2FEOA

Mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
221
structure length
221
Chain Sequence
b'AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNMAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title Structural and functional consequences of single amino acid substitutions in the pyrimidine base binding pocket of Escherichia coli CMP kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,transferase
total genus 52
structure length 221
sequence length 221
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2feoA00
4A8JC 3CR7A 2G83A 1Z6TA 3HDTA 2AD5A 1E1RA 3L0IB 4R9UC 4D82A 3K0EA 2O8EB 1E2KA 5CIQA 3DMNA 3HU1A 5EXTA 1X8JA 1XU4A 4PHTA 4F91B 1VG9B 3W90A 4RD4A 3M6AA 1MO4A 3Q85A 1GNQA 5TXGA 4BZQA 4A0GA 1T0JB 3VTKA 1Q1EA 1GAJA 4Q1FA 1U8YA 4RD2A 1HEIA 4URWR 2OFOA 3NVAA 1LB1B 4OQFA 2WJYA 1D5CA 2ZITA 5E7MA 4R98A 3FHTA 1VIAA 2ZJ2A 2KBEA 3GJ5A 1G5TA 1XCMA 2GF9A 1S1CA 2OESA 1COWD 1E0SA 1CJTC 1N6RA 4KJZA 4IDHA 3JZMA 2XZOA 2WSSA 1MRNA 4Q7JB 2OAQ1 3QENA 3SN6A 2KWIA 2W6JA 1DG3A 4U5XA 1XTKA 2AHOA 2GEDA 2PJZA 1KZ7B 1Z8FA 5FPKA 1DAHA 5JJIA 1A7JA 4CGZA 5K8UA 5EUMA 3QBTA 1Q0UA 1RYFA 1G21E 4Q47A 4YC7A 3FE2A 3NWJA 4YMTA 5DN6A 5D3MA 1UEIA 3CF2A 1P73A 2REOA 2VF8A 2CHQA 2VP6A 3PITA 4A6XA 2HXYA 4ZO4A 1OYYA 1KI6A 1ZRHA 1US8A 4L9WA 3ZS8A 2VPPA 1Z29A 3BWDD 3RANA 1G8PA 4GZMA 4PSAA 3RSOA 4KYUA 4MYCA 3EC1A 1N2CE 5L8VA 3T06B 4Q7MB 2VHTA 1TEXA 4KCGA 4EQ6A 2CLCX 3LX8A 4P4SB 2AL7A 4IDPA 3FPAA 2J9RA 2QN6A 1OJLA 2OXRA 2CBZA 4DDTA 3H2YA 2FZ4A 4WZ6A 1SZPA 2R6FA 4NYJQ 3X1XA 4Q9KA 4K81B 1GZSA 5FR1A 5BXQC 1HT1E 1YR9A 2ZS8A 4NBSA 1XXHB 3KZ1E 4JKIA 2A30A 2A7QA 2MSCB 5AUPB 5JEDA 3CH5A 1I4DD 2I3BA 2VSOA 3CNOA 1VIYA 1KOFA 2RKOA 4IEEA 3DPUA 4MRPA 4RD6A 1SVWA 2GXAA 2N42A 1YRAA 4I1VA 2CMKA 5CK5A 3I61A 3I8SA 3N2EA 3PUVA 3DOFA 3W3ZB 4A92A 1C4OA 1OFTA 2XJ4A 1SXJA 2WZQA 4M21A 2QUZA 4XVRA 2R2AA 3AF1A 4BGDA 2J0SA 3K0SA 4HEJA 4ASUA 3RAPR 2VTKA 2FPMA 3OEHD 5KHOC 5DYIA 2J59A 4AKGA 4RFVA 4Q1EA 1WP9A 1J2JA 1RW4A 1IXSB 4GRAA 1UDXA 1VCIA 1E2DA 3GJ8A 4IDNA 4D0NA 5CDFE 2IHYA 4TSFD 4KYIB 5TV2A 2RGBA 1X1SA 4W9MC 2WAXA 4AYTA 1LS6A 3WNCA 1UBGA 5J4KA 5FUXA 4JBXA 4US1R 3U3RA 2VYFA 4PPFA 1KAOA 2QU8A 2OSBA 2AFHE 1FOEB 2ODWA 3CBQA 1WE2A 1WRBA 4KFTA 5C18A 2DWOA 1ESNA 3KKOA 3I72A 2BIFA 2CNWD 1OF1A 4OHWA 2QT0A 3B1YA 3QF4A 4O25A 2D74A 4DUGA 2QM8A 2A5YB 2QTFA 3Q5EA 1H65A 2GVDC 4M53A 4CEHB 1XJQA 2QL6A 1GL6A 4B73A 1II8A 4JT4A 1W0JD 3TSWA 1FX0A 4GPTA 2MSDB 3OFND 4LJ6A 2AX4A 1JJVA 1UBEA 4RD0A 3HYTA 6Q21A 2QTHA 4LJ7A 3B9PA 2A2ZA 2JAQA 1KNQA 4DC9A 2VHCA 1K8RA 5D3MB 4BLRA 4I4LA 1UDWA 3OIUA 5H70A 3U61B 4MUBA 2F6RA 4PQRA 1AKEA 3B13B 1KI6B 3QVUA 2JLYA 1QHSA 2JLUA 1S4QA 1M7GA 2JLQA 1KO7A 4O0MA 2XJ9A 1D6JA 1ZW6A 3H1TA 4G5OA 1BMFA 2FA9A 2YOHA 4AURA 821PA 1NG9A 2OO7A 2VEDA 4B3DA 3THYA 2TMKA 4LJAA 3SI7A 1Z2AA 1ZNWA 1HUQA 1AN0A 3CF6R 4PO9A 4QBGB 1F5NA 1YJ5A 2IBMA 4BFUA 2WMOB 4W7SA 1E9DA 1ZM9A 3BORA 3KFXA 3KFVA 4EFLA 1RJ9B 2WWGA 1N6LA 2PMDA 3CRVA 4KO8A 1CR1A 4MYHA 3J81k 1E96A 2GHIA 4GP7A 2ZRNA 1T0HB 4MYUA 1GKIA 5E7JA 5EE5B 3UMSA 1G8GA 4DEXA 2XEXA 2JJ2A 3QI2A 3TMKA 2W0SA 3TQFA 2QMOA 5FOSA 4F92B 5FI1B 2MSEB 2HJVA 4WIAA 3EA0A 3W8NA 2ZJYA 1NIJA 5JBQA 2J46A 3SHWA 3GJ7A 3U44B 2XX3A 3UMRA 1TADA 4XSGA 1DBSA 2RGDA 4IOMA 2ONJA 2OCYC 3THOA 2VIIA 1GNPA 1TMKA 1O3YA 1NMYA 3CO5A 2WTUA 2IS4A 3IEVA 2WAYA 1FZQA 3KTAA 2AFIE 2CE7A 2WWWA 2L0XA 3CPEA 2CCGA 2OFWA 3TUIC 2QNRA 1OKKA 4YDSA 1PVOA 2B7CA 2K5UA 5TDHA 4Q4HB 3GLFA 1OE0A 4CW7A 1M34E 1T91A 4AG5A 3RRZA 4BZXA 3F8TA 1P61B 2C04A 5BW8A 3X1YA 2Z4SA 1FUUA 2ZU0C 3ZGXA 5DLQC 2CXXA 5A0FA 1RC8A 4V0ME 4B43A 3VNVA 1R5NA 1KMQA 1KI7A 4NE2A 5CLQA 4B2LA 2ATVA 5CLLA 3R20A 4W5WA 2CCKA 1K5GA 4EJSA 3MFYA 1PV4A 1IN7A 4YMUA 2YINC 2ZANA 2GDJA 3M1IA 4NCNA 2H16A 4M4SA 2BMJA 3A58B 3RABA 2XZLA 1FTSA 1HE8B 3Q3JB 1XEXA 3TNFA 3W5IA 2NO6A 3I5YA 1EWQA 4CT4B 1AK2A 4M1KA 5G3YA 4MYTA 1DAIA 4D4JA 5JWOA 2E1RA 3BS4A 4M1YA 4BLTA 3HJNA 1ZYUA 2GEUA 2DR3A 2J41A 2ODBA 2OHFA 3O8RA 1NN3A 4L5BA 4WOPA 3VMFA 2ZI3A 4I81A 1CLUA 1N6NA 4D4KA 1NKTA 2D06A 2I4IA 3THXB 2QPTA 5IK2A 5GJCA 2QAGB 3MWJA 1Q1ZA 1YZQA 2ODEA 3CWQA 3QOFA 2WIBA 2RHDA 3ZD7A 1FP7A 1OSNA 3KQNA 1XMVA 2WHXA 2ZJ8A 4KLNA 2PEZA 1TQ4A 1EFTA 1XTIA 1N5IA 2B21A 4ZI3A 3MJHA 2FJUA 3SFZA 3RS4A 5LPNA 1E2HA 2VF7A 4PO8A 1T5IA 3BB3A 2Z43A 3RS5A 4D4MA 2CK3D 1S3GA 2KSQA 2BBTA 4B33A 8OHMA 4Z1MA 2QRZA 3EC2A 4PAOA 3RS3A 1JAIA 2JDID 3B1WA 5DI9A 1W36B 2PZFA 2VP0A 1NVWQ 2VQSA 5CK4A 3SYLA 3WHKA 2GCNA 2NPIA 4WW0A 3WMGA 2V7QA 5JZVA 5GVRA 2QORA 4RKFA 5L3SB 5J47A 3W6OA 2C77A 2AWOA 2ZU6A 1W4RA 1AIPA 4POAA 3VR2A 1MH1A 1G7SA 2WJHA 4HI0E 2Q0HA 3GLHE 1KK3A 1HY3A 2IEYA 3LDAA 4PHGA 3QKSB 2V3CC 2HYIC 2AN9A 3VKWA 4LJ9A 5KSOA 1P62B 1Q12A 1TUIA 1Q1BA 1E94E 4PQYA 2VHJA 1MABB 1P2SA 2D4HA 4BE7B 3A4MA 2HYDA 4FIDA 4DDVA 1J8YF 2V9PA 4HUQA 2V1UA 1NVUQ 3KJEA 2OV2A 4LJ8A 4TLDA 1E1QD 3FMPB 3I32A 5DE3A 3HYRA 1SKQA 2PZEA 5FPTA 2GK7A 3PVSA 4MDFA 1GG2A 2ZR9A 2AXPA 2CL0X 2IC5A 3AKCA 3W6PA 1Z08A 1OPXA 2OILA 1GITA 4FWIB 3VX3A 3LLUA 1E2PA 2A78A 2OLKA 3FOZA 4NPHA 2NG1A 2B8WA 4ACBA 4DIEA 3QXHA 5KNDA 1WMSA 5IT5A 4O2LA 