2FEZA

Mycobacterium tuberculosis embr
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
373
structure length
373
Chain Sequence
RLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable regulatory protein embR
total genus 129
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2005-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fezA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fezA02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2fezA03
2VE9A 3REOA 1J9IA 4G1TA 3KEQA 1R58A 5ILSA 4KNYA 5IT9Z 2Q7FA 4NHJA 4BTAA 2V79A 5K5QA 2IA2A 3R0JA 3GWZA 2LF8A 4WXHA 2XAJA 5KJLA 2VC0A 3P9IA 1UHMA 5LRSA 1ZRCA 3N71A 5E1XA 4OINF 2EV6A 1EV7A 3E3VA 4J8EA 1L0OC 2XGMA 4LLNA 2UY1B 2P6SA 4AWXB 1MJ9A 5HS8A 3COAC 4MNUA 4UVBA 2ZNYA 2STTA 2BRFA 1UB9A 2E1NA 2HKXA 1DP7P 4B94A 4TV7A 4I7HA 1T2KA 4YG2F 2FBIA 2GAUA 3CVPA 1G4DA 5FD5A 2XASA 4HOTA 2MH9A 2E2EA 4AY5A 2C0LA 3UNMA 2IRFG 3OUNA 2C0MA 2EFPA 5DEQA 3W6JB 4BQAA 3R4KA 3LFKA 2P4WA 2ADUA 4XSXF 3KETA 3LAJA 3ERED 1FX7A 1S29A 4RG6A 1K2NA 1OYYA 3T5XA 2NNNA 2M30A 3IKTA 5JJ6A 2IA1A 5D8KB 2DPUA 4KYWA 4BHPA 3VPYA 2PMUA 4M9XA 1H9GA 3BJOA 2M1BA 1LVAA 2QQ9A 2FOKA 3O48A 2XAGA 2KJBA 2CWEA 3Q4AB 2W25A 2EA4A 2F5FA 2PEXA 4BHBA 1O3QA 2HKOA 4FX0A 1OUVA 1UHTA 4WCGA 1IXRC 3CO7C 3WE2A 1G3WA 4M74A 3E5UA 2EB7A 2XVCA 2NYXA 1IF1A 1G6NA 1DPRA 3EQLF 3ZMTA 3EYIA 2NC9A 1TW3A 3ASDA 4IRIA 1FHRA 1IN8A 1YS6A 1HSTA 2RNJA 5FZRA 1DDNA 4IJAA 2Q8KA 2HO1A 1I27A 3ASGA 3IRQA 1O3RA 1S3JA 1NA3A 5DD8A 1J7KA 3HSEA 1O7FA 4L0YB 2M87A 3HOTA 3WG9A 5BPDA 2VODA 5DD4A 1JHFA 1DUXC 1TTYA 5BQTA 5ICCA 4HBLA 2XT9B 1KQ9A 1O3TA 4KBQA 4Y6CA 5JJ7A 3RKWA 3IKVA 5F1RA 3I58A 2OQRA 3PFIA 5A2QZ 3OXLA 1HH8A 1MJBA 3TDZC 1BC7C 4M6XA 4Y15A 2QVOA 4M9SA 5E1WA 5IT9K 3EETA 2WWYA 3F6OA 5LCWJ 2AFFA 2A68F 3NQOA 2BUGA 5DBKA 2CO5A 5DCMA 3U1DA 2Y4UA 1HW1A 5LHHA 3KZYA 3WGIA 2MH2A 5L3FA 4I17A 3M8EA 1WI9A 4U07A 3KT9A 2MLGA 1A04A 3ZPJA 2ZJ2A 1D3YA 4LFUA 4M71A 2H6CA 3F21A 4QCJA 5CLSA 5HVQC 3RTRA 4F7ZA 3WTUC 4PCQA 1O3SA 4NQWA 3KFWX 5L3EA 1HSJA 3M9AA 2XUBA 2LNBA 1QQIA 3VOEA 4A2UA 3GEZA 1KT1A 1F1ZA 2V1UA 4ESBA 4HF1A 1LEBA 4G25A 1YW7A 2HTJA 2C2LA 4N2SA 2CQKA 4YFXF 1H0MA 4EGZA 4N5CA 3Q9SA 1CF7B 3L00A 5AYWD 5FJYA 4A0XA 3GQSA 3UV0A 1LQ1A 3BROA 4G6QA 1SMYF 5EEHA 1KYZA 4L18B 4UQYA 3VA1A 3AS5A 4G7HF 5CYVA 3N4MA 4RB3C 5FZSA 2IVMA 5E18F 2PLYA 1A17A 5FD6A 3MV2B 2V1DA 3EUHA 3M8FA 1MDMA 2VOPA 1IRFA 4OIPF 4UVAA 3I59A 2IT0A 2GQQA 1R7JA 4AIJA 4P5OA 3J80K 2XAHA 5JVTA 4ZYHA 2F5DA 1YW8A 2R7FA 4H7YA 3LQRA 1Z1DA 1Y0UA 4RS8A 1QZYA 3WTXC 1WAO1 1J4OA 5IT3A 3D0SA 3MWMA 3ZN0A 4MTDA 3CK9A 3ROUA 4HOQA 4I0AA 4IF4A 1W7PA 3TKYA 2CW0F 5LRRA 1TQPA 1ZG3A 4A0ZA 2XKOA 2COMA 4L9VA 3ZP5A 1KLXA 2L3DA 1S7AA 2X4HA 2HFHA 5CVJA 1W5TA 4EM0B 1YTYA 4XLPF 1XDSA 3VEPA 1YJMA 4ESJA 2WQHA 2FNAA 1QGPA 1V4RA 2LKPA 4YFNF 1HZ4A 3TO9A 2OBPA 1HKQA 4M72A 1GXPA 1B9NA 1BBYA 3V8KA 3WODF 2JQJA 2AS5F 5F64A 4A6DA 1U5TA 2KIMA 1Z6RA 