2FEPA

Structure of truncated ccpa in complex with p-ser-hpr and sulfate ions
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
273
structure length
273
Chain Sequence
TTTVGVIIPDISSIFYSELARGIEDIATMYKYNIILSNSDQNMEKELHLLNTMLGKQVDGIVFMGGNITDEHVAEFKRSPVPIVLAASVEEQEETPSVAIDYEQAIYDAVKLLVDKGHTDIAFVSGPMAEPINRSKKLQGYKRALEEANLPFNEQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEMALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAVAMRLLTKLMNKEPVEEHIVELPHRIELRKSTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of B. subtilis CcpA effector binding site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Catabolite control protein A
total genus 96
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fepA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fepA02
1SXGA 3RVRA 5GOTA 5DLEA 4MQFA 4N0PA 3LUKA 1U0SY 1XHFA 1APBA 4ZPJA 3GA5A 2FN9A 1DBWA 2I6FA 1E6KA 3HDVA 3CNBA 1PEYA 2WB4A 4G0XA 5IBQA 3RVKA 3F6PA 2MSLA 1BDIA 1DC7A 4OG2A 3KTOA 4Z4EA 3MF4A 3SM9A 1ZY2A 4NCBA 4L4UA 1M5TA 2FSPA 3GRCA 3N0WA 5HSGA 4G0PA 2QVCA 4HNSA 3A0RB 3A10A 4ZMSA 1NTRA 1L5ZA 4EVRA 3LUHA 4RV5A 4F3TA 1FSPA 2IPMA 1D1PA 4RZSA 4EYQA 4ML3A 3SAJA 4XLTA 1C0EA 2IPLA 3DGEC 4IF4A 4XXHA 4D74A 1USIA 3RH0A 2FKAA 4DADA 4IRXA 4RDCA 4DN6A 1JL3A 3BRQA 5DKFA 3H1GA 1J56A 4KFCA 1DBQA 3IPCA 5ED4A 2LBPA 4YGXB 3QLUA 3N8IA 2MSKA 1LBIA 1YK0A 2PAFA 3NHZA 4WT7A 3T38A 2JVJA 3ROFA 2PE5A 3BBLA 1DCMA 3EAFA 3FMVA 3UKJA 3FFXA 3DGFC 4RY9A 1SXHA 5EWJA 3S99A 4YRZA 3QX9A 4S05A 2A9RA 4Z4GA 3N0XA 4JA2A 2B4AA 4RKRA 2IPAB 2LPMA 1DCKA 3LKVA 1M2EA 3A3KA 3EQ2A 1QNLA 5KQLA 1QP4A 4MR7A 2GX6A 3BRSA 1YS6A 3QX8A 4RWEA 3ROTA 3JVDA 2WJAA 2LIVA 1USGA 2MYTA 1YK1A 2QSJA 3RVQA 1NXXA 2AYXA 3H6HA 3CFYA 3RVNA 4Z9AA 4F11A 4W5QA 4GPAA 4H3HB 4TN5A 3HUUA 2HJ9A 3C3WA 3H75A 3KCNA 4UHJA 3EQZA 3HCWA 1Z16A 3SQNA 3I09A 1DCFA 3RVJA 1JHZA 4DQDA 2L19A 1BVHA 2JBAA 3RQIA 4LDAA 3DLBA 3KG2A 2WY2D 4FE4A 4MS4A 4GNRA 1P2FA 1Z25A 6ABPA 4LE2A 3LUCA 2HSGA 1Z15A 4P1ZA 3DLHA 1YTUA 4MQEB 4XARA 3CS3A 1QKKA 3EULA 5JNSA 1BDHA 2FLWA 4G0MA 2WMYA 3JY6A 1ISRA 4XASA 3D8UA 3FGZA 4IGAA 1JFTA 4MS4B 3OM0A 5T3YA 5KC8A 1DG9A 3E61A 4L85A 4NV3A 4YLEA 3F7NA 1K66A 4PZ0A 4RY8A 4KREA 1L5YA 2P9HA 4Z99A 4OBBA 3HO1A 3KLNA 1NXTA 1RXIA 2QXYA 4WZZA 3MQ4A 4Z0NA 3QEKA 1DBPA 3CKMA 1RNLA 4JASB 2O20A 3HSYA 2BGGA 3T95A 3HEBA 4N76A 5FWXA 1D4ZA 4QYWA 4MR9A 4YR7A 2VUIB 1JWLA 3LTEA 1FFGA 2JBAB 3VNAA 1B00A 1VRVA 2R25B 4PE5B 2FW0A 5CNIA 4QICA 1OXBB 2XDYA 3LKBA 1JF8A 4UHKA 2FVYA 5KQGA 5CHYA 4RXTA 2V0NA 4OLBA 2OQRA 3TX6A 1YIOA 4F8JA 1QMPA 1DRJA 1TM2A 4Q6BA 3O2QB 4O1HA 1Y1LA 3TD9A 4FB4A 5FBHA 3UUGA 3LUDA 1RZRA 4W5NA 1NXOA 4KV7A 4O1IA 1M2FA 2HPHA 3H6GA 1ZVVA 1EWTA 2QU7A 3RVLA 4Z4FA 1C4WA 4MR7B 5E3JA 2CHFA 2F8SA 5BQ3A 4XAQA 4H60A 1YS7A 2HQOA 5DGCA 3GBVA 1ZDMA 3M9WA 2N9UA 5EWMA 4RXMA 2FQYA 2JB9A 3O1HB 2FQXA 3EGCA 1EAYA 4WXEA 1CHNA 9ABPA 5KQPA 1D1QA 3I5AA 4JP1A 5C5EA 3LUFA 2QW1A 4G86A 2IPNA 3DBIA 3HK2A 4JOQA 1Z17A 3CLKA 5F64A 3FFTA 3H5OA 5IEJA 4NQRA 3IP6A 5TPZD 1GUBA 2QR3A 3CG4A 2NUBA 1JX6A 1NXSA 1LBHA 1JYEA 3IDOA 1VKRA 3OLYA 5IEBA 4NCAA 3DZDA 4LX8A 1QQAA 3KSMA 4MR9B 1BA2A 1CEYA 4RK5A 3HM9A 5CNMA 6CHYA 1H9CA 1ZESA 2PL9A 5TE9A 5DTEA 1EWKA 1ZHHA 2RGYA 5JNWA 3Q7SA 2RJNA 1MIHA 3MYYA 1A2OA 1EHCA 2L2QA 3GV0A 1U2PA 4E7OA 1IIBA 1QP7A 4MLDA 3H5VA 3CRNA 3CHYA 4D6YA 5BRAA 4G97A 1JFVA 3IPAA 4LDZA 2JK1A 4W5OA 2P4UA 5ABPA 2QVGA 2FTKE 3LOPA 4Z4IA 1S8NA 3GYBA 1AB5A 2PL1A 4MGEA 1SXIA 4N03A 4PYRA 2FEWB 4TMYA 5GQSA 2MYUA 5FWYB 1USKA 5B3JA 3O2SB 4EGSA 5JNTA 3O1IC 3D02A 5EWLA 2NT3A 2MYNA 8ABPA 1SRRA 4YS6A 2FMHA 4RS3A 4XFKA 4O5AA 3BREA 1FFWA 1QO0D 7ABPA 3MIZA 4IMIB 2WJWA 2MSWA 5JS2A 5D2CA 3L6UA 3O2JA 2PUGA 3IP5A 3TO5A 1E6MA 3K4HA 2F8TA 3T6KA 4G0OA 4MPTA 4MQFB 2E4UA 2PUDA 1ABEA 4ETNA 1KGSA 3QELB 4KQ9A 1ZH4A 5PNTA 3JS5A 1PUXA 3URMA 1JLKA 1KMIY 4W5TA 3O21A 5TQ2A 3C3KA 3KHTA 4QYMA 3H5TA 4RSMA 3GT7A 1A0OA 3HDGA 3OLVA 5IUKC 2HQRA 3C97A 4M88A 3HV2A 2FMIA 2A9PA 2PJUA 3C3MA 5BR1A 5IC5A 3RVOA 3RVMA 2E4WA 2KYRA 1U2QA 5JNUA 4PEVA 1D2AA 3HUTA 3O74A 4F06A 2FEKA 4MRMB 4LZLA 2JCGA 3Q15C 4KNYA 2H0AA 5IX8A 3E3MA 2GWRA 1DP4A 1GCGA 2E4XA 3MA0A 3UK0A 3BILA 3Q7RA 1NXVA 4NICA 1YMVA 3NHMA 2FXIA 3HS3A 2VK2A 2M1ZA 3LUJA 4EYGA 3Q9SA 2R4QA 5IUNC 4RK6A 1GUDA 3K9CA 5DCLA 2IDMA 4KMRA 4OLAA 4MS3B 5JS1A 2E4VA 3TB6A 5JNVA 5TPZA 3SG0A 2PUEA 2W42A 1UDRA 1KRXA 1PHRA 4Q7EA 3CU5A 2YHAA 1Z2EA 2IKSA 4LE0A 4JB2A 1SD5A 3NNNA 4LRQA 1JFSA 3JVIA 3OQOA 1JH9A 1GLGA 3GWGA 3T8YA 4W5RA 2PUAA 1YVUA 2OENG 2MYPA 3LFTA 4WWHA 2Q5CA 1RPJA 1MB3A 5FWYA 4KK4A 4RK1A 4RK0A 1JYFA 1ZH2A 1FQWA 4Z4HA 1A04A 4CBVA 1QP0A 1URPA 3A0UA 1W9HA 1E6LA 3CTPA 3F6CA 1TLFA 4MAAA 4EYOA 3QEMB 3HZHA 2GBPA 1M5UA 1JDPA 2NT4A 3OQNA 4WXMA 3ILYA 4IILA 5TQ0A 5KI6A 1RZRD 5KWSA 2JRLA 2J48A 2X7XA 4TLLB 1JDNA 4E7PA 2B1JA 3CZ5A 4ZJPA 3OMWA 4RKQA 3FDFA 3O1JC 4PICA 1PEAA 4EY3A 4WUTA 1AB6A 2L18A 5T7BA 1DZ3A 1NXPA 3KJXA 2RDMA 1MAVA 2R47A 3B2NA 3QLVC 2VUHB 3GBPA 1TVMA 2CD7A 1GCAA 1QO0A 4HNRA 2FEPA 3OM1A 4G0ZA 2PKXA 1ZGZA 3CG0A 4JAVC 2FMKA 4EUKA 1F4VA 1FFSA 2CHEA 5BRJA 1OXKB 3KYIB 1P8AA 3LUGA 1NATA 1ZGGA 1R8JA 3MM4A 4G0QA 2GI4A 