA 2VHTA 3QPWA 4II7A 4TTPA 1S9DA 3QVUA 4GOJA 1KJZA 3WBKA 4PFSA 4B35A 4OK5A 4XTCS 1MRSA 5FFMA 4ARZB 5FL7D 5J5CA 3O8BA 3QEJA 1TQ6A 3TUIC 2FSHA 2Z5FA 3HYRA 4IVPA 4HZUA 4NPHA 1CRQA 3T12A 721PA 3OE7A 2FSGA 3RS7A 4AY2A 2J7PD 3T35A 3U7EB 3FB4A 1G3UA 3M1IA 4Q21A 4RFSB 4POAA 1QHSA 5CK4A 4QGFA 2VF8A 1E2FA 1AN0A 4C0JA 3CPEA 2GXAA 3B8HA 2H92A 4URWR 4TL6A 1KOFA 3I72A 1JQJC 1FQKA 2C03A 2GK7A 3CBQA 5SZHB 1WBDA 2ZSBA 4JLNA 2ZRBA 1EG7A 1L2TA 3IPXA 1N0VC 4JYBA 1HQYE 2WWIA 4TQAA 2W6IA 3UANA 3UXMA 5JWOA 1E2PA 2ZI6A 2BIFA 3HWSA 221PA 3DOEA 3QI2A 3TKLA 1YRBA 5AUNB 3GLIE 1GG2A 1SVSA 4TL7A 3A36A 3NKVA 3OE7D 4DJTA 4BFYA 2VSFA 2OBNA 2V3CC 2N1BA 4CT4B 4PSKA 4E09A 1OIWA 2BJWA 1DOAA 4Q9JA 3U7GA 3U6KA 2BBSA 2ZRAA 3MWLA 4PHTA 2ODNA 4LJ6A 4OHWA 1XJ0A 4IEIA 3BB4A 5FUYA 4BLQA 2BCJQ 5LDDC 4TMKA 5DHFA 3TSZA 3Q72A 3HU1A 4TMTA 1DADA 4EPVA 1W0KA 2CMKA 1E2GA 2RCNA 2ZANA 3TR0A 5J4VA 4AWXA 4DUGA 2O8DA 1FZQA 1IM2A 2ZSEA 5B2ZA 3P27A 1N5KA 3SHWA 3ASZA 4CEIB 3KZ1E 2QAGC 3GLHE 2Q0HA 1G16A 1II9A 1XPOA 1IN4A 1E99A 2X2FA 4N3NA 2Q9AA 4HB2A 1G17A 4HZIA 4TSFA 1LS1A 3MRSA 4OI2A 4PANA 4KFRA 4Q7JB 3TW4A 1E2IA 2EYQA 2J5XA 1KMHA 2X2EA 3HPQA 3KXKA 1QHXA 3LLMA 4B47A 3NDBB 4IVRA 4BUJA 4IDOA 1WCV1 2H5EA 3TAHA 2FFHA 3TH5A 4BECA 3ZD6A 2QQ0A 1T5IA 1G7TA 4LJ8A 4ITRC 3QQ5A 1CJVC 2VYFA 3EAQA 1XCPA 2ZYWX 1VIAA 4BLTA 1FFHA 2WWYA 1W0KD 1DG1G 4PSAA 4D4MA 2ZRCA 1XX6A 2ZVPX 2GKSA 1T8UA 1DTSA 3QIAA 1XB2A 2QI9C 3EIEA 2CK3D 2W2XA 4DUGD 5GVRA 4OQLA 1G21E 1RKBA 4TQ9A 1KI7A 821PA 5FTJA 3CX8A 4UJ3A 4FI3C 1FMLA 2OFOA 1MT0A 2BKEA 4LJ5A 2CDNA 3RRNA 2FZ4A 4HUTA 4TYNA 4ZDWA 4W5HA 4DSNA 1HV8A 5CIQA 1ZC3A 4TSFD 5TV2A 2D7DA 1TEXA 4KI0A 3IEUA 5CYOA 1IN8A 1E94E 1OFUX 3F5FA 2LKCA 4WZBE 1CS4C 1SHKA 2Z0MA 1GKYA 1GP2A 3MWYW 5CYPA 1ZBDA 2C99A 2VRWA 4AURA 2VO1A 1Q22A 1QHYA 2ZAMA 4QG7A 2YC2C 4D6PA 1YR9A 5BWMA 1F2UB 5K8UA 4MUAA 4BFVA 2VHJA 4CRWB 4A8JA 2C9YA 2Q3MA 1AKEA 2WBLC 2L0XA 1CLUA 1S96A 2XSZA 3GLFB 2DWPA 2ZU0C 4KFUA 1VYUA 1ZNYA 5CDFE 2KBFA 4TT3A 3L0OA 1GUAA 1OE0A 4Q47A 5D3QA 5F2EA 3I5YA 4CEJB 2QP9X 4B76A 5JI2E 3B7GA 2FFBA 4JVMA 3IEVA 2IS4A 3ZIAA 1DAIA 1H65A 3KKPA 4RD6A 2WTUA 2VP2A 5KPJA 2GILA 4O25A 4K81B 3AV0B 1NL3A 3BB1A 2JLQA 4C7OA 3QJYA 2JIZD 1F60A 2QTFA 3NBFA 2PLRA 1PUIA 2AN9A 1SULA 1GRRA 4V0NA 5KNBA 3AVPA 2WOJA 1P60A 1TEVA 1W36B 4JT4A 5JMTA 4RJLA 1XRJA 2AKYA 1E9AA 1TAGA 4CIDA 1TF5A 4EUNA 4A92A 1OYYA 2AWOA 3NVAA 2VF7A 5JHGB 1OB2A 1KHTA 2Q6TA 4JKYA 1G8YA 2R6AA 3DOFA 4PTLA 2F55A 3AGPA 2W6JD 2ZPTX 4TT3D 1OIXA 3DM9B 3JZMA 3O47A 1VPLA 1NF3A 4EPTA 3A8TA 4QL3A 1ZMXA 2JAQA 3MG9A 4A4DA 3Q7PA 2ZITA 3T15A 5JRJA 1J8YF 1F5NA 4LHWA 5EP2A 4KAXA 3CRW1 3QEOA 1KNXA 2ZRMA 3PEWA 4I1SA 3ZIAD 4C0BA 2ZROA 1CKEA 4M4SA 4TLCA 3WMEA 2ZSDA 2ZS9A 1Z0DA 2CCKA 5EE9A 2D74A 5SZKB 3WHKA 2QGNA 3SQWA 3K70B 2OXRA 1XTSA 4M9QA 4PPNA 4UKDA 1GVNB 3PEUA 4HAZA 1U8ZA 4IHQA 2CLDX 3PUXA 1HQCA 2YZ2A 1CR2A 1KK0A 1CR1A 4JBWA 1D6JA 3R20A 4QJ3A 3NTUA 2DBYA 1P3JA 2G1JA 5BN5A 5KDOA 3DKPA 2Q3FA 3P4YA 2REOA 2P2LA 1IXSB 4M1YA 4A1FA 4IDPA 5EE0A 3B82A 2WJJA 2FFAA 2FN4A 2QE7A 4EFMA 2ZRPA 5DIFA 3M6AA 1G6OA 1XD8A 5AK0A 4KFTA 5TDHA 2AD1A 1HT2E 3VNUA 3GLGB 2YC4C 2H1LA 4IW3B 2V6JA 3R8CA 1NN1A 1VHTA 1N6NA 3C5CA 4H9GA 4B3BA 3G0HA 3QXHA 2MSEB 2OAQ1 4S2EA 3SZRA 1R7RA 3L82B 1E0AA 1Q1BA 1MO3A 3K0CA 4FWIB 2CL6X 2XITA 3IHLA 