2FEOA

Mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
221
structure length
221
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNMAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional consequences of single amino acid substitutions in the pyrimidine base binding pocket of Escherichia coli CMP kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,transferase
molecule keywords Cytidylate kinase
total genus 52
structure length 221
sequence length 221
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2feoA00
3EPKA 3RHFA 1QDEA 1SVLA 2BC9A 5FTMA 5HKKA 1KI2A 1XJ0A 3AF0A 4FXPA 1D2EA 1LVGA 2PT5A 5DNYB 4LZZA 1J70A 3NHBA 4B2PA 4BZQA 1E0JA 1T5IA 3C8UA 3PUZA 4I4LA 2GJ8A 3LXXA 1YR7A 4LX0A 5JEEA 3GLGB 2JASA 2QRNA 1F2TA 3EWSA 1NLYA 1UM8A 4K46A 3QUSA 3RSLA 4YMVA 4A1FA 5JSZB 2HJGA 3KDSE 1W7AA 1XZPA 3AVPA 2H17A 5DISB 3RS0A 2CVFA 1G64A 4B3DA 2F1IA 2MSDB 3DO6A 4CEHB 1M2OB 1WE2A 4TLDA 1JXOA 3NG1A 1P2VA 2JIZA 3PFIA 2BMJA 4UQOA 4JBYA 2GEVA 4M8NE 4BPBA 1JEEA 4S35A 4RD4A 5K8UA 5JRJA 1QHSA 2DR3A 1Z0FA 5AUOB 3WXMA 4LBZA 1CBUA 3A4MA 2QROA 4TL9A 4IRUB 4Q18A 3ZH9B 2OZEA 5LD2C 2OFWA 3M1IA 4HLCA 4B3CA 2GESA 2C98A 2IYXA 4U7DA 3CNOA 3GJ0A 3HWSA 5TXGA 3OEED 2MSEB 4ZDKA 1XWIA 4A9AA 1IXSB 1OXSC 3MSXA 1XPUA 1GL9B 2GXQA 2J1LA 1XEXA 1IN4A 3SFZA 1ZIPA 3ICEA 1OE0A 2G6BA 2WAYA 1Z2CA 4OHZA 2H92A 3REGA 4RKFA 1G6HA 4A82A 1W1WA 3NC1C 3X1DA 3SC3A 1C4OA 1F2TB 1UF9A 3OIWA 4AWXA 3DKPA 2JLYA 3NH9A 1ZUHA 3Q5DA 4GRAA 1Q0UA 4LJ8A 1ZCBA 5CM8B 2IS2A 1QVRA 3C16C 1Y63A 4A0RA 1N0WA 5JHGB 2RGXA 2G88A 3FWYA 3GFPA 4IXNA 1OFHA 3AKDA 3W6OA 4LJ4A 1KY3A 4DLZA 2WSSD 4DLWA 5CYPA 1OIWA 1E98A 2BEKA 5KO2A 5EP2A 3EPJA 5BW8A 5LB2A 1IQPA 1E0KA 4HATA 2ERXA 1TQ2A 1IXRC 5KPDA 2DHRA 2DPXA 3NEYA 1JNYA 3C5CA 1E1QD 1FP7A 1T9HA 3OEHD 2J0QA 4OK5A 4Q21A 1L7VC 2QY9A 3T1QA 2MMCA 2ZROA 3QY0A 3IPXA 3KQHA 3RWOA 2Y8EA 2JIZD 4F91B 1NKSA 4DB2A 2IYTA 4W9MC 1XFAA 4WOPA 2GRJA 2WAXA 2CCJA 2B8WA 3Q72A 5L3RA 4G3XA 1G21E 3VFDA 4GZMA 3THXA 4ABYA 1KI4A 2OAP1 5D3MB 3LWNA 1OFTA 4LHYA 1EX6A 2P6RA 3NBFA 1DTSA 5EXSA 1A5TA 3E70C 4B44A 1R0ZA 1Y3AA 4BLSA 1VKJA 4FMDF 4JL8A 2VF7A 5EUMA 3FMOB 1VIYA 2YOHA 3GP8A 1W2HA 4Q1BA 3SYKA 2V1UA 1GRRA 4O2LA 4QBHA 1N0VC 1YZKA 2VO1A 1QG4A 1DAHA 2WJGA 4YMTA 2ZRLA 4Q66C 1G17A 2NZ8A 3TAUA 1Z06A 1CF4A 1W49A 4NCJA 1GDDA 1Z3IX 1XTIA 4B3GA 2IWRA 1CJMA 1DAIA 2ZUBA 3BH0A 1OYWA 2QM8A 3HR8A 3WNBA 2O8EA 1OHHD 4AD8A 5B2ZA 4NONA 1ZU4A 2QI9C 1WRBA 3I1FA 1W4RA 1CTQA 4QM6A 1WMSA 2GCPA 2SHKA 1N6IA 2C03A 2GF0A 2ZE7A 2CEAA 3KJHA 4X8OA 4YDSA 1KI6A 1XD2A 3GFOA 5JJLA 4Q4AA 2FFBA 2B21A 3IO3A 1VECA 2NPIA 3SU8A 1WB9A 3NVAA 1E79A 3CRMA 4AKEA 2BDTA 3A1VA 1CR2A 3CZPA 2CCKA 1FUKA 2HF8A 4R98A 2XXAA 2F55A 1GSIA 3FE2A 2WIAA 2Z0MA 3P27A 2C04A 3MFYA 4TLEA 1ZUNB 4LJ9A 3EZ6A 2FJUA 4DIDA 1OXTA 3MCAA 4LOAA 2PCLA 4EIWA 2OCPA 1QBKC 1XX6A 3TVTA 1MO4A 3R9XA 5JS8A 2QP3A 1ZM7A 2Z4SA 2P0EA 4QBFA 4RFVA 3GJ4A 1XPOA 4D25A 1MABA 2C96A 5DGXA 3DMDA 4NYIR 2CLCX 3GLHB 5CLLA 5AUNB 2ODEA 2ZS9A 2A5JA 3A4NA 2BM1A 4C0QC 5J5CA 1Q1EA 2R9VA 2J7PD 3H4MA 3BIFA 1F6BA 3QF4A 3AGQA 3QBTA 5FTNA 4URZR 3CPHA 3H1TA 1TADA 1RE0A 2MMGA 2WTUA 3IBGA 3H84A 4HDQB 3KUDA 3GLIB 2PZFA 2X8AA 3QOFA 1LB1B 1PLJA 1W47A 1XXHE 2B6HA 2YHSA 5HE9A 1E2EA 4RZ3A 5L3VA 5TVKA 1P73A 5CDFE 1R0XA 2KE5A 1GOTA 3KJEA 1V43A 3P32A 3TSZA 3DHWC 2WWYA 4PC6A 1DAEA 2Q9BA 1U0JA 2VTKA 3SZRA 1HT2E 4B43A 1II8A 2JEOA 3ZVNA 1U8AA 1OV4A 1E2KA 3A58B 3SDZA 4YC7A 3FB4A 2WJIA 4G1UC 2C5LA 3EPLA 2RHMA 1K5GA 4B75A 4C7OA 1AZSC 4QHYA 2QT1A 2XZOA 2A3RA 4GPTA 1SXJC 4ACAA 3B82A 1KAOA 2WOOA 5FBQB 5JHHB 3MRSA 1HA3A 3RDPA 3K0FB 2AXNA 3IHWA 2IYUA 2ODWA 2OE2A 1SXJE 4JLOA 1MABB 4M1KA 5SZHB 3K0SA 1HH4A 1G7RA 3TUZC 5JJKA 1KSHA 4UXJA 5HZHA 1NVUQ 3LAWA 1LS1A 1OPXA 4B2LA 2I1QA 4HZUA 1W0KA 4FMCB 2V6IA 4O25A 4BFTA 1G3IA 1A82A 1S3GA 4LHZA 3CBQA 1SVIA 1M7GA 1RKBA 1TEVA 2Z5FA 2HXSA 1J2JA 4C4PA 4JVSB 5E7MA 2LWIA 1SXJD 2DFLA 4M22A 3U7HB 3DEFA 1TQDA 1P3JA 1R4AA 2EQBA 2NO6A 2F43A 3RABA 5IK2D 1BOFA 3AF1A 4HYYA 1WCV1 1US8A 4RFSB 2O8DA 3LQQA 2WOJA 3JZAA 5FPTA 2LCFA 1JR3A 2AFIE 2ZU0C 4TYPA 3TE6A 2DY1A 4JYBA 2A2ZA 4B6FA 5KHOC 4QFMA 3UWOA 1GL7A 3PVSA 2ZE8A 1N6RA 4MRVA 4XD7A 3FMFA 4KYIB 4TLAA 4I1OA 3FMIA 3BB4A 4IDQA 1UBFA 2JCSA 1G8YA 2ZR0A 3K0FA 4LBYA 3GJ3A 3GJ6A 4PC7A 2BCGY 1DG1G 3TH5A 1E0SA 1CS4C 1B0UA 1NNEA 4LYAA 1MO5A 3CUEF 4NCNA 3K0CC 4RZUA 1PVOA 2V3CC 3ZS8A 1IN5A 1E1RA 1EFRD 1G8GA 3CR8A 4M1WA 4KV9A 4RD3A 5EXTA 4ZCLA 1LTQA 4PR0A 1ZMXA 3SR0A 4RD1A 5EZ5A 3RRZA 1E2HA 3I4LA 3U44A 2FPMA 5FBLB 1UBCA 1Z6YA 1Z29A 2JJ1D 2O8CB 4M53A 2A78A 4EPRA 1DEKA 2J9RA 2ERYA 5JWOA 3CRRA 2AD5A 2ATXA 3VR3A 2GJAA 4LPKA 3SQXA 2QPAA 2AXPA 2CHGA 1KKMA 5FUWA 5BN3A 2WJJA 3C15C 2XSZD 3MUFA 4TQUS 1WBDA 2W6IA 2YVUA 2ZANA 4ZI3A 1JAHA 1RRFA 1KZGB 1JALA 4OQLA 3L0OA 3BOSA 4Q02A 4TL6A 4OQMA 5TV2A 1Z0JA 1N6KA 4WIAA 2ZJOA 2RGDA 4TQAA 4JZKA 5KSOA 1LW7A 3L8YA 1NIPA 2GA8A 4N3NA 4A6XA 2RGCA 3IPYA 2TMKA 3AV0B 4IDNA 2QAGB 5EE5B 5AJXA 3AUYA 2GK7A 1AS0A 3THWA 1BO6A 3BS4A 3MJRA 4U00A 1OSNA 3UG6A 1NMXA 3QJYA 5K8LA 4CEHA 3W5JA 4BQSA 2ZS8A 4HAXA 4N0EA 3WBJA 1D2MA 3C4JA 1M7BA 2J5XA 