3LUAA 2IYNA 1XHEA 3KLOA 3F73A 1VPWA 3R0JA 2NZUG 3I45A 2LP4Y 4F12A 3EDCA 3VNBA 4Z4CA 3I42A 3N6VA 5IULC 3H1FA 2QV0A 3HXMA 2CWDA 1WETA 1MB0A 1XWWA 1EFAA 4KZKA 2L17A 5TQ0B 1P6QA 4MYRA 4Y9TA 4MRMA 1DRKA 1TJYA 3LMKA 3M9XA 3QEMA 4FE7A 2M98A 1QPZA 2YHBA 4MS1B 3OLZA 1PNRA 3M6MD 3W9SA 1MVOA 1PNTA 3H5LA 1QQBA 2ZWMA 1ZAYA 4MR8A 1LJLA 1D5WA 1YMUA 1DC8A 1NY5A 1ZITA 3JTEA 4H3KB 3QK7A 3NNSA 1K68A 5TPWB 3OQMA 1NXWA 1JBEA 5KQMA 2LUOA 1CYEA 1LK0A 3N75A 2JVIA 4KK3A 3OLWA 4MR8B 2FN8A 4KRFA 2HQBA 1E2BA 4KPYA 3GL9A 3O75A 5EWMB 4Z9BA 2ID7A 3OO0A 3TMYA 4ZMRA 3CZCA 1P6UA 4MS3A 4RK7A 5FWXB 3KS9A 1RXEA 4HNQA 3NBMA 4B09A 3Q41A 4RU1A 3IP7A 5TQJA 4EVSA 1ABFA 2RJOA 3JPYA 1BAPA 2A9QA 3IP9A 3H5IA 5CNKA 5HQJA 2QZJA 1Z2DA 1I3CA 2JVKA 4YP9A 2IOYA 2ZAYA 4RXUA 5I4CA 4P98A 3G1WA 3EODA 4LE1A 1W25A 2WRZA 5FBKA 3RVSA 3OO1A 2H3HA 2TMYA 3H5WA 3OLXA 5IUJC 1BDJA 4TLMB 4Q6WA 2DRIA 1LJUA 3H1EA 1Z12A 4S04A 1Z26A 2FMFA 3QLVA 1T34A 2ID9A 5HM6A 3N0RA 3NNDA 1Z18A 4YCSA 4QPJC 4D6XA 5HKOA 4YO7A 1HEYA 5C5CA 3P9YA 2GKGA 4RK4A 4ETIA 1DJMA 2E4ZA 4EYKA 4YV7A 4OTZA 5TQ2B 5KC9A 1Z13A 2PUFA 4EVQA 3HJFA 2NZVG 3ILHA 2R48A 3FFWA 4KVFA 2PMCA 4HYEA 3MMNA 4MLCA 3SNKA 2FLKA 3QELA 4YWHA 4G0YA 3G85A 5TPWA 1F51E 3JPWA 4N47A 2E4YA 4ETMA 5JNRA 2PUCA 4N0QA 3Q7TA 4RY0A 2FQWA 2PLNA 4JB0A 3RVPA 2WWVD 1EWVA 2A9OA 3C6QA 3N53A 1TMYA 4OATA 2PUBA 4N41A 3EJWA 1KRWA 5EWJB 2VYCA 5CNJA 4ZYLA 3KKEA 5EWLB 4IMJB 4MS1A 1U04A 1U8TA 1VLZA 3OMXA 1ZN2A 4KQCA 3SY8A 3HVRA 3KYJB 4MQEA 1ISSA 3QLTA 5B3JC 2AYZA 3QLUC 3L49A
chains in the Genus database with same CATH superfamily
1N0HA 4R84A 5LQDA 3LCJA 2I29A 1J7JA 1AGNA 4LEIA 2JLQA 2PGJA 4IEEA 2BFFA 3KHUA 4J1SA 4WY5A 5AVKA 2OLEA 3PITA 1H5UA 1Q2XA 1X87A 2PIAA 2R6ZA 1FS6A 5JZOA 4MIKA 2XXAB 1TCVA 2FRVA 4HRXA 4MUHA 4TPKA 1JQ5A 3GEEA 3ICOA 3GIWA 3HDVA 2B0CA 3SVZA 1I4TD 3QH4A 3W5HA 2VT6A 4X64B 1NR1A 3V6MA 4NPAA 1SCIA 1Z7GA 4TYPA 3TXAA 4C6HA 1P9NA 4LJLA 2EZUA 5DTIA 3L1JA 5CUQA 5HA5A 1QOQB 3SP1A 1HYHA 1X2EA 3D8RA 1NBME 4RPLA 3AI2A 3CWZA 2QVCA 3IQIX 3PPWA 3N6RA 3DE2X 2F1OA 2YOFA 2XQIA 2Q4OA 3LXMA 4YRMA 1VJRA 3NM4A 1STOA 5K8CA 1EPUA 4WASA 1XDUA 5KINB 2DBRA 2HA2A 5AIAA 2JLRA 3EXG1 3MT9A 4QPZA 4F7WA 1KAGA 1U3GA 2AMYA 2DOKA 3OIVA 3ZNNA 4BASA 4PYNA 4HSEA 5A7FA 5AW6A 3TLEA 1NMYA 1EUCB 1GKLA 2JGRA 1U2GA 5JXIA 2QKYA 4RD1A 1ZRNA 4D74A 4ZICA 1FXUA 4YI3A 4Z1MA 2A0KA 3F6EX 1SUPA 3OIWA 2PLFA 1DOAA 1NIJA 4LWQA 4NCHA 4CU2A 2YW2A 3DLAA 4HOYA 3EPRA 1FW6A 4WT7A 1OXTA 3WSVA 2NADA 2X0JA 4FC6A 3E3LA 3UVEA 3U5ZB 3I1JA 4O59O 5FFMA 5B57C 2JJYA 2I87A 2A9RA 1E7WA 1DEAA 4ECAA 3BTVA 1TK9A 5B3AA 3V7YA 4ZOQI 4ZYWA 4LZPA 4Z4GA 4IWNA 2O0KA 4XJSA 5I7AA 1G8PA 3GRZA 3TUIC 2VPWA 4BVFA 1Y8QA 4RZQA 5E6SA 4FZVA 4LVUA 1XA4A 3M6UA 3E53A 2OD9A 1DUIA 4NOMA 1WDLA 5T6MA 2OYRA 2XNSA 3P9XA 4R68A 3VR6A 1J6UA 3PEFA 5B6JA 1GPMA 3AEUA 1IBRA 2Z5GA 2PH5A 3PYLA 5EMLA 5LC1A 4GNKA 4M8LA 4X3PA 4I8IA 4PZAA 1XDDA 5AVZA 2ONJA 1RJGA 4DTCA 3WXBA 2P1RA 1A8SA 3CUYA 3HWSA 4RZXA 4I7EA 1CEEA 3P8ZA 4F11A 2JK0A 4H15A 4JBGA 1SCUB 1B6SA 4RIFA 3NRBA 1ILEA 4OOFA 1NR7A 1YGPA 2FU5C 4ACAA 3L0BA 4PYIA 3RU2A 1QHIA 3MJCA 1LA2A 1TIPA 5MDHA 1V11B 4ESVA 3E9EA 1KVQA 4G8DA 5UKDA 5BR8B 3WGTA 2WJHA 1C8KA 3FBTA 2UZAA 3FYUC 4KI7A 4QXMA 1Z0ZA 1FX0B 2F90A 4NYJQ 4U2EA 1BH2A 3KKZA 1NN3A 2ZUUA 1PSDA 1FYWA 2ILVA 3DM5A 1V0JA 3TX2A 1B1AA 4PQFA 1SVIA 2FLWA 4G0MA 4HJRA 5ITZA 1S4QA 2YXNA 3A11A 3G8BA 5KVAA 1FBNA 3D8UA 3WIBA 1UADA 2CLFB 2CGEA 1L7NA 1NX9A 3Q9NA 5IXJA 3FYUB 3NFYA 3HL4A 5T3YA 2QTAA 1DG9A 3QFCA 3DOHA 2VN8A 4ILKA 3UQYS 1BXZA 4KREA 3EBLA 4XIGS 3O94A 1N5IA 4JI6B 3TCNA 3PPIA 4OI1A 3SQWA 3VHXA 1KJIA 5AW7A 4IDHA 3K20A 4MKZA 4HEA1 4NY1A 4A9AA 3R0QA 4OXIA 2DCUA 1AKTA 2BGMA 2I6TA 3OZTA 1EMDA 1P4AA 1FNNA 2XUFA 1QVAA 2Y4OA 1ZUIA 3CINA 2ZYWX 3ILXA 4F5DA 1P62B 1RI5A 2AJTA 2VUIB 2WG0A 4GP9A 3PQ3A 4Y2HA 1MGPA 4DIKA 1T6NA 3ORFA 3GD5A 2N42A 4FDMA 2YV1A 1IRIA 3AC0A 1Y4UA 1JF8A 4JQCA 4R8MA 3HKCA 3BIWA 4FS3A 3TW8A 1QRTA 4R9RA 2JIRA 2VSQA 2V0GA 2AVDA 4DOMA 4PBSA 4UTVA 2OG1A 1UMDB 2R65A 2PHZA 1F2UB 5ILGA 4CFZA 2WINI 1HQKA 4QBIA 4NF2A 1LS1A 4TTRA 1OLUA 1NUTA 1Y33E 4L4YA 4WDQA 4O6VA 1M2NA 4XZ3A 2WZDA 2DFTA 3FDZA 2VT7A 4KV7A 3SC6A 1MAUA 1JEYB 2FQQA 2C2KA 3B6MA 4L8LA 1BA3A 3M70A 4DCSA 1TW3A 2JF0A 2P79A 4UU8A 5A3QA 2XYGA 4L95C 4D8WA 1T36B 1JHRA 2HO4A 2QRMA 3CC8A 2X14A 3ITKA 3N8DA 3LLMA 4L16A 4AMYA 3VZPA 4D9IA 1W75A 5BSFA 4HDRB 1XXHB 4NH0A 4YXWD 2FQXA 1LQTA 1TK2A 4TSFA 2P9EA 3PGXA 1ZEJA 4V0NA 2OFFA 1YA6A 2Z9CA 3O8OA 1P9WA 4MEJA 3BPSA 2H1VA 4C3ZA 4YDHB 3DFKA 4MVJM 2XZTA 4PIVA 2Z5LA 4GI2A 2V03A 4MWOA 4NH4A 4JOQA 1SH7A 4XEHA 4Y2PA 3GFQA 1W85B 4IKOA 5CFMA 1QHSA 2JKVA 2Q3MA 4KTTE 2VF2A 3LP5A 4KPEC 1L2TA 1P9LA 4JYCA 3LH5A 4JC5A 4FYXA 1YDEA 4O2BF 5AKKA 3Q3HA 1G8KA 3H11A 3L6RA 3L92A 3MC1A 3X1YA 1R15A 4RJJA 2VEDA 1N2IA 4ND8A 5EUMA 4CCWA 2ZREA 3K8OE 1XBTA 1VIAA 2P7IA 4FHGA 4MR9B 3QYPA 3UOWA 4EZIA 5K4HA 2X13A 3BD8A 2RJ3A 4L4SA 5JRDS 5KTTA 1DV1A 3NH9A 2AN5A 4B80A 3UMFA 3K31A 3BRCA 1WU7A 2FPPB 3F9CA 4ARAA 2QVZX 2IUEA 2QN7A 3KJHA 3SSMA 1W34A 5CK5A 2WUVA 1WMSA 2CBZA 1JGTA 1CEQA 1XA3A 4LYGA 4Q19A 2V9PA 5HCUA 3RQSA 3M5DA 3ODGA 1RXWA 5I5EA 2X76A 4IDEA 