4QL3A 4D81A 4G5SA 1OIXA 4ZPXA 5FTLA 1A5TA 4AD8A 5EE3A 2O52A 2FEOA 2GNOA 2QTVB 4LBVA 1Z28A 4Q7KA 2BEJA 1YZLA 2ZUDA 2FH5B 3AKEA 3SBEA 4MA4A 3OHMA 3MMPA 4NYIQ 3R7WA 4MKHA 1G8FA 2NZJA 2YKGA 3ND9A 3OESA 1E69A 1S1MA 1E2NA 5JSZA 2JJ1A 5FBLB 4RKEA 4AWXA 3OEEA 5L3QA 221PA 2VRWA 3RYTC 1N6HA 2CJWB 4H9GA 2AXNA 1DARA 2ZETA 4M9SA 3X1WA 4Q1DA 1FMJA 2JCSA 2ZRKA 4NL4H 4BLOA 2SHKA 4DLVA 4TMKA 4EPYA 1TTTA 1XFAA 1XB2A 2OUKA 2W2VA 1OIWA 3CRQA 3QNUA 1QVRA 3KXKA 4EKDA 4TTQA 3X2SA 5GJBA 3RS0A 5HE9A 1GTVA 1EFHA 4Q66C 4V0OA 1ZC3A 5P21A 1YE8A 3T5DA 1EK0A 1NIPA 1G3MA 2EFGA 1UKZA 3U3JA 4Q00A 2GJ9A 3L2OB 3GJ0A 2GZAA 4NHOA 1OXTA 2V8OA 3EAQA 3I3SR 3IDQA 5FL7A 1XF9A 4YXWA 1LS1A 2EYQA 3FWYA 1U98A 3KB2A 4LHVA 5IHPA 1KDTA 4WXPA 2FG5A 4U7DA 3L8YA 4C0SA 1S9DA 2XOKA 1ZD8A 4UKDA 3AP3A 2F1RA 2ZYWX 3NG1A 4OQLA 4C0QC 3UPUA 2J0UB 2O0HA 3CLVA 1ZNYA 4A82A 5KOYA 1GWNA 3K0FB 4EPXA 3Q8XB 4I1OA 2VO1A 3K9NA 4Q4JB 4WAUA 4M22A 4FW9A 3MWKA 3EWSA 1TL7C 2GZDA 2IYZA 1CJKC 5E95A 3REFA 1FTNA 1KAGA 3B7GA 4XVQA 3ZJYA 5AJVB 4X8MA 2WICA 3NH9A 2WIAA 4D6PA 2QG6A 3CRRA 4Q03A 1NVVQ 4F93B 3KJIA 1R8QA 2AK3A 3KKQA 1CR0A 3PEVA 2JEOA 1E2LA 1F2TB 4TMTA 3TW8B 2C5LA 1LTQA 3EZFA 3ZYCA 4XWOA 4H1VA 1BH2A 3LV8A 4QRHA 3KQKA 1ZM4A 2W58A 5HE8A 2YWHA 3EARA 4QXAA 1IJEA 3WBKA 4OQNA 5ELXA 4BPBA 3GD7A 5JRJA 3U3MA 3AGQA 1XJCA 1KI4A 2G88A 2D2EA 4UXHA 1TQ6A 3SJCA 4GOJA 2JLWA 4JVMA 3GLGB 1XNJA 2IYYA 4G5RA 3BERA 5G40A 1A2KC 1CEEA 4QFMA 3EWAA 3BC1A 3UANA 4MRSA 3DHWC 4TYQA 1XTSA 4ZDJA 1YZUA 4TN1A 1KI2A 3N5CA 3IIMA 2CHGA 2R44A 4M1MA 3C14C 3BH0A 3GJ6A 3NKVA 2FX3A 5EP2A 3UKDA 2D7CA 3SS8A 3QE0A 1GM5A 2KBFA 1CIPA 2DBYA 2UKDA 1P60A 2QPAA 1FQJA 2D2FA 5FPSA 5KO2A 5JFGA 1E0AA 4OI2A 3IPYA 3AVWA 3RS7A 3U4QB 4EUNA 3W34A 1IQPA 1E2QA 3KXLA 4C0JA 1G17A 1HQCA 4KI0A 1P2UA 1N25A 1DAKA 5JRZA 1XPUA 3SZRA 5E3HA 3UG7A 4YDHB 2B92A 1E9AA 4ABYA 2XSZA 4A0FA 4Z8XA 1FNNA 1G20E 4W5JA 2JJ8A 3RRMA 3VHXA 2NO0A 3P1JA 3K70B 3C8UA 4BFSA 3ZS9A 4URZR 2ZYTX 3FFAA 2ZJOA 3VNUA 1QHNA 2ZTSA 3IQWA 1E2GA 1XXHE 3TLXA 1XEWY 1GVNB 3KB1A 2R65A 2KI5A 4DCSA 3OE7A 1D9XA 2ZSBA 4RD3A 4TT3D 3VQTA 2A5GA 3MD0A 2JATA 3A4LA 1OV4A 4TQAA 2O0KA 1WBDA 4PAQA 3U6KA 1D2EA 2CCJA 3I62A 2Q9BA 5JCZA 2YC4C 1U8AA 1QG4A 2FOLA 5GVSA 5KNCA 3E2IA 5TVKA 4YMSA 1W4BA 5C2JB 4FXPA 2JGNA 4C3ZA 4RZXA 1D9ZA 1G3QA 2HCBA 2R62A 1T3LA 2BDTA 4Q9HA 1KYIA 4FD2A 1H8ED 1JEDA 5KSZA 1J70A 3FVQA 5AJYA 2ZXUA 1AS0A 2RB4A 2ZUBA 2AD1A 3KX2A 3BH7A 1VHTA 1CP2A 2Q21A 3SDZA 3RDPA 4DHEA 3AVYA 4BLSA 5HCIA 2QGZA 3NHBA 2KJQA 3SU8A 2P67A 3WP1B 4NU0A 2GTPA 1G3IA 4B3XA 1KMHA 5JI2E 4HAUA 1UJ2A 4LZZA 5FUYA 1ESMA 2F1JA 3N70A 2ZJ5A 4BFXA 4RFSA 1NN0A 3DMDA 3TJZA 4TLBA 4ESHA 4YMWA 1ZBDA 1EFRD 2EFEB 1OHHA 1N6KA 2FNAA 4LWZA 5BQ5A 4TL7A 4PX9A 1KO8A 2ZRFA 5FPHA 2UVQA 4YLGA 2XNDA 5E7IA 4UNPA 3SEAA 3X1ZA 2WJGA 4ARZA 4DSNA 5EE9A 3MWLA 1N6PA 2AKAB 2QZ4A 4DRZA 2DYKA 2C96A 2WKPA 2R6DA 4OK6A 2GCPA 2DWPA 5LB2A 4TLAA 4TYYA 3L0OA 2A5JA 2BBOA 2RMKA 3EZ7A 2O8BA 1TQDA 1KI3A 1LW7A 1X8LA 3Q72A 1LF0A 3K9GA 2C9YA 1UM8A 2IF2A 4C4PA 4LBWA 4M8NE 2ZVQX 4B32A 2PCLA 3ICEA 1KSFX 3BD9A 4A2QA 1GNRA 4JLKA 1XRJA 5DGXA 4GOXA 1K6MA 2YHSA 4LHXA 1SVOA 2DFNA 4HZUA 2OBMA 1AS2A 4F4IA 3PV0A 4G5QA 1TPZA 3K0AA 3OF5A 2LCFA 1XD2B 1PLLA 1NKSA 2ZRDA 2PJRA 4OI0A 3SE0A 1Q21A 2FGJA 1G5PA 3HPQA 3KKNA 3DEFA 3B60A 1AZTA 3EIEA 2P3SA 1YZKA 1Z22A 4EFMA 2NIPA 3A1VA 2ZREA 4YQFA 3SJZA 3O8BA 3KQLA 3KL4A 3CF0A 2VSXA 2DY1A 1NJGA 4C7OB 3NBFA 3VR5A 1MV5A 4QGHA 3TUJC 4TLCA 1NI3A 1OLOA 4CEIA 2PMKA 1ELOA 1IN5A 2PH1A 1QHHA 5FR2A 4ZCLA 3RRNA 3VU9A 1JEEA 1PUJA 3FFBA 2P6RA 4ZI2A 1VKJA 3IO3A 2P2LA 3FTQA 4Q4AB 5J40A 1E2EA 1XTQA 1W0KD 2IF0A 3BIFA 1OXVA 2YNMA 4P4UA 4L16A 3HPRA 4OK3A 2WKQA 1Z06A 1T5LA 4B35A 4K46A 2XZPA 1ETUA 3TR0A 1T3SA 4DCVA 3Q7QA 5C4GB 4BFYA 1N0UA 2NMVA 1N5KA 2AR7A 2BHRA 2ZRAA 2Z6VA 4LC0A 1IHUA 3QPWA 2EWVA 3VR1A 1JR3D 2MMGA 3IIKA 3BOSA 3CR8A 2NGRA 2O8FA 2QRNA 2QBYB 1JR6A 3RS2A 3W8RA 4FMCF 4V02A 1RE0A 3DOEA 1I4LD 1KJWA 4DLZA 2BM0A 4WBSA 4IDQA 5GJWC 1X3SA 3AF2A 2OBNA 2QMUA 1XCGB 2ZRPA 5CM9C 1TNDA 4OJQA 4KAXA 1N6IA 3GFTA 5F98A 5KSYA 1JI0A 1RVDA 3OEHA 2ZE8A 1R0WA 5DH9A 1A1VA 1W48A 1ZD9A 4JL5A 5JECA 1KDRA 2YZ2A 1G7RA 3F5FA 3LAWA 4B34A 3U3KA 2O8BB 5J4VA 4GMDA 1NP6A 1CS4C 3PENA 1QHYA 4HAVA 4NCJA 5DSZA 3RVBA 5F3WB 1TU4A 1Z6XA 4TSFA 5F9FA 4GNKA 2IX3A 1IY0A 2Q3FA 2WSMA 3LH5A 2ANCA 1EG7A 5FTNA 3SR0A 4CEJA 4JMPA 4KVGA 1BYUA 2CNWA 2BWJA 3CWZA 4DIDA 3SQWA 5A4JA 2CL6X 2H57A 4B3CA 2ONKA 3EZ2A 3QXSA 4LHZA 4ZCMA 4Q02A 2OLJA 4KLZA 1MO5A 4XD7D 1W0JA 1E9CA 4JVLA 3LBIA 3OFNA 1L4UA 4PHHA 5CM8B 1VCOA 4YMVA 4KHZA 4M0LA 3B1ZA 4C0LA 1UKVY 4L9SA 1KTVA 4R2IA 1TQ2A 1GP2A 4HDQB 3K09C 2F43A 1CBUA 3P32A 3GMTA 1A2BA 4OI4A 2WJIA 5AUNB 2XXAA 2UZ3A 2ZRJA 1US8B 4BUJA 3RNLA 4DCUA 1KNXA 2B8TA 3EA5A 4XJXA 1NSFA 2X1VA 2PBRA 3AVPA 3QXJA 4P0TA 1J8MF 4LHYA 5EXPA 2IEZA 1R8SA 5B58C 5C1BA 1FL9A 1II9A 1QHGA 1DE0A 4EQ6B 2QE7D 3DDCA 3U2QA 3QJYA 3W5JA 1XMJA 3DZ8A 2GXSA 3KUDA 5SZIA 4NP6A 2IYTA 3ECCA 4B6FA 4R2HA 3PUXA 1E99A 4US0R 3FHOA 5HKKD 2JA1A 3GFOA 5CDFA 3V4RA 1T3HA 2FPKA 2Z0MA 3FDIA 4JSYA 3AUYA 3CPJB 4UJ5A 2VLIA 4NYMQ 4L15A 3MJRA 4P33A 