2EFQA 1HKSA 4JK1X 1U78A 4UHTA 1ZARA 1ZRFA 5KJKA 5HDKA 2NS0A 3FF5A 2XKPA 2FXAA 4P9FA 4JHRA 5D5UB 3CO6C 1WLNA 2DFIA 2JTVA 5K1YA 5A7DB 2DPDA 1FLIA 4KMFA 3CKCA 1XGOA 4GXOA 1RNLA 4HOBA 4WXCA 1QZ2A 1ZN2A 5LHGA 5LEKA 4G24A 5HLIA 5TJJA 1Z9CA 4PGHA 4I98B 2V1XA 1YQAA 3ISPA 1Z6TA 4G6DA 3GW2A 3TG4A 3DPLC 5DJOA 4HA8A 2RQPA 2ZXJA 5H20A 3DV8A 1Z05A 4M9ZA 5CVIA 1JHHA 2P5LC 3E6CC 2ETHA 2K7LA 4N9HA 2NRAC 1SD6A 3VB2A 5FT9A 2XIGA 2Y0MA 1XGNA 1R5GA 3FFLA 2GW1A 5JFRA 4ENKA 3B02A 3V8LA 3RJVA 4NRHB 1F4KA 2HWVA 3Q15A 1ODDA 3P7NA 3FMSA 2PN6A 3QWPA 4IXAA 4Q47A 4I02A 2YPRA 3LA7A 4HOUA 4KIGA 4L9TA 4HV5A 4KUMA 1KQ0A 2XRNA 2MC3A 4ZH4F 3J81Z 1PDNC 1PP7U 5LGUA 2FQ3A 3ELSA 2KCVA 1W5SA 2Z5UA 1FSHA 2PL2A 2HYFA 3HSRA 2YX7A 3SFZA 5FFXA 2HR3A 3DKWA 3I6WA 5E8IA 4OIRF 4EGXA 2KRFA 3CDHA 2Q2EA 2DK8A 2ISYA 2DK5A 2JT1A 3K9TA 1FBQA 5D4RA 2OOEA 3QDNA 1R00A 3URZA 3TOBA 5D8LB 1T0FA 4GYGA 1L3LA 4L5JA 2HOEA 4IHTA 3WTVC 3LQQA 3R6SA 1WQ2A 5ILVA 3J80Z 3S7DA 2RV8A 2G7HA 2HDCA 2I6HA 3G3ZA 1PUEE 1FNNA 3GZ1A 1YG2A 3HTUA 1RUNA 5H6RA 5K5OA 4F3VA 3QWWA 4HDUA 2KB3A 5EX0A 1R1UA 2FBNA 3V7SA 3E4BA 1EH6A 3ELKA 1STZA 2ESNA 2L6JA 5ERIA 1BI0A 3RO2A 4BNCA 2OZ6A 1YLFA 3IWFA 2DT5A 2XGXA 1I1SA 2FNPA 4UNOA 4Q5SF 3VA4A 4BXUA 2GWRA 1XSVA 1T38A 1HXIA 5KVRA 2OD5A 5JJTA 3V7RA 1S7OA 2ZKZA 4EM1A 4XLNF 4U0UA 1I6XA 1HQCA 3ZMVA 1F5TA 2A61A 5CHEE 3T0YA 3S2WA 4A0EA 4EJWA 4N2QA 1YFHA 3K1MA 2XGOA 3WE3A 1ZAOA 4HF2A 3BWGA 1ON1A 5LGNA 4ENMA 3RYRA 3TQNA 2K4JA 4LD5A 1SFUA 4O5VA 2QENA 4AVPA 3SZ7A 1J2XA 4U7BA 1J4PA 3TOAA 3LY8A 2B0LA 2MBFA 3BP8A 3KP2A 3TO6A 1QO0D 4WNGA 3N97A 2HEOA 3TO7A 3KP3A 2WTEA 3CVNA 2NNYA 3M7GA 1ZU2A 1LJ9A 4LB6B 3DXJF 1G3SA 5E20A 1XGSA 2ZMEA 3HYMB 3Q49B 3IWZA 3UN0A 2BE5F 4EMSA 4HX7A 3QPHA 4MGRA 3LWFA 3V8JA 1E96B 4JBAA 5CVVA 2F5EA 2Y75A 3TGNA 2EV0A 3RPQA 3GFMA 2XGSA 3K1NA 2QBYB 3POAA 3FM5A 3R0AA 2X0LA 1K3NA 5FO5A 2VBXA 4HX8A 2UZKA 5HLGA 2VBWA 2A6EF 3KD7A 2RVCA 1XCBA 4HV6A 2FRHA 2LSVA 3S7FA 3C1DA 3ML6A 3UUXA 1LB2A 3LSTA 2H6BA 3QP5A 3NEUA 4LG0B 1UJXA 3UNNA 3DP7A 5KK1A 4A1SA 1ZYRF 3P9KA 1R22A 4U88A 2O6GE 3FMRA 1GXCA 1BI1A 4J8FA 1ZGAA 4ZYGA 4HYEA 3LKUA 2F2EA 4IPAA 1WV3A 4RAZA 1KU2A 4H87A 4CICA 3T8TA 3F8NA 4ASNA 2MHKA 5FLXK 4PDKA 1QPMA 3QWVA 3C7JA 1ZRDA 4U0YA 3UOTA 1U2WA 2WV0A 3K0LA 1FT9A 1MZBA 2FF4A 2PZIA 3CK7A 3I0NA 3U4TA 5A6CA 3TGOA 3CUQA 3Q47B 4EJQA 4WNDA 1SD5A 4G7OF 4MQVA 2L4MA 3F22A 5HS9A 3SF4A 5CVRA 3ZHEA 3GF2A 2VGXA 3SQNA 2OU2A 4G94A 4LB5A 3I64A 2W3OA 5BT1A 1LGPA 5ICEA 2VE8A 2GZWA 4GGGA 1WSUA 3JW4A 2PQRA 1GXQA 4UQXA 4J8DA 5DUIA 3FZVA 1QU5A 1Z91A 4GYYA 1TQMA 2BGCA 1P6RA 2PQ8A 4CYDA 3BZ6A 1B59A 4I09A 1P2FA 4OIQF 4KT5C 1W7PB 2IF4A 2R5SA 2UY1A 2E7WA 2HS5A 4OOIA 4HZFA 2L54A 3KEOA 1K7AA 3R9AB 3HTSB 3V4GA 1D8KA 2G9WA 1FYMA 1T6SA 4W9RA 3OV8A 3C3WA 2H09A 1IRGA 2FMYA 2QZ8A 4KICA 1U5TC 1BI2A 5BMZA 3JTHA 1ZH5A 4PZJA 2IFUA 1T98A 3E5XA 3HX1A 1FZPB 1QNTA 4XBFA 1USSA 3SXYA 2H27A 1NZNA 1SFEA 1TW2A 4XI0A 2XAFA 