5H4GA 3U61B 3IUMA 4Q1CA 4MLDA 821PA 3KSUA 4DUGD 4Q3AA 1JLSA 1HFKA 1M34E 4LTNA 4OK3A 3RJMA 4HNTA 1TVKB 2WJJA 4IV5A 3L8YA 4QPCA 5AKJA 3WL4A 5JADA 1IN1A 2H1WA 3T5GA 4BQQA 2ATIA 2HSJA 3EXIB 5FF9A 1RRPA 1M54A 4GI5A 2BGTA 3HHPA 3IVXA 1Y4AE 1NAIA 3C43A 1AB5A 2GZMA 2IHKA 5AKEA 4BNZA 2FEWB 3FGPA 4QX6A 5EUBA 3AUTA 3F7MA 2C07A 3KQOA 2ECFA 3ND6A 1P3JA 4IDNA 4Y2TA 1F2TA 1M1YA 1UPBA 2BISA 2VZ0A 1I0IA 4HH0A 1KOLA 3N2KA 4MUAA 2ZCJA 2HHHB 4TT3A 7ABPA 4KGXA 5U9CA 1K3FA 1OLSB 1Y8CA 3CE9A 2YOGA 4RUKA 2IU6A 1BCSB 4GKBA 2OZLA 4PTZA 3MJSA 5DYIA 3TTTA 4FSXA 1RHUA 4EHHA 1ABEA 2N1BA 1GZSA 2G1AA 2QRJA 3G9QA 4FFWA 3DDHA 5FI0B 2VDLB 3C0KA 3STWA 4EKYA 5ALVA 2P41A 1NPYA 3AI1A 1GO2A 4UE6A 3PUZA 4XCVA 3URMA 5IZ4A 3B48A 1KMIY 2ZI3A 2OBYA 3A4VA 2GZHA 3U4IA 3V1MA 4JI4B 4AZ0B 3PDIA 1OX5A 4YMWA 1HLPA 1MNAA 4OFXA 1JSZA 2EQAA 3MPUA 5LJIA 2DQSA 1KQGA 4PYKA 1BZYA 1XNRB 2R6R1 2NTVA 3WBKA 3PXBA 5H8WA 1GNTA 3HDYA 2D1SA 4L8VA 3FHJA 2JCYA 3QITA 4TOIA 3E9MA 3OZAA 4M1EA 5HF6A 4L9AA 4RTRA 3LX5A 2IYFA 4OM8A 4ZVVA 1XVVA 3LWBA 3O4RA 1NUSA 3RIYA 3SKVA 3T0IA 2AEMA 3WR5A 5IJ0B 5K5EA 3SZUA 1G8SA 5A4DA 2GM5A 2O8EB 4PQEA 4M8KA 3RODA 4QYTA 2FZKA 4WCDA 4TRJA 5D85A 4B76A 2E4XA 5B6PA 1JU4A 1PJAA 3BILA 1X8LA 5DOZA 4NICA 3AQIA 3AHDA 3W5BA 3SJ7A 4BLTA 2OK7A 2YZKA 5ICEA 1R6DA 4Z3KA 2F55A 2XHEA 2FMXA 1AKQA 5CIWA 3H5AA 2O2XA 2XGMA 3IRUA 4MTLA 1J07A 4FZ5A 3I6IA 5ILOA 4OLAA 3ZI0A 3KZMA 4N4AA 4K9OA 3UMBA 4AJNA 4X8LA 4LHWA 5A9TA 3TLBA 4CI0B 1ZR4A 3QPCA 2D5BA 3DEFA 4IXTA 3CPEA 1GAWA 4Q7EA 3NC0C 1GSAA 3H86A 1V7CA 4KQXA 1C7IA 3HSSA 3NVAA 1RDFA 3QXCA 5FLXA 3UJNA 2W6QA 3DMRA 1P75A 4WK2B 3EVZA 3L7BA 5FOXA 1BN7A 1EFPA 1OFVA 3L93A 3S7ZA 2Z6AA 4I4CA 2DULA 2ONYA 3DQQA 1FNBA 4KE6A 1EFRA 1L8AA 1MF7A 4WWHA 5HMMA 1A7UA 4JJ6A 5ELXA 4U0KA 5AD1A 3PRYA 4KXLA 4L4XA 3PF9A 1F0PA 1QKJA 4Z4HA 1NJGA 4O2RA 4DLTA 2Q9BA 3VGPA 4KGZA 4PSVA 4Z9YA 4AS1A 1QVRA 2AXPA 1YDMA 2WSLA 4ITRC 3NI2A 3F74A 3RIHA 1YCDA 1G8FA 2HTEA 2E5FA 1QDUA 1XXHA 1EE2A 1MW9X 2AOTA 4HUQB 4XDYA 5KI6A 4B6OA 5BNIA 1J8QA 3IUYA 3OKCA 1SIUA 2XUQA 4NONA 4UCQA 5LU8A 2PJZA 2B1JA 1CZLA 3OI7A 1CQIA 1QTQA 4EAAA 1VKNA 2A92A 2NXCA 5L8VA 1PWZA 4BPRA 1AX9A 4TWRA 4F60A 2ZRGA 2L18A 3OPMA 2QTBA 3I6BA 4G1VA 3GLFB 1E98A 3KZKA 1TCBA 4XOUA 1U4OA 4Y6OA 2AXQA 1U6IA 3PHIA 3KU1A 1DIRA 5CIQA 4FOTA 1DUSA 4KDFA 1QO0A 4L0DA 3DE5X 3DEJA 1MX3A 2J4FA 5EOVA 3AM1A 3HJBA 4PZYA 2B8WA 5FRDA 5DNUA 4L50A 2Q99A 3PHLA 1U2ZA 1L4LA 2YN4A 1U28A 1GRCA 5GJBA 1QNFA 3ETNA 1EFKA 1GPLA 2RGGA 2ZQYA 4K28A 2GI4A 5ALOA 3ICVA 1N2CA 1X1AA 2DC1A 1TRKA 3V4SA 3FPJA 3UMGA 2ODPA 1M74A 4JBXA 4EL5A 3E22A 4AURA 3TSYA 3DT9A 2X41A 1MB0A 1QVZA 2J33A 1BNCA 1GFIA 2L17A 1P6QA 1KU6A 2YZNA 3E7XA 1VP9A 4PO1A 4WXPA 5A7HA 4JL6A 3AL0C 3ZU6A 1TJYA 1SU8A 2Z30A 4IXWA 4EECA 1H2XA 3GPLA 1O7JA 1LLUA 4P7BA 3WLLA 2IPXA 4UCFA 4K0RA 3K92A 3X1XA 4F71A 1WQ3A 1IOLA 2YJNA 2QZPA 3OZRA 3HUFA 1KNXA 4B4DA 4DWOA 2R6FA 3D31A 3REOA 5BPHA 1GPWB 4JNKA 2ZBVA 5GGXA 3SVTA 3UANA 5DM60 1Y89A 1PJ3A 2P9TA 2LCIA 3K1AB 1L1FA 4BAGA 2H1OA 4DSTA 1R8YA 3EIFA 2ATVA 3L6DA 5KTPA 4P0QB 1T6XA 1T36A 4C3VA 4J29A 3DM9B 3OLWA 5A71A 1THTA 3BJZA 2ZBGA 2VSNA 1NYQA 4OB8A 4MYSA 2Z56A 3FNFA 3STVA 1E9AA 4O4IF 4KYTA 1G7RA 3K2BA 1XMJA 3DZCA 3NZEA 4MLPA 3VYTB 1WEKA 4DLLA 2HADA 4F4DA 2YHUA 5JSUA 2A9JA 2G1UA 1WBJB 3T5DA 5GGYA 5JI3E 1WOYA 2ZE7A 4JC8A 5KAPA 4GAEA 1T8PA 5IS2A 2A9QA 5AQEA 5CD9A 4I3HA 4B2LA 2PTHA 1Q0QA 2DEUA 1U4NA 2JVKA 4RA6B 1UBCA 5I4CA 5HFJA 1AMOA 4KJXA 3NT2A 1MP0A 3EODA 1RYDA 2B99A 3BK2A 3W90A 5IVPA 1RHMA 2R8BA 5DLYA 4ALLA 1DQYA 1U5AA 2I34A 2Q3FA 2WKRA 5T57A 4OMUA 1XNQB 4AF8A 4CUJA 2IXDA 4HG2A 4N39A 3GVCA 3H1EA 2Y66A 4DA9A 4CF5A 4O3FA 3OETA 2MINA 3BKXA 1FXWA 2PX0A 3MWLA 3N2GB 4MVJE 4POAA 1AA9A 4Q93A 1M72A 1KDRA 4GT1A 4PPYA 2L82A 4QDZA 4UNQA 4JLBA 4DDVA 5DM70 1B8NA 3OQJA 4KVZA 5DMXA 1JQAA 3CVJA 4EHNA 1JDJA 1J5EB 4UAVA 2VDRB 4DCVA 4V0SA 3HN6A 4PHCA 1HG1A 4BE7B 5ITVA 1NASA 2R7LA 3V8EA 2GSDA 2R5FA 3OZWA 4EKDA 1KTIA 4OCZA 2R85A 1EX6A 2PVSA 3QM1A 1V3QE 3ABRB 3TM4A 5CLJA 3DVSX 1TCAA 1ZFNA 1DS6A 2PZFA 5LD2C 1Y7TA 4ESEA 4LF4B 5K0JA 2A5YB 2R6GA 3W77A 1BE8A 4H1UA 4GLLA 3U3OA 1YU6A 4JT9A 1Z0JA 1Q6YA 4ND4A 4N7JA 5ESDA 5ICFA 1YI8A 3IB3A 4FS8A 1FUYB 1R4AA 2JRCA 2EL7A 5CNJA 4RIGA 4LK3A 3RTEA 5K6TA 3CX8A 4ZYLA 4OSEA 4BAUA 3M4YA 1AQJA 3KYJB 1Y8RB 4BYGA 4CETA 4CM9D 3CM0A 5FPTA 3E9NA 5IF9A 4ZDIA 2P6PA 1XA0A 2WHEA 3GPIA 2ZBPA 3LUKA 3L8FA 4TL7A 1KHTA 4GS5A 4PGFA 2C9OA 3E9DA 1TYDE 3FCOA 3JWEA 4BO9A 3HUDA 4IG9A 1PR4A 2FETA 3D43A 3KEGA 2CL5A 2I6FA 3U48A 5I7UA 2K7FA 4YVFA 1Z56C 5G0TA 2YHSA 5GIPE 1WKVA 2X1LA 1Q3HA 2CJXA 2QTGA 3JQAB 4G1CA 5A5DA 4P81A 1YB1A 2IIVA 3EZXA 4J16C 4RMIA 3BF8A 1KF0A 3LVBA 4JDUA 3QMVA 4ODIA 3LWNA 3WGNA 3B20A 1N0IA 2OCLA 5I9TA 3FOBA 2Y1CA 5F73A 4EY7A 2M32A 5IWAB 1E59A 4KO1S 4AZWA 2C2OA 4EVRA 4UUBA 3U31A 4BZPA 4D3FA 4Z1OA 1XXLA 3NWOA 4E3WA 1QH0A 2Q45A 1SUFA 2V6FA 3K35A 4N3BA 2B8JA 3OOWA 3SAJA 4AZTA 2O7SA 3CF0A 1GPAA 3EOBI 1QHHB 1E3QA 3DMTC 1ZIXA 4RDCA 1Z6YA 4ZI7B 5IH7A 4WBXC 1BMTA 3OEHD 1W5FA 3TPCA 4O4LB 1JR3D 1U6KA 1U94A 2OCIA 4V0RA 2XRYA 5B7PA 2ANBA 2W58A 2BEKA 2EJBA 3HXQA 2PE5A 2DE0X 2ZIUB 1YZLA 1NNSA 1RTTA 