4HZIA 2H18A 4Q1BA 2J7KA 1FW6A 2G3YA 4P3YA 4PC6A 4P31A 2G1KA 1RRGA 3RWMB 3PFIA 1AJEA 1BS1A 1SXJB 3AQ4A 2BBWA 4BZPA 1A4RA 3DO6A 1EGAA 2OEPA 1JNYA 2GESA 2ZRIA 4D2IA 3I4LA 1AQYA 2IYSA 3MGCA 1G41A 3AF4A 4PPNA 3NH6A 1CJMA 1XZPA 4QGGA 1JXMA 3ETLA 4C0KA 2G77B 3C5CA 3K0CA 1UF9A 1XEWX 2ATXA 5A5GA 3GLIE 3OAAD 4DLYA 4I99A 4OL0A 4ZIRA 1WXQA 4GOKA 1W36D 3FB4A 5EZ6B 4JZKA 4LV8B 3B6EA 1QVAA 3WRYC 5JJLA 4ZV4A 1KJZA 2IXGA 2Q9AA 3EXAA 4IOKA 1G6OA 1W5TA 4QHTA 1U0LA 4FMDB 3HU3A 2XGJA 4OHYA 4C2TA 3QF4B 3ZIAD 4DJTA 2BVNA 4EFNA 3TRFA 5J4YA 4GI7A 4DCNA 1YR6A 2DWQA 4OQXA 2WJJA 4JJKA 4NYJR 4TMZA 4DLRA 4URUR 3MLEA 1C1YA 1II8B 3BB1A 3CX7A 5AJZA 3UXMA 1BYIA 1FX0B 1Z2CA 4X8LA 4DVGA 3A1UA 3FKQA 2NOAA 3HR7A 2GBLC 1PZNA 3HP1A 2F43B 2CL7X 4QGFA 3CKLA 5KDLA 1SVLA 1VPLA 2J45A 4OYHA 2R8RA 1XPOA 1E79D 4PZYA 3R8CA 1OH5A 4MRVA 1Z0FA 2OZEA 4HB2A 4BEBA 4URXR 3G0HA 1XX6A 2GCOA 5D3QA 5B30A 4TYPA 5FTKA 5HZKA 1FUKA 5SZJA 3WYGA 1CU1A 3I92A 3THYB 5H8WA 2A5DA 2ZIAA 3B5JA 4FMCB 3WYFA 2AKYA 4B6EA 2CLDX 3CPHA 2F55A 4FMBB 2ZSFA 5DO9A 1ZD1A 1CRQA 5JMTA 3EPLA 3PEYA 2ZRBA 4BFWA 4Q1AA 5B57C 3GLIA 2IS2A 2ZE6A 3OIWA 4OK5A 2GAOA 4M1WA 4LK2A 4Q9JA 4QHYA 1CJUC 2NPFA 1KZGB 3QIAA 2ZJAA 2HDNB 4XSHA 3OZXA 1G291 2QQ0A 1SQ5A 1NMXA 3EPHA 1Z6AA 4QBFA 5CYOA 1RYHA 2ZR0A 5KSPA 4ZKEA 2GAAA 3NBZC 4V0MA 2CK3A 3B82A 1WA5A 1SVIA 4LHWA 4V0LA 3LFUA 3ZQ6A 5M04A 2IWHA 2JDIA 4JLPA 4TLEA 4N0DA 2F7SA 3AKYA 5FOXA 2OE2A 5H68A 4UQOA 1XDBA 1P3JA 1PJRA 2QSZA 4MUAA 4A8JA 5B2ZA 3KTAB 4HDCA 1SGWA 1OIVA 2BV3A 3IKJA 3VR4A 4TQUS 3REGA 3AH8A 1AM4D 2IYLD 3X1DA 3QQ5A 2NQ2C 3OIVA 3GLFB 2O0JA 3MG9A 3GLGE 3IO5A 1KI8A 3ZVMA 1IN8A 4DT1A 1OXXK 5HZHA 4PSKA 1AQUA 1DAEA 1N0WA 5LD2B 1F2UA 4XH9B 1E1QA 1E98A 2IT1A 3B8HA 1WBBA 1DG1G 1X86B 2VHUA 2WWHA 4FCWA 4EJSB 1NY6A 4NMMA 2LKCA 1CR2A 5L3RA 4AG6A 2IYRA 2CLSA 1YZNA 2ZRLA 2XTZA 3PG5A 1OH6A 1UADA 3R9WA 2XB2A 1MO3A 4B3BA 1RIFA 3S1AA 1Z63A 3FMOB 4G01B 4DEYA 2OBLA 4A1FA 2FFAA 1XEXB 1IY2A 1MOZA 2IA5A 3HU2A 3DVLA 1XMSA 1M8PA 4LYHA 3SJAA 4AY2A 2O8DA 4QBIA 3KQUA 3ONWA 4ACAA 3SYKA 1TX4B 3IEUA 3ZZ0A 4C9BA 3T1QA 1C9KA 1W7AA 1G3RA 3FHCB 4DXAA 3NXSA 2W2XA 4IVQA 2REBA 4Z8YA 2EVWX 1Z47A 3N2IA 3W6NA 2A5FA 1JALA 4Q7LA 2HF8A 5JI3E 4FCVA 3BH6A 4Z51A 2IUTA 5DYGA 3H84A 4IJMA 1Q57A 3NDPA 3AF0A 3AP1A 2ZRGA 4QOSA 2P6NA 2R6CA 4PZZA 2W6ID 3GLHA 4LBZA 1D2MA 2IK8A 1P2TA 1IN6A 1ZNXA 2UZIR 1BKDR 2WPDD 2CEAA 1TF2A 2WBLC 1M1YE 1VYTA 4LYAA 4DSOA 1D8TA 2YOFA 4JJZA 1XD9A 4S35A 4E07A 1QHIA 3PCRB 4DB2A 4XWAA 4WVFA 2G0NA 2JLVA 2F1HA 1GOTA 3ND8A 3I5XA 1VMAA 3ZZUA 4KODA 3AVXA 2BKUA 3L43A 2WWYA 1EFCA 4TZ0A 4PPGA 3LXXA 3BFXA 3IQXA 3TUZC 1M2OB 1OB2A 3ZQJA 1L4YA 4F4JA 2A9KA 4WXRA 4JIMA 1G7TA 4A15A 2EU8A 1KJYA 5GJVC 3RSLA 1KK0A 5L3QB 3ADBA 1Y63A 2YVUA 2NO9A 3CNLA 2JIZD 1P7CA 4LGMA 2ORVA 2HLDD 5EP1A 4A8JB 3IIJA 2V6JA 3VR6A 1W2HA 5K8TA 2GRJA 4Y0VA 4HLUC 1UBCA 1I4TD 3I1FA 4JSTA 4AIIA 4EPTA 5BWMA 2W2TA 3CB4A 1UKEA 1XP8A 4PPQA 4ERNA 1GRNA 2MMCA 3D31A 3AB3A 1CR4A 1HV8A 2GETA 2QSYA 2RH5A 3KQHA 4F38A 1R7RA 4LV5B 1DEKA 2GXUA 1B0UA 3UMFA 1T6NA 4HUQB 5FBRB 1HH4A 2VP9A 1UFQA 4NZYA 3K70D 1VHLA 3PEWA 1M7BA 2IYVA 4IOLA 2G0TA 5KPDA 3U60B 4WA7A 2EFHB 3THWA 2IUSA 2ZAOA 4IVRA 1AS3A 4O3MA 1OW3B 3D8BA 2V6IA 3MUFA 1E9EA 1OFHA 1LVGA 1TEVA 4EPRA 2XITA 4M1TA 4HSEA 5IRCD 2X2EA 4G5GA 3FKSD 2X2FA 1A82A 4RJLA 5EP4A 2ZVPX 2VH5R 1NBME 3A1WA 3DM5A 1G9XA 4QJ5A 2ZM5A 1UAAA 1WCV1 1JBKA 2GJ8A 3T5GA 4LBYA 3QKRA 3WMFA 1U94A 1DPFA 3TQCA 1VYVA 1NN5A 4C0BA 4ZCIA 3MRSA 1ZUHA 3EW9A 2JLZA 2ZE7A 4Q9IA 4TL6A 2GVZC 2QAGC 3GP8A 4QBHA 5DI3A 5CYPA 3R7WB 3K09A 1ZINA 1E2JA 3D3QA 4RCZA 2J7PD 4B47A 4DDWA 4QKQA 4URVR 2FSIA 4GL2A 4AKHA 1ZUNB 3CRW1 1LF5A 4RY2A 1NRJB 3ZVLA 1VTKA 1I2DA 4BASA 3EX7C 2IYXA 4I1SA 1XWIA 4GFDA 4IXNA 3BAFA 5JSZB 4X8OA 3QSYA 5EQTA 1EX7A 5FBQB 1D2NA 3KKPA 5KTYA 4LJ5A 3EIQA 1R2QA 4PAMA 1P2VA 1N5LA 1FNMA 2FZLA 2HUPA 2ZAMA 1SHKA 1BIFA 4LY6A 2X77A 4U00A 2CE2X 1SKYB 1K5DA 1GFIA 1KSGA 3AF3A 5HCNA 1ZU5A 2FWRA 3KDSE 4HDOB 1W36C 4JL6A 5FBWB 1GKYA 2H5EA 2ZYVX 3A8TA 2IYQA 3WYAA 1HQYE 1SVMA 1P5ZB 2YJTD 1W1WA 4A4DA 3AP2A 1IXZA 1WDTA 1YQTA 3C4JA 4LOAA 2QP3A 4CT5A 2F1IA 4BFVA 5HPYB 4DKXA 5KPJA 3ZVRA 2ZRCA 3AVVA 2P6UA 2O8EA 1G1MA 521PA 1Q1QA 2ZEJA 2EQBA 3EZ6A 3P27A 4O2RA 4ITRC 5AR1A 1NBMD 5C4MA 1YKSA 2DFKB 1G19A 3T1TA 2PLRA 2OCBA 4OBEA 1S0UA 3K9HA 3BE4A 5FBVB 1UPTA 1DAGA 1Q3TA 3UK6A 2FN4A 1T9HA 1H8HD 3HR8A 3RLFA 1MKYA 3WY9A 4C0AC 1NY5A 4NYIR 3T1VA 4EJSC 5FTMA 4KV9A 2XB4A 4TT3A 2OCAA 1UBFA 1KSHA 3T34A 5L3VA 1VDZA 5EE0A 3V4FA 5FL3A 1YU9A 721PA 3NC1C 1YHNA 3BK7A 3D7MA 3C5HA 4IFEA 4OQMA 1M74A 5ANRB 4II7A 5AUQA 2P65A 3QUSA 1W47A 1G3UA 1S3SA 3RHFA 5AJXA 1CF4A 4JT2A 1R4AA 2GJKA 3IBYA 4PO1A 5KNBA 3BXZA 4EAQA 3MAAC 3EPKA 3PR1A 3ICQB 4IKEA 4GBMA 4RSGA 4ZDWA 1OH7A 4G1UC 1IXRC 1H8EA 3LBHA 2OXCA 1Z6GA 1ZIPA 2C98A 2ECKA 5CJ2A 5K8LA 2BJVA 3LY5A 4HUTA 4I1UA 1OXSC 4BRWA 3QY0A 1RRCA 3QKRB 3W9YA 4KU4A 4EPVA 3SYNA 2GEVA 5HR5A 3WNDA 1U9IC 3GEEA 4LC1A 1ZMXA 3SNHA 5EUQB 4XTRA 2GBLA 2FFHA 1QDEA 5JEEA 3AGPA 2DCUA 5KDDA 2QI9C 4QNMA 1AGPA 4R7ZA 4B3GA 1GL9B 1CJVC 1ODFA 3PJRA 3A1TA 1EFRA 4NKRA 4PZLA 4P4SA 1ZCBA 