4FMDB 3UATA 4QNRA 2NPIA 1FW6A 4G5OA 4F4JA 1KMQA 3CRQA 2JLUA 1EWQA 2RAPA 1CTQA 3GFPA 4RD2A 3EA5A 4EKDA 3DDCA 2WJHA 1PZNA 1WXQA 3EPHA 1J8MF 3K9NA 1OHHD 1XTJA 1OF1A 1AZSC 3LO5A 5DO9A 5L8VA 3IBGA 1S4QA 1ZAKA 4Q9KA 3KJHA 3IDQA 3SEAA 4E5UA 3TNFA 2QE7D 1M7HA 4UXJA 4NCIA 2VTKA 5CK5A 2CVFA 4LC1A 3RWOA 1OT3A 1P2SA 3G82C 3VHXA 4AKHA 2LWIA 2QPTA 1NY6A 1UFQA 1SXJA 2BM1A 2RB4A 4FCVA 1LS6A 1KY3A 4WAUA 2ZQ5A 4X8LA 1AS0A 3AP3A 3PEVA 3OESA 3PIRA 2XZLA 2J0VA 3IIKA 1US8A 3T1VA 1KTVA 4B3XA 4PAOA 3PQCA 4NDZA 4MGZR 1Z6TA 1PLKA 1EX6A 3D6TB 2ZSAA 4DLTA 2HLDA 3CR8A 2H7VA 4M0LA 4US1R 2HXYA 1Z0IA 3VR1A 5JCPA 1T3HA 1IY1A 1GL7A 5KU1A 2WIBA 3THWB 4D0GA 3SQXA 5IDVA 2PJZA 4QHYA 2ODEA 5GJVC 2YYZA 2EFDB 2ZTSA 5H8WA 3NH9A 1NN0A 1E9SA 2XTZA 4RD1A 2QENA 1D2MA 4CW7A 1ZD9A 3BK7A 2B21A 4NHOA 2IWRA 3U6BA 5H70A 4DDWA 3A4LA 5GJWC 5FBLB 5CB6A 1SXJD 4W5WA 3NG1A 2Z83A 1YRAA 3B1YA 4I1VA 4UQOA 5HPYB 5JHHB 3GLIB 4C0QC 1QVAA 4LK2A 4EDHA 5FOSA 1NN5A 1OH8A 2O0JA 2FSIA 2EWWA 2XTNA 2XX3A 3F3YA 4HUQB 4KYIB 4XD7A 1VG9B 5EP4A 2SHKA 1T8TA 1G4AE 2GZHA 4Q9HA 4RCZA 3UMFA 2VL7A 5CM9C 3RSLA 2W2TA 2V7QD 3LD9A 2IEYA 4K8OA 2C9CA 1HY3A 2P5SA 1U98A 5JWHA 2ANBA 4LYAA 5FOTA 3RNLA 2OILA 4DLVA 5JCZA 1GOTA 5H68A 1QHIA 2HYIC 5FPYA 3AVYA 4KBGA 3IUYA 1NKTA 4D0NA 3Q3JB 4DKXA 2O8CA 2H17A 3GEEA 4NYJQ 3RABA 2IYWA 4ACAA 3AVTA 1GITA 4RFVA 4KITB 3IQWA 3GPLA 2ZR0A 3AVQA 4P33A 1HT1E 2DFKB 2ATXA 4MYCA 1E9DA 4R2IA 1OH6A 3MSXA 2IYLD 2VQSA 1CJUC 2BMFA 4HLQB 3MFYA 2GTPA 2GAOA 4OYHA 1U99A 3NEYA 3OFNA 1P6XA 2R6FA 2F9LA 2RGNA 4IOLA 4Q1AA 4XD7D 4LV5B 1KK2A 3I8SA 1WE2A 4FWTA 2QSYA 1E6CA 3ETLA 5J4KA 2ZRFA 4PPFA 3KTAA 4DXAA 4LUCA 2O8EA 2YWHA 4P32A 4XJXA 2KE5A 3A58B 2JA1A 4LJ7A 2ZRHA 3KXIA 2DPXA 3QXXA 4EIWA 1XZPA 2GCOA 1N6PA 2QRNA 4M1OA 3K9LA 2CHVA 1BS1A 4XSHA 3KKMA 3WRYC 4LWZA 3FPAA 3VR6A 1W7AA 1QVRA 2LKDA 3GJ8A 4B48A 3EIHA 1ZVQA 1S1MA 4GI7A 3UWOA 4EFNA 4AI6A 3L43A 4JT2A 3GEHA 4JYCA 3OEEA 1Z0KA 3K0EA 3LW8A 1A2KC 3W8NA 1A4RA 1T4GA 5A0FA 3FYHA 1KI9A 3OFND 2ZR9A 4TMWA 4Z1MA 2NOAA 2NTYC 4M9ZA 1SVLA 2GJKA 3OIWA 4I1OA 5FOWA 3LFUA 3PITA 3H0KA 3V00A 1T91A 2IK8A 3R9XA 4ZIRB 5FUWA 4U7DA 3U3OA 1RC8A 3NH6A 1SVKA 4OK3A 1CU1A 2QSZA 3B1XA 3EZ2A 4LJAA 4CF7A 2AFHE 2XXAB 1II8B 1UDXA 2V1UA 4GP7A 3MUFA 1WBBA 1XJQA 1KDRA 4JMPA 2ERXA 4URZR 4KSBA 4PZYA 2WIAA 3NDPA 3AQ4A 1AZTA 1Z6XA 4Q1CA 4Y0AA 4Q4JA 4YXWD 3RVBA 2AD5A 3TE6A 2NO0A 1EFUA 2R2AA 1A5TA 3DKVA 3O8RA 5KOYA 3ZVLA 1AS3A 4L9SA 1XWIA 3OF5A 2FE4A 3CLVA 2DFNA 2JLVA 1NJFA 4PQFA 1II0A 1XD2A 4HAWA 2X8AA 2CXXA 1J7KA 1ELOA 3U3JA 1AQYA 4B3GA 4QJ4A 3SS8A 2QTVB 4OK6A 4G5RA 3AVWA 121PA 3CF6R 2DR3A 3WY9A 4KVGA 1BO6A 2FF7A 4D4KA 1P9RA 1NRJB 3W9YA 3AGQA 2GRJA 4CYMA 2F7SA 3ZZTA 3V4FA 4PC1A 1KY2A 2ASEA 2BC9A 2GCNA 2QPAA 3IGFA 2XOKA 5EE1A 1UM8A 2YHSA 3ZVMA 5FR1A 5EP3A 2AR7A 3I1FA 3WYAA 3TSWA 2JDID 3FMOB 1G9XA 2PX0A 2WKRA 5JSZA 1YE8A 3N5CA 2PMDA 2Y8EA 3RS3A 1M6NA 3SE0A 2GAAA 2I1VB 3GEIA 3R8FA 1J90A 4HDQB 5FOXA 2OAP1 3MD0A 1WA5A 2G83A 4LJ4A 2W2VA 4JS0A 3EC2A 4XWAA 4RD0A 1DPFA 4NU0A 2ZXUA 4A36A 1Z47A 2HUPA 4Q02A 1UEIA 2CJWA 2IT1A 4X8HA 4BE7B 4QKQA 1TUIA 3KUDA 2QMHA 4U5XA 4TMVA 1NN3A 3NC1C 1X6VA 2YOHA 4JLMA 3AP1A 2VHQA 3D7MA 3HR7A 1DAFA 1NMZA 3FHOA 2XOKD 5B58C 5KYKA 1CP2A 3QF7A 3QG5A 2QNRA 3UMRA 5JEEA 3X2SA 3AKEA 1YVDA 3B78A 1PLLA 4WOPA 4QBGB 4BQSA 