2O61A 5HDNA 2YR2A 3ESKA 3GYHX 3RIRA 3GFIA 1OKRA 1CF7A 2HYZA 2A07F 5E1ZB 3AS4A 5EKQD 2MD5A 1RIOH 4RGRA 4UI9K 4KYOB 5BOXA 2VC1A 4HDVA 4YIFA 3QOUA 2XPIA 1MZKA 3I53A 3HRMA 5H6QA 4Q4ZF 2K4BA 4CGWA 2DTRA 2VSYA 1K2MA 1MDMB 1SD4A 3LY7A 1FY7A 3E5QA 3CUQC 1ZLJA 3MEKA 5DCFA 3IC7A 3G73A 3NRVA 3LCAA 3MCZA 2STWA 1LEAA 4EGYA 1SFXA 4RGUA 2KC7A 3BJAA 4AIFA 2BYVE 2VN2A 3MA5A 3R60A 4ZYEA 1J4LA 2DBBA 3E6MA 3GZ5A 2BBYA 5AIPA 4UQZA 3JAMK 1IXCA 2QUFA 4AD9A 4G7ZF 4LK1F 2ZCWA 4RGXA 3I5UA 3FM8A 1HW2A 2XAQA 5L3DA 1KGSA 3U3WA 4GO1A 2DQRA 4ZZLA 3L09A 2JKDA 1TBXA 3ULQB 1BIBA 1PP8F 2DU9A 1K79A 3O6BB 3RYPA 5TRDA 3DF8A 4HAMA 4BT8A 2JSCA 3BDDA 1XCVA 2VXZA 4WNFA 3KS2A 3F6VA 3QPTA 2F5CA 1KQ8A 2MLKA 4FHTA 3ZN1A 3HUGA 1Z7UA 2A69F 3KP5A 3QP6A 1K3JA 5LHIA 2JPEA 5HQ8A 2QM3A 3MDBA 3QAHA 1QZZA 2D1HA 3FWVA 1QBJA 4A0YA 1U3EM 1QQEA 5JHUA 2D2WA 3I54A 3CVLA 5BPIA 2FSWA 3WTTC 3V7CA 1FYLA 1FHQA 1YO5C 5D5XB 3KCCA 1IN4A 1FC3A 4N0BA 3KP7A 2P5KA 4JONA 5D0OD 1YS7A 5K5RA 2DAOA 2PQNA 1IHGA 1OPCA 4BYYA 3EDTB 3HRSA 1ZBPA 3TDUC 4XSZF 2DW4A 1KA8A 2XCCA 1REPC 2TDXA 2PMHA 4DQ2A 1KT0A 3T1BA 5J8CA 1FCHA 4I2OA 4UUVA 2A3SA 1KU3A 1UFMA 3CLOA 3QKYA 4WWCA 2KB4A 2IP2A 4Y6WA 2IJLA 1ELRA 2VYIA 4XI9A 5L3GA 3OXGA 2AVPA 2FMLA 5FB2A 1J4QA 1J75A 1K78B 4HORA 4NB5A 2VT2A 3GW4A 2KCLA 1W3BA 2C6YA 1B1BA 1P4AA 4GCVA 2EH0A 1K3QA 4P55A 3Q5FA 1B6AA 5D5WB 4RB1A 1KU7A 2LSUA 2GA2A 3CTAA 3VTXA 2VQ2A 3ABUA 2HR2A 4EJOA 2GIVA 3I0MA 1IZ1A 1HXDA 5HI7A 1FBSA 2O0YA 5DDGA 4BTBA 1KYWA 1LNWA 3PE3A 4LMYA 2CYYA 4BT9A 3QU3A 3W6KB 1XMAA 4ETSA 3PDNA 5LLQA 4CXFA 2ACJA 3F3XA 5DIZA 3BPXA 3LY9A 1FP2A 5J8FA 2W85A 5HS7A 5LGTA 2JLBA 4RB2C 2Y48A 3RKYA 3K1PA 5EEGA 2HYGD 2QQBA 4LLLA 3KAEA 3GXOA 3K2ZA 3MAJA 4RB0A 2RDPA 1U8RA 4CZZA 2P8TA 2JZYA 2Q0OA 3RI4A 3QRFF 2EA2A 1D5VA 1P4XA 3BPVA 3M1EA 1TNTA 3F8FA 1IUYA 2V9VA 1ELWA 4N3BA 4GYOA 3RJPA 2VSNA 2OZUA 1UHWA 4GYWA 4UVCA 5AIQA 3HIFA 2BEOA 2HQNA 4JA7A 2L4AA 2MA3A 3K9IA 5FFZA 3RPUA 1USTA 1SMTA 4XIFA 3ZGQA 3LA2A 4QWQA 4EV0A 5D0QD 3SHFA 2FE3A 3UPVA 3DEUA 3ZPLA 4EQQA 4UV8A 3JYSA 4A6EA 1JGSA 4Y13A 1BJAA 2JRTA 4U7DA 2CG4A 1S6LA 1FSEA 5E8GA 4RGSA 4KIFA 4RG9A 2Z33A 5DCMB 5FTPA 1B4AA 4EJUA 4H0EA 2QQAA 4H7XA 4CHUA 4CDRA 3P9CA 1P5QA 4I1AA 1HW5A 4BHCA 2CSOA 3KLNA 3SZPA 4YVQC 3HUEA 2RC4A 4U04A 1P92A 4G2SA 3FXRA 4B09A 2P58C 4ABNA 5FZQA 3WTSC 1HKTA 2PBIA 3LYAA 1MGTA 1TJCA 2RGVA 5JI6A 2XV4S 4N3CA 3O2PE 2DQLA 3KZZA 4LJZF 3F8BA 5FLXZ 3VTYA 4MHGA 3UQ3A 4OIOF 4I2ZA 5F6FA 4LGWA 4GCOA 4B8XA 3MEXA 2LSOA 1RZ4A 1BM9A 4YVOA 1W7PD 5J6XA 3FHZA 1LDJA 3FXQA 1BC8C 3ZMSA 5D6FA 2J9QA 4ESFA 1AWCA 2UWMA 1WRJA 4D0PA 1SD7A 1W4MA 3AS8A 3BJ6A 4U0ZA 4YIIA 2J5PA 2KATA 3J81K 6PAXA 3H3UA 4MTEA 2UWJG 4IHSA 5E50A 4U0SA 4U0WA 4KA4A 2L01A 1ON2A 1ONVA 2JQIA 3S7BA 3WGGA 3VFZA 3LAPA 3PE4A 1LDKB 1XDUA 5BW8C 1ZG1A 3FMQA 4IN3B 1P4WA 4O3MA 3H92A 2M45A 3OOPA 3I59B 4LG0A 4A5MA 4U0VA 3WTWC 1IN7A 3BY6A 4L9JA 4FX4A 2G1LA 4KFCA 2KKOA 1HBXG 4E70A 