3KQNA 1AIPA 2QMUA 2ZU6A 4CEIB 4LYFA 4ASUA 1FX0B 4P4SB 3RS5A 2WMOB 4EJSA 1KAGA 2O8CA 3ZZTA 3PJRA 2CL0X 4PXAA 2HYIC 4C0SA 2VEDA 3X1XA 4TYWA 1CJUC 2F1HA 4IHQA 3GD7A 3TK1A 4FWTA 4QJ5A 4UNSA 2D62A 4M9SA 4KFSA 1NN1A 2WWIA 3UK6A 1BKDR 5HKKD 2P67A 1NJGA 2PL3A 2WWXA 1R5OA 2R62A 1W4CA 4W7SA 1H8HD 3I5YA 3AVVA 4N0DA 2D4HA 5C4GB 2FPKA 4PAMA 1UKZA 1G8HA 4DCUA 3TSOA 3RNLA 2XOKD 4NHOA 5J4VA 2IS1A 5FOTA 5H8WA 3CF2A 2NPFA 2V54A 4MRPA 1Q1ZA 1KI8A 1QHYA 2AR7A 2AK2A 2HLDA 3IHLA 2WIBA 3W8RA 1I4TD 2PEYA 5FFMA 2ZJ8A 3B1VA 1GG2A 3EARA 4HI0E 2BM0A 3HYRA 4NYMQ 3D31A 3TUJC 1TU4A 4XVRA 2C77A 2BBSA 4LRWA 4PHFA 5CITA 2QTVB 2JJ1A 1ZAKA 2R44A 2UZIR 2Q3FA 4M9XA 1SVSA 3T06B 3BFKA 2BKUA 2CE2X 5H68A 5D3QA 3QQ5A 4EPTA 1GZSA 2AFHE 2QUZA 1X86B 2BBTA 1AGPA 4C3ZA 5L3SB 3FHCB 3L0SA 1CKEA 2EFDB 3OEEA 4B3XA 3O8BA 4LV5B 4LY6A 3KX2A 4Z8XA 1P4SA 5DI9A 2GBLC 1UKVY 3GLGE 3QF7A 4QKQA 1YR8A 5HE8A 1XP8A 2CE7A 5FL7A 3W3ZB 1NF3A 3U61B 2KJQA 2J87A 2ORWA 4A8JA 3NWJA 2FZ4A 3B60A 1ESNA 4A2WA 1HE1C 1KO7A 1N5JA 2ZPTX 3V4FA 2ZVPX 4PHHA 2FMXA 3PITA 5IDVA 1AZTA 2RKOA 3VKWA 4M1TA 3QKUA 2GF9A 4V0LA 3L0PA 1G8FA 5JWHA 5L8VA 3RRMA 2XTZA 4Q01A 4AIIA 1F5NA 2FG5A 3LBHA 3KQUA 4OQXA 3WNDA 3K0AB 5DHAA 3LFUA 2QGZA 1ZU5A 4FN5A 3DDCA 4AG6A 1KO4A 3B6EA 2ZETA 2WWHA 3AF3A 2WPDD 1IY1A 4EFNA 2NGRA 3H86A 3CKLA 1YQTA 5EE1A 3UMFA 1XEWX 4G5RA 3R9IA 1KDOA 2Z6VA 2IHBA 1MO3A 4PQFA 2OXCA 1RVDA 1RW4A 2QM7A 3BFXA 4TZ6A 4D4LA 4MYCA 4OQNA 3SEAA 4IDHA 3FGNA 2ZM5A 3RAPR 4A92A 3HR7A 121PA 2O8EB 3K0EA 3AKYA 2IYWA 1XTQA 3MMPA 4PC2A 2GXAA 4IFBA 4MUAA 1KTVA 1C1YA 1KDTA 2ZJ2A 1E32A 5TB5A 5GADl 1R0YA 2ZI5A 3T5DA 3TUIC 2JATA 5TMPA 3KUCA 1Q22A 4XTRA 4A0GA 3OIVA 1XD2B 2YJTD 2OESA 5FTJA 3BXZA 3QENA 4GSYA 5DH9A 4OJQA 2BV3A 1DARA 3AGPA 4R2HA 1JPJA 5DN6A 4DCNA 2FGKA 3TLXA 3RS7A 2GWHA 3BFVA 3CRVA 4JBXA 4B34A 2ASEA 3AF4A 4FI3C 4Q9JA 3VHXA 1DO2A 5EE0A 3LLUA 3DM5A 1IY0A 3QSYA 4HDCA 1CIPA 5JI2E 2ZJAA 3FFAA 2PLRA 1VPLA 3LH5A 3UIEA 2ZREA 3NBXX 1QHHB 2VP9A 1VHLA 2YNMA 3KXLA 1N3BA 2Z43A 3DL0A 1LV7A 2CCGA 2GKSA 2HLDD 3KB2A 1ZNYA 3Q3JB 5K8TA 5GJWC 1X8LA 2FSFA 1TQ4A 1M6NA 2EFHB 2ZI9A 3TKLA 5J4LA 2PT7A 2W0SA 3B7GA 4FW9A 4DT1A 4JLDA 5ANRB 4B76A 5M04A 1ELOA 1KYIA 1AKYA 2DFKB 4Q4LA 4YQFA 1CRPA 4AKIA 5E3HA 2GDJA 3VU9A 1BYIA 4OYHA 4AURA 2Q6TA 3O8RA 3GLIA 1R8SA 2ZRDA 4OBEA 2F6RA 1KI7A 4QNRA 4A8JC 4JJKA 2QP4A 3BH6A 2RGNC 3NDPA 5SZJA 5F2EA 1A2BA 1E9BA 1YZUA 2IEYA 2W6JA 3DZDA 3MWLA 4NH0A 4IKEA 4US2R 1MRSA 1P9RA 2IXFA 5C2JB 3BD9A 1EFCA 1XMIA 1OT3A 5HR5A 2CJWB 4WVFA 1ZC3A 3PUWA 4C0AC 3GJ8A 3Q85A 3QBVA 3GMTA 1G8PA 4LBWA 4BFWA 3SJAA 4ZIRB 2F9MA 1KJWA 3WBKA 4JSTA 4EQ6B 3EA5A 4MGZR 4JSYA 3THYA 3A1TA 2CK3A 3THOA 3L2OB 1Z2AA 1G3RA 1VCMA 4TL7A 2CNWD 1WA5A 3DPUA 3IEUA 3NBZC 2VA8A 5GJVC 1XD9A 2ATVA 4JVNA 4DSOA 5J4YA 4QM7A 1E9RA 3TSWA 1FFHA 2ZSFA 3HDTA 5CK5A 4ZI2A 3EX7C 1FMLA 1VHTA 1GIAA 4EDHA 4MKHA 4ZCIA 1DG3A 4WA7A 4QNMA 2YWGA 3T1VA 4PPQA 3QIAA 5G41A 2VRWA 1W5SA 3OIUA 4XTCS 3Q7PA 3SJCA 4BEBA 4DDVA 2C95A 4ZKDA 4KJZA 4HLQB 3RC8A 5B57C 2H7VA 2R2AA 4Y0VA 5FUYA 3PENA 4OHYA 1DOAA 3EWAA 2GVDC 2XNSA 3WHLA 1JI0A 4L5BA 4C2UA 4RCYA 2EU8A 4HAYA 3PR1A 3FYHA 5AJZA 1FL9A 2FEMA 8OHMA 2H18A 4FINA 1P9NA 1R10A 4Q19A 1ZJ6A 5DYIA 2CL7X 4D81A 3I61A 2ZSAA 3UATA 2R6GA 4YMWA 3CLVA 5H70A 3ADDA 1XEXB 4DLXA 4L9WA 2ZAMA 2XNDA 4GFDA 2ZYTX 2FSIA 4HB4A 4IOMA 4Q9KA 3ZIAD 421PA 4WZ6A 2QMHA 3H0KA 3ICQB 2V9PA 3VKHA 5AR1A 4BLTA 1T3HA 1FZQA 1FOEB 4PQYA 1K5DA 4F4JA 2QTFA 1IHUA 4C0LA 4Y0AA 5DIFA 4BUJA 2ZUCA 4NYMR 2WMNB 4QC2A 4GBMA 2QPTA 1T6NA 4PX9A 3FKSA 1LY1A 4B6EA 2ZRIA 3BB3A 5F3WB 4P0TA 4HAZA 2FDCA 3TR0A 2F7SA 2QL6A 3AVXA 4ZDWA 5JBQA 5EJEA 1OW3B 2FOLA 2FFHA 5FH9A 3LLMA 4FCTA 1YE8A 2RHDA 1E2MA 1Q3HA 1CJVC 2ZRJA 1R5BA 3F0TA 2ZYWX 3RS2A 1ZD9A 1KJYA 3QXXA 3SN6A 1IONA 1NP6A 4HUQA 1BMFA 2XZLA 2WV9A 1NLZA 1DAKA 2O5VA 1XEWY 2V7QD 2GZDA 1Q3TA 3GJ7A 4GMDA 4GP7A 1PUJA 1CXZA 3AVQA 5DN6D 3T1OA 3THWB 4FD2A 2H5EA 3NKVA 1E4VA 4GOKA 4PQRA 2JDID 4TMVA 4URYR 2VIIA 5KDOA 1AN0A 1GILA 2W2VA 1S1CA 2IK8A 3FKQA 2JLUA 4M4SA 2XB2A 1Z5ZA 4BRWA 1NY5A 5D3MA 5FPSA 1E9EA 1U2RA 3EC1A 4EJSB 4PC1A 4OL0A 2VP5A 2ZSDA 3MGCA 2R65A 3TRFA 1XD8A 3V9PA 3MLEA 5JECA 1P5ZB 1XXHB 4BLQA 4OQFA 2W0MA 5FR2A 4DLVA 4EKDA 3SBDA 2HCJB 4EFLA 3PV0A 4PO1A 4B2IA 3WRXC 3QXCA 4QBGB 4C9BA 2FV8A 1XB2A 4PSKA 3W90A 4NYIQ 3W8NA 4XOIA 1IXZA 2C8VA 4TWZA 1E2IA 3AVTA 2OBLA 3GEEA 4C0KA 3B85A 4QJ4A 4TTQA 1S4QA 4EFMA 1SGWA 1OKKD 3QI2A 4HUQB 5CDFA 3FHOA 4MDEA 2XITA 3EXAA 4Q7KA 4Q4HA 2VPPA 3PEWA 4XWAA 3RWMB 1DPFA 4DCSA 1W36D 4IDPA 3JVVA 4M1YA 5G3ZA 3ADKA 1KNQA 2YWEA 3CX8A 4HAWA 1TF7A 2VH5R 1FTNA 3Q8XB 3QE0A 2DFTA 4UXHA 4DCVA 4Q7LA 1F2UB 3CZQA 2KI5A 1E9AA 2JDIA 4UNPA 4AC9A 5FOXA 1XCPA 5FI0B 3GJ5A 4CRWB 5FPHA 3LY5A 4TLCA 1TX4B 4GMXA 2GHIA 3CO5A 2ONJA 3KFVA 4QGAA 2UZ3A 2ZRHA 2OLKA 3M0EA 3SFVA 3WMGA 1KMQA 2YWFA 2PJRA 2O0KA 4I99A 3KTAA 4G5SA 4O3MA 4M21A 4X8HA 3QNUA 5F9HA 3WYGA 3CNNA 3W9YA 1W4BA 3EW9A 2XTMA 2ECKA 2B8TA 3DZ8A 1IJEA 2ZJBA 2ZJ5A 1L2TA 4A4DA 2JLVA 4MITA 5BYJA 3IIMA 4MRSA 3IIJA 4KCGA 2Q3MA 2LKCA 4GOXA 1KGDA 4LGMA 3DOFA 3B78A 4M1MA 1RC8A 2W58A 3QF4B 2DWOA 4JLKA 3E1SA 4Q4JA 