4CF7A 2WJVA 3TGPA 4MGKR 3B85A 2OCPA 1GSIA 3BGWA 4A2WA 2QGNA 1RFLA 3AM1A 2RGXA 4W5HA 3CUEF 1WF3A 4RVCA 1Z0DA 1XXHA 4IFBA 3AKDA 3LVQE 1Z07A 4GP6A 4QM7A 2Q3HA 2VA8A 1GL7A 3H4MA 2BCGY 3K1JA 1ZJ6A 3DKPA 1HA3A 5CB6A 1O87A 3E70C 2XNDD 1VG1A 3M4YA 4Z54A 1NVVR 1E2FA 3P20A 4PC7A 1II0A 1V5WA 1GKUB 1E1RD 2N1BA 1VECA 2EWWA 2G1JA 1JR3E 2HV8A 4E22A 2GILA 2XAUA 1COWA 1DELA 1KY3A 2H1LA 3I8XA 1G64A 2BM1A 3IHLA 3PXGA 4HB4A 3PIRA 5FOVA 4DLSA 1N3BA 1NN1A 2RGCA 3VAAA 5JWRA 1VCNA 2PLFA 3CM0A 2FGKA 5IDVA 1AKYA 1XPRA 3VKGA 1NL3A 4B76A 1JECA 4TYNA 5SZKB 4N3NA 2PCJA 1X1RA 1WQ1R 4EDHA 2GF0A 1S2MA 1ZUIA 2ZE5A 1DAMA 1GRQA 2WWFA 1N0VC 3RWOA 4FMDF 4MGYR 3BRWD 1F60A 1SXJE 2QENA 2WSSD 4UJ3A 4J0QA 2ERYA 2W6JD 3BFKA 4CEHA 2Z4RA 4JBYA 1ZM2A 2FEMA 1XBTA 3Q5DA 1IY1A 1QG2A 3LRPA 3GFPA 1KKLA 3WRXC 2F3RA 1DADA 1W49A 2B7BA 3SFVA 3U7EB 1W0KA 1XTJA 2J3EA 421PA 5DN6D 1SVKA 2PT7A 4XWKA 2RAPA 3TVTA 1BOFA 4DSUA 2RHMA 1JQJC 2IHBA 4KFRA 5JS8A 5FUVA 1CULC 4Q18A 1KMHB 4BECA 3B9QA 4FCTA 1YRBA 3OIYA 3VFDA 2RGNC 2GK6A 3ASZA 3ADKA 4MGZR 4NCIA 2FV8A 4FI3C 4TWZA 2HJGA 1G6HA 3QEOA 4RFSB 3KJHA 3TK1A 4B71A 2J0QA 1AGRA 4RD1A 4GZLA 3SC3A 1ZAKA 4XVUA 1HYQA 1JR3A 2G9NA 1NNEA 3LWNA 1R5BA 3I73A 2CVFA 3H0KA 4MITA 1E4VA 1EXMA 1QBKC 3TBKA 4JLDA 3DM9B 3QF7A 4ARZB 3DKVA 2WWXA 1DVRA 1RJ9A 3UWOA 1ZVQA 2BJWA 3GJ4A 4CZ2A 4DWJA 2DB3A 1XTRA 1FPMA 2GZHA 4JVSB 3PUYA 1Z83A 4BWYA 4A6PA 3IPXA 5KUTA 4LX0A 2H8KA 3NBXX 1OXUA 4HLDA 3AUXA 3P4YA 4Q4LA 4UNQA 4HLCA 1XD8A 2RGAA 3IILA 3PUWA 4UNSA 1JPJA 1E9BA 2R9VA 3B78A 4A0RA 1SXJD 4E5UA 3K70C 3U44A 3P26A 4ASUD 4Q9LA 3CIOA 5FTJA 5KU1A 2KE5A 5FFMA 3T35A 4LRWA 2E87A 4E09A 3LQRA 1G4AE 5BYKA 4F4CA 4HZUB 3F0TA 1JJ7A 4KBGA 1TUEA 4JS0A 5G53C 1HTWA 4RCYA 2P5TB 2IS1A 3K0AB 1RZ3A 1KK2A 4FINA 2JASA 4Q4HA 2GWHA 1GDDA 3CH4B 4FN5A 4XD7A 4HLUA 1F3OA 3NEJA 4QJ3A 3BB4A 3LLMA 3JVVA 4B48A 5CIWA 1T4GA 5C46F 2GJSA 2OFXA 4GT1A 3IUYA 3ZLJA 1EFUA 4DUGD 2VP5A 3CZQA 4DLUA 4NCKA 4TTPA 5G3ZA 3MWYW 3SJBA 1Q20A 4JLAA 3E1SA 4CEIB 3QXXA 1ZP6A 4PHFA 1W2GA 1QHHB 2QQEA 2WV9A 3VU9B 2O8CA 4QG7A 4EIWA 4LYJA 4JYBA 4Q1CA 2QE7A 1S96A 1CKEA 4U02A 1FFHA 2ZI6A 5JCPA 4MQBA 2PL3A 2JLSA 4UNRA 3GLFE 1LNZA 2V4ZA 3KUCA 2D7DA 4R71A 2HXSA 1G8YA 1JXOA 5AJWA 1CRPA 1PLJA 1ZC4A 2JLXA 1J99A 3EZ9A 5HKKA 5LB4A 5EXXA 4BLQA 1BMFD 2HEIA 2P5SA 3VR3A 4A2PA 3C7KA 4ON9A 1P9WA 4OHZA 3THXA 2ZI7A 1TF5A 3T1OA 2O8FB 4HAYA 2QAGA 1P9RA 4L8GA 3TVDA 1R0YA 4MH0R 4KSCA 2IUUA 3MSXA 1UEJA 5J4LA 5F2EA 5CITA 2C9CA 2WOJA 5FPYA 3B2EA 4KFUA 2ZJZA 3FGNA 4LYFA 4OKSA 4PANA 5BN4A 3U7HB 3H86A 1Z3IX 1KK1A 3AEZA 1N6OA 3SHFA 4RZ3A 4D4LA 1I2MA 4PSVA 1W4AA 2JJ2D 3GPLA 1YZGA 4QJ4A 2BMFA 4ESVA 1NJFA 5AWFC 2CHVA 3OAAA 4JLBA 2LWIA 1JAHA 4DDUA 2FU5C 2VP2A 3T61A 4B2IA 1Z6YA 1SHZA 3ZZTA 1E9FA 1DAFA 5K8IA 1KHTA 4CEJB 1FP6A 5L3SA 4WZBE 3GEIA 4PC3A 3NHAA 1DOAA 2ZQ5A 4KBFA 4N1AA 3QKTA 2IWRA 1OKKD 1MO6A 1E6CA 3PEUA 3ZIAA 2V55B 4JYCA 3LXRA 3WXMA 4G0NA 2W00A 2ORWA 1FMLA 2VL7A 1YZTA 3VKHA 3TSOA 3QPUA 5JS7A 3LD9A 3QKSA 1SULA 3QG5A 4BFTA 1NG1A 1TU3A 1KO4A 5JHGB 2BMEA 2IXFA 2NZ8A 1W44A 5DHAA 1KGDA 1IM2A 1MABA 1VYUA 2OG2A 4Y0AA 2F3TA 4ZDIA 3FMFA 4P32A 2YWGA 3QKUA 2EFDB 4HB0A 4BRUA 4MDEA 4M2LA 2WMNB 3UWKA 1DO0A 2Q3MA 1DTSA 3LBNA 3BJIC 3RRYA 3BBPA 2XXAB 3DZDA 1E79A 1E4YA 3C16C 4V0KA 5EZ5A 2ZR7A 1IOZA 3CX6A 3F3YA 4LCBA 4QM6A 2YWEA 2HT6A 4XTCS 1S9HA 2O8CB 1G8HA 4JVNA 4B44A 4JLOA 4MKFA 4JL8A 2ZUCA 4D25A 2IXEA 5TB5A 1LV7A 4Q5IA 5FH9A 4NTZA 4AKIA 2R6GA 3U6BA 2J87A 2C03A 1W5SA 2JLRA 3AVOA 3PQCA 5TMPA 1EWRA 3GJ3A 3LVRE 4TTRA 2ZJBA 3DL0A 4Q19A 3QVVA 4MRNA 2CDNA 2ORIA 4A36A 3AVTA 2EW1A 4MGIR 4NH0A 2C8VA 4AK9A 4LJ4A 4URYR 5EXSA 3UIEA 5IK2D 1U9IA 1Z0IA 1KSJA 3CONA 3O8CA 1U0HC 1HE1C 3CW2A 4YONB 4TMVA 5TY0A 2PX3A 4Q21A 4JBWA 1G5RA 2CJWA 4BLPA 2FPLA 4QC2A 4KITB 3CNNA 1NLYA 4HLQB 1HURA 1KI9A 3WP0A 1IBRA 3A37A 2ANBA 3AV0B 2XTNA 3WNBA 4IW3B 2YYZA 2F9MA 2DFLA 1F48A 2X8AA 5CJPA 4JKYA 2FSHA 2A3RA 4TZ6A 1GIAA 2NTYC 2Z83A 4M9XA 4TMXA 4AI6A 4Z1MD 4ZIRB 4BFZA 2IS6A 2BC9A 4QGAA 4IEIA 1OYWA 2G6BA 3K9LA 4IVPA 4AYWA 4ZDKA 2H7VA 3A36A 3R9XA 3T15A 1QZXA 3BFVA 3QBVA 4Q01A 5AK0A 3TSZA 3UG6A 3R8FA 2V7QD 5SZHB 2Y8EA 2GJAA 3Q9LA 3V9PA 4E03A 2WVJA 4JLVA 2FFQA 3SBDA 2J1LA 4LJYA 1U8ZA 2QMEA 2XNSA 1J90A 3M0EA 2J0VA 5CB8A 2X19A 2D3WA 3QG1A 2REXB 1GILA 4LSGA 2BEKA 4CDGA 2PEYA 4DLTA 4DLXA 1KY2A 1G18A 4GSYA 1DS6A 2J0UA 3IHWA 4F7WA 4IRUB 1SKYE 3K0FA 2F9LA 1E3MA 2GXQA 4K8OA 5FUWA 4AKEA 1EX6A 1OT3A 2FSGA 3VHLB 4ZKDA 4Q4JA 4NYMR 3L8ZA 4C2UA 1J7KA 2VP4A 4MKGA 3E5HA 3GJXC 1HT2E 3ADCA 4D26A 2VBCA 2QAJA 4A0HA 2QMHA 4IDOA 2IL1A 4OI1A 4KSBA 2Q6TA 4MKIA 5J4HA 1G16A 2Z5FA 4H1UA 3LQQA 2ZPTX 1OB5A 1U81A 1X6VA 1WB9A 2QA5A 4LV6A 5DNYB 2WM9B 2GCOB 4LUCA 1GUAA 2AK2A 4G3XA 3ZD6A 1F2TA 3P4XA 4NCHA 4TL9A 3A6PC 1N5JA 2N46A 1P4SA 2WKRA 5F9HA 2QY9A 3MCAA 1Y3AA 3L0SA 1ZCAA 1R10A 2BKEA 1BO6A 1XZQA 4DBLC 1MRSA 4AYXA 4M1SA 1W4CA 3GLIB 2WWIA 2BBSA 5LDDC 1NSTA 2W6IA 2D62A 2OAP1 3TE6A 1OFUX 2EYUA 2B6HA 2WPDA 4IHQA 1QHXA 4UXJA 3GLGA 1IJFA 1ANKA 5FI0B 4CRWB 2FDCA 4JLMA 5GADl 1SXJC 4MRRA 1AA9A 1DO2A 1W46A 3KKMA 2YC2C 2IYWA 4OHXA 4UNNA 2ZYUX 4XIGS 1SVSA 3AVUA 