1FRQA 4BFLA 3GRKA 4FBMA 5A3JA 4CIWA 4H4EA 5F5NA 1E3EA 1ODLA 3JYHA 4H31A 1YZHA 3HUEA 1NW7A 3F5FA 4ALMA 2C92A 2R96A 4CF7A 3PQ2A 1PKXA 3GUVA 1K63A 4K2HA 1DFHA 5AW4A 1QGDA 1TX4B 4B4UA 3Q10A 3P2IA 2WQ6A 3CF4A 1LZKA 5EZ6B 4JA0A 4TX1A 3U7RA 4DV6B 2R7MA 4L9WA 2DWUA 4V02A 4HMPA 2OTCA 5IC6A 1C30A 3NAMA 3RVDA 2AE2A 3QSYA 2I3BA 1FXSA 4K9KA 3IILA 1CJMA 1EDDA 3HA5A 5E3HA 4OHMA 4TN5A 3HUUA 4X1OA 4ENVA 3EGIA 2GM4A 4IDQA 3C3WA 2Q7DA 3ZK7A 4GQAA 4CM7A 4D3YA 5JO9A 3KSDO 4C76A 1JXMA 1K7SN 4O4JB 3ZD6A 1KEEB 5JZMA 2O57A 2ODQA 2X0NA 5SZHB 3R6LA 3IQXA 4MP6A 4F9EA 3LQ1A 1BWSA 3SFTA 3W2GA 3RT1A 3AFMA 3PE6A 1S9HA 2VHJA 3NJRA 4DA6A 1SCUA 4E31A 3GNQA 6ABPA 1NHWA 2YS7A 3EYAA 4JL8A 3B38A 2GBGA 5BWBA 4HWRA 3ZZ1A 1CY6A 1MJFA 2QLFA 5G0WA 1WKBA 2I80A 3RLFA 2EV9A 4OQDA 3DLPX 4CMIA 4XD7D 3EULA 2XUPA 4MVJD 2I9KA 3INNA 1XAJA 4ZU1X 1YUMA 2ZTHA 4YPFA 2BTEA 4YT2A 4KR3A 4W1QA 5TX7A 4B6FA 1UF9A 1RR6A 1RRVA 1DJLA 1XD2B 1JPVA 4BNTA 3GLGA 4S0XA 4BV9A 3GUHA 3ELWA 4YREA 3G2KA 1EVQA 3W7VA 4YIKA 1NI5A 4E2ZA 1LWOA 1LTKA 5K3BA 2IH2A 3KBOA 1U28C 2C9MA 1P6XA 3ESQA 4LGVA 2E1RA 4RTMA 1CC1S 3BIOA 4BC0A 3NEPX 1H5NA 1EM8A 4WFKA 5KVSA 2FZCA 1NU8A 1VG8A 2XMSA 4L5CA 1R5NA 2C3UA 4ASUA 2C1EA 7AT1A 1EBUA 1G6KA 4DCPA 5BVHA 1FZQA 4KAFA 2NQ2C 4J0QA 5CLLA 4GBGA 2V0NA 2ZAOA 1CDDA 1WHTA 4DMCA 1DG1G 2ODWA 1YIOA 3MJDA 5IDXA 1JQDA 3TI9A 5A1JA 3LO5A 2NVWA 1KC1A 1NI4B 3HMQA 1JPNA 1QS0B 4MYCA 3HBFA 4BX3A 1W0KD 4HFRA 1NW6A 3HO8A 1FBTA 5BSVA 1ML4A 4F38A 3P2JA 5KVCA 2HIHA 1XKXA 1Z28A 1NA5A 2HWKA 2W4QA 4IVQA 4OHOA 3OLCX 4RHYA 4DRXA 4MR7B 2C8KA 1ZU5A 3GRPA 1W52X 3TTYA 3QIVA 4BLUA 5F3RA 2BW0A 3HZZA 1E2LA 2Z1MA 1OLUB 1RPTA 4N40A 1CR0A 1ZDMA 3PK0A 4PSAA 5TNXA 1Z2PX 3L7NA 2BL4A 3S2GA 4DLPA 3SZ3A 1E2FA 3AVWA 3FR8A 3GH1A 3VO9A 2JFOA 4I1VA 2WHRA 2P5SA 2H2AA 3OWOA 4FUQA 4U9HS 4CEJB 3NWPA 1XK7A 3O1LA 1Z17A 2D5AA 3BA1A 2B5OA 4HF7A 1CY4A 1X7ZB 4RD0A 3VPBA 1ZSVA 1S3GA 5TPZD 1R5JA 4OV6B 4WXHA 3UGKA 1JX6A 2ZR8A 3NATA 5AVRA 2HSDA 4IEIA 2Q1YA 3JQ8A 2OXEA 4RADA 1XLTA 4HD8A 5JZVA 3QY9A 1PYGA 3DCYA 3EVCA 4ZQEA 2AQHA 1FB5A 3QJYA 4DUZB 2VJAA 4RABA 6CHYA 4ZZ0A 4LZZA 4TYWA 3K2IA 1QIEA 5D1HA 1YHYA 4U9UA 4BFUA 1TQ8A 3B7WA 4Q21A 3H11B 2R4UA 4I1YA 3ZW8A 1KFCB 1IEQA 2KMLA 4EA9A 4UXJA 1E66A 4X95A 2PSEA 3NV9A 2J08A 1HT0A 3HU5A 3V4ZA 2GXSA 1T3HA 2CNBA 4OK6A 1KY2A 1ZBDA 1XAIA 2AD5A 1SKBA 2PRSA 2XYPA 1XCPA 1KIAA 2GD0A 3HFSA 5DN6D 1DEHA 1U2TA 1JFVA 5DH9A 5G53C 4LDZA 3NCTA 1L5NA 4F21A 1W7AA 3NPAA 5LDDC 1WSBA 2E89A 2BGIA 2PL1A 3ABQB 3CYFA 2DUUA 4QT0A 4CM4B 3CO0S 4W6QA 2VHZA 1R5BA 2FW7A 3E0QA 4BVAA 3RYIA 1G5HA 1ZH0A 3AXSA 5EWLA 4TS3A 2JGIA 3B1KA 3JD2A 4RJLA 3AP2A 3HVKA 4Y2XA 5F5LA 2OWEA 4L57A 2FMHA 1RKBA 4H2DA 5FNZA 3W8RA 3TNJA 1WQ1R 3BWXA 1XX6A 2WJWA 4AJOA 1RC8A 4RLHA 2HLDA 4AYXA 4NHEA 1HTTA 4KXNA 1YZNA 4YRNA 3QOFA 3T6KA 3QOWA 3L8GA 1G0NA 4HNUA 1ID8A 2E4UA 4YCAA 4TTIA 4PPGA 4CV0A 3TS1A 2NUPA 5DLPA 4CMAA 1W88A 1NBMA 2QD1A 1U0BB 4L27A 3COPA 1PJSA 1SIWA 4W82A 4WZAA 4RM2A 2WU3A 4CKYA 5CGQB 3VYVA 5D01A 5TJHA 4F9GA 1GIAA 1D6SA 1NW9B 4TLEA 2AMJA 4C30A 2I78A 4L78A 5FB3A 4EEKA 2XKAA 2A9PA 3IKJA 1YZTA 4I50A 4H18A 1A98A 2WD7A 1XZAA 2QE6A 1KP9A 2WE7A 1JEOA 2KYRA 1FQKA 4LY3A 2QUKA 3ID6C 3A6ZA 1U2EA 1E1CA 1UDAA 3DB2A 3ZV7A 2VNAA 2PSFA 2WVHA 3UNXA 3E5HA 4PG4A 3RV3A 3RC9A 1JN0A 2IXEA 5BW5A 5LP6F 1DP4A 5EKSA 5REQA 4W4TA 3WZ2A 3ED1A 4AWAA 3NBFA 4DNFA 4EJMA 3FROA 4ZQBA 4DMGA 3HS3A 5A9SA 2BGRA 4M1WA 3SQXA 2Q49A 4I9GA 3ECCA 1GUDA 3O0DA 5DCLA 4AKIA 3UB3A 1YBFA 2GN4A 4KSBA 3VFDA 4CTJA 4KR2A 4MP8A 5E0KB 1BEUB 5I47A 2JJ1A 3NRJA 3GN2A 1WMFA 3BXHA 3C7TA 3QJ5A 2ZCVA 5EERA 4ZVPA 4E5DA 5JNVA 2PUEA 3D7MA 121PA 3LAWA 4I2NA 5KOHA 3NG1A 2PBZA 5KVVA 3OICA 4JB2A 4XR4A 1GZUA 1SKAA 3V46A 2GNOA 3JYLA 1E8DA 4D0SA 1AN0A 3FGOA 1XTZA 2WM3A 3T7DA 2X0EA 3WIOA 4HDMA 1QIJA 2O52A 5FWYA 3A6FA 3UBTA 5EVJA 3VR0A 1RBZA 3KALA 4CBVA 1X39A 3K32A 4QDKA 4B7UA 5EMNA 4AULA 1V37A 1QO7A 2Y8EA 3GYGA 2D4HA 1E2MA 1XCLA 1MRSA 2FPXA 1HE1C 1VG1A 2IU4A 1KEZA 3R3UA 1RWXA 2H07A 5AK5A 3EFBA 1PU2A 3AVTA 5MGBA 1P0IA 4DR1B 5KWSA 2B3TA 4I4TF 1T1GA 1XEXB 4X63A 1ENOA 3IIIA 2ATEA 3CZ5A 4NEHB 5KCMA 4DABA 1RJFA 4Z5XA 3FDFA 3V97A 3T15A 2PH3A 1T13A 4FJ0A 1EXDA 2C54A 3NBZC 1X7ZA 1AB6A 2ACKA 1XEWX 2BYTA 3AUFA 4MW4A 5DM1A 3RVKA 3CZ9A 5J4LA 1TVMA 3LV8A 2ZWPA 1G3IA 1WPQA 3QA3E 5AI5A 4HNAA 3R6WA 3UJAA 4BJ5A 5BN5A 1CY0A 1RHKA 1YCHA 1ZGZA 2BGLA 3RAEC 2ZITA 4D44A 1JHUA 2XA2A 3C1AA 4DHEA 2XKJE 3KV1A 5HQTA 4CLRB 2YJ3A 4MA5A 4U7WA 1F0NA 2GAIA 1UODA 2G0NA 4FR0A 4DFDA 1MB9A 2XE6A 1VJCA 5M5BA 1N36B 3EF0A 5DI3B 4BRSA 3IOBA 1H2BA 2MSEB 4PLHA 4UATA 4WX2B 5MN5A 1I94B 2C7OA 2GEKA 2NQ8A 2WIAA 4BGDA 4QUGA 1PD0A 3R74A 1CB7A 4QJ3A 4BKMA 4RVHA 1R4NA 5CFLA 4W63A 3ESYA 1X86B 1XJWA 3F6BX 4DCGA 1K92A 2F1JA 2HYDA 2ZRQA 3IBFA 3VR2D 1VECA 1HT1E 3QVGA 5DNVA 5H59A 4ON9A 3VSEA 5DLEA 4FE7A 1HG0A 3ZZNA 1UKCA 4CNQA 1F8YA 3VMFA 2X9NA 1NFFA 2AZTA 5I7WA 3YASA 3T1TA 4E5VA 2VYFA 2YWBA 1ORWA 1SWVA 2FOIA 2ZWMA 5IBRA 4N65A 4DPLA 2PS3A 1T0IA 1WXWA 2BH9A 3W5JA 3QKIA 3ANNA 4Y6QA 1FUKA 1FTYA 1F17A 1X9IA 4B4KA 3GJSA 1KYVA 4QGHA 3IR7A 3TNFA 3HJGA 1CUYA 5K0ZA 3RCBA 4ZO4A 4Z3DA 2IEYA 4P5PA 5KJFA 5LQJA 