3E6BA 1IYGA 1IXSB 2IW5A 4KN7X 4WXDA 4IRHA 5LCWC 3L9FA 1R1TA 4MEYF 3ZN3A 3ZMZA 2QWWA 5E17F 3EDPA 2LDUA 2K27A 4ENNA 2QBYA 1CGPA 2EK5A 2QYOA 2YHCA 2CFXA 4WX9A 3CKBA 2PFBA 3WU0A 5HOOA 2HTSA 3ASHA 1K78A 1WM5A 2FA5A 3CEQA 2KIFA 5LBQA 2UXXA 2D45A 4WNEA 4CGVA 4M73A 3GLXA 2NAZA 3JTGA 1G6GA 2JPCA 1OYIA 5ICGA 4WUYA 1FBUA 2H94A 2K86A 3HRTA 4IRGA 1LDDA 4UI9C 1H9TA 3U2RA 2V6CA 3IEGA 4ZYDA 4R1HA 3HUFA 4A5NA 3FX3A 1TQIA 3RIBA 1R1VA 3KE2A 4CO8A 3S7JA 2O03A 4JA9A 2GA1A 2JQLA 2OA4A 4I0BA 1Y8MA 3Q9VA 1ZREA 2Y4TA 4GA2A 2IPQX 2P5VA 4GZ5A 2PG4A 4MQ9F 5FGMA 4NQ0A 4AY6A 3NF1A 3L7WA 3ULQA 5CJ9A 1R5HA 3WXXA 4L0ZB 4APOA 4JL0A 1B9MA 3O3KA 3ASFA 2D1VA 2W84A 3ZHEB 1GVJA 3MV3B 1S8NA 4G9YA 5CCLA 2IA0A 3D5LA 4N39A 2EWNA 3MZYA 3QU6A 3OXFA 2E7XA 1XNFA 4WK8F 2P7VB 4R79A 4LK0F 5L3CA 1F9NA 1TLHB 3GO5A 2A6HF 3HOSA 1YW9A 2A0TA 1WWXA 1XB4A 5HDGA 1MKMA 2RKHA 2ISZA 4EJVA 1BI3A 4BAYA 4GA0A 1DMZA 1J59A 4G23A 4EJTA 4UV9A 2WPVA 5G04C 4Y17A 3TAXA 3ELVA 4K2EA 4ON0A 3EYYA 5C1DA 4I9EA 1GHCA 4N9IA 4R8HA 3MQ0A 1ZGJA 1ZLKA 1DPUA 2HQRA 2YU3A 1G3YA 4FT8A 2FBHA 1OYWA 3F8CA 5ED4A 3GYZA 4CGZA 4I01A 2YX4A 5ARGA 4OU0A 2VONA 4G8XA 2O3FA 1I5ZA 2J5OA 2P7CB 2EFNA 5ARFA 2FO7A 2OAZA 5ILUA 4KIBA 4KDPA 1E17A 3F23A 5KJMA 4P9UA 2BV6A 2R7DA 3E97A 2KFUA 1IAWA 3CJNA 2KIUA 2VOOA 2A5YB 4WF2A 1VTNC 2E1CA 3BOQA 1MD0A 4HLYA 1D8JA 3GVAA 4S05A 4ZZDA 3MKRA 3ZFWA 4G26A 4S04A 3CK8A 1T39A 3HHHA 1J4KA 2KJCA 3MZHA 4AIHA 1ZG5A 5G05J 2O8XA 3RKXA 3KLOA 4OMYA 4YNDA 2VBYA 1OMIA 3B73A 1Q1HA 1PC2A 1XSXA 5CCMA 2ESHA 3I6UA 4GPKA 1G3GA 5D6EA 4EQFA 2DI3A 4HQEA 4ENJA 4KMUX 1V3FA 1B89A 3KP6A 1ZHFA 1KU9A 4YFKF 2WC2A 3C18A 1I1GA 3PQKA 4CDGA 2FU4A 1U5TB 3FP3A 5BS6A 2DO7A 1U6GA 1EH8A 2XHKA 1FP1D 1O57A 2PJPA 3IHUA 3HYIA 5AONA 2CSWA 4I9CA 3F8MA 3CUQB 1XSDA 4BWRA 3E6DA 1OR7A 4N3AA 5G04J 3RKVA 3RU0A 1IN6A 3ZMUA 1XN7A 4Q48A 2ZFWA 1JE8A 5DUKA 1JXSA 3DQVC 3CV0A 1IN5A 3GFJA 3U9GA 5DV5A 4HOSA 2JPBA 5A8IA 5D4SA 1TNSA 3JAMZ 4PGGA 3R61A 4MEXF 1LGQA 3IRRA 1X3UA 3GZ2A 1WKMA 2W57A 4O6FA 4QLCU 5ICFA 3QOPA 4RAYA 1ULYA 2R3SA 5D5VB 3JSOA 5KJNA 3LA3A 4P96A 4M6YA 3GZ6A 3ECOA 5EX3A 4LEUA 4EVIA 3DFGA 1C0WA 4OMZA 3H3ZA 4HF0A 1XGMA 3FM3A 2RN7A 2GXGA 3LPZA 2PI0A 4ME2A 2LC1A 3I71A 3UMZA 1FOKA 1YIOA 2Z3YA 4HX4A 4JQFA 3FXUA 1J5YA 2XROA 2KCKA 4D9VA 1RUOA 3I4PA 4UI9J 2K02A 2FEZA 2V5FA 4KXKB 3TG5A 2AXLA 3HHGA 4UXNA 5A2QK 2LF7A 3BEEA 3KP4A 4KN4X 5DYMA 2EFWA 2ZMEB 2LNIA 2ONDA 2PIEA 4GZ6A 2EV5A 4BH9A 3VODA 4L5IA 2FI7A 1J0RA 2HZTA 3Q5MA 1G3TA 1RI7A 2YSRA 3WU1B 2KKLA 3ZMDA 4GCNA 3I0TA 2YQ8A 2XEVA 2GXBA 4G2VA 3K69A 1NA0A 1XD7A 2M8EA 1XMKA 3GFLA 3SZTA 4IVNA 3ABTA 3J7AO 2ZO4A 2OQGA 4GA1A 4Z2YA 3ECHA 4GYIA 2CGPA 1E2XA 2DBAA 3WGHA 1MJAA 2ZNZA 5JR3A 2QLZA 3PQJA 2XCBA 1R21A 2Z9OA 2Z99A 1AOYA 3F72A 5G05C 2M5WA 4HQMA 2W24A 4I2WA 2FBKA 4EM2A 3JSPA 3WTYC 1K6OA 2VT3A 3PO8A 3HSFA 2G7UA 3HRUA 4HLXA 5LEJA 4DNCA 1BOAA 2UXNA 4O6JA 4AIKA 3CUOA 2VBZA 5HLHA 1FYKA 2QFCA 1YA0A 3FWEA 3ZQ7A 4A12A 2VGXB 4HW0A 4XRFA 2EFOA 5CVUA 2P6TA 4J0UA 2ZBKA 2L02A 1BN5A 4GZ3A 3IL2A 2ELHA 1YJ5C 5BNWA 3T8RA 3MFKA 1FPQA 2HGCA 1YYVA 1NHAA 3L2CA 1R23A 3GX4X 3CVQA 5M72A 4LLGF 2EJRA 1IW7F 1SAXA 3AAFA 1BIAA 1EH7A 1UCRA 3DPTA 3RDIA 4AM9A 1R36A 3GUDA 1FWZA 4L9NA 3WTZA 3RO3A 1O7LA 2DLLA 2VGYA 5L3BA