3LQQA 4RCYA 1JALA 1P5ZB 1J70A 5GADl 4R2HA 1M34E 2PEZA 3TUZC 1MOZA 4Q4HA 2Q9BA 4IKEA 4EPRA 2VLIA 3AUYA 3H84A 4GMDA 1Q0UA 4MKGA 1KMHB 2C77A 3QKSA 4PZZA 1FTNA 2AK2A 4LI0A 1U90A 5FR2A 2ZI3A 5FTLA 4Q1DA 5C4MA 5HZKA 4US2R 4DCVA 1R0WA 2QU8A 1ONBA 2QGZA 3CKLA 3ADKA 1W2GA 4BRUA 5AUOB 3SC3A 2PBRA 4DCTA 1HTWA 2Q3HA 3FDIA 4I99A 4URXR 1C9KA 1E9FA 4BRWA 4NYIQ 3T1QA 4GRAA 2H57A 4HLDA 1W47A 1OXVA 3PUWA 4PAQA 1AGPA 4B3DA 1RPZA 1W0JD 4P0TA 3L0PA 4P31A 2EFHB 4ZI2A 4A8JC 1KKLA 3SJCA 3K1JA 4DSTA 1GKUB 3ZVRA 1ZNZA 4BFSA 1XMSA 2OEPA 3QPVA 4HAXA 3AP2A 2NMVA 5TB5A 3ADDA 2B8TA 3CZPA 3BERA 4ZCIA 1E69A 1AM4D 4V0KA 3SR0A 4QNMA 4MITA 2N42A 5L3SA 3K53A 1ZM7A 4CVNA 2IUTA 5BXQC 3C7KA 2VBCA 4BLSA 4URUR 5FPHA 3CUEF 4MUBA 4XIGS 5DISB 1U9IA 1UF9A 1H8ED 1P9WA 5FBQB 2ZJYA 1E96A 3EW9A 3R9WA 3ZVNA 4EPYA 1I4TD 2OXCA 1Y63A 3GJ4A 4QBFA 5EZ6B 2ORWA 3WMGA 5JLJA 4DIDA 2OHFA 2QL6A 2REBA 1U94A 5CLQA 1LNZA 4G5QA 2PZGA 3AVVA 3BFXA 3PUVA 4TL8A 4QHTA 4C0KA 4V0OA 2JLWA 2DFLA 2QBYB 2IL1A 2OE2A 3THYA 4YC7A 3ICQB 2C98A 2F1HA 1P72A 2VP5A 4A0RA 4C7OB 4GOKA 2FA9A 3K8YA 3CH5A 4HI0E 5EJEA 3MAAC 5FUXA 2AXNA 4N1AA 4HAUA 1MABA 2AX4A 3C5HA 3C4JA 3TAUA 1E1RA 2B7CA 2D2EA 2XJ9A 2ZI7A 3CRMA 3GJ3A 2FNAA 4LPKA 1ODFA 4BASA 1W4BA 4LYHA 5L3QB 3FGNA 4G1UC 2ZE5A 4F7WA 1XEFA 1HH4A 2F3TA 2XNDD 1P2VA 2YV5A 3EA0A 3THOA 1ZCAA 4A0HA 4C2UA 3IO5A 2ZUDA 4LBVA 4D4JA 1KDOA 1U0LA 5A4JA 4ZO4A 1KI3A 1M7GA 5AUPB 1Z07A 4TYYA 2C5LA 2J0UA 4A9AA 1E79D 4XWKA 4L15A 1CRPA 2J59A 5IRCD 5GJBA 1NVWQ 3E70C 3CWZA 3QKRA 5K8TA 1RRGA 2RHDA 3PCRB 4ZDKA 4BPBA 4K46A 4EQ6A 1X8LA 3DPUA 4TLAA 1N6HA 5HCNA 1H8HA 2JLRA 5DYIA 5KUTA 2ZRLA 1F48A 1OFIA 1G1MA 3K0AA 1IJEA 2JGNA 5LBIA 2EFEB 2CNWA 4A6PA 3LRPA 1RW4A 3AB3A 2GXSA 4Q1FA 5AJZA 2O8FA 3P20A 3QBVA 4ESVA 2BCGY 4WXRA 1J2JA 5DHAA 3QVVA 3MJHA 1E1RD 1K5GA 5G53C 1NKSA 2CK3A 4AIIA 1BYUA 3RS5A 3AF2A 5BN3A 2IYZA 2DWOA 3TGPA 3K0CC 3EZ6A 3KJEA 1EFHA 5BW8A 2ZI4A 4BEJA 5J4LA
chains in the Genus database with same CATH superfamily
1CUFA 4P53A 5LP6C 3E8MA 1RAFA 1DS6A 3H0EA 1MB2A 5EHIA 4ZI7A 3OZAA 2HMSA 1WG8A 1TC2A 1QDEA 2HUNA 2Z58A 3CGGA 4OTZA 4U7HA 1UQTA 3ESXA 3UUGA 1EM6A 1KJYA 3TI7A 1Y9AA 3PP8A 3OMXA 3RJ5A 2X7JA 1MRZA 3TQRA 1G20E 2RHGB 4CEHA 1RE0A 1EZ1A 3BXPA 2FCAA 2FG6C 3X1WA 4AF8A 2QJWA 3VPHA 3M5PA 1HYGA 2HJVA 3PR3A 4GPBA 1JXQA 5HNKA 3MZ0A 3T5BA 1ISGA 4ZMBA 1T0HB 3IP8A 1XHLA 4JMLA 4MB2A 2HCJB 4GWLA 2HSWA 4PC2A 4YJ2F 2H2AA 5GAJA 5IVHA 2C58A 4GOND 5A3QA 1TM1E 5EWLA 4AJIA 2XYRA 3BD9A 5EHQA 1YCFA 3UJ6A 4BC1A 3JYOA 1P0FA 4NMHA 4UE6A 3ZNQA 3A9CA 6ADHA 4JYZA 1VMKA 5CD9A 3MS7A 1YE5A 1GUDA 3CE9A 3UEOA 3SYTA 4A16A 1CUBA 1JMKC 2JFUA 3TLBA 1YQWA 3WRWA 2WQ6A 2A1TR 3SEFA 3VTKA 1C3JA 4BWYA 3D2AA 4UVDA 3LL4A 1CETA 1UMBA 2OL4A 2D1RA 4DR4B 4NWIA 1MRNA 2QUAA 3ZN2A 1EIWA 3LI2A 1TA0A 3GCWA 1DZIA 4TTRA 1TO1E 3T7JA 1GPDG 4F96A 2UVQA 4KMSA 5BURA 2K4MA 1E2EA 1PQUA 3QF4A 1NQXA 4W82A 2HN9A 1N34B 2QL9A 1CCWA 1WF6A 1GWNA 1XZGA 3KIPA 4UJ5A 5F1PA 3UYKA 4K1XA 4UAGA 4XM0A 1NLZA 4NJEB 3SX2A 3MTJA 4AYXA 1TKBA 4DIUA 1DL5A 2K7ZA 3HKEB 2YINC 2ZK7A 3R6TA 4K40A 4NE7A 4HDOB 4Y1GA 1QPZA 4PYRA 2A5DA 4KXNA 1L7DA 4HP8A 1MX1A 2Z30A 2C4HA 3S2YA 1JHOA 1L3IA 4S04A 2PSEA 3EB9A 1ZNXA 2H1OA 4XM1A 2M6KA 3T5MA 3TJRA 2OXFA 4QGHA 1TEZA 3TK1A 2XI4A 2GKGA 1XQ1A 2YN4A 3L3BA 2Z3VA 3GD7A 2X5XA 1AZWA 