4HATA 1Z0KA 2RGNA 4HAZA 2JJ1D 1KIMA 4B3FX 1U99A 5H1YA 1CXZA 4EPWA 3OEED 3NDBB 3U5ZB 2CVHA 1XCPA 4PXAA 1R5OA 3UATA 4FWTA 2ERXA 3RC3A 4HAXA 4HB3A 2ZS7A 5JWHA 3G82C 5JHHB 5KYKA 1V43A 2V54A 5TARA 1P72A 1L2TA 1JPNA 3A1SA 3LA6A 2ZI5A 2W83A 2C78A 2JIZA 3SQXA 5FOUA 2HLDA 3WBJA 3U4QA 3CX8A 4TMWA 1E2MA 2C99A 3L82B 4B74A 5KDOA 3TAHA 2KB0A 3LNCA 1ZNZA 1RKBA 4S2EA 2ZSAA 4IOJA 1IAQA 2QM7A 2HCJB 2PZGA 3ASYA 4A9AA 1Q44A 5UKDA 3K53A 4DT1B 3NC0C 3GEHA 4KVAA 1U90A 3NEYA 1VCMA 1KO1A 4XOIA 5FL7D 2EFCB 3R9IA 4HAWA 4YXWD 1F2UB 2FMXA 5EJEA 2ZRMA 121PA 1RRFA 2BOVA 3V00A 1PLKA 1ZIOA 2XOKD 4RZ2A 2PT5A 1OH8A 1UKYA 2GA8A 2ZS9A 3C15C 2QPOA 1R6BX 3S1AB 4CIDA 1JQLB 4C30A 3FKSA 2I1QA 4NONA 4DSTA 1FQKA 3L0PA 1ZM3A 1M6NA 4LDJA 4PC2A 1G7CA 3EASA 1P6XA 2HF9A 1XMIA 3O47A 5EE1A 2IYUA 3Q7PA 1AZSC 2NO7A 1IN4A 2O8DB 3LX5A 2OM2A 4D0LB 1KDOA 3U7FB 2I1VB 1M7HA 4M9ZA 5E4FA 5JLJA 1NMZA 5DISB 5IF9A 2J7PA 4PQFA 2J5XA 5EP3A 3T12A 1OFIA 1G4UR 1NLZA 1ZM7A 2ZSEA 3FMIA 5BYJA 2H17A 1T8TA 2WOOA 3GQBA 2P0EA 3TKLA 1JB1A 3QEJA 2PX0A 1VG8A 1R0XA 3GLHB 3C41J 4BEJA 1Z0JA 3IBGA 2ODNA 2RGGA 4KXFB 4GMXA 4DZZA 5FOTA 4QHSA 4B2PA 2Q9CA 4B75A 1Z5ZA 2YV5A 4JLJA 1U2RA 3GCGA 2ASEA 2H92A 1E0JA 4N0EA 3TAUA 1RRPA 2VSFA 2ZSDA 1X8KA 3TR5A 3W3AA 4C0HA 4OJKA 1ONBA 4M9QA 4P4TA 2R6AA 4IXMA 1E0KA 3K0CC 3A4NA 1VG0B 2AWNA 4WZAE 3NBYC 1KKMA 2ZROA 4D0GA 621PA 1R0ZA 4RZUA 1S8FA 1IONA 1MR3F 1RPZA 3PUZA 2W0MA 3QXCA 1E9SA 2YWFA 1MT0A 2QP9X 1L8QA 1NBMA 3HWSA 1LFDB 4D80A 5BN3A 2FFBA 1E9RA 4CYMA 3TW4A 4M1OA 5G41A 3D6TB 5LD2C 4UXIA 4DB4A 1Z0AA 4PFSA 3LO5A 3U7GA 2XSZD 1H8HA 4BQSA 1XJ0A 1CTQA 3KXIA 3ZVNA 2DFTA 3K8YA 4X8HA 2C9OA 1QRAA 2ZRHA 3WMEA 1E2IA 2FF7A 2LKDA 1F6BA 2VHQA 1B23P 4TL8A 5FOWA 3VX4A 3EG5A 2DHRA 1E32A 5J5CA 1EESA 4LPSA 3EPJA 3THWB 1NLFA 2E9SA 2FSFA 1XD2A 4DCTA 2NO1A 3KJGA 1ZU4A 1Q3HA 2RGEA 3LW7A 2V1XA 2QT1A 4US2R 2ZI9A 3SOPA 3OE7D 4Q48A 5AUOB 4PC1A 5BN5A 3FYHA 1P75A 5DIFA 2C2HA 3B1VA 1T8UA 3JZAA 4GDFA 3B1XA 3G5UA 1PUIA 1TF7A 1GRRA 2FE4A 1YR8A 4LI0A 3JVUA 1U0JA 3WHLA 4ILEA 4C7OA 4JLNA 3U3OA 4KFSA 4TYWA 1KI1A 1NF3A 1L7VC 1QF9A 4NDZA 3NIBA 4PTLA 5DI3B 2IW3A 2OT3B 3TH5A 2HT1A 1XEFA 2C95A 3ADDA 3NTUA 4AC9A 4V0NA 4Q4AA 5JJKA 3TIFA 4PR0A 5HTKA 5LBIA 3AVQA 4V03A 2QROA 4DLWA 1KO5A 3CRMA 2BCJQ 3ZDQA 4HYYA 4LPKA 2BMDA 2DPXA 2XTMA 4L4UA 2QEQA 1Q22A 1YR7A 1LY1A 1TAGA 3O8DA 1P9NA 5DHFA 3IGFA 2ZI4A 1YVDA 2GKSA 3CZPA 4OHVA 4TQ9A 3LW8A 4QNRA 3QPVA 5B64A 1OHHD 3ZH9B 2QP4A 2O5VA 2YOGA 2QBYA 3RC8A 1NVXQ 2RCNA 1KDPA 4CVNA 3EIHA
chains in the Genus database with same CATH superfamily
4GLJA 2J3LA 3ZZMA 5CB4A 3HXOA 5FA5A 2G83A 1Z6TA 2KHZA 4XFJA 3L0IB 5DZSA 4R9UC 3T1HB 5ESRA 3UT5A 2BI8A 2QT9A 4JEHA 2B1RA 2XRFA 3IT0A 3VJKA 3KV3O 4MRMB 3DMNA 3JQ8A 4K87A 3UJDA 3HU1A 4I3HA 5EXTA 1XU4A 2EIHA 3HCEA 4PHTA 3HI6A 3VPHA 1W35A 3VZPA 5IPFA 1LCIA 2WFLA 5A6SB 4B7CA 4RJTA 4ALNA 1Z0ZA 2HQRA 4ALJA 1ZVVA 2OCKA 4OJMX 4Q3KA 3BXGA 3VTKA 2YJ5A 5I8WA 4OMDA 4UAJA 2XUFA 2JKYA 3HCOA 2JB9A 4RD2A 1HEIA 1E20A 3EYWA 3C3MA 4R16A 1LB1B 5DDIP 4HNQA 1XJ5A 2OGSA 2WJYA 2O2EA 2XF8A 4N4AA 4RULA 1NVEA 1TVEA 2O05A 1G5TA 3GFGA 2OESA 1DTEA 1H2XA 4Q0MA 4UHKA 4BCCA 4DPLA 4WL0A 5GQSA 1I80A 1KVSA 3TKYA 4Q7JB 2OAQ1 1KE2A 3S2UA 3VDQA 3F74A 1NZDA 3KZNA 4U5XA 4UHEA 1C3JA 4JCCA 4EJ6A 1PGJA 2JK1A 4ZJPA 4IZ6A 5BV7A 2GEDA 2GPBA 4FGJA 2WQ6A 3TQSA 2H5JA 3D8HA 4I9HA 1YDWA 3O7WA 4BB0A 1DAHA 2IEGA 2YHUA 1A98A 5JJIA 3IA2A 1ZGZA 3I0MA 3PC8A 2UUAB 3QBTA 5AXCA 1G21E 4Q47A 4Z3DA 3RIYA 1D8AA 2X0DA 4IIYA 2F3UA 3T3PB 4PG8A 4YMTA 5DN6A 2RHBA 2AJDA 5DGIA 2IGBA 3DE7X 2NSYA 5CR9A 3VH2A 3F67A 2JFXA 2CWDA 5DK4A 1BFUA 4A6XA 1OYYA 3Q8LA 5IJXA 1ECLA 2OSVA 3G59A 1US8A 3VR5D 3VGJA 1J21A 4WINA 3ZDFA 4F6RA 1J5EB 1G8PA 3IAUA 3V4OA 4GZMA 4WY5A 4H27A 3N75A 5JT1A 5L8VA 3DUFB 4Q7MB 2H6EA 4DADA 2SKEA 5TQ2B 1G20B 5CPBA 5ALUA 1GQYA 3NHYA 1OLXA 3FTFA 3TIXB 1ENZA 3OJLA 3ZJTA 3LX8A 2VPTA 4P4SB 4Q93A 1H85A 1XZGA 3A6KA 3WFJA 1H2HA 4OMUA 3PDCA 4UEJA 4EHIA 3DH0A 4WVLA 1ZSNA 2Q7DA 5HRUA 3I0NA 1OWNA 3U31A 4L50A 2J9GA 3W1EA 4H4CA 1QCZA 3ZIDA 4DIUA 1YR9A 2HCTA 1I51A 1EVQA 1J49A 1WPXA 1XXHB 4JKIA 4NBSA 2A30A 2MSCB 3D59A 4LOHA 3OPYA 3CH5A 1PR3A 4QRIA 1IWOA 5AUPB 5KJFA 3CNOA 4IEEA 2PNJA 1RYNA 3AX6A 3DPUA 4LMPA 2IIQA 5TGZA 2FUEA 3V6LA 4BNTA 5C81A 2GXAA 3I61A 2MWMA 3R6GA 4BO1A 3II6X 3N2EA 3U7HB 5H4HA 3PUVA 4HX5A 3DOIA 4QU5A 4DEVA 3W3ZB 5F23A 1TM4E 4PRYA 4AF6A 1SXJA 3KPJA 4X44A 1ECGA 3E9CA 5IXSA 1NBIA 4R2XA 1W9MA 2QTAA 2C5EA 2G1UA 1JEAA 2FPMA 2XXBA 3KTOA 3OEHD 5HK9A 1WXEA 4AKGA 4CKWA 1LA2A 1IE3A 4PRKA 4RFVA 4OA5A 4BP1A 1G6Q1 4F97A 5GOZA 3LJKA 5ENZA 4GRAA 1W52X 1VCIA 3TB4A 3ZWVA 3ANMA 4D8TA 3MGKA 3E8XA 2BSAA 1E2DA 1EDZA 1MJNA 2C4TA 2IKSA 2XZDA 3B6MA 3GJ8A 4IDNA 3T3GA 3UWPA 4D0NA 4N7RA 4KOEC 5CDFE 1OZ0A 3FSGA 1EZZA 2MIIA 1XZEA 3MJCA 1LS6A 3PXCX 4MUGA 4OD0A 1DQSA 1MTOA 2QZJA 4FOTA 5I7FA 4V0SA 2XQJA 2VYFA 2ZVJA 4PPFA 3S2SA 3AJDA 1JA1A 4LNAA 5BW5A 1WRBA 1ZHHA 2HTEA 4FUTA 2XBLA 1R5JA 4OTZA 3RVMA 1D4FA 3FM9A 4XLLA 1I2ZA 3SDSA 2VTBA 2CNWD 4KRGA 1Y6GA 1OF1A 1XQYA 1W9HA 1RXUA 2D74A 3QVGB 4DUGA 2QTFA 5A1TA 2W4MA 2A6PA 2NM0A 2ZUUA 4UHJA 2GVDC 