chains in the Genus database with same CATH superfamily
3FULA 2VE9A 1E7UA 1PY1A 3REOA 5EJGA 1J9IA 2DYSE 4G1TA 3H9GA 2CFUA 3KEQA 1R58A 1EKEA 5ILSA 3FKIJ 4IX7A 2Z16A 4KNYA 5IT9Z 3HPHA 1MH3A 2Q7FA 1VQ4I 2XSJC 3V8NA 2DDAA 2LBFB 4NHJA 2X38A 5FKKA 5FQ4A 3E34A 1U3CA 1TWCJ 2VI6A 4FASD 4BTAA 1Z21A 3SI5A 1IRXA 2NS7A 4H4KC 2V79A 5K5QA 4KT6B 4NACA 3HXCA 2BHZA 5CBNA 2IA2A 1YT5A 3R0JA 4G8LA 4XRSA 3GWZA 4EZLA 4XKVA 2NXPA 2LF8A 4WXHA 2KFDA 1V55H 2XAJA 5KJLA 3E1SA 2QC9A 3G4SI 2VC0A 2QF7A 3FU3A 5M5YJ 3WG7E 3P9IA 4RAGA 1S72I 2H6IA 1UHMA 5LRSA 1ZRCA 1J09A 3N71A 4BSXA 4I6EA 5E1XA 4ZDLA 4A3TA 2DOFA 2W00A 3FXJA 4OINF 2K5CA 5KNGA 2EV6A 5IY5E 2CH0A 3ZYMA 2DA5A 1EV7A 3E3VA 4J6IA 3CHSA 4J8EA 1L0OC 1TNBA 3K2AA 4L23A 2XGMA 4RVBA 1BJZA 4GTMA 1FIAA 2EINE 1GV5A 4LLNA 2UY1B 1JUSA 2P6SA 3DBRB 1Q2ZA 4AWXB 3QARA 4K0RA 1NTCA 4XX5A 4F55A 1Y1WJ 2VKDA 1MJ9A 4DZPA 2IO3C 5HS8A 3COAC 4MNUA 3K4NA 2J09A 3ABMH 1D1CA 4UVBA 2WQ7A 2ZNYA 2STTA 2ETAA 5CBOA 5BXOA 3E7LA 4HSTA 2WXPA 2JA7J 1UB9A 2AXTC 2E1NA 2Y0BG 2BRFA 1FMWA 3TMOA 4IHWA 2HKXA 4HPQA 4BBSJ 1DP7P 1N52A 4KJZA 1R71A 3DSTA 2QKMB 4TV7A 1QU3A 2VJIA 4GMJA 4XI0A 5AQ9A 4BETA 3TXNA 4I7HA 3A1YA 3NBNB 3ZYQA 1T2KA 4YG2F 2FBIA 2GAUA 3CVPA 1G4DA 5FD5A 4IRUA 2XASA 2QYJA 4NBQA 4HOTA 4DYRA 2JVHA 1OY3D 2MH9A 2E2EA 4AY5A 4DZJA 2C0LA 3UNMA 3OR2C 2WADA 2XRLA 2IRFG 2NSZA 3OUNA 3VWBA 4CSWA 5DHUA 2C0MA 5B66C 1JUMA 2JGRA 2EFPA 5DEQA 1MK2A 2VIXA 3W6JB 4BQAA 3R4KA 3O4ZA 5K7FA 2LTPA 3GZNB 3LFKA 2P4WA 2ADUA 4XSXF 3LS8A 3FTSA 3KZIC 3QC1A 5M5XJ 4L1BA 3KETA 4YIRX 3CDIA 1K4TA 3LAJA 2B0OE 3ERED 1B72A 1FX7A 1S29A 4RG6A 1K2NA 1OYYA 3T5XA 1QRYA 2IBDA 2NNNA 4CDMA 2M30A 3DSVA 1V5FA 3IKTA 3ML9A 5JJ6A 2IA1A 5D8KB 1WHUA 2BHYA 1HFAA 2DPUA 5IOYA 4KYWA 2F8XK 1W36D 1MNDA 1TT0A 4BHPA 3VPYA 2QZAA 3Q78A 3CZ6A 2PMUA 4M9XA 3S3NA 2IO2C 5FRNA 3JRGA 3G2WA 3TWRA 5BVIA 1H9GA 4IOCF 1X2MA 4AVXA 1VDYA 3DSUA 3BJOA 2ME0A 2M1BA 1LVAA 2ZU6B 2GRMA 2WQ6A 3Q9NC 2QQ9A 1X3WB 2FOKA 1H8AC 2XAGA 3O48A 2KJBA 1JKQC 2CWEA 5M3MJ 2JABA 3Q4AB 3V80A 2W25A 2EA4A 2E5ZA 2F5FA 3LOCA 4DBQA 5M3FJ 1AU7A 2PEXA 4BHBA 1O3QA 3S15J 2CHWA 4HS2A 2HKOA 4FX0A 1OUVA 3G2TA 1UHTA 2W7NA 1FPPA 4WCGA 1K4SA 4S0HB 2I2AA 3DEWA 1IXRC 3CO7C 3KSLA 3WE2A 3SDGA 1G3WA 3D3MA 1ZOQA 3TEDA 4M74A 3E5UA 2EB7A 2XVCA 2NYXA 2VQGA 1IF1A 1G6NA 3VDXA 1DPRA 1E0EA 1NK3P 3P1UA 3EQLF 3ZMTA 3EYIA 2NC9A 2ZGGA 1TW3A 3ASDA 5CQGA 4IRIA 2J08A 1FHRA 1IN8A 1YS6A 1G8XA 1ORKA 3DCFA 5EZHA 3APDA 1RPWA 2IAIA 1HSTA 2RNJA 3VYTB 3OYKA 5FZRA 1YJWI 3D9HA 4BY7J 5AQAA 4A69C 3W9GA 1DDNA 4IJAA 2Q8KA 2HO1A 1I27A 3ASGA 2ZJPF 3IRQA 2O7OA 3CCJI 1O3RA 3S14J 3DSWA 3LEWA 3ZYKA 