1LK0A 4Q9JA 3H8JA 4MR8B 4O4IB 3HGMA 3LTNC 2B61A 4UE3S 3CQ9A 1J9EA 1ECBA 1XZKA 1FNCA 2CDCA 3EWIA 4IRUB 5TQVA 5CEEA 1HGXA 4MIOA 5AOBA 4C2TA 3JYPA 4G25A 1XTUA 3VU0A 2UAGA 3KDAA 3NBMA 3VOSA 1I13A 4BP9A 1K8ZB 5K0TA 1W94A 3OZXA 3E7FA 4FSHA 3KUKA 4Q39A 4ND3A 1ZOOA 3O8RA 3ENZA 3JWGA 3AIMA 3PTZA 3DAGA 2WYHA 4TUYB 2OFXA 2JD1A 3IA7A 2B4RO 5ANRB 3Q6IA 5C1IA 1S2NA 2OYSA 5AVSA 3E23A 1E5XA 4XVHA 1W25A 2O3RA 5DCUA 3AH8A 1TA0A 5ALLA 5K8TA 2F3SA 1NBMD 4MRVA 1PFKA 1QRAA 4MW1A 1FFBA 2DRIA 5LYYA 4DQLA 1W76A 4PWZA 1TMKA 3B1VA 2P2DA 1RI3A 2YFHA 3L82B 1YB2A 3N0RA 2ZI9A 4UBIA 5A6SB 3V32A 3HPRA 3R24A 4YO7A 5C5CA 5CCXA 2YJ4A 3V7FA 1XWIA 2GJ4A 4MVJG 3CUSA 4NOLA 3ITEA 4YY3B 3D59A 2IC5A 5FR2A 4R3NA 2NAPA 4CT4B 3L7OA 4U63A 1X7XB 1S01A 2W8BB 3MVEA 4I9HA 3C7DB 2NYUA 1NIPA 5D5QA 4YC7A 1FJHA 5BWLA 2IYVA 1Y7PA 1Y4SA 1XVUA 2I3GA 4NL4H 4BMCA 5KEIA 3BJEA 4KVFA 3SOZA 2PMCA 2IYOA 4G5RA 1PHPA 4E13A 1WXHA 5B36A 3DEYX 5THKA 1DIHA 3QBVA 3GEHA 4KPUB 2YASA 3B1FA 3SFVA 3D0KA 1WBDA 1G42A 1DQPA 1GRQA 3AEYA 3DKKA 3E1KA 3IERA 4C4YA 1GFWA 5C8ZA 4DC1A 4J0KA 2QLNA 2ZRAA 4C78A 1JIUA 1YQGA 1X2BA 2QN8A 2XZDA 3AUJB 5EWLB 2X8AA 1IWBB 1ZN2A 4RSRA 3CSDA 3SY8A 3RHSA 2PL5A 3BE6A 2BI8A 3N8GA 3B70A 3LHDA 1RQXA 3SE0A 1S0UA 3Q5DA 3TSAA 1U7UA 3WRVA 4MQFA 2J9RA 4OXRA 4NATA 1V96A 2X5JO 4PONA 3N2IA 4ZPJA 4NABA 4EMBA 1HH4A 2RG1A 2V59A 3EF1A 4ZZ2A 3T7IA 1E6KA 2NUPB 1M1NA 1NDUA 3KQMA 1R8XA 2A88A 3NRCA 2FGKA 3GW8A 2WB4A 1G3UA 3CX4A 3I2GA 4WNAA 1T8YA 2VOJA 4Z8YA 3DOUA 1DC7A 1O95D 1RXUA 3KTOA 5L3SA 1BDIA 1MBZA 4L4UA 4QQRA 5K0SA 1QLWA 1HDZA 4KH0A 3DWGA 2QM7A 4MV9A 4Q1BA 3QFRA 4PANA 3AEKB 2JATA 3ORQA 3TBHA 1EP9A 1X74A 5JH7A 1OYVA 1X7GA 4WNCA 4OX9Y 2GEJA 2Z2YA 3GC6A 2WT4A 3G5TA 4L08A 4PC2A 1XZDA 3OESA 5B1EA 1XMIA 4UTZA 2A86A 2GA9A 3R44A 1J0EA 2X2EA 4CQMD 4F3TA 1ZMRA 2DUWA 4QOIA 3G17A 3U4HA 4M0LA 4INZA 2HK7A 4EBFA 1O9GA 3G88A 2J5QA 4N0MA 4NEQA 5DP2A 1PGOA 4P4LA 4W1RA 3WP1B 4BO1A 5BV0A 4MJXA 2IUTA 4PG5A 2XH8A 3IAS6 5J2TA 3IKLA 1YI1A 2AMVA 2R00A 3H2HA 2J5KA 2P40A 3HR7A 4DC0A 2QP9X 3IIJA 3K9HA 3SHFA 1P31A 3W5VA 3I2HA 2ORIA 2BBSA 1AGRA 4IYJA 4LA4A 5EWJA 3KB1A 3MMSA 4WAUA 5K3OA 3FTFA 3CNOA 2DGDA 3VC2A 1A5BB 1R0BA 2CLOB 2BJHA 3PE4A 1WM1A 1JZQA 3S2FA 2ZAIA 4JYMA 3PEWA 2Q6KA 3MCTA 2P7HA 1X8XA 3E5RA 1M0WA 1PTJA 3CRW1 5HDQA 4EHJA 3I62A 2P8SA 3OTHA 2LW7A 2ADFA 3BRSA 3HKBB 4YLGA 3EIOA 4BZWA 4OEHA 2EFGA 5LYJB 1Y9JA 1E1MA 3SKXA 2QMEA 3T38A 3Q2OA 3EXHB 4IKPA 5CYPA 3F3YA 1NWCA 3Q0TA 2OXRA 4QUEA 3TQQA 4XGIA 3SBDA 5A5GA 1M6YA 1U80A 3WYDA 3AJDA 5LOVF 4O4HA 5GTDA 5K6AA 3ZYZA 4V1CA 4TVKA 3CW2A 2Q6TA 1HDYA 2WU4A 4CLDA 2AMFA 4OP1A 2ZG6A 4PQRA 2PKRA 2EQ5A 2F8MA 3LBNA 3DLBA 2XQKA 1ZUHA 2VK4A 3B2EA 3C39A 1VHTA 4HPJB 1GLVA 1UK9A 5SZJA 4KDEA 4BX2A 5JEEA 5JDCA 3UGJA 1T6ZA 4UUQA 2IZ5A 1KQNA 3ZW7A 5K45A 3P9ZA 2QYTA 1UFVA 3VYUB 4TSKA 2QMUA 2PVPA 4JCCA 1UK8A 1IUOA 4OUDB 3BS4A 3HCDA 1ZPDA 5LWHA 1ZJZA 1RYFA 5I45A 2IYQA 4RBNA 1OC4A 2XY4A 2YZMA 3TZEA 4URWR 5ELLA 3A6GA 1CK4A 4CIDA 4D9NA 5HJ7A 2BFCB 2KBEA 1NBOA 3ZEAA 1RP1A 3DZKA 3KB6A 3FMOB 2QBYB 3VC3A 5DO9A 1T5BA 1X77A 3MTIA 4E08A 1N5DA 1T3LA 4JU8A 1KDPA 2E1PA 2MSNA 4UNSA 4A03A 3ZCXA 5JCOA 5JBIA 1QYRA 2COUA 1ZM3A 2X1HA 4JASB 3PNYA 1P5ZB 5DHPA 1JR3A 1E64A 3C7AA 3CE6A 3DAOA 1JMYA 5FWXA 1KAMA 2QUZA 4QYWA 3IBSA 5KNBA 2UXBB 5KIAA 1XTVA 4DLZA 3GAMA 1CUCA 2OCYC 2O6HA 5JOQA 1SCQA 3CF4G 4AZ3B 4BRWA 4GVLA 1OXBB 1G38A 3PX2A 1XAGA 1BFKA 4OVKA 1D7OA 3NONA 4ZO8A 5L3ZA 4ZCIA 1IZYA 3QKRB 4L7VA 2VVTA 4F45A 1RCTE 1YFKA 2ZJ3A 1QMPA 3F2IA 3K0AB 4FK8A 2JHCA 2HMAA 1DRJA 1TM2A 2FWJA 4IIBA 4EKIA 1W1UA 3PGVA 2B5WA 1GPH1 5FBHA 4NRDA 4FYIA 4R0VA 5LZ2A 2Q0QA 2H06A 3UMMA 1NXOA 1R3UA 5AI0A 1HT2E 3RKSA 2CUNA 3UYLA 1Q0PA 4Z4FA 3SFZA 2OZVA 3K8ZA 1YOVB 5CIYA 4JI0B 1CUXA 1V71A 2QM3A 4WCFB 4WERA 1XC7A 1CFZA 3TGLA 5H1YA 3K5WA 4H60A 2DPHA 2BM1A 2DWCA 2QMOA 3IB6A 2VI5A 3PRKE 2ZATA 3OC0A 1UMBB 3OAAA 4V0LA 3KTAA 2R68A 5JE8A 4CM3A 1UBEA 2ROQA 2AN3A 1R0LA 5WRFA 5T5QA 2QT1A 4B8YA 5DVZA 2P4QA 2XRFA 3G0DA 5ALDA 1VKHA 4QGAA 1RMQA 5EKUA 2Q6VA 1BS1A 4HX9A 3TIIA 4XD2A 4G36A 4PO8A 3M81A 3TKYA 1UDXA 1XQ1A 1O0SA 2MSCB 3TZHA 3VOTA 3VZSA 3CLKA 1AKRA 3DR5A 3WIEA 4BV3A 1B3RA 2ERYA 1Q50A 2QORA 1IXRC 2HZBA 3QVTA 4ER7A 4UUMA 3E7WA 1WA5A 2FEOA 2PX6A 3HM2A 3KE8A 3NW9A 5A1TA 5FUYA 3IOMA 2L0XA 4GKVA 1FX0A 3IJ5A 4MVJA 2P75A 1T2NA 4GSLA 3STHA 1VI5A 3NAQA 4A73A 1PZGA 3TRJA 4A23A 2BMEA 2CFSA 2AKYA 5CLIA 2I3ZA 1ZN9A 3JWPA 1KWKA 3EGDA 2X4IA 3DEIA 4JL5A 4YBRA 1JBQA 2G9QA 4MWZA 4A91A 4DDUA 1P2GA 1VCNA 4C1BA 4DMFA 3SF0A 4DXAA 3D6MA 2DQ4A 1XOIA 5FBRB 3EEIA 3U9TA 1KO7A 2WOJA 3A1SA 1IUKA 3LBAA 3NTVA 4EUFA 4C7OA 5JJLA 2BE7A 2L2QA 3AJ8A 3GJ8A 1JSRA 1QP7A 4IV0A 2IW1A 4H6XA 1NPTO 5IKXA 2QRPA 3RYFB 3CRNA 2OO7A 1C9YA 2CDBA 4K26A 3SD7A 1GCIA 2SKDA 4LWZA 4W9RA 4A8JA 3L8MA 4D4HA 1B2LA 4A4DA 2RARA 1W4BA 1JP7A 2V7VA 4PYRA 4JP2A 4B33A 1T6BY 3ZI7A 4QELA 1V8BA 5TLSA 4Q9HA 3E27A 5KREA 3O1IC 3I5YA 2R3SA 4IDCA 3BT7A 4OREX 1TEXA 1PBTA 2WTBA 1POWA 3ZJ4A 4QWWA 4UMFA 4MGIR 1CJSA 3FVVA 4O02B 1FFWA 3B3JA 4B31A 1JVNA 3WYNA 4WBNF 3GBSA 4LXYA 1V1JA 2HQSA 4CM4A 2ETXA 1YQUA 1C3LA 1N8TA 1E6MA 2SKEA 2Y1OA 4XB1A 3Q88A 3HCNA 1VLLA 