4URVR 1N6OA 4QXAA 2DWQA 3K0AA 5AK0A 2G1KA 4B74A 3QKRB 3TR5A 4D82A 1PJRA 2YOGA 2FA9A 1F48A 2V6JA 3TAHA 1KHTA 5CB8A 3BERA 3OAAD 2ZSEA 4A36A 3T61A 2GXSA 4KLNA 1G4UR 5E4FA 4W5HA 1OF1A 4A6PA 2D7DA 4D4MA 4RD0A 1OB5A 1II9A 3WNCA 5JMTA 2RGEA 3BB1A 2PJZA 4KAXA 2FSHA 3WP1B 2KWIA 4IVRA 3VX3A 4KU4A 4C7OB 3KTAB 4YXWD 4V0ME 3CIOA 2QMEA 4II7A 2GETA 1GM5A 3TQCA 5BN4A 1VMAA 3F3YA 1OYYA 3EC2A 2O8FB 1VCNA 4NE2A 3W6PA 2PMKA 1RRPA 4QJ3A 2ZR9A 2YZ2A 1E1QA 2AWNA 1SKYB 3AVOA 4AI6A 1ZM4A 5G3YA 4Q48A 1H8HA 3KQKA 3DMNA 1FNNA 3CNLA 3GEHA 4MRRA 1WP9A 3OESA 5FOVA 1N0UA 4OHWA 2O8BB 2QT0A 3AB3A 3QKRA 4BFYA 1YZGA 5TDHA 5KDLA 1TU3A 2J45A 5EXXA 1IM2A 5AWFC 2YINC 2ZIAA 2QAGC 3NHAA 4RJLA 3BH7A 3ZD7A 1MO6A 3LVQE 1AK2A 1X1SA 4CDGA 4DSUA 4H1VA 1G7SA 4NYJR 3N2IA 1LF0A 3SHWA 2V8OA 1XRJA 4ZKEA 3FFBA 1GNQA 3KFXA 4UXIA 1BYUA 2DFNA 1T5LA 3A4LA 1J8YF 2VSFA 3HU1A 4DEXA 3M6AA 3TBKA 1ZM2A 4QGHA 3VNUA 3T15A 4FMDB 3OZXA 3PUYA 3I5XA 1VCIA 1M7HA 4US0R 3EZ7A 1Z83A 2AHOA 2FPLA 4JLJA 1GITA 4GT1A 3ZVLA 4A2PA 5AJYA 2RGGA 4KBFA 1D2NA 4C2TA 4KO8A 5EP3A 4DBLC 2HV8A 2WZQA 3C41J 2F9LA 1YVDA 4DSTA 2QP9X 5EE9A 4CYMA 1U8ZA 4KFTA 2R6FA 4JT2A 4XVQA 4I1VA 1E2LA 2WJVA 2QBYB 2J3EA 721PA 1WF3A 2BKEA 1E9SA 2A5FA 4TMXA 1TQ6A 4PC3A 2IA5A 5AUPB 4IJMA 5JS7A 4EQ6A 1M34E 2GAAA 2I4IA 4TMZA 4Z51A 2BIFA 1W36C 5BYKA 2F1RA 1OIVA 4B47A 5UKDA 1NY6A 3WMFA 1KO1A 2IL1A 3RS4A 2IS4A 1MOZA 1D8TA 2P6UA 2WBLC 5EQTA 5F9FA 5CJPA 1VIAA 3K09C 4L15A 1FP6A 2IYRA 1COWA 1HUQA 1W0JD 2YYZA 1NBMD 1UAAA 5CK4A 2PLFA 5LDDC 4ESHA 4B48A 5KUTA 1ETUA 3C14C 1HEIA 1FMJA 1W2GA 1ZINA 5K8IA 1ZNXA 2JGNA 4BRUA 4Q00A 3D7MA 2ZXUA 1R6BX 4EAQA 1E94E 3IGFA 2VL7A 3KKMA 2XAUA 3LO5A 4UNRA 2FH5B 4Q47A 2X2EA 2ZI7A 1YZNA 3B1XA 4GI7A 3Q9LA 4TTRA 1NI3A 1QG2A 1Q20A 2OG2A 3TNFA 2EWWA 2PZGA 3B9QA 5BN5A 2CNWA 3PQCA 1GL6A 1WXQA 1X8JA 2REOA 4MYTA 1W4AA 2KBFA 2Z83A 1GNPA 3AF2A 3DOEA 1FX0A 3A1UA 1N25A 1ZYUA 4WW0A 2ZITA 2ZRAA 2EVWX 3PG5A 3T1TA 2QBYA 1ANKA 4D0GA 4LV6A 4IW3B 5FOSA 1COWD 2IYQA 4IDOA 4CEJB 1OXUA 1W5TA 3VR4A 5G53C 5FPKA 2P5SA 3U7EB 1DBSA 1I2MA 1XDBA 2QE7A 3I62A 1UADA 1G7CA 2BJWA 1QF9A 1E96A 1M8PA 4V03A 1M1YE 4ZDIA 3PEUA 1Z07A 2XEXA 5ELXA 3CX7A 1B23P 4KFUA 5DYGA 4MYUA 4RD2A 2JA1A 3VTKA 1PV4A 4BZPA 4JJZA 2QSZA 1G3QA 4JS0A 4D0LB 1J8MF 1DAFA 1SXJA 3R20A 2VBCA 3THXB 2BBWA 1KY2A 2BJVA 1MKYA 5JSZA 2BHRA 2VP0A 4HSEA 4WZAE 1XJQA 3I8XA 4P3YA 1YJ5A 4Q1AA 3MWKA 2IW3A 2OAQ1 2GBLA 4ILEA 1SVMA 3R7WA 4IFEA 1GUAA 4LJAA 2V7QA 2QMOA 1GWNA 2F1JA 5KNDA 4HB2A 3T5GA 1N6HA 3B1YA 2PX0A 2QA5A 1V5WA 4IOKA 1U99A 1SVWA 2J46A 3RS3A 3BGWA 1Z0IA 1T4GA 4URUR 5C18A 3D3QA 4DSNA 1KI1A 1SQ5A 4OI0A 1H8EA 4FCWA 4UJ5A 2CK3D 4JYCA 3U2QA 1VG0B 2OHFA 1G3UA 4O2RA 1GVNB 2WWFA 4OI4A 4DDWA 5JCPA 3AVUA 3K09A 5G40A 1XBTA 4DJTA 3NXSA 3NTUA 4ZDJA 4OHXA 3AVYA 4PSVA 3BORA 3R8FA 4E03A 1CRQA 4QRHA 4XJXA 3ETLA 3LQRA 3BBPA 2AX4A 4OKSA 1N5LA 4X8LA 1WBBA 2ZRFA 1AM4D 1EK0A 1G9XA 2L0XA 4LJYA 2QQ0A 4NCIA 4R9UC 3K70D 1GNRA 3PEVA 1HY3A 1ZIOA 1NBMA 1U98A 2ANCA 4B33A 1W0JA 4MUBA 221PA 1XXHA 2OM2A 4LDJA 3UKDA 5KSYA 4HZIA 5HCIA 2VHJA 4Q9LA 3R7WB 1P75A 3EASA 4YONB 1P9WA 4BE7B 2C99A 4PHTA 3ZLJA 4NBSA 3X1YA 4IVQA 4Q03A 2GJ9A 4RKEA 2WWWA 4KSCA 3GLHA 4V02A 1O87A 2V4ZA 4DIEA 1UEJA 4OK6A 4QL3A 4PHGA 2CL6X 4DLYA 4L16A 1R0WA 1DAGA 4JL6A 2W6JD 2AN9A 5KYKA 1SKQA 3N70A 4PTLA 2J59A 5EP4A 4C0BA 1ZUIA 2QPOA 4ON9A 4Q4HB 1JR6A 4TT3D 1UBEA 3N2EA 4LWZA 3AUXA 2JLRA 5J4KA 1NLFA 1T8UA 2KSQA 3EZ9A 3MD0A 3W3AA 1OXVA 4H9GA 5FBRB 1G5PA 5LB4A 3QG1A 2IS6A 1F2UA 2G1JA 1RJ9B 1SHZA 1RYHA 1CR0A 3B1WA 1D9ZA 1II8B 2E87A 3OEHA 3QXJA 4MA4A 4D4JA 5FTLA 4AKGA 4JLNA 4OK3A 4UNQA 1Q12A 1S0UA 2EYQA 3LBNA 3WRYC 2DWPA 2GCOA 4FIDA 4IEEA 4RD6A 2J0VA 3LXRA 3QKSB 4RY2A 3V00A 1R8QA 1TPZA 3ND8A 5J47A 3RANA 2FX3A 1EESA 1GKYA 2VSOA 2W6ID 5EP1A 3ZYCA 1CJTC 1DE0A 4CZ2A 4EPXA 4OHVA 3I32A 3C7KA 3U5ZB 1E79D 2QTHA 3ONWA 4LHXA 4BEJA 2NIPA 3ZS9A 1UKEA 1KKLA 1U0LA 1VYTA 4QG7A 2F3TA 1ODFA 4F4CA 4P33A 1NBME 2IWHA 2IBMA 4DLRA 5JFGA 4NCKA 1YKSA 3ECCA 3TW8B 1VTKA 4LJ7A 2A5YB 1WQ1R 4ESVA 4BWYA 2XJ9A 4FMBB 3AEZA 4R71A 4E07A 1GTVA 2ANBA 3KL4A 5A4JA 2XOKA 4UJ3A 4MKGA 3SJZA 1QHXA 2GNOA 5AUQA 1NIJA 3MAAC 2VHCA 3RLFA 3AVWA 2OBNA 3R9WA 1FPMA 3BE4A 4BECA 3QXHA 2HT1A 2ZTSA 5SZKB 4TN1A 1J99A 2Q9AA 3IKJA 1US8B 2P6NA 1CR4A 4RFSA 2O8DB 5DO9A 5EZ6B 2RH5A 2NG1A 4F7WA 3QXSA 2CJWA 4B35A 1UPTA 2FN4A 1ZW6A 4W5WA 2NO9A 5HCNA 3A36A 1XEFA 3NC0C 4M2LA 4IVPA 3CX6A 5C46F 4IOLA 2OV2A 2Q21A 3EZFA 3AQ4A 1SHKA 2ZRGA 4XH9B 5JRZA 3KQLA 2IXEA 5GJBA 3KXKA 3HYTA 3K9LA 1S9DA 5DSZA 4A0FA 4IOJA 3B1ZA 4B32A 1S1MA 1PUIA 1ZC4A 2XX3A 1NL3A 1D5CA 2OSBA 4A0HA 2ODNA 2XJ4A 1T3LA 2G0TA 2VHTA 4WZBE 1CR1A 3NIBA 1A1VA 2DBYA 2I3BA 4E09A 4IXMA 4BLPA 3U44B 4MDFA 2CHVA 3P4YA 4Q9IA 3CR7A 2O8BA 4WAUA 2D74A 2GAOA 2HXYA 1CLUA 1G291 3BC1A 2LKDA 3MWJA 5L3QB 2IYVA 2C9CA 1T0JB 3LW8A 4DC9A 2JJ2A 3GLFE 5FOUA 5IT5A 3BJIC 2REBA 4DCTA 3F5FA 3A8TA 1TEXA 4XVUA 3LVRE 3LW7A 2XB4A 3ADBA 3GCGA 5CIWA 2N1BA 4JT4A 2OCYC 4LPSA 3TMKA 5B30A 3BAFA 4GDFA 3L0IB 3TQFA 2H8KA 4LYHA 3TVDA 3UMSA 1XMSA 4HAUA 4BLRA 4JLPA 1NJFA 4LJ6A 4NDZA 4ERNA 3U3JA 3DKVA 4LBVA 4PFSA 1EXMA 