4EECA 3OWTA 1S3JA 1NP7A 4B8CB 2HNHA 1NA3A 4DY6A 5DD8A 4TUUA 1J7KA 3HSEA 4NC6A 4L7TA 1O7FA 2K9MA 2LR8A 3ZU7B 4L0YB 2M87A 3HOTA 3ZRGA 3WG9A 4BGDA 5BPDA 2VODA 5DD4A 1JHFA 1DUXC 1WGXA 1TTYA 1TYQG 2IU1A 5BQTA 4BJ6C 1RKWA 2PJRB 5ICCA 4HBLA 2GIZA 1VNDA 2GOMA 4PSXA 5E3MA 2XT9B 2JMWA 3AG3E 1SZ9A 1KQ9A 1O3TA 2RFAA 4KBQA 3H5AA 4Y6CA 3BTLA 5JJ7A 5EJFA 2WB1A 4X1EA 3RKWA 4L2LA 1BPOA 3IKVA 4II3A 1HOMA 4W1UA 2OPTA 3I58A 2OQRA 3PFIA 5F1RA 5A2QZ 3OXLA 3TW6A 2Y0SN 2IS2A 1HH8A 1T95A 1MJBA 3GTJJ 3D5RC 4A3DJ 3PL8A 3TDZC 4C3HJ 4M6XA 4Y15A 2QVOA 1BC7C 2E35A 1MSFC 1NL4A 1OWMA 4O60A 3NWSA 1YGSA 3LSMA 4M9SA 1BA5A 5E1WA 3CCLI 2HOAA 2EIKH 5IT9K 1FVHA 5ENOD 2KB4A 4JP0A 5F1JA 3EETA 2WWYA 3F6OA 1Y0NA 1DU6A 2QSFX 2A68F 3NQOA 4MRUA 5LCWJ 1Y3IA 2AFFA 2BUGA 5DBKA 2KQRA 1G3NB 4NIKA 2CO5A 5DCMA 3U1DA 3PO2J 2Y4UA 3B7BA 1MR1A 1HW1A 4JHJA 5LHHA 4B4CA 3FU6A 3E37A 3KZYA 2MG4A 3WGIA 2MH2A 5L3FA 4I17A 3M8EA 4PFOA 5KBAA 3AFOA 3G71I 1WI9A 2M4GA 2DXIA 3GTLJ 1E8WA 4U07A 3KT9A 3S17J 2MLGA 3Q9UC 1A04A 3ZPJA 4RAFA 2X85A 2ZJ2A 1D3YA 4LFUA 4M71A 2H6CA 3F21A 2R59A 2VL8A 2KHMA 2LXLA 4QCJA 5KNHD 1PYVA 2WY7Q 3K4JA 3DXMG 3HUGB 5CLSA 1WJEA 3DBLB 5HVQC 4MIMA 5FQ8A 2GRQB 3FTWA 4E7HA 3RTRA 4TXPA 2COBA 4F7ZA 3C2HA 3WTUC 4PCQA 3FEXA 4AXHA 2LY1A 3ABKH 1O3SA 4M3OA 4NQWA 3KFWX 3OIQA 5L3EA 1HSJA 3M9AA 2XUBA 3AL0B 2LNBA 2UUZA 1MBJA 3CSFA 1QQIA 3SZGA 2EIJH 2JJ7A 3VOEA 1JCSA 3ZRHA 2K85A 1LVKA 1LD8A 3A77A 4A2UA 1K1AA 5ENPD 4CCLA 3BTJA 3GEZA 2V9PA 3VPRA 1N77A 3ZKJA 1KT1A 3V8RA 1X4PA 3MVPA 2XAUA 1RW2A 3MJWA 3Q0VA 1F1ZA 1N4SA 1S7EA 2DYRE 2V1UA 3G1MA 4ESBA 4HF1A 1Y56A 1VQMI 1SC7A 1LEBA 4G25A 2YNQA 1YW7A 4BS9A 3E33A 2HTJA 2C2LA 4N2SA 2R7UA 3MGBA 2CQKA 1Z7LA 1TN8A 4NURA 4YFXF 2DA7A 1H0MA 4URKA 4EGZA 3B7SA 3PH0C 3CMMA 1LKXA 3BTIA 5EJCA 3Q9SA 2R5YB 4N5CA 3QNKA 1CF7B 3L00A 5AYWD 3EHRA 5FJYA 4A0XA 3GQSA 3UV0A 1LQ1A 3BROA 4G6QA 1LFUP 3FHNA 2L9RA 2Y30A 1SMYF 2XB5A 2V1NA 5EEHA 1KYZA 2P2CP 4L18B 4UQYA 2WXIA 2X6IA 3FTXA 3VA1A 1JWGA 3K10A 3AS5A 4G7HF 1WCMJ 5CYVA 4FJYA 3N4MA 4CCMA 3PFYA 4RB3C 3VLEA 5FZSA 2IVMA 5E18F 2O9LA 2PLYA 1A17A 2M34A 3CLJA 5FD6A 3I55I 3MV2B 3BR3A 3OL4A 2CQ7A 3GZSA 3JQ1A 2V1DA 3SEZA 1YCSB 1LUJB 3EUHA 3M8FA 1MDMA 2HU9A 2VOPA 1IRFA 5J1RA 1H2UA 4OIPF 4DIQA 3S2AA 4OYSA 2IGNA 4UVAA 3W2VA 1R6RA 4F3QA 2IS4A 3JUIA 3I59A 4R7LA 3DLAA 2Z1DA 4HSRA 2IT0A 2GQQA 2V0PA 4I6GA 1R7JA 3OYIA 4AIJA 3HXFA 4U8VD 4P5OA 3S1MJ 1Z3YA 1FTZA 1K8KG 1ZB1A 3TP0A 4NNJA 3J80K 2XAHA 5JVTA 5C4XJ 4UWGA 4ZYHA 5AJLA 2F5DA 2BEDA 1YW8A 4P29A 4U96D 3DRAA 2R7FA 1HF8A 2IGOA 3LQRA 3H9JA 3FUDA 3X2QH 2K9LA 1XMXA 1Z1DA 4H7YA 4KZCA 1Y0UA 3HJEA 4U63A 4RS8A 1TWHJ 1QZYA 3WTXC 1N78A 1WAO1 1J4OA 5IT3A 2KISA 3D0SA 3MWMA 1BW5A 3OYBA 3ZN0A 1Y8QB 1YJNI 3T9KA 4MTDA 1APLC 2L6BA 1VQ7I 3CK9A 2VJ8A 3L17A 4I99C 3H5RA 3ROUA 4HOQA 4I0AA 4IF4A 2E19A 3FUEA 2WXJA 5FQ7A 2BTDA 1W7PA 3TKYA 2CW0F 2OCEA 4RMNA 4BBRJ 4ZJZA 4JIVD 3S93A 1U7VA 4A3MJ 3AG4H 4ZYAA 