4B4VA 3OWXA 3IIJA 2D62A 2XWPA 2G6BA 3ASUA 3MJCA 1I7DA 2YW9A 5JDCC 1JGTA 1Y89A 3EXHA 4R8KA 2WWVD 4A2QA 1H5UA 1M6VB 3HUTA 2IV2X 1DWQA 1W5EA 2ZSKA 3SLGA 1FNDA 3HQ4O 3N2LA 3O75A 3AR2A 3ZXYA 2UDPA 1SXHA 3W06A 4YWJA 4LC0A 4KHPB 1QHGA 1C8BA 3AU9A 1IZYA 1N75A 3AI3A 3G8AA 1XMJA 1GNSA 2AV6A 4MCHA 2QYHA 3R76A 1CIJA 4BZWA 1AUPA 4KWIA 4Z2YA 4UDYX 1P19A 5LLSA 5C1PA 1N5IA 3QMVA 2J6CA 4BWVA 1WB9A 1OFGA 2M9MA 3ZU4A 5JS8A 1RCUA 4OV6B 2VHUA 3PV0A 1AA9A 1RSZA 1ZL0A 4R9UC 4BMXA 4DIMA 3JARB 3OCXA 4BMZA 5HCIA 1UBNA 1XTKA 3DTVA 3BGSA 2H1WA 2G4LA 2AI1A 4P4NA 1B8NA 1Y81A 3I2FA 5BV8A 2H51A 4OLFA 2OV3A 1Y7HA 3CISA 2Y9MB 2FTKE 3FZEA 4WNCA 1GAJA 4BAZA 3P5BA 2MMCA 4UCQA 4IH1A 3AK4A 1QJCA 3L8HA 1EVIA 5AVUA 1OXTA 4IUYA 5ALSA 3ONNA 1FOEB 1IXYA 2Q4TA 2WHQA 3KAQA 3LXXA 4EGSA 1PNRA 4H1WA 2YWJA 3CVOA 5FLEX 2WF5A 2JVIA 4LHZA 5JQGB 1XG5A 1PSWA 1QGDA 4HWSA 3INRA 4IM7A 3NV9A 2GXUA 3FVWA 3MJ4A 4GM1A 2B83A 1X87A 4IXTA 4K3VA 1E3IA 1WB6A 3PLRA 3MGCA 1YHNA 2Q6LA 3ZE1B 4PPYA 4R7ZA 4JC0A 1YB6A 5DE3A 2PH7A 4DSZA 2GPAA 4EO9A 1MXHA 4LYFA 4ALKA 1XDZA 1OHHA 4R71A 3T3GA 2PO5A 4YPFA 2A30A 1PK8A 2X0JA 3I39X 3HXOA 4DIBA 5IJ0B 4BNLA 4DHWA 1SKYE 2MYUA 4L02A 5EXXA 4B43A 2VSNA 4EZIA 2ADFA 1RP7A 1NBAA 1XCLA 1XEWY 2PN1A 4KPFC 3J80A 1GPLA 2C3YA 2J09A 1GTMA 3U56A 4Z49A 1KIAA 2Q3BA 1X80B 4NPCA 1MOPA 2R7LA 5IM4A 3H2IA 4YRLA 3OX1A 4ENVA 3OFJA 1O0SA 4IDGA 4Y2GA 3VR2A 2O8EB 1ZW1A 1U11A 2B4QA 3SN6A 2D6FA 1BHO1 3RC2A 5CNKA 3CT4A 4KOAA 5LR6A 5BQPA 3E1GA 1NSTA 4B6OA 4GBMA 3ZKWB 3UHFA 2EATA 1NPTO 5SYMA 2ISSD 4AJ4A 3F5QA 2PL5A 4YR9A 1QV6A 4Q9AA 3AJAA 4WZAA 5LMNB 2ZIXA 1ZOPA 4QG3A 5JAOA 1V41E 2H7XA 3CUVA 3KPVA 3VH2A 5KKNB 2AZ4A 1OAOC 4KXWA 1QRAA 3L1IA 3NUQA 4WOBA 2G1UA 3VR5H 2R751 1ZVVA 2DU8A 3WV5A 3QXSA 1DJNA 4FMCB 1YFKA 5I48A 2CFIA 4RDHA 1W0CA 4BNKA 3ZE7A 4QOGA 1MJ5A 3GROA 1NQVA 4GZMA 3RSOA 3FYCA 3Q6MA 4NAVA 3NOQA 2OHHA 2FUG1 1WHSA 4IS2A 2XMQA 4M1TA 4DA4A 1Q0ZA 2EIHA 4B2LA 1MOSA 2QVZX 3L1VA 1TYZA 1C9DB 2JEYA 2MINB 2FKAA 3GZTB 5EP1A 4ZOQI 2RG7A 5IU6A 2VDRB 2BMDA 3QOFA 3SC4A 3WYGA 5HA5A 3S2ZA 2PJDA 1K7FB 3SOZA 3WO0A 2RKBA 2X13A 2A0WA 3GGGA 2IIQA 4KPGA 1HDYA 1EB9A 4M1QA 1DFGA 2R44A 4N3GA 2EFYA 4KYUA 5DMXA 2C0CA 3KEMA 4Q4JB 1VPWA 1ST3A 2CUKA 1R8SA 2GQ0A 1QRRA 2I6FA 3EY9A 3LZDA 2X40A 1PZXA 1JNYA 2OBBA 1QQ6A 2ZTVA 3DHVA 4YRFA 1L5KA 3LX8A 3ZV6A 4CV1A 4ZQIA 1GTSA 5TPZA 3R3SA 1DBPA 2AE1A 2BFAA 1AE1A 3BAFA 3EXAA 4X24A 1CQJB 3ZTWA 2J3HA 3GJ0A 1O7JA 3NR2A 3VU3A 3WKEA 4OQ4A 1N0HA 4JEHA 4C6TB 3N8GA 4J0IA 3T95A 4CG3A 5M34A 1J99A 2EFJA 4OAOA 2GFQA 1NG9A 1PFGA 2PUCA 5DK4A 1BRTA 4B4OA 3RFXA 1GIAA 1Y6ZA 1T5TA 1EK0A 4DZZA 4JCOA 2HXSA 4A2CA 5C8ZA 3LHKA 1ZGCA 2OXIA 1RWOA 1JEOA 2AJ8A 1GNVA 3ONWA 1OFHA 2WD7A 5JS7A 5I4BA 1SG9A 4E12A 2RARA 3ACCA 4CEJA 2FLKA 1XQ9A 2C9OA 3DDOA 3WLLA 1IM5A 3RNOA 1N6IA 3N0VA 1XLUA 3G8BA 4CG2A 4Q3BA 4O0MA 2IHJA 5KJFA 3CR7A 4GICA 4WOJA 4EW6A 5JJ5A 2NIPA 2QN2A 2KHZA 3P2MA 3PHCA 3WHLA 1I2DA 1LFDB 1KF0A 4LHSA 1Z37A 1OVGA 5FWNA 1BYIA 3W6OA 5C35A 1XXHA 3IAEA 3Q2IA 1JEYA 3RKUA 4IXNA 2IUUA 4HOYA 1WCIA 4DBLC 1R5BA 3LQRA 3U26A 1Z73A 2JIRA 2CE7A 2PMFA 4L07A 5F73A 3RC3A 5FO1A 2RH8A 4S3MA 2ZFUA 1LNSA 3OU2A 1Z6PA 3SM3A 3PGMA 3HJRA 4R2MA 4C0LA 3RSFA 1DT5A 2XUFA 3LHSA 3D6FA 2G4CA 4NZZA 4XPIB 5KJ6A 1W6RA 2H1SA 3F5MA 1K5PA 1SIWA 5K4AA 4JL5A 1KQGA 3G9UA 