3HY6A 4L5YA 2PBRA 1TGYA 4E22A 3NWBA 1M1XB 1OWNA 2P4HX 4KR9A 1PEDA 4R1TA 4IJUA 1Z08A 5PNTA 4B47A 3P9IA 1U1IA 1FFYA 1U98A 2ETVA 2ZB7A 4QARA 1DDGA 2DU8A 4P58A 2VQEB 1NNI1 1P2UA 1N25A 2FN4A 2ZBFA 2CXQA 2XQGA 5CA1A 3O8OB 1DAHA 1JJFA 2ZS9A 3OLQA 4JITA 3QZUA 4LZAA 5FP0A 1F1BA 4XVCA 3C3MA 2B36A 4DLWA 1EUZA 5L51A 4WGFA 1U8CB 5IC5A 4X61A 3CJQA 4GOXA 3RBVA 1FDTA 4C22A 1XPUA 4UW9A 2E4WA 1CNFA 2GFIA 2QX6A 5EJFA 1HQDA 3KJFA 3V42A 4QATA 4HVCA 1NBIA 4KNYA 4MVYA 1N9GA 4I5FA 4JQSA 2Q1XA 5HM8A 5JI2E 5TS2A 4BCDA 2G17A 4JR0A 4ND5A 3NHMA 4Y2YA 1QTIA 2Q8NA 1P1RA 2VLBA 3PGA1 2H52A 4NBWA 4DANA 3AHHA 1D2RA 3DLTA 2VRCD 5T41A 4ZGGA 1KBOA 3C4VA 1RABA 1V43A 5EGSA 4R8LA 2QSYA 4K2AA 5CBPA 3A1UA 5E7JA 4W5JA 3Q3IA 2YXPX 4W8OA 1A2QA 5J3JA 4JU9A 4K7JA 3RASA 4AL4A 1J0BA 5DYWA 2W2QA 4YQYA 3U4CA 4R0MA 1TQ4A 2IEDA 3WLAA 2SICE 3WJ7A 3AVOA 1SVMA 3GEMA 4KSYA 5EFOA 4IHJA 3ESDA 4C4PA 5I8ZA 3IGFA 5GM2A 4B34A 4DLUA 1NYRA 5HX7A 3FKJA 2IHTA 5DSZA 4C7BA 3WYBA 3ZH9B 3VU9A 3DE1X 1VP3A 4ZRDA 2BEWB 2Q5CA 5KJ6A 1EK5A 1MB4A 1BKDR 3TLXA 1QFXA 3GZJA 5K0LA 3ZWNA 1X13A 1XI2A 1QE0A 2MMCA 2ST1A 3W3AA 2H5LA 4RV4A 5JDIA 3KVOA 1URPA 2AI3A 2VYVD 3M2PA 1Z35A 1AKEA 5FA6A 4WZBA 1TLFA 5FPHA 4JK3A 2BUCA 1F8GA 5B1IA 3DG9A 1SO8A 5FBLB 4DM3A 4D4KA 5C8VA 1IDOA 4HWPA 1NUAA 1ZOSA 1VE9A 4I4TB 4KJZA 1J2RA 3L46A 4LJ7A 3JD0A 3PQ5A 1Z5PA 2PLWA 3WRYA 7GPBA 1CUAA 2X7XA 5ESRA 4MQ4A 2Q9CA 3LDFA 5AK6A 2C3YA 3K5HA 2ERXA 2H2IA 1JLHA 4RH0A 3VKVA 2BN4A 3RYTC 1E3LA 1L3BA 2ZJFA 4EY3A 1VCHA 1O6FA 4YAKA 3ZHOA 3C4QA 3JTMA 1SUBA 4TQUS 3LJKA 4DSAA 2QAGB 5HR5A 4Y1RB 4BBAA 3CVUA 3BK1A 4DHWA 3T7RA 1P3DA 3VZDA 4O63O 1IY2A 5EE5B 2QS9A 4DR2B 1EIWA 1DARA 4MWSA 4NZZA 5KYYB 3GJ4A 3ZGNA 3PNQA 3MZ0A 4OIFA 4R40A 4FCCA 2HF9A 3K0FA 2YTZA 1Z0FA 1E63A 3EC7A 3MB8A 3EDRA 1NT2A 3MLAA 2OCBA 4NE7A 5DHQA 1NW3A 1IQUA 3HCPA 3KP1A 4FHZA 3UC5A 4AY2A 4EFDA 1A4UA 4EM6A 2WA2A 1NF9A 4H1VA 1U1FA 3MRXA 3FOFC 1N5OX 4PQGA 1XZMA 3JQPA 5CX1A 1QCYA 2A35A 3PZRA 4U2GA 2QQEA 4MZDA 3I04A 3D6FA 1WETA 4LHSA 4C1NA 2Y99A 5SZIA 5EHXA 4BMXA 3RWOA 4D41A 4KR7A 4M7OA 3ZIUA 2COEA 2XDWA 4DNPA 1S3SA 1RQLA 4GR9A 2P30A 4NBKA 2IVZA 4ZYYA 5KNBH 1ESEA 1N4AA 1ZN7A 3LQFA 4TV8A 2YHBA 5ECDA 1YQDA 1XUOA 1WCYA 4LCJA 4S35A 1V3TA 4WECA 2QJOA 5JVDA 3F7OA 4QIHA 5DFAA 4N5NA 2VKTA 3DBRA 4GX2A 3DS8A 3T4PA 4W5NA 2VA9A 1PTKA 3ETEA 3O4FA 1NVAA 4H3KB 5J4HA 2FWBA 4PZCA 2XMBA 1RRFA 1Q7GA 2Y1EA 2AUMA 4I55B 4W5HA 4X54A 5BR7A 5CDFA 1H0RA 1Z6TA 5TXGA 3S2SA 1G21A 1G7TA 2X8JB 3JD1A 3BK7A 2FRDA 4U7HA 3QWHA 3BICA 3JQ6A 1NW8A 3GMIA 1DJOA 4R31A 3FB4A 3H87A 5A6VA 4OU4A 1IOWA 3K9BA 2E7ZA 3ENQA 1JKFA 1UMCA 4HNQA 4Q03A 1XZIA 2B92A 5TQJA 2GEDA 4XB6B 4YJ3B 4WLVA 1NLYA 1FUIA 1HWYA 4XFJA 2Q5EA 1MENA 3A3PA 5BQXA 1TO2E 1X1CA 2GHQA 1G55A 2ZJOA 4YT8A 1TYBE 3RVSA 4ZAWA 2JIQA 3OPXA 1FNMA 2QZSA 3M7IA 4M36A 2ZYHA 5F1OA 3SS9X 3X1KA 4DJDC 4CKCA 2HZ7A 3VNVA 1OFHA 3FRJA 2XR1A 2QTFA 2FB9A 2F43A 3EGOA 4NP6A 1Z26A 5JRJA 3T4XA 3EQ8A 3IMGA 4EY8A 4ZA2A 3WISA 4YCSA 3KQTA 1H22A 4D6XA 1ZGCA 3FY4A 2CVPA 4G0WA 3K96A 4DXDA 1R8SA 5DNEA 2GKGA 1G8HA 1I8TA 1PDVA 4YRPA 2AF3C 1ISGA 4JYAB 2J3KA 2QUJA 3GXOA 5JXWA 1KZHA 1XV5A 4FGKA 2X42A 5DXJA 3Q85A 4Q1AA 4XCQA 3DE6X 4A6EA 1RQGA 5H80A 4EHKA 3WNVA 4N47A 4RV9A 3ZD9A 3ZWOA 1GG2A 4AMUA 3K9FC 1M10A 1I0LA 2DR2A 5HGJA 1B6RA 2W37A 2ZU0C 5H3CA 2A9OA 3HRIA 2PUBA 4G4IA 3K05A 3HA2A 1KP2A 4FU0A 1XK6A 1ZH8A 3D54D 3KTDA 4HQLA 1ADGA 3GCWA 1J2JA 3UT0A 5L3QB 4RTOA 1ISSA 5H83A 1VSQA 1XQWA 4HN2A 1UBJS 3RVRA 3RT7A 1VQ1A 3HP4A 3CJTA 3KAPA 4OB7A 4OL9A 4G1BA 4LRWA 1DKPA 3WHLA 3UPUA 1O03A 1WRBA 1YKGA 1YIAA 5IM5A 3UAGA 1APBA 4UPEA 4KXUA 1Q91A 2ZYVX 1PL7A 2PWAA 3OQHA 4P8RA 4LX0A 4QJIA 1DBWA 2IXFA 4BMDA 2PG3A 1RRGA 3WGVA 4IMRA 1XG5A 3GY0A 5FBZA 2J3JA 1TMGE 4Y2SA 5CVEA 4Z4EA 2ZJ4A 1PFGA 1GAXA 1EP1B 2ZR9A 1FJGB 1NVEA 2YIVX 3OE1A 2H2FA 4FEEA 4I81A 2G9ZA 3P0FA 4G0PA 4J8PA 3BMXA 1XJ0A 1L3IA 2BTQB 5FUXA 4LUCA 2JHAA 1X7HA 2H1CA 3TINA 5C7IO 1J8MF 1FFXB 1L5ZA 2YZ2A 1Q0SA 1Y1SA 2BSAA 2XUDA 4Q4JA 4EYQA 2NYRA 4PFKA 1K89A 4E0BA 5BUZA 1KE2A 3K0CC 4GUDA 3DR3A 3K0FB 4N01A 3OEEA 4XXHA 5CH8A 5FBVB 1GQQA 3RH0A 2NUAB 1L9KA 2G9RA 3K53A 5ELMA 1G19A 2O7VA 1OYYA 4LV8B 5DI9A 4KVGA 3AVUA 3U5TA 2XVYA 2XXJA 3H1BA 1FSZA 5J47A 3SYTA 4UCWA 4RY9A 2WJZB 2X0RA 2PX4A 2NZXA 4I50F 2IW3A 4PYMA 4CQLB 5CP8A 1HSZA 2UYYA 4YMUA 2QY9A 2VDKB 4MRRA 3T54A 3NANA 3SR0A 2A14A 1S7CA 3PEVA 5EGNA 4Q3LA 2QYSA 1X0VA 2HU7A 3KQPA 1YUBA 1Z3IX 4IGIA 2RHHA 2MR5A 3MQ2A 2HW8A 2J3MA 4BPBA 1C8LA 5JISA 1VRWA 4ZV4A 4IJWA 3BF7A 1YOVA 2DJIA 2GX6A 3WYFA 5IWCA 3VKGA 3K6JA 3Q7IA 4IGFA 4EJSC 4IS2A 3ISTA 3GVHA 4L8YA 1TKBA 1P1HA 4NLLA 1BDMA 3PR2B 4LTMA 3AF1A 1HKHA 2AYXA 4LYYA 4C29A 2EC5A 4GPAA 1M7HA 4LSMA 1MJGM 4OYLA 5TMBA 3TOCA 5IASA 5A0VA 4RMHA 2AC7A 5ADUS 4MVCA 3KCNA 3R5XA 3U62A 3A9WA 1IB6A 3IAAA 3RSSA 4C0SA 3SNHA 4GXTA 5K0GA 3CZ4A 5BYAA 3UJ6A 1DCFA 1ZD2P 1I30A 3ZXYA 2IS2A 4AKHA 1XDWA 2Z2IA 2L19A 13PKA 2JH8A 1OT3A 1JNXX 3P9RA 4XKJA 3EQ6A 2H1SA 1W4RA 5BSUA 4MS4A 4RPKA 3SC2B 5HVNA 3FUWA 1Y6GA 4LIPD 4F3YA 4FTWA 2C29D 2VPPA 3DFIA 2WHQA 5I48A 4I14A 3CS3A 4XARA 4IDFA 3UEOA 3H8VA 1TAGA 2GERA 2V9ZA 4QVKA 2I1QA 5B2FA 3FNHA 3WLKX 2WSYB 