3ZQGA 4FLBA 5LRRA 2DJNA 4AYBN 1TQPA 1ZG3A 5FRMA 4A0ZA 3KEYA 1ETQA 1P7JA 2R7ZJ 2EPFA 2XKOA 2COMA 4L9VA 3ZP5A 1KLXA 5B3SE 4FETA 2L3DA 1S7AA 2HVRA 5HODA 2X4HA 2AWIA 3UKGA 2HFHA 3EIJA 4JD2G 5CVJA 1W5TA 3TW7A 4EM0B 4NC7A 3JRDA 1YTYA 4XLPF 3MX3A 3UINC 3B6CA 3PZ2A 1XDSA 3VEPA 2IXSA 3QQAA 1X1AA 4PJMA 4K5BA 1YJMA 2ELKA 4DK5A 2X3MA 3RK6A 4UB6C 4ESJA 2WQHA 3PVLA 2R92J 5EEAA 1MH4A 2FNAA 1QGPA 4BE1A 1JT0A 1V4RA 1LTXA 1PUFB 2LKPA 3RCOA 4E7ZA 4YFNF 1HZ4A 3HZJA 3TO9A 4CT0A 3SD5A 2OBPA 1HKQA 1V5EA 3GTPJ 2RFMA 4HRLA 1X4OA 4AC0A 4M72A 1OCZH 1GXPA 1B9NA 2X9DA 1BBYA 1IDYA 3V8KA 3WODF 1I6HJ 3TWSA 1Z0SA 2JQJA 4XKWA 2AS5F 4ATGA 2QYUA 4OAZA 5F64A 4A6DA 1FOYA 1YX5A 1K83J 1U5TA 2KIMA 4FQGA 1LD7A 1XGWA 2VJ5A 3LJ3A 3BLYA 1Z6RA 3K4BA 4KVMA 2EFQA 1MQSA 1WVRA 4XKBA 1HKSA 4JK1X 1U78A 4UHTA 1ZARA 1ZRFA 5KJKA 3RZOJ 5HDKA 2FULA 4PJLA 2NS0A 3OS0A 3CMYA 3FF5A 2XKPA 2E1MC 3LSKA 3P5JA 2FXAA 4P9FA 5GTHC 1T08B 2ME6A 4JZYA 4OVVA 3AG1H 2XRZA 3LSGA 2MOWA 4JHRA 5AJDA 3MKYB 2EIMH 5D5UB 3CO6C 1HX8A 5ENRD 2LOOA 1WLNA 3HUFA 4CCKA 3KEAA 3FUFA 2WXRA 2DFIA 2JTVA 1DD1A 5K1YA 3KYDB 3HXDA 4BQQA 3QYFA 3FH5A 5A7DB 4F1SA 2W4SA 2DPDA 1FLIA 4KMFA 3CCVI 3CKCA 1XGOA 2CFZA 4GXOA 2R17C 1RNLA 4HOBA 5J40A 4WXCA 3A01B 3G1LA 1QZ2A 3HKZA 3DPDA 3HOUJ 3FU0A 3N05A 1ZN2A 5KAIC 5LHGA 2XEHA 5LEKA 4G24A 5HLIA 5TJJA 4HG2A 4BX8A 3CF2A 3ZEFA 1Z9CA 3BCAA 4LSZE 4PGHA 4I98B 2V1XA 1YQAA 3UMVA 3ISPA 1Z6TA 1FT2A 4G6DA 4LCTA 3GW2A 3TG4A 3MZLB 1GLNA 5KCMA 3VYRB 2J4DA 3DPLC 1LPQA 3NZSA 1G2HA 1FEXA 3RRUA 4B1RA 3I3LA 3UX4A 5DJOA 4HA8A 4DRXE 2RQPA 2ZXJA 5H20A 4GDFA 3I5PA 3LXUX 3DV8A 1ETWA 4L9PA 1OR7C 4PJNA 4DW6A 2LAHA 1Z05A 5LD2C 1SZAA 2QGUA 4M9ZA 5JVGF 3HHMA 3NB2A 5CVIA 3RRNB 1JHHA 2P5LC 3E6CC 2ETHA 4F91B 2V4LA 2K7LA 4DX6D 4N9HA 2NRAC 2MSYA 1U7VB 1SD6A 4A63B 2ECCA 2XENA 5JA4D 2KT0A 3VB2A 1TWAJ 2L0IA 5FT9A 2XIGA 3PSFA 2Y0MA 1XGNA 1R5GA 3FFLA 4QQIA 4FU3A 2CUZA 2GW1A 5JFRA 3OYGA 4ENKA 2H6FA 3A0BC 3B02A 3RPUD 2DVWA 4D7MA 3S7FA 3V8LA 3RJVA 4NRHB 1F4KA 2HWVA 2LXMA 2R93J 5J4VA 2P9LG 2LLKA 4MFEA 3U21A 5DHRA 3F6QA 1O1SA 3Q15A 4A4YA 1ZGWA 3ABKE 2LO6A 4I76A 4PSWA 1JCRA 1ODDA 3P7NA 2I9CA 2DJIA 3FMSA 2PN6A 3ML8A 3QWPA 4IXAA 2KZVA 1E3HA 4I02A 2YPRA 3LA7A 4Q47A 4KIGA 3PREA 4L9TA 2EILE 4XM3A 4HOUA 4DPRA 4HV5A 4KUMA 4ZFHA 2R2LA 4CRWA 1KQ0A 3PNVA 4L02A 2XRNA 2MC3A 1GW6A 1EPUA 4HVBA 4XLCA 2L7FP 1LFBA 4ZH4F 3QYEA 1VQ9I 1UG0A 3B7RL 3J81Z 3OAWA 4XZ4A 2HYJA 3AFHA 1PDNC 4YDOA 2KMUA 3CC7I 3BT9A 4MO7A 1PP7U 3PNTA 5LGUA 3MMYB 3JUEA 4L5EA 2FQ3A 2CU7A 2K40A 3ZGKA 4HI8A 3ELSA 2KCVA 2ZXIA 2GBYA 3L2QA 2EZLA 1W5SA 2Z5UA 1FSHA 1W36C 2LREA 2PL2A 2HYFA 3HSRA 2YX7A 3SFZA 3LDZA 2WXQA 5FFXA 1O1TA 1N11A 2X6XA 3CHRA 2HR3A 4OAVB 3DKWA 5CECB 3I6WA 4DYCA 5E8IA 4OIRF 1XS9A 4EGXA 2KRFA 3CDHA 1OCZE 2Q2EA 2DK8A 1JKPC 1GUUA 1ELKA 2K9QA 2ISYA 1TN6A 2DK5A 1DVPA 5EG0B 3C3OA 3FTZA 3RSNA 4LNGA 1JT6A 5BUZA 2JT1A 3K9TA 1HDPA 1FBQA 5D4RA 2OOEA 4F93B 1ITYA 3NAUA 3QDNA 