1P1HA 2J0QA 3GT3A 1NBMD 2RHHA 3EODA 4DA8A 2E87A 1GRQA 3OTOB 3RVMA 5J3JA 3A9UA 4ZYYA 5CCXA 1C7QA 4A03A 1RCFA 4PRYA 2AK3A 2OCIA 1DAGA 1DKPA 4F8JA 3L8YA 1CT9A 3WGTA 5BSTA 2H11A 3PQEA 1BX1A 3VSBA 4AY3A 3PL5A 1ZIXA 4YS6A 3PUZA 4P6VF 4LXGA 3FUVA 1NSFA 1PSDA 4L75A 4W9NC 4RYDA 4BVGA 1AJEA 1X2EA 2W93A 4NIMA 3BXHA 3RE1A 2O8BB 2NQ8A 5AM1A 2XQJA 4RVCA 3UMCA 3WI7A 3H11B 5CJ2A 5JTTA 1SD1A 4PBTA 3EQ7A 3DVRX 2IITA 1NVUQ 3MJVA 3R23A 1PT7A 4FZ5A 1Y9EA 5FEMA 3QVOA 4TXJA 3HXLA 4TROA 1GU7A 2FZEA 4PINA 1GZ3A 5TJHA 1NGSA 4D57A 4ETNA 2OV1A 5KAPA 4YXWA 1B6TA 1CWUA 2GCIA 2VPIA 5B37A 4DIEA 1JTVA 1P9NA 2QP3A 4Z0HO 2EW1A 2I7TA 4FFBA 1I80A 3QBTA 1J56A 4AZ0A 2VDQB 1GL3A 1NW3A 1U8XX 3FKSD 2PLWA 3R3WA 4KN5A 5J2TF 3GLGA 4GZ3A 4BCCA 4G0UA 2BFMA 4M36A 1SVNA 1UKYA 1U9IC 3BULA 5CNJA 2HF8A 3ZWCA 2QM7A 3QW4B 2DUWA 2WV7A 1YZLA 3HA2A 5A3JA 2GCPA 1Z5NA 2I3BA 2JFVA 3I04M 4HVCA 4R2XA 3RFFA 2O0MA 5I3CA 1N2EA 2RGXA 3LP8A 1DC7A 3F74A 1I4EB 4WBNF 3I0MA 4UATA 3AU8A 3AI7A 4MKRA 2EQBA 4NOKA 5KQSA 2ZRGA 3MHPA 3NC0C 4H17A 4BQFA 2VDPB 2YWRA 3E6AA 2V9PA 3S68A 2YJ5A 1N1GA 2D1TA 1P0CA 2FGJA 2PKEA 3KB2A 3T61A 3T9AA 4Y1FA 4MJ7A 3DKRA 4P7FA 4JENA 3M4YA 4MQ5A 3RVDA 4S1TA 3LUAA 1TU3A 2GZRA 1DAHA 2FZLA 2P4UA 1NP3A 1Q0QA 2OQ2A 1Y5NA 1UPBA 1KAQA 1AKYA 3CFYA 4DAOA 5F1KA 3DZDA 4GQBA 2GOYA 4B2YA 2G77B 2K7FA 2JHFA 3BPSA 1E2KA 3D1VA 3FD8A 2JLXA 1WDMA 4L5JA 1NJ5A 1RD4A 2V65A 3CN9A 5HE8A 4C4AA 4TV8A 1SHZA 1REQA 3D3KA 4AS1A 4PLYA 1NW5A 3HE3A 2Z2ZA 4GI2A 5DNYB 1QONA 3KETA 4A15A 4DLZA 4WRRA 1QF9A 3T3OA 4YB8A 4DV1B 3BH6A 4Q3KA 2AS0A 3QELA 5CIWA 3KRTA 4EY3A 3L02A 4BL5A 1XI2A 4J4HA 2NUTA 1KJWA 1ZU5A 4HAVA 5KTNA 3TX2A 2R47A 4FJ2A 2W8BA 3EQ6A 3H9BA 4I4IA 2CXOA 2EJVA 1JPVA 3BRWA 3C4VA 1YZNA 4N0DA 5D1HA 3AB8A 1QIEA 3ESDA 3I2IA 3LGXA 3M34A 4GKAA 4HCJA 2O1XA 3O92A 1OZGA 4IR7A 2H9YA 4RABA 3V1UA 3ZPXA 1JL3A 1QZZA 3D6JA 4IIHA 1QBKC 4ZKEA 1L7EA 4GFDA 6NULA 4GQIA 1UWCA 4R8LA 3WTCA 3R6GA 2O5VA 2JGJA 3SGLA 2IQ5A 2I8LA 5EERA 3Q40A 4H7EA 4ZEXA 3Q10A 1MTZA 1LWOA 4F5EA 1UXKA 3BOSA 4PYMA 1BMFA 2OBXA 1KO7A 1T6NA 1JQLB 2POCA 2AKAB 1EX7A 3LDFA 1P81A 2PUTA 1QJ4A 4GUAA 4KN9S 4GLOA 5E4JA 2Q5JA 5KX5F 3ER9A 2XCSB 4XR4A 1CRZA 1LPNA 4ID3A 3K9GA 4E5DA 4CZ2A 2OR3A 3W5AA 3T7DA 2CHFA 2QUZA 3D5TA 4X60A 1B16A 1XP8A 1TF7A 4UE3S 5EEGA 1PFUA 3IUBA 1GY8A 4KMRA 2YYYA 1G8JA 5ICGA 3MCAA 3U3XA 3E03A 4KACA 1E7YA 3BWMA 2HLPA 4R0NA 2E4AA 3CC8A 3AWIA 4G9BA 3ZHUA 1XXHE 5TMPA 4HUQA 1Q12A 2XKJE 1LPAB 1XMVA 4QUEA 4EMSA 3OURA 1WP9A 1C7FA 2JAXA 4KGZA 3CXUA 5FBVB 2BFFB 4LZZA 3DFIA 3A37A 2JCSA 4RGVA 1O0CA 4P5DA 1RQPA 2QPOA 5ENVA 3C6MA 4K1LA 5DGXA 5JOQA 3HB9A 2IX3A 1LD3A 1QUEA 5BN3B 3I3SR 4MWBA 1KWGA 2EWVA 4DSTA 1E4EA 1Z4MA 4YRMA 1P7VA 3OETA 4GXNA 5LWHA 2BHRA 5PNTA 1QVWA 1V9LA 4UVEA 1GR1A 1CIPA 3ER8A 3MLEA 2R2GA 1MZPA 4ZOLB 3SR3A 1BS9A 2YUTA 5DYNA 3W5DA 3BWDD 2QL5A 2OAEA 4NBVA 5DWVA 1YACA 1JB9A 4RIFA 1A4XA 3PX3A 2BZ1A 5CT8A 3RREA 2XOEA 3UJ8A 4L7QA 3P4UA 4MIKA 3KLOA 2OCBA 2XXBA 3R3HA 5I6DA 1JG7A 3X2FA 2CE2X 4WN9A 4OM8A 1AQ6A 4QEDA 1WULS 1FNBA 3OAAD 2ZVJA 1E2UA 3QE2A 5A04A 3D4LA 1J0CA 1I24A 4WY8A 1USUA 2ZRNA 1QE5A 3LS2A 1PKXA 2HI0A 1UAAA 2F1JA 1GFSA 1VC2A 1V5GA 2FDXA 3R09A 1V7ZA 4LJKA 2Q46A 3D8RA 3V4SA 2H59A 1U9YA 1E6MA 2ZJ8A 1Z06A 2E9SA 3COJA 4LX8A 3RFUA 1PQPA 4MCJA 3UMYA 1EVEA 3GRRA 1CQIA 2BGNA 