3O91A 4A92A 3QVJA 3J81A 3NBUA 2VF7A 5KU1A 3GD7A 1OGYA 4BMOB 2E21A 4R5MA 4ZC1A 3TUJC 1FUEA 4EJFA 3AOEC 3ICQB 1YS9A 1Q11A 1K97A 1L5HB 4L85A 1IG3A 4NYMQ 5G4KA 3QF4B 4DR5B 3D9QX 3BMQB 4KAXA 4OBBA 4Z99A 4RPCA 3TJZA 3VKWA 3DBLB 3FSJX 3VBCA 1TF7A 1X1EA 3LT5A 4KQJA 3QJGA 4OQ4A 3T9CA 5IVKA 2ZJ8A 4U4AA 5F7OA 2IS1A 3U4DA 4LGYA 3SEFA 2IOFK 2D1RA 4AX8A 3KUCA 2A0XA 2X19A 2YWGA 4FQ7A 1IZ7A 1XYGA 1XVLA 3BFVA 4C4ZA 2E9SA 1RYHA 4N6OA 2KM1A 2HA0A 3NKFA 3A1VA 2K7ZA 2PZKA 4URYR 1L5FA 3QLEA 4ZVLA 3WC4A 1QCDA 3KPUA 2DHCA 4R1UA 1C8BA 1TE2A 4FGZA 3JW8A 3VR5D 4RXTA 3FF1A 4WVLA 2MT9A 3P0EA 3GLIA 1U0NA 1N6NA 5FCDA 4E33A 1JHOA 4FGWA 3N2NA 4DE5A 2ZI6A 2HJHA 1CR1A 1QH1B 4H16A 1VPTA 2XHZA 3MERA 4K5QA 4PRKA 1G17A 1U7ZA 1RWMA 2Q4EA 4N7BA 4DREA 4UQLA 1M2FA 2HPHA 3EUFA 3RF6A 4QAQA 1E6CA 2WTMA 2GLXA 4IGEA 721PA 1ZVVA 4B3MB 4O4LF 9GPBA 2CHFA 5JWHA 3ITNA 1OA0A 1T5OA 2AA3A 2J7KA 3COVA 2ZYGA 1JXOA 3F5SA 4HYQA 4KQ1A 4NS1A 5BSTA 5BQ3A 5ITWA 4XQ9A 1YS7A 4HDCA 1A9SA 5A4JA 1WX1A 2DLCX 4OKSA 1L8XA 1VLQA 1V95A 3CNEA 5EWMA 2BFFB 3IQEA 1V16A 3RROA 2FWRA 2Z1NA 1LDYA 4IP0A 3FPFA 2OLJA 4FI3F 4WVFA 1E1CB 2B4KA 1YJ8A 1GEEA 1VHQA 3TRIA 4YRAA 3THWB 4IFBA 2CE2X 3I5AA 4DLVA 4AO7A 2FMTA 3ME5A 4TYQA 4LZJA 2WZQA 2FK7A 1GTL1 2XGOA 3HK2A 1GNRA 1QZ3A 1AKMA 3DDZX 4LJ8A 5IDQA 4JROA 3REFA 5HQ3A 3F49S 1HURA 1UJNA 3MTJA 4LDRA 3JZDA 2P77A 3PXGA 2DFKB 3IP1A 5G02A 5BQOA 3WJ2A 4YO8A 4YRIA 3L6BA 1V41E 2GN2A 2G40A 3MWYW 3LX8A 4LSZA 4RY2A 4KQMA 1QF6A 1EA5A 4XJVA 4LV6A 4MKGA 2XCIA 2NACA 2XAAA 3ISVA 1GFZA 3SK0A 2PKYX 1T4CB 3F9RA 3NVDA 5KOHB 1WZIA 3MN1A 5SZKB 3MELA 2NVUB 3MOIA 5A03A 4XQGA 3GFFA 1EWKA 4JVSB 3AT1A 3Q7SA 4R1NA 1G6Q1 4EATA 3H6KA 1I2CA 3AV0B 4TSFD 3B9QA 2QD3A 3GV0A 3A4LA 4AY5A 4K3VA 4UZEA 1P18A 4WIAA 4I4IA 3OX2A 1DI0A 3FX2A 4XTRA 4EG3A 3OH8A 1TEZA 3M3HA 5J40A 4B75A 3DDWA 1ZP6A 3HJAA 1ZZGA 1GL3A 1KVUA 3W4JA 4MQBA 3ON5A 3G9UA 2AFIB 4JKYA 3D4OA 3HJTA 3UWPA 2WHYA 3H04A 2HNKA 3RUCA 1DTWA 3U0VA 1IULA 4V3CA 3ZHBA 1UZUA 3ZCVA 2DFDA 2IQIA 2V4ZA 1H4VB 1HF3A 4RMGA 5ALZA 1YRQA 3BD7A 5BNFA 4BNDB 5JNTA 1QFJA 3D0OA 2AIRA 1JLMA 1OVMA 2FQ1A 4NJEB 1NFQA 1ZW6A 2R8RA 5HRAA 3BIXA 1X7WB 2RH8A 3CZAA 4WKNA 1WS6A 1XRRA 3IS3A 4O5AA 1SQSA 1GTG1 3KKLA 4MUYA 3MWKA 4UU7A 4D8UA 2FJPA 4RACA 2YVQA 3L6UA 4FFDA 2Y0DA 2CFCA 4Q3DA 1C1YA 4JLVA 2X2OA 2GK4A 1JE0A 2I4OA 1SHTX 3DL2A 4E5KA 4JUBA 5F1YA 2QSZA 5CA0B 4BQIA 2QAIA 4ETNA 3UJBA 1SVUA 2OESA 1L9XA 3QELB 2ZBDA 4K87A 5DX8A 1A4RA 4K6KA 4HS4A 3SBEA 1YQXA 1FVOA 1KY4A 3DW3X 4CCYB 1E61A 4KR0A 4K9RA 4KGVA 4XGNA 4K8OA 1AS2A 2AWNA 3EZ7A 2Q3CA 1FA9A 2RG7A 3ZXUB 1KO5A 1LRLA 3RJZA 4HRVA 2A84A 1EQAA 3HB9A 3WWDA 1GKKA 5CVVA 3V7WA 3OPYI 1NMEA 1OHHA 3FKSD 4J7CA 4LF6B 3K0SA 4A6XA 2R1TA 3JZFA 3E70C 4QSMA 4PEVA 5HZMA 1W1WA 2FSVC 3HZRA 4AJKA 3E9ZA 4YFYA 2NTNA 4LZLA 4D8VA 2IYRA 2WIDA 1KEKA 2YYSA 3CZPA 3EMBA 1HQYE 4I1UA 3I9FA 3WMFA 7YASA 1GCGA 1H9BA 1L5OA 3K9QO 5JWRA 2XGSA 3D4BA 1NXVA 1EFVB 2A4KA 1MOQA 4BQRA 4F6RB 1Z88A 4CIAA 4DR7B 3WL8A 3LL7A 4IBOA 2K87A 5F98A 4YALA 4KFTA 5BNZA 2JHGA 4GICA 4XYEA 4KMRA 1R0SA 3MMXA 2CUZA 3WRXA 3A70A 1XTBA 5ADVA 1ZL2A 3QPDA 4KBGA 1RKQA 2PMBA 1BS2A 1H66A 2HF8A 4ZDJA 1G4AE 4TM7A 1Z2EA 2IKSA 2ZSKA 3QLJA 1N3BA 1XN1A 4TTSA 4KDRA 2QX4A 1E2KA 5FNVF 3A6PC 4YJDA 2A78A 2WWGA 1XEWY 2VWGA 1JR6A 4L28A 4F2DA 2X3FA 1TM7E 5AVXA 2ZKLA 3FDZB 2I55A 3VO2A 3DV0B 2KW5A 4PLCA 4LBVA 4L07A 2YXBA 2Y9MB 2GBLC 5LWQA 4D82A 2YY7A 2WF8A 4N5DA 1YFJA 1JG1A 2H65A 3ELYA 3SZMA 5CDHA 4CKBB 2I91A 3EZ9A 4YACA 5FO0A 3GLGE 2OZEA 2UUAB 3H9GA 1G8GA 2XPCA 1B0AA 4Q7KA 4ER5A 3STTA 4V2IA 3D3EA 3ND7A 5BXQC 5GVSA 4AQ7A 3CRRA 4IH4A 4Z1MD 5JEDA 3E22B 4RKQA 1S2DA 1P0MA 2VHTA 5H7XA 5BQPA 3H0CA 1BO6A 1MQSA 1IH8A 3RS7A 3IUQA 4BNHA 5ALFA 2QVYX 3QNWA 2AJBA 4ENPA 2HLDD 5JD6A 3B2NA 5JECA 4L5IA 5FV4A 5KX5B 2H8GA 4R41A 4QE3A 4HNRA 2FEPA 1ZUNB 2FW9A 4I19A 3SC3A 1TC2A 3MAAC 2NTJA 3CUUA 4JOSA 2VTDA 1NE7A 1RXSA 1UZNA 1MN6A 2FRXA 4KEAA 1GM5A 1WHSA 2CHEA 3NETA 1YBAA 5KQRA 1CJBA 2OD7A 1NATA 3SJCA 3VR1A 3TZBA 1J00A 2RAVA 1KKLA 4H17A 4ZVSA 5FFNA 1Z38A 4QHSA 1W2WB 2NVUA 1OW3B 2Q4BA 3OT4A 4J2OA 3VKUA 1EFPB 1WDTA 2BF4A 2A7QA 3HVUA 3AERB 5U4QA 5CD1A 4U1RA 2QZ9A 5FWNA 2ODNA 3AQ4A 5CU7A 3FNRA 3I42A 5IULC 4IUBS 4IHAA 5ERGB 3E8MA 3PNVA 4F8EA 2HCTA 3L84A 3Q3CA 3QXHA 5CB4B 2XWSA 3CF2A 3LGSA 1KH2A 1XVIA 3ROXA 3M9LA 3A1DA 3CLSC 3P9SA 4IWXA 4ZD6A 4G1UC 1Z75A 1EXVA 1ATZA 3FTDA 4ALIA 1Q17A 2AOUA 1OX4B 1XTIA 4EZBA 3R9WA 5IMBA 2TMDA 3M6MD 1B73A 3N87A 4KV9A 2HB6A 2XB9A 4C5AA 1SOMA 3DJFA 1QQBA 4MR8A 4O4IA 1CZNA 4Y2JA 2GARA 3E82A 3FNQA 3K9WA 2WFLB 3KYCB 1RM3A 3OU2A 3PC2A 4LC0A 1C80A 1SKYB 5EHNA 3M4XA 4HLQB 3PKZA 4I36A 3JYOA 4GEGA 1R6UA 4CV3A 3HADA 3QK7A 1E0SA 2ZRCA 3GLHE 1GILA 2WVJA 3FHLA 1OZ0A 4J7XA 2CC2A 4M60A 1P3Y1 3EVFA 3BRWD 3BWDD 2VJMB 2VP5A 3AILA 5DTMA 1NLUA 1U0TA 3N75A 2JVIA 1UZAA 3CIOA 3THRA 4CMEA 5FPKA 3HDQA 5FA8A 5IDYA 1YFZA 3QUSA 4EARA 5AUQA 5EJ5A 3T12A 3LQRA 5EWMB 1ICIA 2E0IA 4Z9BA 1NLFA 2PGDA 2W6OA 1P6UA 2A59A 3CZCA 1R0KA 4V0QA 3HBNA 3GLKA 4DBLE 4MVJH 3UIEA 4WDRA 4P33A 1K5HA 4MB6A 4J0DA 4GSYA 5A9RA 1A4XA 2W2LD 1GUZA 1GZ3A 5E2IA 2Z3WA 1C1DA 4F96A 1ESMA 1I2AA 1FYDA 3N7UA 1QYDA 