2KBEA 4M1OA 3KKNA 2GILA 5HTKA 4D0NA 2C9OA 4A2QA 1EWQA 2NO1A 2AWOA 2VHQA 1CU1A 3FKSD 3BWDD 4B3BA 4MKFA 2IF0A 4MGYR 3NDBB 1Z6XA 1DO0A 2RCNA 4DLUA 4LC1A 2ZRBA 5DLQC 5FBWB 2FF7A 1C9KA 1Z0KA 1HTWA 1AKEA 4NP6A 4TSFD 4P4SA 1WDTA 4WBSA 1ZBDA 2J0UB 5GJCA 1ESMA 1GP2A 2IXGA 2HYDA 4JLBA 4LI0A 4BASA 4PPGA 1E99A 4ZO4A 2BOVA 2G77B 2C2HA 2YC4C 2FU5C 4NPHA 2F43B 1G20E 1TMKA 5FL3A 3CRQA 4CW7A 2NMVA 4ASUD 1AQUA 3FTQA 1RFLA 1Z6GA 3B9PA 4JVLA 2QE7D 2FE4A 2R8RA 2F3RA 4QHTA 4D2IA 1G18A 1XMJA 2QG6A 2XNDD 2XSZA 3ZIAA 3VR1A 4QOSA 4HUTA 4QHSA 3GLGA 3G5UA 1EGAA 2RB4A 4IEIA 4PO9A 4OI2A 2YKGA 2IUUA 4CT5A 1MR3F 2ZE5A 1R5NA 3AP2A 5CM9C 3HPQA 2GVZC 2OO7A 5TARA 1ZVQA 2C9YA 5FUXA 3VR2A 2EFCB 4NCHA 1N6NA 3NBYC 1RRGA 4I81A 4JLAA 2CDNA 1TUIA 2GXUA 1E2FA 1QZXA 4F92B 3K70B 3SQWA 4NU0A 2GTPA 2FWRA 4G0NA 1KK0A 4TTPA 5F98A 4HLUA 4NMMA 3X2SA 1P2UA 2C78A 2BVNA 4I1UA 4F4IA 4P31A 5L3SA 1JR3E 4N1AA 2J0UA 3OFNA 3B13B 4QBIA 1MH1A 4RCZA 4E22A 4JVMA 4LJ5A 2EFGA 1NN0A 1ZRHA 3RC3A 3CWQA 2RGAA 1XTJA 1YZQA 1O3YA 1ZM3A 1KIMA 4Z1MD 1XNJA 2WM9B 4M9QA 2W2TA 2AD1A 2V55B 2AKAB 4B71A 5KNCA 4OI1A 2BWJA 1EWRA 2EW1A 2W83A 2ONKA 1F60A 4Z8YA 4E5UA 2B7CA 4BFUA 3QEOA 1OH5A 3GQBA 2EWVA 3U3KA 5JWRA 1CP2A 2GK6A 1E2PA 2VHUA 1SXJB 1VG9B 1XMVA 1YR6A 3U4QA 3CH5A 4Z54A 2R6AA 3K0CA 1E9CA 1KK3A 2OFXA 1U0HC 2WVJA 2QZ4A 4Q1EA 4Q1CA 2ZAOA 4C30A 1EFHA 2ZYVX 4HB3A 1DELA 2I1VB 3WHKA 4Q9HA 3R8CA 3K1JA 4US1R 2FFQA 3GPLA 1SKYE 2ZRKA 3D6TB 2QAJA 2WJHA 1KK1A 3JVUA 2QN6A 3REFA 2ZJZA 4GP6A 1CJKC 3UANA 1QHGA 1L4YA 1P7CA 1G5RA 4V0NA 1Z8FA 5B58C 1E0AA 3LA6A 4BZXA 3AP3A 3OF5A 3PEYA 1GFIA 2GEUA 1OH8A 1A4RA 2W2XA 1GRQA 2O52A 5FI1B 4P4UA 1VYUA 3B8HA 3ASZA 4CF7A 3RRNA 3CPEA 4GNKA 3TJZA 1D9XA 2ZSBA 5E7IA 2G3YA 2JAQA 3LD9A 3L43A 2NO7A 1LS6A 2A30A 2OCAA 4KI0A 2WSSA 2JLZA 4Z1MA 5EUQB 2ZS7A 3WMEA 1SVOA 3P20A 4LSGA 4AK9A 1GRNA 3I72A 1OH7A 2QSYA 5CYOA 1Z6AA 4EPWA 3JZMA 2BEJA 4Q4JB 3U4QB 1KI9A 4BFVA 4BFZA 1UFQA 1G1MA 4PZLA 3AKEA 3EIQA 4LYJA 3IILA 1OJLA 4BFSA 4G5GA 3ZQJA 2PBRA 2BBOA 1GKUB 2W00A 1XJCA 1I4DD 3PIRA 4CT4B 1AJEA 2CBZA 3I92A 1J7KA 1P61B 3FHTA 1RRCA 2G0NA 2ORVA 2X1VA 3A1SA 1G6OA 2UVQA 1W46A 3HP1A 1P6XA 4TYQA 4GL2A 2VLIA 1U8YA 3FVQA 4XIGS 2A7QA 2JJ2D 2X19A 4Q1FA 1IN6A 4G5OA 3A1WA 1TF2A 1P2SA 5SZIA 1HV8A 1Z63A 3EPHA 3W5IA 4LK2A 1YZTA 4M1SA 4MGIR 1IAQA 4HLDA 4WXRA 3ZZUA 1FW6A 4A15A 2NOAA 1L8QA 2QEQA 4LUCA 5FTKA 2IYLD 1N5IA 1XU4A 2IC5A 5JZVA 2EFEB 3CF6R 1KI6B 3CRW1 4K81B 1JBKA 4Q4AB 2JLQA 4PPFA 1KO5A 4DLTA 1NVWQ 5J40A 2FSGA 4I1SA 1RJ9A 1Z08A 521PA 2FGJA 2H16A 3FMPB 5P21A 4Q1DA 2RAPA 1KDPA 2A9KA 4MQBA 1XPRA 2ZRNA 4PPNA 1A2KC 1Q1BA 1G5TA 2B92A 3KXIA 1TF5A 5KTYA 3U60B 2GCNA 2ZRMA 4TMWA 4F93B 2UKDA 1E6CA 3Q7QA 3G82C 1JB1A 3WP0A 3C5HA 3GFTA 4EUNA 5TY0A 4QGFA 5GVSA 1OHHA 1S2MA 3K9HA 4BLOA 1IN7A 3U3MA 5KOYA 1ZNZA 1W0KD 1E2JA 4XWKA 2AL7A 2VF8A 4FWIB 1W48A 4RZXA 3T12A 2ZE6A 4PANA 1L4UA 1TAGA 4RVCA 2ORIA 4KSBA 1UBGA 3QVUA 2FEOA 1TUEA 1A7JA 1J90A 4JBWA 5JJIA 2VYFA 3GJXC 4JKYA 3F8TA 621PA 3RYTC 2WHXA 1M74A 3CPJB 6Q21A 2HUPA 1NVXQ 3ASYA 2ZI3A 2Q9CA 1NN5A 5FUVA 1NMZA 2IYYA 2HF9A 1E3MA 3M4YA 4R2IA 2WPDA 5A0FA 4NYJQ 1UDWA 2P2LA 1NN3A 5FR1A 3OE7D 3TIFA 4ACBA 1DADA 2ZYUX 3AKCA 3OAAA 3VR6A 3QPUA 1XTSA 2HCBA 1UEIA 1JJVA 1RZ3A 3QG5A 1DVRA 3P26A 2J0SA 3SOPA 3O47A 4X8MA 2PX3A 1IBRA 1T3SA 2OBMA 3PCRB 5CJ2A 4BGDA 1PLLA 4OJKA 2ZI6A 1IOZA 2HT6A 2OFOA 4JL5A 2O0JA 3T34A 1G4AE 4HDOB 4JIMA 4GZLA 1VYVA 4HZUB 1AGRA 1DAMA 4KBGA 4MKIA 3I8SA 2YOFA 3LDAA 2O0HA 4D80A 1ZD8A 1HQYE 2AK3A 3KKPA 3V4RA 5LD2B 3A6PC 3VQTA 3OE7A 5KNBA 2CVHA 3WYAA 5BXQC 2WKQA 4DUGA 4D26A 2DYKA 1T91A 4TQ9A 3U7FB 1FNMA 3CW2A 4EPVA 4LHVA 1KSGA 3SHFA 1N6LA 4LCBA 4R7ZA 4DHEA 2A5GA 1JXMA 4P32A 5J4HA 1HURA 3QPVA 3UXMA 3AP1A 1FUUA 1S8FA 1LFDB 4C0JA 2QENA 3GLHE 1E2NA 1HQCA 4ZPXA 2R6DA 2D7CA 3PUXA 3TGPA 4EJSC 2GJKA 5IRCD 2HEIA 3S1AB 3IEVA 3NEJA 1KK2A 1VG8A 4LC0A 4TYNA 4ZIRA 1P2TA 4POAA 1Z47A 2IYZA 2NZJA 4UKDA 1E9FA 4TLBA 1K6MA 1HT1E 2WWGA 1EFUA 2BMDA 4UNNA 2X2FA 3THYB 3GLFA 3GLIE 2H57A 1LF5A 1HYQA 5AJVB 2IX3A 2A5DA 1XTKA 4YLGA 3EA0A 5JEDA 1IY2A 1MRNA 3LBIA 3IQWA 2OUKA 5KSPA 2BMFA 2IYSA 3G0HA 4CVNA 3KB1A 1U94A 2ZI4A 3AM1A 1U9IA 4P4TA 2ZQ5A 4PZZA 3K9NA 2RGNA 1T8TA 4C0HA 4URWR 2IT1A 1XZQA 1YZLA 4Q7MB 1PLKA 3DVLA 4AG5A 3P4XA 2JJ8A 2IF2A 2WJYA 3U6BA 3ZQ6A 1VCOA 4GOJA 1RIFA 3EZ2A 3QEJA 2HDNB 1XCGB 2ODBA 4PSAA 2D06A 2Q0HA 4HB0A 4J0QA 3PXGA 1OH6A 3LX8A 3HJNA 4M0LA 1GKIA 2IUSA 4TL8A 5CIQA 1FQKA 3VX4A 3QPWA 1TTTA 1SZPA 1JQLB 1KNXA 2OEPA 1Q1QA 2PMDA 3SI7A 5JLJA 1RPZA 3QVVA 5A5GA 3ZD6A 4F38A 1JJ7A 2P65A 2YWHA 3S1AA 4NZYA 1OIXA 3OHMA 4TMTA 1Z28A 1KOFA 1Q44A 1JR3D 2CXXA 4Q7JB 5HZKA 4DUGD 4DXAA 1P62B 4B73A 5DI3A 2HJVA 2D2EA 4ITRC 2VQSA 3O8DA 1U9IC 1KO8A 1ZCAA 1X3SA 1OFIA 2QAGA 5HPYB 2GZHA 5LPNA 3GLFB 3RRYA 1II0A 2PEZA 5IHPA 5KU1A 2CLDX 1I4LD 3Q5EA 1BS1A 2JLSA 4XSGA 5BQ5A 1JEDA 3HU3A 4CIDA 2ZVQX 3W6NA 1P60A 1Z22A 3RVBA 3TW4A 5KDDA 3B2EA 4W5JA 3OIYA 4CEIA 1G3MA 4DDUA 5FL7D 1AS2A 3K8YA 1E9DA 4H1UA 3DM9B 4FMCF 1H65A 3FPAA 1NG9A 3SYLA 1KZ7B 1AQYA 2BCJQ 3SJBA 4AYTA 4KYUA 2P3SA 4DDTA 1N5KA 3SBEA 3WYFA 1E1RD 3LRPA 4DEYA 1ZD1A 