1OH7A 3R3JA 2Q07A 1V7CA 1W4CA 5T4HA 4OJQA 1JKJA 4IXDA 1M8PA 1MC5A 3FSEA 5EE3A 3FGOA 4V2IA 3O26A 2G06A 3V55A 1I94B 1BAPA 3TOZA 3FNHA 4V0LA 1P33A 5B6JA 5AR1A 1LSOA 1E1CA 3B9RA 3QU9A 3VSEA 1USGA 4NMXB 2TMKA 3IT3A 5KWEA 2X7HA 4TL9A 1T9GR 2WHEA 3R9IA 3TNDA 2C42A 1SU4A 3PC4A 4FGUA 4M87A 5CH5A 5IJ9A 2XF2A 2EKQA 3EBPA 3N8NA 3MSCA 4WPGA 1R0KA 1R0YA 1KETA 3DOJA 1TU0A 3NW9A 4IQ4A 4AMVA 3WJAA 2XB2A 2R86A 2DG2A 4HMPA 3OQJA 4WKBA 4EENA 4JI3B 3VAZA 2VP6A 1SD2A 2F8TA 1IY0A 2AQ8A 3OZIA 4Z4IA 5L3ZA 3LY9A 2ID9A 4PYKA 1DUSA 4L8WB 1EFRA 2VCYA 5FXMA 5SY9A 5CXUA 2O2ZA 4R3WA 4UTZA 3FVQA 4AC9A 1L3CA 1SBIA 4NY1A 3DE3X 1FUKA 3O74A 5T4FA 3SFVA 2ZRDA 3FYUA 4XD2A 2NTNA 1C3XA 4UTVA 5CPBA 4YRQA 3X1ZA 1XIVA 4LF8B 4HBGA 4AP6A 4HDRB 2AN3A 3PE3A 3K6KA 4BLVA 5JBNA 2J0SA 4Y9SA 3H5RA 1YR8A 3EPRA 1J24A 3IJEB 4PCAA 5CDFA 4GLFA 1NZDA 1P4SA 5THQA 4GWGA 4Z8YA 2CV2A 3KT8A 4PG4A 2YJ4A 1GXSA 1YT5A 3A1FA 3E1KA 2Z1MA 1DCMA 3L8FA 2C2WA 2AMLA 2LIVA 1P1CA 2OM2A 2ZRIA 4F2GA 1G5PA 2VHCA 2CXNA 5EQFA 2JFHA 4CUZA 2CVOA 1U1EA 3A9SA 3B20A 5L4SA 1NQUA 2LNDA 5CJPA 3U4DA 1FX0B 3A27A 1IXRC 1FB5A 1Z29A 1S8FA 3B13B 4HLUC 4JJ4A 2POQX 3IQIX 1CZKA 3OC6A 3U81A 4B17A 5TY0A 4MVJM 4XYBA 3DFKA 4MZDA 4DXHA 2NTVA 2RK3A 1COWA 2GPSA 1EDBA 5C8VA 3W6PA 1MVOA 3D6AA 3ZOKA 5FUVA 4A6EA 3HFGA 2Q0QA 2B3DA 3STUA 2HA0A 2HK9A 1YR1A 3PFBA 3DEJA 5IKEA 1U0EA 2YHIA 1P7WA 2FZ5A 2PZBA 4K6OA 3O1HB 2XH8A 3B52X 3DGFC 3K9BA 4YMWA 3H2BA 1N6RA 1ONSA 1U8UA 4WBSA 3RDPA 4AU1A 3TQOA 4DCPA 1NUUA 5LJIA 2O7RA 4IZHA 2Q4DA 4ZT7A 4IJUA 2WY2D 1YL5A 5KS2A 1WV0A 2XGJA 3C3JA 3UK7A 2V1XA 2QI9F 3I5XA 4NP6A 2CFSA 3SYKA 4HH3C 5TQ2B 4URVR 2A1IA 4C5BA 4ZI3A 2JAUA 5AHWA 4HWRA 2O2JA 3I37X 4HNHA 2PHZA 3W3AA 1C3VA 4KNVA 4KVZA 2QUHA 3BX1A 5F77A 5JASA 1UEJA 5KWVA 3VKWA 1VIDA 3QWBA 2JIPA 2IIBA 1FUEA 2XCOA 1QIKA 1NASA 2FWIA 2PX8A 4LYGA 1QHNA 1Q2XA 5EWJA 5TJ9A 3TRIA 1UP6A 3AW8A 1T1SA 3D43A 1Z25A 2IF2A 1HYEA 3DNPA 3JAKB 4Y2VA 1PZHA 1FYWA 2J45A 2XD9A 4L6CA 1XT6A 1SQFA 2Y99A 4JJ8A 4MRMA 3OLWA 4E6EA 1N7GA 3WNDA 1V1MB 4N5LA 5M04A 4RKEA 3GX1A 1F8GA 3DO5A 3HP1A 3F5SA 2PT7A 3P0IA 1XZNA 2ZIAA 4UREA 4QOIA 3JD0A 3E22B 3WBFA 2WM2A 1Y8RA 2AT1A 2V58A 3AEQA 3DOHA 4IY1A 4RLQA 2GKOA 4YI3A 5IT5A 3HUUA 2I2FA 4ACBA 1MJHA 5IUKC 4HYYA 1ADYA 3PC8C 2VTBB 2PUFA 3DZ8A 2J32A 1RCTE 1N33B 4Z3KA 2YTZA 1CZNA 1KEVA 2X9NA 1XZBA 4FJ1A 4NX2A 5DN6A 3W2GA 2IF0A 4TN1A 4UD2A 3SPXA 5EHZA 1XN1A 4RD3A 3B1VA 4H4CA 4N6NA 4LMPA 2FPPB 2JIOA 4O0LA 3NASA 5BNTA 1B14A 2W9XA 1KARA 4TT8A 2ZBUA 1V48A 3BH0A 2R66A 2MJLA 4FHGA 2ILTA 2WK1A 3FAKA 2CCGA 4MYHA 1I7QB 5JSZA 4ERNA 1XELA 3EPLA 2FFJA 1HFJA 4LYJA 3CX7A 4KXFB 4CKEA 1DO2A 1YQQA 3P8ZA 3SS7X 2PJUA 1QLJA 6GPBA 3AW9A 3BZBA 4BMSA 4P5PA 2AG5A 1FX1A 5H3CA 2BEWA 4GC5A 1FYFA 3DZIA 3JYQA 3RUIA 1T2AA 1Y3IA 4EW2A 5BMOA 1OXSC 1RACA 5KYTA 4PRLA 4LC9A 1TMYA 4O2BB 5I4KA 1D2CA 3PNOA 1GNPA 1KYZA 2IDKA 4WVLA 1V26A 2CNDA 1U28C 2LPMA 2ZJFA 4C6HA 1OXMA 3MHTA 1F8FA 3HRKA 1ZVKA 2O7SA 4DHEA 2YNMA 1KSJA 2Z6UA 1QV9A 5FPSA 3W7AA 2IGTA 1DMSA 1EFVA 3CUUA 2E6KA 2R7MA 2JKYA 3UBMA 1WSBA 5EXTA 1Z2DA 3VPAA 1BQ4A 5LD2B 4Q82A 4URHA 5EXDA 3OUZA 4N5HX 3U7FB 4DEYA 2IXEA 1NQWA 5F33A 1ZISA 4DANA 3I32A 3KWJA 3HNOA 3M9XA 3M49A 4FOTA 3QEBZ 1CF4A 1E2NA 4IGIA 3EE6A 4X1YB 3UBTA 5BN4A 5AVOA 3TM4A 1JDNA 1KQFA 1NF2A 1E9BA 1I5EA 4ZTBA 4H1VA 