4M53A 1UBLS 1IXKA 1XJQA 3UW1A 4X63A 2QL6A 5AKIA 1UAGA 1II8A 3VHQA 2WRZA 4DMLA 1UZNA 1Z9BA 5DP1A 3TSWA 3GHHA 4GPTA 4C4SA 2AN3A 4PG5A 1ISGA 1UBEA 4HS4A 2I80A 2VNKA 4FYVA 3KBOA 2J9ZB 5SYMA 3MM4A 2A2ZA 4DC9A 1KNQA 3OCCA 3FPLA 4HAIA 3ABIA 3ROTA 5CH5A 2DHEA 3EHDA 1UDWA 1NWCA 3OIUA 4WBNF 4FNMA 4MUBA 3LBAA 1BGVA 3A9RA 4CDNA 1V4BA 3PD1A 1Z8NA 4JR0A 5GM1A 4BO6A 3PIIA 3B13B 3H19A 5KX5F 4O2AF 3QVUA 1M1XB 4LQDA 3CHYA 4O0MA 2GBGA 2XJ9A 1D6JA 3H1TA 3KJNA 5LOVB 2JH8A 4QU8A 5IC6A 5CCDA 3BHJA 1VPWA 4JBGA 821PA 3LC1O 4QEDA 3RC7A 5BSTA 4U6NA 1RQ7A 3COJA 2FSUA 2QUBA 2YXDA 1QTQA 4FHEA 5TT0A 3RUIA 4YUYA 2AZXA 3EIFA 1J2EA 3ND7A 5GONB 1V41E 4QBGB 5ES4B 1LI7A 1VFNA 3AYXB 4LYGA 4TV8F 1A0OA 2BI7A 3KFVA 2R1UA 2WWGA 3DD1A 1N6LA 2PMDA 2HR1A 3OQBA 4RTRA 1E96A 2FDXA 4B6OA 3HVJA 4LJKA 4XUEA 4WOKA 2ZRNA 4KE7A 3BVPA 4OG2A 3OCXA 4MYUA 1QFZA 2PKQP 2NXWA 2NYAA 2MSKA 3K96A 4DTCA 3TR6A 2P4EA 3UMSA 4YP9A 1GPDG 2XEXA 1AV6A 2IHTA 4P6VF 4UAVA 3TMKA 4F9FA 1DBIA 4IKPA 3DAFA 3MOIA 2XMDA 5JE8A 3U4GA 4BNUA 4D0SA 1S8AA 2EF0A 2WYOA 5F1YA 3W8NA 2B3DA 1UOPA 4WJLA 2ZWPA 2JLCA 3RRJA 1JMYA 1JYFA 3GJ7A 3SHWA 3TD2A 4DR2B 2EGUA 3U44B 4XSGA 4CE6A 1DBSA 2JI7A 2P40A 2OCGA 4IOMA 3FBWA 2OYRA 3THOA 2VIIA 1IDN1 1XKXA 3M6FA 1GNPA 2EHJA 1O3YA 5E3JA 4CPDA 3ILHA 4ND7A 1KZHA 2P9EA 1NR5A 3DXYA 2D5IA 1FZQA 4NCXA 3KTAA 2AFIE 1GJRA 4LW8A 4ZTBA 3TUIC 2WB2A 5KYYA 4BMVA 3QVTA 2FWIA 2CNLA 2GKGA 1PVOA 2CDRA 2K5UA 1I2AA 3F2IA 3MIIA 1PJ8A 1YDFA 5HILA 2WQZA 3REOA 3ZTTA 4BZXA 3LBYA 3F8TA 1DC7A 4H77A 2IZ6A 1JHAA 2O3TA 3AI1A 3JAKB 4X3OA 2C04A 2JF0A 2AUTA 2Z4SA 1FUUA 3AHHA 3OMXA 3ZGXA 1RZRA 2Z9DA 2FTKE 3GZNB 3Q3IA 3Q0EA 4V0ME 5BMVA 1KMQA 1KI7A 2Q3DA 4CQLB 1MD9A 4B2LA 3W05A 1WXIA 4TKLA 4CV3A 1XO1A 2CCKA 3OOHA 3RVNA 5ISMA 1BJTA 1IN7A 3PQ7A 4RLHA 1XQWA 2F3SA 1KFBB 2VATA 4J43A 4C4ZA 1MIOA 5K03A 1V9CA 3DWIA 2ZANA 2CNBA 1JWLA 2H16A 2BMJA 2REQA 1UXKA 2VBFA 2YWBA 4BWGA 2FMFA 3Q98A 1TB4A 2BFBA 3H11A 4RV9A 2XZLA 3QX8A 1K3FA 1PZGA 3BMOB 4ZOCA 1EX1A 3Q3JB 1XEXA 4UARA 1HFJA 2NO6A 1K3TA 3I5YA 1YI0A 2PRYA 3H5AA 1AK2A 1CUEA 4M1KA 1EWQA 3MRTA 4MYTA 2MTBA 4NBKA 2PZ8A 2Z30A 1DAIA 2ZWVA 3H8SA 4D4JA 1XG5A 5EMLA 3A6GA 4LMAA 5G02A 2X0EA 1R88A 1DKOA 3KEGA 3MK31 2OORA 4FYHA 4JP5A 4L5BA 3VMFA 4U7GA 2VXYA 5ICCA 4NEGA 4K6FA 1CLUA 1I6MA 2V7UA 2ALJA 1E1YA 1Y1PA 2X5NA 4D9JA 5CVCA 1LBTA 2HMWA 3B1KA 2A57A 3TW8A 3ZBPA 4D4KA 4HZGA 2D06A 2IE8A 4P35A 2QPTA 1YZ3A 3PDIB 2IYPA 4ZAVA 5KOJB 4RTJA 3C98A 3FUCA 3MYYA 1WW3A 4UE2A 3DOJA 4K9OA 2W43A 2WIBA 5WRFA 4DA7A 3IT3A 1JFVA 4GC5A 1O5TA 2HA6A 2OR3A 3SQMA 2Z98A 1OSNA 3F6YA 4OY3A 3IAS6 1A8UA 5A05A 2WHXA 1KXZA 4FFWA 4JT8A 4PFKA 1UXIA 1LJUA 2PEZA 3BEOA 3JQ7A 1EFTA 2EF1A 3WICA 3JYLA 2B21A 2XDWA 3LWDA 3MJHA 3N39C 2PIAA 3RS4A 3AJ8A 2B37A 5LWQA 1RJEA 4PO8A 2DETA 1MDBA 1T5IA 4RDCA 2X0IA 1U5BB 2IDZA 5BSRA 4NNJA 2ZK7A 3MWFA 1S3GA 4RXTA 3VTZA 5B58T 4Z1MA 2A5LA 2IOYA 3RS3A 2Q5OA 1NFQA 3I01M 4ARBA 1P2BA 4D99A 2VQSA 1SCIA 3HP7A 3A3NA 3VO1A 2NPIA 5TMEA 3RH0A 1FP2A 1LV8A 4YLEA 3FSEA 3I0ZA 4NPCA 3UUWA 2Z58A 1MX9A 2YUTA 3RIHA 3R1IA 3PHJA 4FDMA 4CM7A 1JDZA 2AG5A 1X7GA 2C59A 4NOLA 2X9GA 4WKPA 2VTVA 3C85A 2HRBA 3O8LA 1G7SA 4HN9A 5AVYA 1F3LA 2GN1A 3A1FA 4FUQA 4HWSA 1EINA 3M6UA 1KK3A 2XWSA 3R6WA 1NF2A 3JQ9C 4PHGA 2HYIC 2E82A 3A9TA 4LJ9A 1QK5A 5LXTA 1Q1BA 2FZVA 4JAVC 1OXBB 2Q50A 2VHJA 4YQYA 1XALA 3D6UA 1GZ7A 3ZNOA 1DMRA 4Q9AA 4RA6A 1J1UA 1HMPA 4A03A 3I9V6 1TO2E 4LOLA 5A4DA 1VJTA 1E1QD 1EVYA 4UBOA 4OSPA 4UOQA 3U7IA 1Q19A 1L8OA 2DH5A 3DBOB 5FPTA 4DVJA 3UVEA 2ZR9A 4C1NA 1M67A 1A4UA 1SXPA 2YNMC 2IC5A 1RJFA 3BGOS 5C37A 4DJDC 1D5WA 4FWIB 1NJ8A 1WY7A 4MIOA 3VX3A 5C1IA 4EJ0A 2XRZA 2OLKA 1JPUA 1Y8QA 1Q2UA 4WKGA 1AY0A 3FOZA 2NG1A 3SGLA 3H87A 3O4JA 5JDCA 1WMSA 1W5AA 2Z6AA 1GCAA 5EJ6A 2GAIA 2J4DA 2JVJA 1I5EA 3PJFA 4ZPXA 5BSHA 5J2TB 3UOWA 1WTAA 1A5TA 5EI5A 5EWLB 3UTDA 1BQEA 3UK2A 1O6CA 2Z1MA 3DB1A 2O52A 3BCHA 4B8ZA 4NENB 4M8KA 1Z28A 3W2FA 1SKBA 1Y3IA 2WLSA 3T38A 2CV2A 3V4LA 3RFVA 4MA4A 3OHMA 1VCHA 2ZIEA 1ZMBA 1XDWA 3G88A 3HLKA 4MV5A 1GXSB 3O75A 1SRRA 3ZXUB 2ZCVA 3BREA 3UB4A 5C3UA 4WZBB 1E2NA 4PN7A 1IFXA 1J9EA 2JJ1A 5FBLB 1BCRA 1X38A 4IMIB 5HFAA 4H9GA 2CJPA 1RAAA 5D5HA 1RXYA 4GEGA 2XWPA 3X1WA 4Q1DA 2JCSA 2Q3EA 4DLVA 3ANTA 1QIHA 3TPFA 1HMYA 1T5HX 3HJGA 2CF6A 3O4VA 4I50B 4QUGA 5HFJA 4D9IA 1CJBA 3CRQA 4RYDA 1QVRA 1ZJ5A 2XT6A 2COUA 3FPSA 3IELA 4J3FA 4NMLA 1U0RA 3RS0A 5A4KA 4V0OA 2VDWA 4DG8A 1Y80A 3FX2A 5P21A 3S6JA 2ADMA 2D1FA 2GBIA 3KOMA 1EK0A 3FETA 4REOA 4C6SA 1JTVA 2EFGA 3E2MA 3HB4X 3A6HA 5EGNA 5AM2A 4BNDA 4OFBA 1KPHA 2NTEA 4N6NA 2BFCA 1Z2PX 1TYCA 4BBZA 3GJ0A 4E1AA 1M10A 2UYHA 4TTVA 1I2BA 2GZAA 1BD4A 4NHOA 1EHIA 1C3OA 1L5YA 1AXGA 3EAQA 3I3SR 3IDQA 3M82A 2GBFA 3O2SB 5JISA 2R0QC 4EUSA 3ER6A 5A4IS 3OF3A 3VR6D 2G9ZA 4YXWA 2EYQA 1Z45A 1KDTA 3JRXA 4WXPA 1E1CB 2DXIA 5K20A 2B36A 1ZITA 1TCCA 4UKDA 1YWGO 2F1RA 5FTWA 3DXFA 3NG1A 1GAXA 2LP4Y 1Z5WA 2O0HA 4IAOA 4YBRA 1JYSA 2ECOA 1C9YA 2D2VA 1PSDA 3IBTA 2CLIB 1FJGB 2PUGA 5KAPA 2GUWA 3Q8XB 1FMCA 1VP3A 3DXXA 3K9NA 4MVJM 3LPDA 1E3IA 2BEWA 4N3AA 2EX0A 3FR7A 2C3MA 5G0TA 3V4PB 3ZJ4A 3JARB 1M2HA 2X5OA 1QP8A 4FW9A 1CUSA 