2XTNA 3X1ZA 2DCUA 2PZEA 1JQJC 1KDRA 3IDQA 2JLWA 2OLJA 2E9SA 1OKKA 2IHYA 4DVGA 4V0OA 4CGZA 3IIKA 4D4KA 2IEZA 4AYWA 4DB4A 3CH4B 2MSCB 3T35A 1R7RA 2ZR7A 4JMPA 2WKRA 4K8OA 1EFTA 4RSGA 4V0KA 5DI3B 1X1RA 3W34A 5EXPA 3PUVA 1ZP6A 5H1YA 3U7GA 2EYUA 4L8GA 3MJHA 2Z4RA 3CONA 2Q3HA 3ZVRA 5IK2A 3O8CA 4L9SA 1VDZA 3BRWD 4S2EA 1KI3A 2WKPA 1SVKA 1QHNA 2E1RA 3I73A 5IF9A 3VR5A 4PO8A 2OXRA 2OCBA 3EAQA 3GEIA 2ZEJA 2RGBA 1G41A 1Q21A 3CB4A 5GVRA 2VP4A 3BK7A 5JI3E 2XXAB 1LNZA 2OT3B 4ZV4A 1NSFA 1P72A 2GEDA 3UMRA 2ZRCA 3CM0A 4G5QA 3VNVA 2B7BA 821PA 2GCOB 4KODA 4NL4H 1NG1A 4KVGA 2R6CA 3VKGA 1KSFX 3A37A 3K53A 3KKOA 1EG7A 3QKSA 3VHLB 4BFXA 5AJWA 1CEEA 2AKYA 4KFRA 1HE8B 4JLVA 5DHFA 4TMKA 1E69A 2O8FA 4NKRA 1S9HA 1NSTA 1NMYA 2PCJA 4A8JB 3ZVMA 1BMFD 4TT3A 2K5UA 3VMFA 1YU9A 2FFAA 1G16A 4LV8B 2G9NA 1DS6A 4Q5IA 3KZ1E 4RZ2A 1XF9A 1UKYA 3ADCA 1F3OA 2N42A 1BIFA 4PAOA 4HAVA 4EPYA 2D3WA 2REXB 2WSMA 4LHWA 3UPUA 4AY2A 1OFUX 1Z0AA 2CLSA 4U5XA 3J81k 4TZ0A 3NH6A 1E4YA 3IBYA 1GAJA 2V1XA 2J7KA 1EX7A 3CWZA 4NTZA 4KHZA 2D2FA 3L8ZA 1RYFA 4DZZA 3LNCA 4MRNA 2KB0A 1FQJA 1S96A 4DKXA 1H8ED 5BWMA 2CMKA 5KPJA 4XWOA 3E5HA 2J41A 2WICA 1BH2A 2PH1A 2VP2A 2G83A 3RSOA 4DRZA 1KMHB 1KSJA 2QRZA 2YC2C 1IJFA 4KXFB 3ND9A 3LX5A 2XZPA 4HLUC 4M9ZA 2DB3A 3IQXA 1S3SA 1NRJB 2J7PA 4G01B 1ZNWA 2FZLA 4MGKR 1JAIA 5C1BA 1T0HB 1NVVR 2N46A 1ONBA 1ZM9A 1Z0DA 1Z6TA 1E2GA 4YMSA 4YXWA 5B64A 3ZGXA 1EFRA 2QU8A 3EG5A 3HPRA 1OB2A 3LV8A 1Q57A 2X77A 3X1WA 2XGJA 1G7TA 2OILA 3EIHA 2QGNA 3I3SR 4L4UA 5LBIA 4ZCMA 1YRAA 3K70C 4ARZB 3OFND 4AKHA 4O0MA 2GJSA 3VAAA 1KJZA 3MWYW 1UJ2A 1MV5A 5C4MA 2BMEA 4XD7D 1X6VA 4DWJA 1X8KA 2FNAA 4FCVA 1NKTA 3CF0A 4MH0R 3SYNA 2GZAA 2NQ2C 5FBVB 1AA9A 5DE3A 3WY9A 3AH8A 5L3QA 3MG9A 3EIEA 1QHHA 4HEJA 1UDXA 1JPNA 3D8BA 1E2DA 1SULA 4WXPA 2VP6A 3KJGA 2H1LA 4JKIA 5E7JA 2CHQA 3UG7A 3E2IA 1XTRA 1N6PA 3L82B 1D6JA 3KKQA 2JLXA 5FOWA 3SS8A 2ZRPA 2ZUDA 1VG1A 1QRAA 1R2QA 4DT1B 4B3FX 3IUYA 5KSZA 4YDHB 1KMHA 1YHNA 3ZDQA 1YRBA 2P5TB 3FOZA 1QVAA 4URXR 4TYYA 4KITB 3U3RA 2VSXA 5FPYA 4YMUA 1CULC 4PAQA 5CLQA 3VU9B 3KJIA 3UWKA 5JCZA 1AS3A 1K8RA 3K9GA 3IO5A 3B5JA 1U81A 4U02A 1E2QA 4XSHA 3P1JA 4QGGA 4AYXA 3N5CA 3U3OA 1TNDA 2QORA 3U6KA 5E95A 3ZJYA 2IUTA 4ARZA 1W36B 1PZNA 2RMKA 1XCMA 1W44A 1YR9A 4JLMA 3ZZ0A 1I2DA 3QKTA 4MYHA 1NVVQ 1IN8A 1OXXK 3SNHA 2YV5A 4KVAA 1N2CE 2ZJYA 3HU2A 2NTYC 4D6PA 4PZYA 3SE0A 5EE3A 1FTSA 1QHIA 2QNRA 1JECA 3FDIA 4CEJA 4V0MA 2NO0A 5CB6A 1G19A 1U90A 4DLSA 1OLOA 1MT0A 4KLZA 4TSFA 3H2YA 2QQEA 1TL7C
chains in the Genus database with same CATH superfamily
4NATA 1DFHA 2F8MA 4IJ5A 1E9VA 3JD3A 2BC9A 5FTMA 5EA2A 4C5AA 2ZYHA 3HSSA 2W93A 3TS1A 1XJ0A 5CLJA 3TZEA 1D2EA 3WFJA 4LZZA 3CPSA 2OO5C 3G59A 1W0CA 3RGGA 1T5IA 4HXYA 3IT2A 4AZ3A 3GLGB 2JASA 1QB7A 1L1FA 1PR6A 4YMVA 4MUMA 1N9KA 1Z4KA 3DT8A 4JP8A 1B8OA 3W2TA 4WADA 3WK6A 5BSHA 1XZPA 2BEVB 1G55A 1PVDA 3L5OA 4Q34A 4F86A 2CVFA 1W59A 4CN8A 2ZQZA 5K0TA 2MSDB 3IXMA 1Z6ZA 4BGIA 1H1TA 1VGQA 4HDNA 3FJ1A 1P2VA 1NI5A 1MIOB 3O74A 4NBWA 4A73A 3AFMA 3ZJVA 2WUFA 4C6TA 3PFIA 3DPSA 3LT2A 4NULA 4JBYA 2NU6B 4WKOA 2I65A 4YQEA 3UJ3X 1F3LA 1RLOA 3QE2A 4EBFA 1M2EA 2DR3A 2VYVD 4GAEA 4OYYA 1Z0FA 2ZJ0A 3UTDA 6PFKA 1CBUA 3A4MA 2WNSA 4F1JA 2OHGA 4YASA 1HMYA 4IRUB 1L5RA 3ELBA 4UEQA 3ZH9B 1EHIA 2OFWA 1WETA 1D4AA 1YU6A 2RH9B 2COEA 1I9CA 3WL7A 4G37A 1DOHA 3GJ0A 1KARA 1XTVA 3CCCA 4ZDKA 1OLUB 3I2JA 1BE0A 2HIMA 1QIDA 3MSXA 4I9HA 4CU5A 5KJ1A 5JZOA 3BWMA 1DEHA 1IN4A 1CZUA 1ZIPA 2CVOA 3E1KA 2WAYA 2V7XA 4F56A 1EJ6A 3ICEA 4OHZA 4X60A 3REGA 4YV1A 1G6HA 3N39C 3JR3A 2L69A 2I2CA 5TC4A 4R51A 4V0RA 1ENYA 3ZK7A 3CN9A 3F7TA 1RAFA 4JC4A 2HCRA 4DR2B 3AL2A 4ALNA 5CGQB 3K72B 2DBQA 3Q5DA 2E6KA 3QFCA 4GL4A 2BEVA 2Q8NA 3S70A 3DBLB 2IS2A 4IDFA 2WTMA 4R0MA 4QPCA 2F4VB 4BU1A 4PTYA 5A05A 1AQJA 3LUBA 4XJTA 3TOXA 5AM3A 3H87A 4HNRA 1XWFA 1T2FA 2JCGA 2L82A 1OFHA 2D5LA 3TTWA 3EGXB 4LJ4A 2NSLA 3IAS6 3MWDA 3ZR4B 5B3AA 5A02A 4CLDA 1M66A 1DC3A 3TE7A 3HJRA 5EP2A 5JSHA 3O9VA 4JUIA 5LB2A 3W05A 1E0KA 1GG8A 1YDMA 1TQ2A 4ZAFA 5LQJA 2DHRA 3HG7A 3VPDA 2HA3A 1MAHA 4B6OA 3NEYA 1FNSA 2Q0SA 3ND7A 3DVSX 4JX9A 3U9TA 2HMYB 4BNYA 4G86A 1YI1A 2ZROA 3T1QA 5AHXA 2P1DA 5J63A 1T2CA 1UOEA 3KQHA 3BD8A 4ARIA 2C3OA 3UWDA 4JROA 3UV6A 2X1MA 3V4ZA 3BL5A 1XFAA 2GM3A 1I2CA 3Q72A 2B8WA 2G82A 2PVCA 1EVLA 1R6VA 4L95C 1AMNA 4RTNA 3TX6A 1PRYA 1USVA 3OPYA 4OLAA 1AB6A 1JP7A 4M89A 3TNJA 5KKCA 4XUDA 2A1UA 3O2SB 1Y37A 4E32A 4BJ5A 1JLRA 1M72A 3D8NA 1ECJA 1KI4A 1C9JA 2OK7A 4P08A 4EG8A 1L5OA 4KIJA 5EWMB 4NXNB 5IVPA 1U6IA 2GBCA 1RNLA 1OFTA 2IUFA 1EX6A 4N5NA 1DTSA 2WINI 3AFOA 3JU3A 3PNKA 1VKJA 3MWGA 4FMDF 4HRXA 2VF7A 5EUMA 4G81A 3FMOB 2R2GA 2G0AA 1IC6A 1N7IA 1RP1A 1W2HA 3BPSA 3O1JC 4GLOA 4ZALA 2FMIA 2D13A 2FDXA 2V1UA 4FW8A 4O2LA 5DXFA 1T34A 1YMQA 5LU8A 4Q66C 1G17A 3DMRA 1Z06A 2VXBA 1U7WA 3IFSA 2UVPA 5T3YA 1CDDA 1XA0A 4HNQA 2BR4A 1C0PA 2AMVA 3IIEA 4GS5A 4IYRA 1WHSA 4D8XA 1GDDA 2FUG6 1JHOA 3C70A 3EFHA 4K9SA 1DAIA 4Y30A 3BH0A 1XVAA 3CGWA 5LYYA 3C3XA 3KPYA 3MB8A 1Y5RA 5ERXA 3TNLA 2NAFA 3PA8A 4PBTA 4A16A 4F5WA 1AK9A 2PV7A 1WRBA 3I1FA 2O7NA 1W4RA 1CTQA 3HLKA 4NBVA 2HK6A 2OG1A 