1H5NA 3DAYA 4N0EA 1XZ8A 3F97A 3KQOA 3E9CA 4QFBA 4S35A 1YR3A 4J2OA 1KYVA 4RSRA 5HM6A 3Q3IA 2O8VA 4OHVA 2BMJA 2N0SA 3OKPA 4OXNA 2EZ4A 3FHJA 4BN5A 1U3VA 4FCWA 4EUEA 1Q44A 3GLRA 3DEFA 3I5UA 4X45A 1SVIA 2EKDA 3L1UA 3LX5A 2GDJA 1DB3A 4I4TF 5DSTA 2YQ5A 3TDNA 2Y4NA 3KU4A 3OVMA 3WQBA 3HXQA 2NT4A 3OICA 5JJIA 1Q1AA 4ZEMA 3E7PA 5HMMA 5BW4A 3UMMA 2O3QA 1V11B 3U37A 3DDHA 2A0FA 2XE6A 3P1JA 3Q7EA 3R0JA 4KDRA 1HLPA 4NOLA 4OREX 5EQTA 3BHIA 3C1TA 4LGCA 1AGRA 1NATA 2GZAA 4HVTA 1IWOA 3S99A 1FJXA 3DA8A 3GWGA 3AHDA 3MXOA 4ZRDA 3GO4A 4GOXA 4R8SA 1IDOA 2GYVA 3G2HA 3M0EA 4HX9A 3UJ9A 3IAHA 4DV2B 4QRHA 1W93A 4EO4A 2IXFA 1DBQA 3FTQA 3TS1A 1CD5A 3LHDA 5I7EA 2J9XB 5L3QA 3EPKA 5G41A 3MIZA 3B1KA 5IF9A 3DFZA 1GGNA 2FN8A 3D6MA 3RRXA 4KCGA 4TQUS 2ZS8A 1ISPA 1U8AA 2DFTA 2H8KA 3ANYB 3KB6A 3QVXA 2BMEA 4GPIB 3UJDA 4O8ZA 5CA0B 3I01A 2C7PA 5AWFC 1BVYF 1IBSA 3S70A 1L5HB 4OJMX 4DDUA 3NKFA 3PLAE 4RF3A 3TD9A 3O1JC 5HW0A 4J0EA 1P75A 1L5SA 4RMGA 3SVTA 2I4LA 4FLEA 3AR3A 4EH1A 1GZ6A 1MR3F 4DTIA 1M67A 4J0DA 1MO4A 2ZUEA 3F0TA 2H0AA 2OZPA 2NUAB 1KHHA 4NK5A 3ECCA 3OZDA 5C7LO 4XVQA 1DHTA 2ZYUX 1XU7A 1BA2A 1QOQB 2Z2JA 5I7RA 3H2SA 3V33A 2C78A 5IP5A 4ZVKA 3DM5A 5DCWA 2C4VA 1OH5A 4B34A 3EJ6A 5AM3A 5CRIA 3W1WA 1M2EA 1N25A 4TXMA 2B78A 5B53A 2FZVA 2YCLA 2I87A 5JZMA 5EUQB 5JANA 5KNBD 3WAJA 1WEHA 1WOMA 2O54A 1FRFS 4J0FA 5F5LA 3BRSA 4QXMA 1TI7A 5CYGA 1PEYA 5FOWA 2XADA 1O6BA 1OZHA 1QO9A 3L7KA 1T5BA 3GQBA 4CG1A 1T9ZA 2ZIUB 5GY7A 2ZR8A 5JCOC 4XVHA 3SVZA 5LU8A 4E2FA 2JHPA 1WMSA 2DX7A 2N1MA 3C3BA 3IAM6 4QWMA 1YZUA 3WQHA 2A5JA 2A9JA 2WF7A 5BSRA 3V5NA 2OHIA 4BFLA 1H2RS 3UK6A 3OE1A 3M6XA 4RGQA 2BFBA 4P4LA 3K96A 1DC5A 2ECFA 5G0UA 4MYDA 4FN5A 3G2OA 2WHRA 3JQ7A 2IH2A 3A3NA 4URYR 3U4AA 4CHGA 3AYZB 2B1RA 4RM2A 4CLRB 5JO0A 2IHBA 1IQUA 4MVJG 1SZCA 4G1MB 5ALWA 3MA0A 2BEUA 2XF8A 4MYRA 4W9MC 3FCCA 4Q1BA 2Q2VA 3ERCA 4G4SO 1O5IA 2LBPA 2VSYA 1Z88A 3DFUA 3ORSA 4AXXA 3JRWA 1UXGA 3GRFA 2ORIA 4YK7A 2QAGA 4ZHQB 3FSRA 4IJMA 1GGFA 2QLFA 2C61A 3KT0A 3KJQA 4OL0A 5EWMB 4S12A 5H83A 1JWBB 2VRCA 3GRPA 4B6GA 3GBSA 4GLLA 4BBJA 3OEYA 1X1RA 5DULA 3FVTA 1CNFA 3B60A 3QI7A 3O4JA 4CQMA 1W6UA 4JP5A 3QVLA 4XPZA 4R0VA 2WHPA 1JTFA 4YAUA 3ZJYA 1YK1A 1L3BA 2O0HA 1MF7A 2XWQA 2XVAA 1U1FA 1K8ZB 2AFHA 3QNUA 4GMGA 4CG0A 2FUCA 4QC2A 3PNLA 4DT1B 5CAEA 2AXEA 1KAEA 3MRTA 5U1PA 1CUYA 1X1EA 2ZXFA 4DDVA 1FVHA 1UZLA 5HF5A 1KI2A 1J8FA 1XQVA 1ZPDA 3U7IA 2BMWA 3FNRA 1D9ZA 1SK8A 3PQDA 4M0UA 3VU9B 3CZQA 1IQRA 4DG8A 1G2IA 1LQTA 2BRUA 4TXNA 5EVJA 3ROGA 1NIPA 1DXYA 4ZU1X 3RSSA 2PQMA 2EJBA 2P5TB 2Z3WA 2DPHA 1K8YB 3AHCA 1MAWA 1QE0A 1VBFA 2HRDA 3I34X 4BNIA 5EA2A 3QVSA 2WOOA 4YH1A 2VJMA 2P9EA 3L4EA 4ODIA 4UNNA 2I29A 2W8ZA 3AVOA 3WL5A 4EAQA 2RHCA 5A62A 5L6MB 3FNQA 4A2PA 4Q12A 1RLTA 2OCLA 2P2SA 2PQ0A 2ST1A 1BEUB 3ZBPA 1GQYA 5JWRA 1TLFA 1RYEA 2O05A 4Q7QA 2W83A 1BQEA 1O9HA 4D9EA 3FWPA 1SQ5A 1ZQ1A 3GW8A 1WY5A 3PQ7A 2PV0A 1HTTA 2RH4A 3JYNA 3QHPA 4LRXA 1M66A 3DONA 3OT1A 4JDPA 4HZGA 4N3AA 5FPTA 1JEDA 2GPWA 2IUFA 1SBQA 1WS6A 2Z4SA 5JSZB 3FRIA 4BMYA 1K6IA 2W2QA 2PCLA 4IX1A 4DNFA 2OECA 4L08A 4RAQA 1NT2A 4CKCB 2VJCA 4U00A 4RJIA 3WO1A 3IUPA 2XQGA 3FTPA 1I2AA 1BWQA 3M82A 2NACA 1HDCA 3KTDA 3O4IA 4H0FA 1RC0A 4YJ2A 1FP1D 4OKIA 3PEYA 3ZKAA 1Y3FE 3MJDA 3EQ8A 4B46A 5DBIA 5E3HA 2F8SA 4MV5A 1ACJA 1QH1A 1Q17A 4AFNA 2DC1A 4I81A 