1NXTA 2QRPA 5AT1A 3V1YA 4PYJA 4KQHA 4P3OA 1AUOA 1EA7A 1FDOA 2GZDA 2H07A 4UQLA 1LK7A 1QJ4A 2H4XA 3I23A 2H2GA 4XVQA 4E51A 5ADVA 1FU7A 4UC0A 5CT9A 5AJVB 3NH9A 4D6PA 2JFVA 1PIWA 4BQRA 2QG6A 4R6XA 1DXQA 1NVVQ 3CZRA 1SKAA 4MTCA 1RIIA 4GMKA 1BG6A 3KKQA 3TL3A 1P18A 1G5IA 2BF7A 2QUKA 1X1BA 4M9UA 4B9EA 4TKVA 1Y5NA 3OPMA 4YMLA 3FUXA 2I66A 5TQ0B 3TW8B 5TQVA 4XWOA 4CKCA 3K6KA 2FJ0A 4GC9A 2GPJA 4QRHA 3TD6A 2XW6A 3HNPA 3USZA 5DNAA 1IJEA 5K3FB 4W5TA 4HWOA 5JRJA 1KVTA 4YUAA 3QYJA 4RL4A 2G88A 4ZCRA 3LY8A 4UXHA 3OU7A 3N2GA 1J2RA 3LNTA 3SS9X 3VH3A 5LSAA 5E6SA 1N8TA 1HE3A 2OQ2A 3H16A 2PRIA 3WLHA 3Q2OA 1XNJA 5E9QA 2NSLA 4M37A 3WWCA 5FO0A 3EWAA 4TYMA 3DHWC 1EHCA 3DAGA 1N2SA 3MHPA 1KI2A 3VYRB 3IIMA 4BLUA 3NVDA 1AX9A 4J1TC 3O2JA 3FOWA 4MCAA 1GTRA 1S02A 3BCRA 1K88A 4QDOA 1W5BA 3RKUA 5EP2A 4UATA 1YZVA 1QE3A 1FDUA 2HQSA 2Q28A 1KYZA 3GC6A 3HVUA 2BGIA 3BE5A 3QE0A 3EH2A 4QO7A 4C1BA 1CIPA 2DBYA 1EG2A 2UKDA 4KW7A 3U7QB 4RK4A 5AKXA 5JCJA 2HU7A 3U1VA 5KO2A 5JFGA 4JEUA 4E88A 4FB5A 3A26A 2XLCA 3U4QB 1SCUA 2WHEA 3W34A 1BKYA 2IZ1A 1XL0A 3X1JA 1A9YA 1ILWA 2RHGB 1YRYE 3PE6A 4HNUA 1G17A 2YL2A 3PKZA 4KLCA 4MEBA 1WSBA 3RUCA 3E03A 1XPJA 2UUOA 1N25A 1DAKA 2C7OA 1QLJA 1X80B 5F3RA 1U9ZA 3RB8A 3UG7A 5E3HA 2QRGA 2VAXA 3FOCA 3LUFA 1Q7EA 1O96B 3RQSA 4DCCA 1WKVA 2B92A 4GI3A 3F96A 1QOQB 5EFOA 2CJYA 2RD2A 4Z8XA 1FNNA 1PS0A 3DL4A 1L4FA 3T1YB 1GCUA 1X19A 3M4NA 3NJRA 3RRMA 3GMDA 1OCEA 5F51A 3VHXA 1F8UA 4ALIA 2SICE 4NQZA 3U4AA 4E6EA 3BILA 3PRHA 3E4CA 5AI9A 5F5LA 3ZS9A 4BFSA 3PL1A 5DOVA 4QQ8A 4MB2A 4YR7A 4ALMA 4J76A 4YTEA 5HKLA 4N01A 1QHNA 1J0XO 3CWCA 1Q5PA 3D8NA 3WDSA 3ZGLA 5B4VA 4HAOA 1CRWG 1E2GA 1PR9A 3KB1A 4LK3A 5EY5B 3WGTA 1GZ6A 2XOXA 4O4IB 4BNVA 2EJUA 2UZ1B 1M1YB 1A4XA 3ELYA 2ZSBA 4DCSA 4RD3A 1JT9A 3BSFA 3EDOA 3F6SA 4X6LA 2JATA 5HDBB 3REQA 3JSAA 4HGYA 2I9PA 3T7AA 4EHDA 2DRIA 2GPSA 3U6KA 3CRNA 2YC4C 4MUJA 2AG6A 4AB1A 1QG4A 5I51A 2NU7A 3ESDA 3GEGA 4RHEA 3TNYA 4C7BA 2R6R1 3HXTA 4J49A 5HIIA 4MLCA 3ZDBA 2JGNA 3ZEAA 2JCGA 1MUUA 1TVMA 1D9ZA 1G3QA 3IC5A 3WHIA 2R62A 4KNYA 4FC6A 3S70A 3JZIA 4YJ2F 5BSKA 4HJXA 1JEDA 2CSUA 1V7QA 3MMSA 5AJYA 2AD1A 1BWSA 2PSJA 3ZWDA 5BWBA 3BH7A 4DHEA 1CP2A 3RDPA 1GGHA 2PXAA 3WIDA 4Z2AA 3AVYA 2B0CA 4OBWA 3SU8A 5CFNA 1UDCA 2HDHA 4H18A 5EJIA 1VZ3A 3SZ3A 4NU0A 2GEKA 2VBIA 4YJFA 1CS0B 4LDQA 4EG0A 3OCZA 5TJ9A 2W2QA 4AQDA 5FUYA 4C4YA 5L6LB 4I6GA 3M5PA 2ZJ5A 4MHSA 4ESOA 2PO5A 4RFSA 1UR5A 5LQUA 3EDYA 2GZ3A 1SXHA 4A5SA 4FZJA 4C21A 3D1VA 3FI9A 1SH7A 4N82A 3DONA 4LWZA 5BQ5A 1I33A 1R0CA 3N28A 4TL7A 4NF2A 4PX9A 2JZOA 3H18A 2C31A 1YZFA 2UVQA 3EDRA 4RAOA 5BRNA 4QSMA 2XNDA 1X70A 1AU9A 4UNPA 3UNXA 2C7BA 1QZUA 1UPUA 1CP3A 2PGOA 4DSNA 5EE9A 4RWZA 2DWCA 2WLTA 4QX6A 3U0BA 3MTAA 4B0PA 3A27A 1WKBA 4XFDA 4D7AA 4CIBA 4HMOA 2OK8A 1N6PA 2AKAB 2QZ4A 4U0JA 4YNBA 4CLXA 1TGYA 3VV3A 3ZWYA 1GCGA 4IJVA 1WAMA 1EKXA 1JW9B 2AJ8A 3NTVA 3R2JA 4DRZA 3WA6A 3R4VA 4NECA 3ST7A 1O08A 3JZFA 5LB2A 3ZK9A 1E3EA 2DJIA 1HLGA 4Q3NA 2RGYA 2A5JA 2RMKA 1P4AA 3EZ7A 4LWOA 4OP1A 4YP7A 3GB9A 3UC9A 1NUSA 3Q72A 1FK8A 1L3CA 2XMSA 4IQGA 1ZW1A 2B99A 2NQ8A 1YAHA 4JX9A 1T15A 2IF2A 4G4SP 4LECA 3IP1A 4S04A 1UQRA 1LPOA 2WVGA 4N3GA 1GNRA 1UXJA 1XRJA 3AUFA 4LRTB 4OA8A 4Z86A 4F72A 4ZMRA 1AQNA 2YHSA 3MT0A 3CR3C 3LY9A 2K6GA 4MVJI 3B70A 4Y6OA 3JAWB 5A2GA 4G56A 5CCXA 1RM5A 4UBKA 1AG9A 1YZHA 1AS2A 4F4IA 3HC7A 1E0DA 4MAMA 4KO3S 3G13A 3ZDEA 1LDBA 2J4CA 3OF5A 1VL8A 1CYDA 1XFDA 3K1AA 4Y3UA 4BX9A 1NKSA 3EXHA 3N8HA 2PH7A 1Z4KA 4PNZA 1JLKA 1G5PA 1LSSA 1NQAO 5BNWA 3KKNA 3EFOA 4EECA 5IMSA 4BS9A 2ORYA 3MTGA 3D6JA 3EIEA 1YZKA 1Z22A 2EGGA 2OZVA 2ZREA 1WUTA 2A7XA 4LDAA 3O8BA 1JIIA 2WD7B 3CF0A 2VSXA 3OC0A 4TROA 2YHAA 3L6CA 3GOQA 3NBFA 5DNUA 3HV0A 2ZYIA 4HNRA 4W8HA 3M6WA 3TUJC 1YMUA 2H1HA 1KQ3A 1NOIA 3EIOA 2PMKA 4ZCLA 1QRSA 5IG2A 4FDTA 1XAJA 2P6RA 4MB6A 4MQ6A 1Q11A 3GGGA 2WTBA 4ZODA 1VKJA 4ZI2A 3WWEA 1E77A 4QREA 1APBA 2BN4A 4IILA 1CHNA 4HADA 3WLTA 3WYBA 5ICMA 4Q3DA 4P4UA 5CXQA 4L16A 3ZN2A 1LLDA 1HNXB 3F5QA 3LF1A 4OOFA 4U8HA 4A0SA 1IEVA 3L9XA 3AERA 4PRZA 4JH0A 4WASA 1FNSA 2NACA 1X15A 4JI3B 3TR0A 2CFSA 3GA7A 1PK9A 3MF4A 4DCVA 3Q7QA 3QV2A 3QTLA 3T7RA 1T35A 3QUQA 4C4XA 2AR7A 4EA8A 1R3UA 4ZAYA 4BOYA 1RCTE 3QRWA 2AOUA 3DT6A 3K5WA 2FRVA 1MBZA 2BM8A 1ZOLA 1Y3FE 4DILA 3WAKA 5KYXB 3HYCA 1JEYA 3BOSA 2NVUA 2XIQA 4FFLA 3GUHA 4XWYA 1IHYA 2CMFA 3BAZA 2VNHA 2O8FA 1EAYA 4MQ5A 3F2VA 4LVUA 3PTAA 4QWWA 2G5CA 3W8RA 5PGMA 1LLUA 3NX4A 4V02A 2G28A 1SUDA 1XCBA 3A70A 5D86A 2BM0A 4DLZA 3BL6A 1HKUA 2AQIA 2CFRA 2DECA 1T13A 2OB2A 2VJNA 3FLMA 3FYUC 1TCBA 3JR7A 5GJWC 3UN1A 5IT4A 1BZYA 1GQSA 1UFKA 2ZRPA 1X42A 1TNDA 4OJQA 4OYYA 5CM9C 5K3CA 4ED9A 1N6IA 2P9GA 5K6TA 5F98A 1RVDA 1X0VA 4L5AA 2PNFA 2ZE8A 1NW9B 3BE8A 5DH9A 1H0RA 1A1VA 2E18A 3COSA 1LSOA 1KDRA 1G21A 3HMKA 1ECFA 3LAWA 2Q2WA 1Q1GA 4FZRA 3SIPA 3U3KA 3X0DA 3OT4A 3CVWA 3LUAA 4YAWA 4JUBA 4BGEA 3LT4A 4UTRA 5EFZA 1AKWA 3PENA 1LPPA 4CG3A 3UM9A 1JJBA 1L5OA 4KLAA 4NCJA 2AEMA 1TU4A 4G67A 4GM1A 4NK4A 4KDEA 1Y1QA 1L5VA 2IX3A 2WSMA 2VEOA 3NAZA 4FFPA 4KTVE 5FTNA 1F38A 2YDXA 3P2EA 3RYHB 3UA3A 3JRNA 1U63A 1KEZA 1XLTC 1UANA 2MT9A 3L8MA 4ENUA 4MA5A 