3AFNA 5F4ZA 4YRLA 2C03A 1HDRA 1BN6A 2AC2A 2ZE7A 2CEAA 4O5OA 4QXRA 3KJHA 3RPEA 3D0KA 2B4YA 4LVUA 1CY0A 1JNXX 2YMMA 2YFHA 3U7RA 5JJLA 2Q7OE 1SEVA 3T54A 1WB9A 3S8YA 1LLFA 3NVAA 1E79A 4H2DA 3BICA 3CRMA 4AKEA 2PMEA 4KR9A 3F73A 1E1MA 3ZY2A 4MPDA 1H69A 1Q0TA 3A1VA 1G98A 1MAAA 1QDLB 4NJMB 2A1TS 3EBLA 4ZICA 4EY5A 1C3XA 4P0PB 3ON5A 2XXAA 1GSIA 3FE2A 3RTBA 2Z0MA 2ATCA 4RV9A 4ERXA 3I1YA 3MFYA 4TLEA 1ZUNB 2BMVA 2HK9A 4BZZA 2WU8A 4L6IA 2FJUA 1M1ZA 2LE0A 2BMWA 3MCAA 1ZGZA 2PCLA 4IQGA 2PRJA 3HHPA 2OCPA 1QBKC 1MO4A 1M2WA 2NZWA 2W2PA 2HLPA 4QBFA 4WKGA 4C08A 4TWBA 5E4YA 4G5XA 3VUFA 4CFSA 1H9CA 2GSDA 1DBWA 2O5RA 2ZUWA 3DD5A 1Z4JA 3BIOA 3DLAA 1X1EA 4NYIR 2CLCX 3R40A 3UJAA 4LF5B 5FX2A 3H5RA 1SKAA 2XRYA 4FC6A 4BRSA 3A4NA 2BM1A 3WLMA 1B74A 4MYSA 1Q1EA 4E5KA 1XHFA 3GI1A 5KINB 3PLAE 1UUFA 3BIFA 4BUCA 2JGJA 1EFPA 1EVEA 1Q16A 4YUZA 3G5LA 3OECA 2L19A 3H05A 1FLNA 4URZR 1T1EA 3H1TA 2HDHA 3WI7A 2C5EA 4AN1A 4TX1A 4QTZA 2X0JA 2EF1A 3IBGA 4JOBA 2OO5A 1H2RS 2UVDA 1IM8A 2PZFA 2GEJA 3NI2A 3UAVA 3RIYA 1EM6A 2JKVA 3BILA 2YHSA 3IP7A 4RZ3A 1YDHA 4MUNA 5GOTA 2D00A 1GZUA 2WSLA 3IAFA 2O2SA 1XJWA 3L0YA 4HQLA 4LE0A 2L42A 1IWBB 1V43A 3TSZA 4NPAA 3U7QA 1USKA 1GNVA 4PM4A 3ZCQA 1VJRA 1TK2A 4PC6A 3WIDA 1K0FA 1QBGA 2EIXA 3T5TA 4JI3B 1UPFA 3IQEA 2OPBA 4IVNA 4B43A 3ZVNA 4FE7A 1ADJA 1KE1A 2QQGA 2YNMD 3FSGA 3I8OA 1E66A 3QHQA 4YC7A 4PAGA 5LMUB 3OJCA 5AK3A 4GVXA 4J3NA 3B6KA 2HUNA 4G25A 1MCZA 3N2LA 3EB9A 4LRQA 4C7OA 1PFWA 2A3RA 1TFRA 1NOJA 4DZTA 3D5QA 3GGSA 3AESA 5D3ZA 3OLZA 1KEEB 3GRPA 3MRSA 1HA3A 3PEEA 3K0FB 2AXNA 3NORA 3IHWA 4QDUA 4YRRA 5I9MA 3N07A 1SXJE 1WSDA 1MABB 1B26A 2EKQA 3IAM6 3UO8B 1HH4A 1G7RA 3D54D 1KSHA 3NAQA 2YZGA 4ZTUB 1J8FA 1NVUQ 1TAHA 1LS1A 2WWRA 3JAMA 3OWHA 5GONA 3CNHA 2H4WA 5FADA 5FLKA 1HDXA 3DZJA 3OM0A 1L5HB 1AXEA 1A82A 1WLSA 3V9AA 4BO7A 1Q7EA 3AW8A 3FG9A 1W85A 2BEWA 1H66A 4BVLA 1AV6A 1IEVA 2HXSA 3CRZA 4XLLA 3L7NA 1H9BA 4M86A 4X61A 2LWIA 4RU1A 2DFLA 4O8ZA 1FQOA 3N0TA 2AFIA 4UFOA 1K5PA 1MIHA 1QFMA 2EQBA 2F43A 1U6KA 1FP4B 2NO6A 2VAMA 5IK2D 1JDNA 3KM0A 4MWSA 3TECE 2A0XA 3H9BA 1WCV1 2WF7A 2Z57A 4QOGA 2PL5A 1LU9A 3I6MA 1GN9A 5I7AA 2PS9A 5T6BA 1FLDA 1VHJA 2FWAA 4RPLA 4X1OA 4MUGA 1NV8A 5C53B 4AF8A 3H5WA 2ZU0C 3UPDA 2W9XA 2NO5A 1WXIA 4TYPA 5DYWA 1TW3A 1TJPB 4N6GA 5KHOC 4QFMA 1TLTA 2MDTA 1XXLA 1MJFA 4O4JB 2X6QA 2NXCA 4HDRB 4MI1A 4K6CA 1MB9A 3DBVO 1E64A 2JCSA 3NTQA 1G8YA 3ZYCA 2JA2A 2OKGA 3GJ6A 4FKZA 3TZ6A 2BRUC 4G8BA 1MN6A 1MO5A 4F7DA 3K0CC 4RZUA 1W9HA 3GIWA 4RBNA 2X5XA 3TJRA 2C7RA 3E82A 4EFKA 1EFRD 3KOUA 3CR8A 3QYAA 1U0RA 2JFGA 3RHTA 1ZJWA 3BDVA 4PR0A 1ZMXA 3DEZA 3SR0A 5BXYA 1G6KA 1C1XB 1KU0A 2I87A 2VXCA 4M8SA 4PQGA 5EZ5A 3S3TA 3RVKA 3GT0A 2FPMA 4BAUA 3AWDA 2NTJA 5FBLB 1UBCA 3GT3A 3HKEB 5J23A 2PLNA 4FNAA 4PIMA 2JJ1D 3TRHA 2X2OA 4EPRA 3B52X 2I0FA 1WNFA 1SC1A 4MKRA 2GKOA 1PJTA 3JWHA 1L5WA 3MOSA 2QW1A 4PW0A 4B5KA 3GJRA 4RK6A 2ATXA 5C8VA 4MB2A 3E5NA 3PFWO 2GJAA 3C3WA 4LPKA 2ZWMA 2C83A 1QAMA 3G5MA 1NRWA 2SKEA 4HWKA 2AUMA 4EARA 1VE9A 1YIOA 3LCRA 4Z86A 1EDBA 4F21A 3TSAA 8ATCA 1BAPA 1HG0A 2W6IA 2YVUA 3PNQA 3G0IA 3S55A 1RRMA 3B3JA 4H3SA 3U62A 1PL8A 1YTLA 1KBZA 1Z56C 4Q3DA 4BP1A 4TQGA 1T5DX 3A4TA 3S6JA 3UWPA 3R7SA 2ZB3A 3EUFA 4TQAA 3AEQB 4CNBA 5CT8A 2I1WA 4GGOA 1M2JA 1OREA 3FPGA 3VR2D 1XDDA 5C1DA 3IPYA 2ZAGA 1PUXA 3V48A 4AB1A 4F5DA 4E5YA 4N7RA 1YWGO 5C3UA 2GK7A 1AS0A 5M3BA 4AJIA 1ZH8A 2AFHB 2IU4A 4REQB 4B7AA 3T99A 1I36A 1W34A 1B2LA 2X6TA 3RAEC 5K8LA 1P19A 2NXNA 3LDGA 5ALZA 1L7DA 1AA6A 3ID6C 2A9QA 1JEYA 1FU4A 1MIOA 3KZXA 1FFSA 3KDAA 3ZD9A 3VO9A 3PJDA 2QSJA 2BP7B 5G1NA 1FX0B 5JROA 1LWOA 4P4SB 3RS5A 3M7IA 5K8VA 5FYQA 3PJRA 1IOLA 2CL0X 3W5HA 5I4KA 3ITKA 3OPQA 2VEDA 2HYIC 3X1XA 1NVAA 1CJUC 2ZBDA 4RHFA 5A4IS 4UNSA 3U3DA 3R3ZA 2D62A 2Y0PA 4AJHA 3LFHA 2WWIA 1V1JA 2EDCA 2P67A 5LYJB 3NTRA 1J09A 5KC9A 1NJGA 2PL3A 3M2TA 5HUHA 1YT5A 1R5OA 2RHGB 1W4CA 5IABA 3AVVA 3IC5A 3GO4A 3JYHA 1J2UA 4N0DA 3G9UA 4HYTA 1I7NA 1N1DA 3UYLA 2AKEA 5J4VA 2XOKD 4FZJA 2P35A 2IS1A 1FRNA 2EL9A 3D7SA 4EX6A 4O6VA 1N2ZA 4QSMA 2NPFA 4MRPA 3DE3X 3IA7A 4YAWA 2AK2A 3DDNA 5JYEA 2WIBA 3D4NA 5BRNA 2PEYA 1NYTA 2CNLA 3EGOA 3M4JA 3ABQB 1ECLA 1GG2A 2DLNA 2NZ2A 3EARA 3LHFA 4WZBB 4Y1RB 4BVJA 4KSYA 3TUJC 3M33A 2GVNA 4YRKA 2BBSA 5CITA 2QTVB 3ROXA 2R44A 4Q9NA 4U8GA 4FGJA 3ZK8A 1NXWA 1CQPA 5AICA 3W04A 3BJEA 4F6RA 2BKUA 3LUKA 5D3QA 4KW7A 3QQ5A 5KSWB 1GQYA 1JLKA 3NAGA 1DFIA 2C57A 3KKLA 1KPHA 3PGVA 3ILXA 3JYPA 5L3SB 2RHTA 5PGMA 1TVCA 3K8ZA 3OEEA 4N01A 4RF5A 4C1BA 3O03A 2P7HA 3O8BA 4Z8XA 4CIXA 4EO9A 5BQFA 2XE4A 4WASA 4WINA 3VH1A 4N7BA 4AWBA 1LEHA 2E37A 1UKVY 5D8DA 7REQB 5FL7A 5L4SA 5HNKA 4RK4A 3AJEA 3ZC3A 2NUPA 3QSGA 5JAOA 1ZQ9A 2J87A 4W82A 2B7LA 2PANA 2FZ4A 1P1IA 1J56A 3PDWA 1T3TA 3PXDA 5GM2A 5CBPA 5FDFA 1JZTA 2FMXA 3PITA 1GG9A 2RKOA 2R96A 1E5XA 2FFRA 2YZMA 3H4TA 2B1QA 3O4GA 3P9QA 5CA1B 1QPZA 5H3HA 3RRMA 2PPVA 4QGBA 2IOQA 1N2SA 5D86A 2FWMX 3JD2A 1L5MA 4AIIA 8ADHA 4NBNA 4OQXA 4HL6A 4H3VA 4OBXA 3OZSA 3LFUA 5EJ2A 2D3TA 2B99A 1KO4A 2E21A 2HJWA 3B6EA 3PDIB 3PQEA 4QX6A 5HJ2A 4DEVA 1IDN1 2HHCA 4C4YA 3AF3A 1IY1A 2ZDHA 3MAGA 4BJ1A 1UK8A 1VSQA 1YQTA 1FRFS 