4CM6A 2J0QA 1PQYA 4ZOCA 5IYZA 3QYJA 2Q21A 4EY4A 1X19A 1SY7A 4NE9A 4QU5A 4AN0A 5H3LA 1EVLA 3QVXA 4JUDX 1ZEMA 2Z8YM 3GGCA 4HDSA 4RESA 1QJCA 1AK1A 2EZTA 4OHFA 5E1DA 4EG5A 4HH4A 3GZ4A 3L05A 3QLVA 4D3XA 4ZAVA 2H9AA 1ECFA 2IIQA 5TJ9A 3MEQA 3ADPA 1KSJA 2P9CA 1L5VA 2V7UA 4PLFA 1KDTA 2HFKA 3GGPA 1NVUQ 2A3NA 3A4TA 4J9VA 1GDDA 2JFFA 2ZRDA 4NKRA 2WP0A 4PTYA 3ZHVA 1RJWA 2VF5X 4YHHB 3O26A 2YC4C 4RCZA 3HCAA 3KZOA 4QO7A 4RK4A 2E6UX 1NKVA 5JZ9A 1J1IA 1I1OA 1Z8HA 3OM9A 4PTLA 4EYKA 1PT7A 1UPXA 3UCFA 1MC5A 4BWVA 4QBGB 3H84A 4TTAA 3TAHA 2F64A 4EVQA 3E03A 3ILHA 4J75A 1C30B 3VPHA 1QONA 4ZGWA 4CQJA 2HJRA 1QIFA 5AI9A 4M0MA 1MRZA 1F51E 5L7YA 3UYKA 4H3SA 4J4HA 4COKA 1GR0A 4CKZA 2RGCA 1V9CA 4CNBA 2FK8A 1H2RS 4JB0A 10MHA 3F8TA 1ORVA 2VHUA 3MTEA 1VTKA 3DL4A 1TMYA 3ZX5A 2BKAA 1JPUA 4U2DA 3T3HA 3ZKAA 4D2IA 5IJXA 1AZSC 2FFQA 3K9GA 2QTRA 2ZJ7A 2ZVPX 4IMJB 2H4FA 1U04A 1YVDA 4N1AA 4S3MA 4E11A 2DQKA 4CRWB 3CR3C 2ZAMA 2G09A 3ZJ5A 1RBQA 1CCWA 5CG1A 3JCZA 2RBKA 5MN6A 3CEMA 2AN1A 4YGYA 5EHGA 4Q4LA 1P61B 2ICAA 1OFTA 4DBLC 3M5WA 1QIMA 3HXMA 3U81A 2WA1A 4RHEA 5JZBA 1L0BA 3KL2A 3ZOZA 2Y0BA 2IIBA 3AR6A 1R0ZA 4R05A 4DBZA 2IEBA 4K9QA 2R0QC 1FX1A 2YXEA 1MA0A 2V98A 3AHFA 5KOJB 4MHTA 5FAXA 2QW0X 2J46A 1YVEI 4C0QC 3V33A 4AUKA 4E94A 3JQDA 1G7CA 5DJ5A 4WZ6A 3LP8A 2UZ3A 3EIQA 4QBFA 1US8B 3LYHA 4RSHA 5FBWB 3RSHA 1TAHA 3EB9A 3MLEA 1EK1A 4MW5A 2A0YA 4R6WA 3A3OA 1KKUA 2PBLA 2ZUVA 3NKLA 5AXAA 4RZSA 3PLAE 1L7AA 4ML3A 2E85A 4PR3A 3O8NA 1T2AA 3LECA 4LJ9A 3AUYA 3EBPA 1J5PA 4JQOA 5HNKA 2D7CA 1G64A 2IITA 3L01A 3VPCA 4JQYA 2XV1A 1O9BA 3N58A 4V0OA 1HNXB 4EGJA 1OOEA 1WAMA 3OA2A 3TFWA 5ED4A 2R79A 3MJFA 3OFND 5KYUA 5HJEA 4JI8B 3K9LA 2PM8A 1Z7WA 2NUTB 3AEQB 3QKUA 4GVPA 3QXJA 2Q7XA 3TSCA 3B3QA 3IURA 5ALXA 5BUSA 1Z45A 4DSZA 4MWGA 5AVJA 4DMRA 4B1FA 4NFYA 1MOZA 3T3IA 3HH8A 4OK5A 4FYWA 3WB9A 5B30A 1R27A 3KZVA 1KL7A 2UVPA 5B1HA 1VE1A 4MUIA 3FSRA 2CZQA 1Q1GA 1SB9A 1REQA 3DE0X 2WFMA 2NPIA 4TWIA 4B74A 1G8MA 1O77A 3PJFA 5KDOA 3LX6A 1EA7A 3H9JA 4MR7A 3FLBA 3GDGA 3KKNA 1ZJ5A 3QX8A 4Z9XA 2DQYA 4N6GA 5JTTA 4D25A 4HGYA 4QOFA 1GTRA 4CMIB 3BB3A 3N76A 2B0JA 1UPUA 2H4HA 3B82A 4LRSB 2C9CA 5ALHA 3INTA 4JENA 4B44A 4LYJA 1V3UA 3QP9A 4CEJA 4Q3NA 5BYKA 5EIWA 4MV0A 2FWAA 3FNGA 5SY4A 3R7LA 3SIXA 3VXKA 5EIXA 1LI7A 4DQDA 4U2BA 1QWOA 4DLSA 1WTCA 4CM1A 1TFRA 2JI6A 3MB5A 3HI6A 3QG1A 4ARZB 2B69A 3BSSA 3IAHA 4Q66C 4A2QA 2PX5A 1UXKA 3EG9A 2QJRA 1B93A 3NOOA 4G63A 3LUCA 2HSGA 4G1FA 3HU3A 3FOWA 3I4FA 4OL0A 4B8ZA 2C99A 1B0ZA 1ANKA 3P2OA 2XNDD 1SHUX 3OECA 4E21A 1P1FA 1E1RD 2CNDA 1DTSA 1AQUA 2C20A 3UXEA 3RVBA 1QFSA 2X7JA 1D2GA 2W2KA 2ZWIA 3LQ2A 3R3ZA 4B71A 3QU4A 5LM3A 4UPVA 5J63A 2XWJI 2LXNA 3VV2A 4ZI7F 3AKYA 3E61A 4A26A 4RAQA 2O59A 5LA6B 1MVNA 1WVGA 2KWIA 4UVDA 4EG6A 3A2NA 1K8YB 1NXTA 5H68A 1BU8A 1YB5A 1AV7A 4QHYA 4QOJA 3VU8A 3EIXA 2G71A 1PWHA 2DR3A 1N2CB 2YWFA 4JLWA 3RSLA 2RONA 3GP5A 4BNLA 2BGGA 3WBJA 1WXIA 4D6PA 1NKSA 4MV7A 3THYA 2A1IA 3AB7A 1GZDA 1MJNA 3HHEA 3QVUA 4DIBA 5K8VA 1C7JA 4ZYTA 2C5GA 2P67A 3ANMA 3P9KA 5G4KB 3KOZA 3QNUA 2CDNA 1L5HA 4O2BA 1P45A 5DHAA 3NHLA 4ZV9A 3S8YA 3V4RA 5JJIA 4XA8A 1VMAA 2E5WA 2WC1A 4NPHA 3F6YA 2GJ9A 4UVIA 5H9WA 4IJMA 1ADCA 3QQPA 4IPTA 2C4VA 2C00A 3I23A 1ECGA 3G2IA 2J8ZA 5AM3A 4B9AA 3KB2A 1YKSA 3L5KA 4RFLA 4Q82A 3WWZA 4JBHA 3GROA 4W7HA 2JLCA 3WLTA 3AI3A 1TYAE 4BTLA 1XMVA 3G6WA 4BLOA 4NULA 4EA6A 3FVRA 2V5VA 1DWPA 3IUPA 2OORA 3T99A 1C4OA 2ZRKA 5C3UA 1NLZA 2H08A 3I58A 4AF7A 3H4VA 3LBIA 4HH3C 4GZMA 5EEGA 3G0GA 3GBVA 3N7TA 4LCBA 4NZOA 1UDBA 4XPZA 2OC4A 4Z7NB 5B1YA 1LW7A 1Y5MA 2ZI7A 4TL9A 1EAYA 1VA4A 4G9GA 4CW7A 2KI5A 3IEUA 1XKQA 2OBXA 3H9CA 1CHNA 4HWSA 5FI1B 3V6LA 4R71A 9ABPA 1SC3A 4JP1A 3R40A 2DSTA 5JROA 3I12A 4CL0A 1Y9ZA 2CCJA 2HX1A 4CMHA 3MBKA 1I1QB 2ZKIA 5F64A 2QM8A 3KFVA 1IL0A 4UVGA 2HEIA 4L22A 4XVQA 3G9TA 4AXBA 2JGDA 1QR2A 1ELOA 3OZ7A 4UOQA 4BNGA 4P53A 4P82A 4X9XA 2G8NA 4QFCA 4WNYA 3T7TA 1ZC4A 1ZUWA 1WR8A 3IC5A 3VVMA 5CH3A 2EZ9A 2W6ZA 1BA2A 4LF5B 3RFXA 1R0RE 3ZV6A 1DEKA 1P80A 1WZCA 2DWQA 5F4ZA 3VZQA 3RYFA 1KDZA 1NOKA 3A8TA 5LCXA 1SHLA 1N34B 1GDHA 4DARA 2GCOB 3D6AA 4YTEA 3W9UA 3CURA 3WYCA 4PAQA 1MNQA 5JALA 1Q3TA 2IYUA 2ZM5A 2IX9A 3HQ4O 3MYYA 4B46A 4BBZA 4MHSA 4Q34A 1IATA 1P0QA 3PTLA 2CF5A 4NYIR 5AHOA 4J0IA 3DOFA 4FDTA 4A15A 2FHPA 1I6KA 4QFBA 4G97A 4M1OA 3IPAA 2ZE6A 5KTNA 3DJYA 5JC1A 4PPFA 1CS0A 3VH1A 5GJCA 3B6JA 3TKAA 2C4WA 2PRZA 4CCAA 4ETMA 1KJWA 1Z5WA 1UEIA 5D1NA 2YJ6A 4HDMB 5FWYB 4JHXA 3L1VA 1HRKA 1E2PA 1WNTA 3PJGA 3R5SA 4KN5A 1T8SA 4MROA 1YR9A 1SUEA 1E96A 2MYNA 5M29A 1PFUA 2B1QA 3MINB 4Y2GA 4DLKA 1YASA 4GPEA 5TS3A 3VBEA 1QO0D 4GR5A 4C7KA 1PJLA 5DLDA 4QL3A 2PKWA 4G5QA 1DTWB 5JZSA 1NE2A 1W96A 4OBXA 2F8TA 1Q1AA 4MW9A 3EOZA 4WSOA 1QIKA 3C1UA 4JFAA 3RTBA 4BZQA 3W2TA 3VC7A 7MHTA 1A72A 1VI6A 1RHQA 2XB6A 4MXDA 1XVTA 2FUNB 4QYMA 4RW0A 4WOBA 2Q5HA 3JQBA 4TXMA 3U0BA 4M1QA 4F4FA 3L7IA 3NKVA 4M88A 4BEWA 3KLMX 1I9CA 2FMIA 2PJUA 5D00A 2V5UA 1HDXA 2R8PA 4NESA 1O5TA 5B12A 2ZWOA 1JALA 3HJCA 3NP7A 5BVGB 1I36A 5I8WA 3WQSB 4NBRA 5TT1A 5LN1A 1CE8A 2FPOA 5AK0A 2VP4A 3PUIA 4KLRA 3ZKWA 4F06A 1ZI6A 3Q6NA 4IX1A 4Q02A 4CUKA 1KKMA 1TW2A 1W35A 4IHKA 8AT1A 1YZ3A<