3ZUGA 2BWJA 5M5BA 1EQAA 1WMBA 3IV6A 4OQ4A 4OB7A 3OPXA 3C45A 3IP6A 2CL6X 2YY5A 4IM7A 1M73E 2UAGA 4LZWA 1R8XA 3QXSA 1MX3A 4LHZA 4KE8A 3LC2O 4Q02A 2RHJA 2ZT7A 3OSUA 2O6LA 1UIRA 4YV2A 2IYAA 1Z2DA 3BL8A 3AFHA 1VHDA 2D1SA 3K20A 3OFNA 4WADA 1ZXXA 3CLKA 4ZEXA 5SV2A 3I30X 3WLNA 2I4TA 3I5MA 3JCZA 4DQDA 4M0LA 3U40A 4X94A 4YMVA 2PQ6A 1UKVY 1KTVA 1PT9A 2W6MA 3C97A 3E5RA 3IBFA 4AT1A 2V6FA 3K09C 4E4TA 1E7YA 2B1GA 3ZWCA 3PKIA 1HX7A 4TLMB 2XXAA 2GZ1A 5AUNB 1EFVA 2UZ3A 4JU9A 4KKVA 3LTNC 1FFEA 4BUJA 4DCUA 3EA5A 2ACVA 4C7XA 1USUA 3C43A 2X1VA 2JI8A 5EXPA 1J8MF 4RK6A 2AQHA 4IIDA 5B58C 2V45A 2HHCA 1L4BA 3FR8A 2XVZA 1II9A 1SU7A 3DE1X 3FRJA 2ZZKA 3OX2A 2SCUB 3SMQA 4A10A 3AW8A 4B8WA 4EQ6B 5IU6A 3DDCA 3OLWA 3QJYA 4Q4CA 1ZX1A 2OAEA 4Z4QA 2ACWA 2QTBA 4EFKA 1UBJS 2YIJA 3H7IA 3KUDA 1U7XA 3Q87B 4MQMA 1XVUA 5F1OA 3SE7A 4X97A 1C29B 1GTZA 4D3FA 4L0MA 4B6FA 4YRIA 4HWGA 4FD3A 3VNSA 1U2DA 3F4LA 1E99A 2BZ1A 4GPD1 4HOYA 2JA1A 5EMHA 5CDFA 3ZCSA 4FHGA 4I4TB 5JTTA 1CVLA 1N2ZA 3AUYA 4QUBA 3CPJB 2AOUB 4RF2A 4RHUA 2C4VA 4UJ5A 1B2RA 1J0DA 2R96A 4YJGA 3J81A 4IH9A 4IUBS 1L5WA 3L0BA 3KUXA 1EJ6A 2IH5A 3ZDDA 3NNDA 4P3YA 4PC6A 1ECPA 3RWMB 2AZMA 2OC4A 3K32A 4XCVA 5T4BA 4V38A 1GPAA 3AQ4A 3U1TA 4BZPA 1RLTA 1OA0A 5EHZA 1GPKA 1ZOIA 2J5KA 4JJAA 2FK8A 2HLNA 1JF8A 1VPDA 2UV8A 4WLNA 2B35A 3KAKA 3O2QB 2BTQB 5KTPA 2PYIA 3WLLA 3MGCA 3ERCA 3FF1A 4PPNA 1H4TA 3NH6A 1CJMA 1KAHA 2H2FA 2MHCA 1XZPA 3I05A 4ND8B 4QGGA 5CEEA 1ONSA 4R2KA 3C5CA 3KS9A 1PR4A 1K27A 4DLYA 1SAYA 1YS2X 2CXTA 4S1OA 1WXQA 2DFDA 1YOBA 2CEKA 4YV1A 3KVNA 4TRJA 1V9LA 5IJ0B 2FY8A 1TM7E 4MPDA 4JZKA 5HTOA 4LV8B 5FWYA 3OZ7A 1U0BB 5DHRA 5JJLA 1GHTA 4ZV4A 1KJZA 5IAGA 2BKXA 4X90A 2PGXA 4QHTA 2FKNA 1KIAA 1U0LA 4FPXA 1AZLA 4K8RB 2G0AA 4E5YA 3STYA 3O3CA 4FKZA 4C2TA 4DJTA 3GT4A 4MW9A 4E2WA 3DZBA 4GI7A 2RHRA 4R1OA 1YR6A 4YP0A 3QMMA 2J33A 2WJJA 4NYJR 4DLRA 1N57A 4OQZA 3V48A 2ATIA 3MLEA 4NBUA 5AJZA 1MAWA 2PBFA 1SC1A 1TLFA 3NJ8A 4NJEB 5B1HA 2XBUA 4Q1VA 4R9SA 4X8LA 4YH1A 4HGZA 3WIOA 4BKUA 5BXYA 3PGLA 2PJDA 3HKEA 2WMDA 3E82A 4KQ2A 5CVDA 1F0KA 3ETCA 1PG2A 4ME6A 1PZNA 3D2LA 3ETEA 3W77A 3HP1A 3RF6A 1DLIA 3WOVA 4BE4A 1ZRSA 2VZ0A 1SVLA 4OYHA 2A88A 2HAEA 2R8RA 3B53X 3EWNA 1ZK3A 5IJZA 1HDRA 1XPOA 3EUAA 2QTWB 3VPAA 2BFEA 4KQWA 4Y6RA 2JFPA 3GPDG 3QYFA 4INAA 1Z0FA 2OZEA 2ZUSA 4HB2A 4QE3A 3G0HA 1KH3A 4DA9A 2I22A 1LSJA 4NU8X 1CUXA 4M9RA 3AHFA 3V4SA 4BO8A 2GHTA 2FPUA 4PLYA 3R7NA 1I4WA 3E9YA 4H59A 4OSEA 3OX3A 4LTMA 3RU3A 5GTDA 4KZKA 3ZHRA 3LT0A 3DEJA 4II3A 4GE0A 4B6EA 1HM5A 3IUNA 1EGMB 2AFIA 1FVXA 4TV8A 4DPKA 1ZD1A 3RG8A 4IQFA 1IH8A 2FR8C 2ID4A 2QUJA 1YL7A 4Q1AA 3CG4A 2OO3A 4Z6KA 2OWEA 3OM0A 2FE1A 1VGVA 3UBTA 3ROPA 5EPEA 4QHYA 2X1LA 2EQAA 3P9XA 1RWBA 2HB6A 2ZB7A 4IX9A 1RAGA 3QIAA 4FR2A 3SYMA 2R00A 2ZDQA 4L2IA 2B98A 4QDTA 2D13A 3OZXA 3QMWA 2QQ0A 5EJ7A 4G1MB 5KTNA 3EPHA 3W7BA 3STXA 1QKKA 3QE9Y 3NBZC 1B8VA 1PYDA 3OT1A 4V0MA 4XSVA 2YY7A 5IN4A 1AHHA 1Z0UA 4E5SA 1WA5A 3GNQA 4GKJB 3ZQ6A 3LFUA 3DVAB 2P5UA 5M04A 1PZMA 3RYCA 3ET4A 1GN8A 4TLEA 1GGKA 2QJRA 2RJOA 5TS2A 3QZUA 3RYIA 3AKYA 3JQCA 1P1HA 2OO5C 3O4GA 2OE2A 2ZZNA 5C9ZA 1MAHA 1BS2A 1S2GA 2JH9A 1DFHA 4LOIA 4LVOA 4R7TA 5B2ZA 3R7SA 4LJRA 4HDCA 4EG4A 4DSZA 4L85A 3H3FA 3REGA 4DREA 1ZJ4A 3X1DA 2V5UA 4CI0B 5EPUA 1O1YA 2O0JA 1O2DA 1WU8A 1OTHA 4D79A 3MG9A 1CQIA 3GJSA 4MUEA 5IVKA 3LT2A 1TUBB 3IOCA 3Q2IA 3EEYA 3TRIA 4ZOLA 1EP1B 1YL5A 2G25A 2ARKA 2LXNA 2RHHA 3H4VA 3NIDB 3ZYZA 4PSKA 4B83A 3MGGA 2VPXA 3NORA 3O9ZA 2PKEA 3KSDO 1CUVA 1KERA 2Q0XA 2ZWOA 4OPMA 3B8HA 4UM5A 3UKJA 3WE7A 3SEFA 4QU0A 1NPYA 1CR2A 4UE3S 1OA1A 1D3AA 1EUDB 1XUOA 4B79A 4FQ5A 4RPJA 3OU6A 5FCDA 1OH6A 3SZOA 1PEDA 2XB2A 3D02A 2VAPA 1PD0A 5GWXA 4B3BA 3G9XA 2XCRB 3K5IA 3C3AA 1Z63A 4G01B 3AZPA 3LSYA 1C2TA 2NZUG 5COBA 1KFCB 1NURA 1IWBB 2OBLA 3GG9A 1C1DB 3F1LA 1GG5A 3FVRA 3G9QA 1D1TA 1EIWA 4OUDA 2PGAA 3KXDA 1WW2A 1PEKE 2MINB 3L79A 1H2YA 2ZUTA 4AY2A 3GRYA 3S55A 1RXIA 1OZFA 1PK8A 2E0IA 5DYTA 3WVNA 3KQUA 1TX4B 2UXBB 4C9BA 4HNAB 2BFEB 4K40A 3T1QA 3WOHA 2UVPA 4TXJA 5G4KB 1NLMA 2WE7A 2Z5LA 2Y1XA 3CUWA 1NSYA 2W2XA 2Y77A 2REBA 1MJGM 2BISA 1OI2A 3OQPA 3KUKA 3N2IA 1WF6A 2EERA 2Z5VA 3GMSA 1SQSA 4NFLA 1F14A 3BH6A 1CRZA 2IUTA 3KIPA 3H84A 1CJCA 4IJMA 3VC2A 3UAYA 4F84A 5EJ5A 2AQKA 4YRJA 2ZRGA 3RVQA 4ZEVA 5JNLA 1W2WB 1DRWA 4PZZA 1UKAA 2ZJ7A 2XCQA 4LBZA 5HNKA 1ZNXA 2WPDD 1DXYA 5JYBA 2UZIR 5IBCA 4LYAA 1WHSA 2YH2A 4F1WA 3ISTA 4U9HS 1QXSA 4AJ9A 1CF9A 4I9UA 4M0PA 3MRXA 1EUQA 3DNPA 2HWWA 1KEPA 1PT5A 2YJ6A 3I58A 3ND8A 1M5RA 1U1DA 1VMAA 1WB4A 2IJGX 4DLPA 2WWYA 4DA6A 4QNNA 1KQNA 4MV0A 1RP7A 3IQXA 4DG5A 1M2OB 3EVEA 3CLRC 1AKNA 2A9KA 4WXRA 1G7TA 4A15A 2BE7A 1LPMA 4JUDX 3RSLA 3SXUB 3GMIA 4ZYLA 3FZYA 3RVRA 4CR7A 4P5EA 1ND6A 1TVCA 2D5BA 4N9QA 4WN3A 3T95A 1PR5A 5C1DA 1C9EA 5EP1A 1U7PA 3CEMA 2Q8QA 1L4HA 1MRZA 1ADGA 5K8TA 1PAUA 1E8NA 1UBCA 4AW9A 2VLBA 4L08A 1N8KA 3NGLA 4JSTA 3CT6A 4I4NA 1OU0A 4JR2A 2ZSHA 2G72A 4EPTA 1I1OA 2O7RA 3N8GA 3IVMA 3BK1A 2IRWA 4TWAA 4E11A 1T6ZA 3P9PA 4UEQA 2MMCA 3D31A 2QTCA 3GV0A 1YSCA 1DTWB 3O94A 3ECSA 4UDOA 5KTTA 2QSYA 2GETA 3RUHA 4F38A 5DM1A 4LV5B 5BUCA 1DEKA 1YF3A 3L92A 5FBRB