2YMPA 3KDPA 1M33A 2YXLA 3CTMA 3I76A 1RZUA 3JPYA 2LPMA 1XEWX 4GR4A 4LOLA 2YMQA 2R47A 2M32A 3OQIB 1H5NA 3C97A 5C8XA 3OU6A 4KPGA 2XH8A 1J20A 1RW4A 3D6VA 1J49A 3VPHA 4MYCA 2KLHA 4C87A 1ESEA 1DJNA 2BSAA 3A6ZA 4IDHA 1KDZA 3ZKWB 3P19A 4ZODA 1WMAA 2MR5A 1KL7A 3FGNA 4IO1A 1LBSA 2VJAA 3UENA 1ZVKA 5BNZA 2O8EB 1PD1A 3F90A 3AKYA 1T5SA 1NBOA 1KVRA 3RF6A 3TIGA 4DC0A 7YASA 5E6SB 4HWRA 2DPHA 3S4YA 4W5RA 5E6RB 2GXAA 5KYVA 1KDTA 1M0SA 2VRNA 1E32A 2BGRA 2ZJ2A 3C43A 1R0YA 2ZI5A 3E6AA 3FLBA 4KP7A 2JATA 4OBBA 4PLWA 1OA0A 2HFKA 2QLJA 4XTRA 1T1SA 1TMGE 1U4SA 2R87A 1L8LA 5FUBA 5CA1A 4U6NA 5DH9A 2H51A 2WYHA 1S2LA 4OP2A 4ZEWA 2E49A 4O2BF 1H2YA 1ZNQO 4C76A 1KKUA 2GPYA 2I5PO 4MW1A 1MZVA 3RS7A 1Q77A 3CRVA 4JBXA 4B4WA 4B34A 2ASEA 1F7VA 3AF4A 4FI3C 4Q9JA 1JPUA 1DO2A 4GH5A 3VHXA 5I9BA 4CCWA 5A5FA 1L8XA 2OM6A 3DM5A 3PRKE 1IY0A 3CVYA 2G36A 2ZJAA 1N2IA 3W4KA 2ICAA 1X74A 3JQAD 4EUHA 1O94C 3UIEA 3ADOA 1T43A 3I1IA 3NBXX 1N32B 4L4YA 4I4TB 3DL0A 4CDRA 1N2JA 1AY0A 1ZS9A 2CCGA 4JUBA 1TGVA 1QH1A 1ZNYA 1M8GA 1RAHA 2EKLA 2R6JA 2A84A 1X8LA 2FSFA 5J4LA 2TMGA 2W0SA 2CZGA 4IPTA 1O0BA 4FW9A 4DT1A 1Q7GA 1LTKA 1EP9A 1F8UA 2J3HA 1ZXXA 1QO0A 2FQWA 4RX1A 3PNYA 3BQ9A 4OYHA 4AURA 5DNCA 2Q6TA 1K7SN 4FUTA 3GLIA 1WU7A 1AV7A 4A8JC 5F3RA 2Q6OA 1A0OA 3E03A 4R1LA 1PZGA 5SZJA 4JCCA 2VPXA 3SVLA 1A2BA 1E9BA 3T1HB 3DZDA 1GARA 3MWLA 4NBTA 2VJMA 3DONA 1XDZA 2O6LA 3K7EA 4D41A 4FYPA 3WTBA 1OUMA 2VA9A 1EFCA 2BDUA 1SWVA 1XMIA 1RMQA 2IYAA 3ZCSA 3B2NA 5HR5A 2EP8A 3I34X 3KWMA 3QFSA 1QQ5A 4JBHA 1E89A 1LLQA 2X5JO 3L77A 3Q85A 3QBVA 2RGRA 2IOHA 3BE6A 4I50A 2F8SA 2QLTA 4KWHA 4EQ6B 4F71A 4H6WA 3P2MA 5H7XA 3EA5A 1WCIA 2IHJA 2H9YA 2PS3A 1ZSYA 1AXRA 2I7CA 3BTUA 1H2AS 1ZL2A 3C1OA 3THOA 1QGAA 4GC9A 3L2OB 5KJ6A 4DR7B 3O8NA 3ENKA 4C7MA 2ZSIA 4TL7A 2CNWD 3G7SA 3IEUA 3DPUA 3UEOA 2FN9A 2JJMA 3UK1A 2IEDA 3WB0A 5YASA 4E88A 4GC5A 5CB4F 5GTDA 3TSWA 1BRTA 9ABPA 1BDJA 3EX7C 3U7JA 2BF7A 2B82A 1FMLA 5EHQA 3LUGA 3F3MA 1VCHA 2I6XA 5F77A 1R37A 2BFDB 2ID8A 2OGUA 5B57C 3DZFA 3G0BA 1B00A 4BNDB 3O3OB 4QNMA 3TR6A 4D42A 4F4DA 5CA0B 5C5CA 1NUTA 3N0VA 5CDGA 4LF4B 1INLA 2VJOA 4YJ3B 1ENOA 3MLBA 3N8GA 4XTCS 3BA6A 2WKSA 4QJIA 4CLOA 1BX0A 1SBQA 2IDJA 3L93A 4DDVA 5AD1A 4V1CB 4ZKDA 1V2HE 3KLMX 5K09A 2JGMA 3V2UA 3RC8A 1UINA 4OHYA 2GPSA 1LDYA 5BNWA 4U7TB 1DHRA 1U31A 5L40A 3WBBA 3EZNA 2XNSA 4YJ3F 1KJIA 4ZVOA 2HSEA 5AKYA 3GYGA 4FM9A 3R6LA 1C8BA 4YJFB 4C2UA 2ONCA 2EU8A 4CG1A 3WDSA 1Y5IA 4HAYA 4A0HA 3G6KA 3FYHA 3BUSA 5AJZA 3ZDDA 1QUEA 1U7XA 4YQZA 3S2EA 5LA6B 4CXMA 1QKJA 2CUNA 2ROQA 3FUXA 2AR0A 3JQRA 4FINA 4JC8A 5F76A 1BH6A 4ITUA 3A9TA 4Q19A 3S99A 4B3HA 1PZXA 3RSGA 2RJ3A 3OM1A 2HRDA 2H4YA 4K9QA 3K20A 2MSKA 3DKIA 4WLOA 3UB3A 4YMWA 1QZUA 1U5CA 4IJKA 4MEAA 4ZGGA 2WB2A 1XEXB 2HHAA 2QJRA 5HQJA 2ZAMA 2XNDA 2Y4OA 3RYFB 3ICQB 3A4IA 3U09A 2V9PA 3ABOB 4Y6QA 4F1WA 2B9EA 3M34A 5K3BA 1XCJA 3ZWAA 1MFPA 2ZIFA 3CG0A 4KMRA 2JCBA 4PQYA 4OSOA 5A3VA 1YI8A 3RBXA 4C0LA 1WMEA 3V8NA 1RBYA 1X13A 4YRCA 4EA9A 5GINE 4OA8A 4UVEA 1TT7A 4JQCA 2V5UA 3JASB 1I7SB 1LY1A 3OUUA 1B0PA 4UHHA 1SHLA 2OV1A 2Z3WA 4FFLA 4ZMBA 1BKSB 3Q5GA 3VTZA 5F3WB 2FEAA 4P0TA 5IWAB 2GR9A 2HOQA 5L3ZA 1PJAA 2C9DA 2PGAA 2ZB2A 4RPHA 3H2HA 1OW3B 3HCAA 2GB4A 4OLJA 2FFHA 4PQEA 5F73A 3NVDA 2RHDA 1N1MA 1E2MA 2J08A 1Q3HA 1CJVC 5FBKA 2VH2A 3S7TA 2VYNA 3F0TA 5JPCA 3U17A 5HUJA 2Z9CA 3RS2A 4MV7A 2PHZA 5KX5A 1NP6A 3Q7EA 1LDNA 1Z5PA 4YI3A 3WOVA 4II3A 5HTOA 5A9SB 3PXEA 3D2CA 4E94A 4M6WA 5FNZA 1XKTA 1Z7YA 3QI7A 5F23A 4QRDA 1FDIA 1X7WA 3NGLA 4D8TA 4TMVA 1CZKA 5EG5A 3O0DA 1Z12A 2G4CA 5ENZA 1AN0A 1GILA 1S1CA 2IK8A 4R9SA 2X3FA 3MRVA 4GKBA 1Q1GA 4OATA 2A1UB 4BNHA 3ZHSA 4AJKA 1FYEA 4M4SA 2XB2A 3LIPA 3KHSA 4V39A 4D9GA 1NY5A 1YJBA 2CXNA 1E4EA 2PZBA 4CCAA 2P27A 3HB1A 1T2NA 4DLPA 4AQYB 1QFYA 3HXKA 4LISA 4OA5A 2P9GA 2VP5A 1HORA 4KYTA 2RAFA 1XXHB 4NG4A 2W0MA 3QMWA 4Y2XA 3SBDA 3UAOA 4AJJA 2KMLA 1ULUA 1GSAA 1B7GO 3PV0A 2YHUA 1H6CA 1YBFA 3PICA 4HNUA 3FPEA 3QXCA 4PAWA 3INGA 4KQFA 4X1YB 3R7BA 2OYSA 4DQLA 3W90A 2G9UA 2PK3A 2YIMA 2XWQA 3GFSA 5EQFA 4XOIA 4C7VA 1LPMA 4XCXA 1JWAB 3VSCA 2PS1A 2B83A 1DIHA 1K7EB 1A71A 1NW9B 1V1RA 4WGGA 1T5HX 3DXFA 1D2RA 3AVTA 1QOZA 3KWLA 2WD9A 5TQ2A 1DQRA 2A9JA 3OOWA 4EFMA 1SGWA 2ZIUB 2AGVA 2X7HA 5AKZA 5CDFA 3EVCA 3KZKA 5A9SA 1XCOA 3D2BA 4CL0A 2QN3A 2OZKA 4C5CA 4MK4A 2EV9A 1DPFA 2OCLA 3SKVA 3TJMA 3WYDA 3IQHX 3ODGA 1KMMA 2C58A 3F47A 1W1UA 3L4EA 4IDPA 4CIAA 1LQUA 1B8UA 2XQKA 5KOJA 3AF5A 3AEUA 5DRYA 1TDJA 3Q8XB 3AKZA 1JS1X 1M2VA 1QGYA 1M6VA 1MHTA 4PTZA 2YW2A 5T7BA 2XMRA 3DPIA 3GEPA 3L7DA 4Q7LA 3NTXA 4Q3EA 3WLKX 4AC9A 2CXPA 4XKJA 1GTG1 3F74A 4Y8VA 3CQ9A 5AHOA 2Q3LA 1RKVA 5FPHA 2HMUA 3DS8A 3LY5A 1TX4B 4NJMA 5DWVA 4V0QA 4J2TA 2ONJA 3D3JA 4QGAA 3JZFA 3TG8A 2WKWA 2ZRHA 3WMGA 2PJRA 1KMQA 3LXUX 1ZIYA 1ZHOA 1TJ3A 3WAKA 2YJZA 4I99A 4UMEA 1IBLB 4G5SA 4AY4A 1N7HA 2R8PA 3ZNNA 4ZOEA 4F3CA 4WQMA 1GZHB 4QUBA 4XQ9A 1PS9A 1QH8A 3DZ8A 2ZJ5A 5AW7A 1O6BA 4YEDA 3WGUA 4MITA 5BYJA 4KTVE 4MRSA 3TLYA 2RHRA 1YRQA 2VPQA 3DUFB 1PN3A 4KCGA 5HM6A 5JMWA 1U3UA 1Q74A 3LTEA 3DOFA 4LGMA 3I6QA 3USCS 4CE6A 4M1MA 2IE0A 5I3CA 5ICSA 5C34B 1RAEA 1U9YA 4Z6KA 3DAGA 