1IN1A 1FPQA 5CDTA 2UXBB 3KJIA 4IJWA 4RPCA 2ISCA 1PFYA 2MSDB 2IEIA 1OPXA 5EZ5A 1QLHA 3CYFA 1KKMA 4KLAA 2I1WA 1P1RA 1RRCA 4RKQA 5LZ4A 2AFRA 3STTA 3E27A 4NICA 1T5HX 2YJNA 3AUAA 3RTDA 1E6EA 2A57A 2J7KA 2M98A 1RAGA 3C87A 4WD3A 3TBHA 4OO3A 1L1EA 4M7PA 4D9CA 5JH7F 1M6HA 1R9GA 3KKQA 2FUKA 2JJ1A 3G0OA 3MT9A 3THXB 3RIGA 1BGWA 3U7HB 4LGVA 2ATCA 3RUPA 2A1UA 1H6AA 5IHXA 2ZSFA 1Z2PX 1N8NA 3C16C 3PNQA 5B55A 1DDOA 4HSGA 2BH9A 1V5WA 1VCHA 4HFMA 4UUBA 3ZHSA 2ISQA 3O9ZA 2GYUA 3REQA 2FN9A 1J8QA 3A4TA 4XQCA 1L4LA 5JEDA 4KIGA 1A5SB 3ITDA 5L4LA 3LC1O 5HDBB 1YD7A 1OX6A 1UDRA 3OFSA 2PANA 2FPGB 4RV5A 1S1CA 3BAZA 1MN6A 4Q93A 3W5SA 1E5LA 2LRHA 4E4YA 3ICVA 3N53A 3WB9A 4POOA 2F9FA 2K87A 1NVBA 3NYRA 4JOQA 1D5CA 5CPFA 3BMOB 4IDAA 1DKRA 1SCUA 1ZITA 3C5EA 3N1UA 4HEA1 3I3OA 3PUIA 4Y98A 2WSBA 3ZCXA 4D9KA 3AXTA 1W2WB 3NIWA 1NVTA 1LNQA 5DM2A 4X1IB 5DBFA 3WLTA 1U0OC 3HB4X 5E6UB 1EUQA 3AUXA 3NZEA 2IOYA 1G8FA 3F49S 2FUNB 4PC6A 4PXAA 1NLUA 4Q1VA 5B3JA 3R9KA 3SBDA 4YT8A 4NZYA 3FPEA 1GCIA 2DT8A 4E21A 1VKHA 4X6YA 1XPJA 1JEQB 1WTAA 1Z16A 2FHPA 4LDZA 4YJ3B 4K9MA 1E3LA 1I6KA 2C9MA 3A05A 3NHPA 5LQMA 3KVYA 4G0XA 2AMYA 4RVUA 4MKIA 2WJIA 4LF5B 1AXRA 2FCRA 4M54A 3WR5A 5HKKA 3LXRA 3MUOA 2X4DA 4PLWA 1V6CA 3SF0A 2X0RA 3GP8A 1JXMA 3PDIB 2DJ5A 1LBHA 3ZHVA 1IU9A 4M38A 1DEKA 2WPNA 3F46A 4J1NA 5KO2A 1L4MA 1FVOA 1Q21A 1GCGA 5A6SA 4G63A 1GYRA 3RTEA 3VISA 1SZPA 4EJSB 3L0SA 1KIMA 3ETJA 4WKNA 2ZBFA 3Q6IA 2YN0A 1S8OA 1MJFA 4FNGA 4IUBS 3LJKA 2ZE8A 2C3UA 5EJ2A 3S1AA 3ZU5A 1BSVA 1FUUA 4HGRA 5JRDS 1KJ8A 1J0DA 2A9FA 2GD0A 4G0NA 3WK5A 3QJ5A 3LWZA 5JS6A 3ESCA 1H23A 2OP0A 4L8YA 4M98A 4YRPA 4JEMA 4UHJA 1P17A 3NFYA 1DMRA 3EBLA 1MV8A 2BZ0A 2GHIA 3IQDB 2FWBA 4WL0A 5EXEA 4D7AA 1ZA2A 5DDIP 2OGTA 3TRJA 3H86A 6PFKA 1N5LA 4OAPA 2I4IA 3K0SA 2YY5A 3O03A 1JLMA 3HACA 5BMVA 5HQ3A 1ESDA 2QRVA 3G79A 1UK6A 1TVEA 5LOVF 1Y5LA 5ECGC 2JJMA 1FP2A 3C24A 4GSLA 1L8AA 4UBLA 3ZLBA 5DH9A 3UT6A 3ZCSA 4DFDA 1UBOS 5IC6A 1KFKB 1QPBA 4WNAB 4C7KA 3EFOA 2Z2XA 3C5VA 5BSHA 4RANA 1CRWG 3WGLA 1WMDA 1T4CA 2GPTA 1G8HA 5G3ZA 3GLFE 1HTBA 2IBMA 2GBGA 3WE7A 2UUOA 1HDXA 5ICFA 4YRJA 3ZY5A 1NNEA 4TLEA 1E3SA 3HV2A 3R4VA 1ZLYA 2GX6A 4HATA 4DRXA 3LV8A 4BE4A 1OXXK 1UQUA 2RJNA 1SEPA 4ZU6X 4FB4A 1O5TA 1CY1A 2BM8A 2PZLA 3JQ8A 2X22A 5EPEA 1UOOA 5LYYA 3SIXA 4JVSB 3WLHA 4HNAA 2XCLA 2Z8YM 1K7SN 3QKRB 1V16A 3TPFA 3QKUA 1XAIA 3QWIA 4NZ9A 1EGVB 1JIKA 1V2HE 1VKRA 4LE2A 5DYGA 1QRTA 4MRAA 3H1TA 1UKBA 4Q15A 4UNPA 4JVLA 1N2CB 2VA8A 2P9YA 2YFYA 4K88A 3N9IA 4WGGA 4XOUA 4TRRA 4DLSA 4NBTA 4PNPA 1B3RA 4B8ZA 4C21A 3ORHA 1PGQA 2PPVA 2CDRA 5CDYA 1YZ3A 3G6WA 3S2IA 5C2JB 1FQJA 4DCSA 3VZSA 4HN9A 5HSGA 1R1DA 4KXMA 3WB0A 1A8QA 2FEAA 1HG1A 4PHHA 1Y3HA 3URMA 1CR4A 1HMPA 1Z6YA 1N3BA 1UBGA 2EFCB 2REXB 3FMPB 4HXGA 4PHGA 1PBNA 5DIZA 3T4PA 4TUYF 3QYAA 4XWYA 5CMLA 4EY8A 2YH2A 1E61A 2B5VA 4PAMA 3ESBA 2Y1XA 1QPGA 1ZRNA 4P2GA 1V37A 4QRIA 5AFSA 2A9OA 1K6MA 4ZI7B 1M0WA 1KH1A 4MAAA 2OFWA 4PZPA 4R54A 4G5GA 2BKVA 3ZLJA 2DBRA 2F62A 1Z2AA 4AZ3A 1CXZA 3FAZA 5KI6A 4CEHB 2DQSA 4D99A 2PSHA 1OKKA 4J6EA 2C83A 2ATVA 3NETA 3ZBUA 2OHJA 3X1KA 1E6UA 5LB4A 1R8JA 1IUPA 2CNLA 2WAAA 3MBKA 3MT8A 3UJPA 2AXQA 5HF8A 3OPYA 4WBNA 1FFGA 4I9UA 2QW8A 3DT8A 2BI4A 1ZWKA 3G13A 5EWLB 2FRDA 1M1YA 5HS6A 1XVTA 2A3RA 3FMFA 3LCVB 4MH0R 4OHMA 5AT1A 4D82A 4EUSA 2PZMA