4Q4JA 1T5BA 3PWTA 2X3YA 1N6OA 1Z4QA 3HI6A 2DWQA 2C9BA 2P8JA 4E2XA 3K0AA 2G7ZA 1NZJA 4UTNA 3B1JA 3B6IA 4X63A 8GPBA 3FZGA 1TCAA 3UN1A 5A3SA 4JP1A 2VPTA 1DPGA 2WDZA 5JH7B 3FZNA 1F48A 5A4KA 3EOAI 4JB0A 4QUGA 4WACA 3W3AD 3T9DA 5CB8A 3BERA 2PUTA 4Z4EA 1AG9A 4GF5A 4A36A 1C4XA 2AOTB 2JFNA 3T61A 2GXSA 3TXAA 1WR8A 4W5HA 4YRNA 1JU9A 1OF1A 1X7XA 2XA2A 3CURA 4HPXB 2CNDA 5KVQA 3RSQA 3PHCA 3VDMA 2V3VA 4D4MA 3RVMA 1OB5A 3RSCA 4KAXA 2ZYAA 5CT6A 1YC2A 1SRRA 5E2BA 5DTJA 2NU8A 3HRIA 3L8FA 1H2WA 2QMEA 1L4EA 2PJDA 3HCEA 2Y1WA 4IUBS 2IDMA 4XVHA 3T7RA 1IQUA 1GRCA 1T0PA 3HA5A 5JPIA 4AZWA 5K01A 1OYYA 5E6RA 5EPEA 3I45A 3K73O 1VCNA 2M6LA 1LCIA 1IBCA 4BNWA 1T36B 4HMPA 2I99A 1RRPA 5EIWA 5T8KC 1UDAA 2JI9A 5M5BA 3L1VA 5REQB 2YZ2A 1A4IA 2AWNA 1SKYB 2JGEA 4QXMA 3P0RA 1QS0A 3HN2A 1XNHA 1KYXA 1G20B 1FIUA 5A0TA 5I5GA 2YV1A 1H6BA 2ZLBA 4KXXA 4O2AB 1JFSA 3DVQX 3KQKA 3AJAA 1PL0A 3GEHA 2YWXA 5LBUA 2NVOA 1N0UA 4BE9A 1IHDA 3FCSB 2QT0A 1E7WA 3QKRA 2DETA 3SK0A 2HO5A 2PGDA 3G8BA 4R69A 5JAMA 3I01A 2J45A 2X0DA 4JOSA 1H5QA 4RZIA 1XAIA 1XQXA 3H1GA 2PBLA 4X44A 5EUBA 3R9KA 3ZCPA 1JHUA 5DHSA 3I2KA 4MX8A 3LVQE 4YB8A 4AO6A 4H1VA 2X4IA 4DLLA 1G7SA 3QH4A 5F1OA 4F72A 3DUWA 4NYJR 1T8YA 1GLGA 3DL7A 1U9JA 5KHAA 5AKLA 4FP9A 2V8OA 3HDJA 1EJ0A 1XRJA 3FFBA 2EGUA 2DFNA 4UXIA 1R3DA 5LJLA 1TMOA 1YTUA 3BZBA 3HGQA 3KQSA 2PD3A 2FRDA 2MJLA 1C30B 3V4VB 5TGZA 1PIWA 4KO1S 3HUEA 3TEJA 2FVYA 2J3QA 3BWVA 1WB5A 2D1RA 5JVDB 5I4CA 3W2EA 4KXVA 3EPPA 4R2LA 4EUKA 3TQOA 4IWXA 1OI3A 4PIPA 4UOQA 2J8ZA 2NU9A 1U3CA 4US0R 2PRZA 2AHOA 1AC5A 2FPLA 1VGVA 2QJWA 3FWKA 5I7RA 1TRKA 3HBLA 4KQHA 1LQ2A 4E7PA 3R6TA 1CQIA 1D2NA 4BBPA 5HP4A 4HH4A 5EP3A 4XUGB 4DBLC 1D04A 1XFDA 1P1JA 3QEMA 1DDIA 2WRZA 3EHEA 4BYGA 3ZDXB 2HV8A 4XQEA 1V5GA 3NOQA 1U80A 3ZWCA 2QP9X 5EE9A 2ZSHA 4FT2A 1HE3A 1HFJA 3P9PA 1WXHA 1ZOLA 3G9XA 4JT2A 1QE3A 5M29A 2QBYB 4FFDA 3TZBA 2QTTA 3E22A 3CEJA 721PA 4PX3A 1E9SA 4Z4CA 3QBDA 5COQA 4EI8A 1TQ6A 2FMHA 5A06A 3U19A 1V9CA 4KXMA 4ESOA 1XL0A 2JLBA 4CIYA 1O6GA 3KSMA 2AJLI 4BTEA 1OIVA 5UKDA 1W73A 3OMLA 2R00A 1KO1A 1YVEI 2EBHX 3CKYA 3D8SA 3P2EA 3F5QA 4Q93A 3LVBA 3GVPA 3UUGA 3VBCA 2H07A 1D8TA 3FSJX 2PYZA 4ZC8A 1E3IA 1X92A 4Y7CA 2MU1A 3S2ZA 2IIBA 1FP6A 2IYRA 2J6IA 1IVYA 1HRDA 5EKSA 3QELA 1CEXA 3GNSA 4ZAYA 1UAAA 2PLFA 3TL3A 4S0XA 4LKRA 2CLIB 1PJZA 2XT6A 3C14C 3TYXA 1J5XA 1W2GA 1VB3A 1M8FA 5JVDA 2JGNA 2AEEA 5CH5A 4BRUA 1Z2EA 2VYQA 5K8IA 2CV2A 2ZXUA 2NUTB 3NU1A 3AHFA 3OCCA 4UUBA 4MUYA 5LIPA 3F97A 3KJXA 1ZHHA 2XAUA 4RDHA 1DSSG 2JGKA 3EXEB 2R4UA 4HN9A 1T9KA 2FUCA 1YRYE 2ZI7A 3MZ0A 1DIBA 4INZA 4Y2RA 3B1XA 3ANXA 4GI7A 4HS9A 1AOXA 1AZWA 2XMPA 1WQ4A 3FPKA 4KKXB 2TYSB 2OG2A 4HDSA 3G2QA 4MXDA 4RVSA 3PFBA 4KMOA 5K3OA 1OLXB 3D43A 1X8JA 1PBTA 3FI0A 5EJGA 2BP7A 4YRAA 1AMUA 1RACA 2ID7A 4R3WA 3E18A 3H2BA 1QMPA 2BGMA 3HXPA 2ZITA 2QBYA 2EVWX 4I9FA 4D0GA 1ODTC 4MP6A 5DHQA 1J9EA 1COWD 5LZ2A 4TN5A 4WK6A 4QUHA 2GPJA 2GM4A 3WLAA 4FBLA 4ESEA 4GR5A 2AG6A 3M6XA 3MWFA 8ABPA 5LZ9A 1DBSA 1A88A 3IOCA 2G6TA 4F3NA 3B7WA 5ALNA 1E96A 2PKQO 4OGLA 4V03A 1NPTO 3W7VA 4RM3A 1KF0A 2FPXA 1Y3HA 4LTMA 2XEXA 3R3HA 4JHLA 4MUFA 5E3JA 5BY2A 4X41A 2I9PA 4X6XA 4HMQA 3F49S 4MYUA 4RD2A 5AM2A 4QYWA 1PV4A 3T3OA 4EW1A 4E51A 1DAFA 1NQAO 1AKRA 1ENPA 2IY8A 3WDLA 3MK31 2BBWA 3NV7A 2VAWA 1HFEL 4J1TA 3HYLA 5JSZA 2X3UA 4HSEA 4G0PA 3HLTA 1CUWA 4WZAE 5EIBC 1F4LA 1XJQA 2HPZA 3HN6A 3AZQA 4DNFA 2PUBA 4G09A 4P3YA 1YJ5A 5AW6A 4MMZB 2PGLA 3MWKA 3LLSA 3GR6A 4X20B 1RYYA 1PR4A 3D1LA 1M2OA 1J06A 2I4RA 3DZIA 3G9ZA 3BD6A 3ZWMA 5AI6A 1SVMA 4PN3A 3KHUA 4OHCA 4MJLA 2FZEA 1GUAA 3HKCB 3ZH2A 3KWFA 4LJAA 3IKLA 3ORHA 3B9RA 4KLAA 3QX3A 2OHJA 1GAXA 3C6XA 4IHAA 4EHKA 4EBBA 2F1JA 3ZD8A 2B37A 4R68A 2PX0A 3SVTA 1BW9A 2GYYA 1V5WA 4HK4A 4ZT3A 1YF3A 4QEKA 2NSDA 1RT9A 3RS3A 3N0RA 4EY3A 3BGWA 3GCZA 2PV0A 5IASA 1T9CA 2JJQA 4MAFA 3QNMA 1KI1A 1SQ5A 3N6XA 1KZHA 3GFVA 2FR0A 3D7LA 3MILA 2CK3D 4U7FA 4J91A 4UJ5A 3ROKA 3LYHA 1LA2A 1J33A 1ZH0A 2ZJ1A 3B48A 1FDTA 3H7AA 4JEHA 2CFRA 1V5IA 1GVNB 1UZMA 1P2FA 1WDLA 3EW7A 3O8QB 3BKXA 4K7JA 4OI4A 3W78A 4DDWA 3CZ9A 3NXSA 4RYLA 4DJTA 4ZDJA 1K3FA 4LHEA 3R8FA 4H35A 1CRQA 1YOBA 3N05A 5JNSA 4QRHA 2J6CA 1ZJYA 1KXJA 2ECPA 2RHBA 3BGSA 3HZOA 3QV2A 1M83A 1YJAA 2AX4A 3I23A 3UFBA 4YT8A 1VPWA 3LIIA 1J0AA 1N5LA 3LQ4A 5HK9A 3P2JA 1R4MA 4MW9A 4NCIA 2B1IA 1XI2A 4L0DA 1REQB 1IWPB 1HY3A 1NBMA 5KTRA 1W0JA 4MUBA 4F46A 1F9EA 3H9UA 3SXUB 4ZK6A 3N53A 5IT4A 4LDJA 4X6YA 4DYVA 1WD5A 4Q9LA 1ZIXA 2GRAA 1QYVA 4JYMA 2R00C 5EWJB 4Y1GA 1QX3A 4NBSA 2QW0X 1TRHA 3AR4A 4MQEA 4UZSA 1VLMA 4V02A 4DIUA 3GLHA 4NOKA 1O87A 4LSMA 4U4AA 2V4ZA 3ZNQA 1UEJA 3RKSA 4DIEA 1BFDA 4QL3A 4IF4A 3A32A 1XNQB 1PR2A 2WAMA 5F7JA 3LDFA 1H6DA 3R0JA 3LY7A 1HFWA 2AN9A 3OSUA 1UFVA 4MQFB 3ANSA 4BUZA 2J59A 4EATA 4F4FA 1NUSA 4AX4A 4G41A 4RABA 1CDOA 2QPOA 4U9UA 1I1NA 1UBEA 3N2EA 1WUYA 4QJBA 4LWZA 3ZQUA 2ZSUA 3AUXA 4DJAA 1ISJA 4ZYLA 1EDZA 3N8NA 4MV0A 4IJWA 5AM1A 1NLFA 1NUUA 1D09A 2ON6A 3G17A 4AKSA 2KSQA 3EZ9A 3H5LA 1YZFA 1GZ3A 3EVEA 2RJNA 4J4BA 1G5PA 2JIQA 4O5AA 5K8JB 3G49A 4RA9A 4XI9A 4KQJA 2G1JA 3L7IA 3I4FA 1HZJA 1KP2A 3I9OA 3GUYA 5B3JC 2AJ8A 4OKIA 5LMC