4G12A 4OWRB 3S3MA 1A6IA 2YUSA 1PJRA 1R00A 4B0ZA 4D10C 3URZA 2M7BA 3RSEG 4ZTFA 3D5SC 3TOBA 5D8LB 1T0FA 2X6HA 3D9IA 3K6GA 4GYGA 1L3LA 3LVRE 4L5JA 2HOEA 5DHPA 2AQFA 4D9JA 4BU2A 1NI1A 3LSPA 3WTVC 3LQQA 4IHTA 1UJJA 1DCEA 3R6SA 5AARA 5JHBA 3HX1A 1WQ2A 3BTCA 2MRIA 1X3ZB 5ILVA 3J80Z 3OY9A 1YE9A 3S7DA 1INZA 3ZQIA 5A23A 2RV8A 2HI3A 3AJIA 4KU0D 4CZ2D 2G7HA 2HDCA 3J5QB 2I6HA 3G3ZA 1UELB 1QA6A 2M7AA 5B1BH 4K5CA 2L9BA 1PUEE 1T33A 1FNNA 2DN0A 1YG2A 3GZ1A 3HTUA 3LFUA 1DEVA 1RUNA 2BZTA 5H6RA 5K5OA 4F3VA 4LOCA 1OCTC 2DZNA 4HDUA 3HVEA 3QWWA 4A55A 4F53A 3V8MA 4B44A 2W1OA 2HOSA 2KB3A 5EX0A 1IV6A 4GTRA 4TRQA 1ETVA 1R1UA 2FBNA 3S1RJ 4F1PA 3B95A 3V7SA 4D7NA 3E4BA 3WG7H 2R0QC 1ZTRA 2KDOA 1EH6A 5HS0A 3ELKA 1STZA 2ESNA 3WHBA 1A35A 2L6JA 3ONLA 5ERIA 2EIKE 3DTEA 3VLDA 2LP0A 3JRCA 1BI0A 3RO2A 4BNCA 2MYOA 1GVDA 2OZ6A 1YLFA 2XPVA 3IWFA 1JUQA 2DT5A 2XGXA 1I1SA 3DWLG 2FNPA 3DU5A 3HXBA 4UNOA 4Q5SF 3VA4A 2GROB 5AQ7A 3CVUA 4BXUA 2GWRA 1XSVA 2HZDA 1T38A 3VZCA 3FHEA 1HXIA 2WVIA 5E75A 5KVRA 2OD5A 5C2YA 5JJTA 2I5UA 3V7RA 4HQDA 1S7OA 2ZKZA 4EM1A 4G6TB 4XLNF 1VQ6I 3AL0C 4U0UA 1I6XA 4IO9F 1HQCA 3ZMVA 1F5TA 3M8JA 3UKUG 4YDWA 2A61A 3MKZA 2J07A 4HBDA 3HKZN 5CHEE 1MX6A 3T0YA 3D1NI 1DQUA 1OCOE 2VSXE 3S2WA 3PIPF 4CEMA 3MD2A 4C3JJ 3FUIA 4HLLA 4IZZA 4EJWA 4N2QA 4A0EA 1IV8A 1YFHA 3K1MA 4UUSA 2XGOA 2X6WA 3WE3A 1N25A 1ZAOA 4HF2A 3CESA 2XPYA 3C3RA 5EDNA 3BWGA 3PSIA 5T8IA 1ON1A 5LGNA 4ENMA 2R02A 2I2BA 2LY2A 3RYRA 3TQNA 4A3FJ 2E36A 2K4JA 4NDLA 3PRZA 1H89C 4LD5A 2VQCA 4GZDA 2MGQA 1SFUA 4O5VA 2VSOE 4WERA 2I2OA 3FK6A 2JA6J 5EG0A 2QENA 4AVPA 3SZ7A 1SFOJ 1J2XA 4U7BA 5EYPF 1J4PA 1SEUA 1N9AA 3TOAA 3LY8A 2B0LA 2MBFA 3BP8A 3KP2A 3FTVA 3TO6A 3GTQJ 1QO0D 4EBAG 4WNGA 3N97A 2HEOA 3TO7A 3KP3A 1PVEA 2WTEA 3EHQA 3CVNA 2NNYA 2D5VA 2CW7A 3M7GA 2AJAA 1ZU2A 3D9MA 2M9HA 1LJ9A 4LB6B 1EA3A 4EPZA 3ZR8X 3DXJF 3DPYA 1G3SA 1Z77A 5E20A 5CEAA 2IGKA 1XGSA 4Q69A 1OCRH 2ZMEA 3HYMB 3U64A 3Q0UA 3Q49B 3IWZA 1OCCE 1QVUA 4M3BA 4BFRA 3UN0A 2JN6A 2KIQA 2BE5F 4EMSA 4HX7A 1WG0A 3QPHA 4ZC3A 4MGRA 3LWFA 3V8JA 3MKQB 3QAQA 1E96B 4JBAA 4BUPA 5CVVA 5FIOA 2F5EA 2Y75A 4CYCB 3TGNA 2EV0A 3OYEA 1DP3A 1IKND 3RPQA 2P9SG 4IQ4A 3MKWB 3GFMA 1OWLA 3K1NA 2QBYB 2XGSA 4RQIA 3POAA 2ZXWE 4DOZA 3FM5A 3R0AA 2X0LA 1K3NA 4C30A 1S64A 2ZIRA 4HXIA 5FO5A 1NG7A 2VBXA 4HX8A 4Y33A 3TP3A 2UZKA 4IHVA 1OT8A 4X8QA 5HLGA 1OCRE 1MBHA 3CHOA 2VBWA 2A6EF 1TNUA 1Z5SC 3HGGA 1M1EB 3KD7A 2RVCA 4IKFA 3JCUC 3FTYA 2Y3AA 1XCBA 2Z2SB 4HV6A 4TV3A 2FRHA 5F0FA 5TGTA 5FROA 3C1DA 1KPSB 2H1KA 2LSVA 4PUSA 3QK0A 3ML6A 2NVXJ 3UUXA 2JVGA 1LB2A 1IQUA 2CRGA 3LSTA 2KZTB 3ZXPA 1FMVA 2H6BA 2H6GA 4UWHA 3A0HC 1LE8B 2EIME 3QP5A 2R4GA 3ABLE 3NEUA 4LG0B 1UAAA 2GLOA 3UIOC 1RKTA 3IH4A 3CHPA 3ABME 1UJXA 3UNNA 4E7LA 4FCYA 3DP7A 5KK1A 1D5YA 1ZYRF 4A1SA 2V7FA 3P9KA 1R22A 4U88A 2O6GE 2VTBB 3FMRA 1GXCA 4TXRA 3ASNH 2I1KA 1BI1A 3FISA 5JLWA 2E1OA 4J8FA 3E32A 1ZGAA 4Z6YA 4ZYGA 4HYEA 4LIUA 4C3IJ 3LKUA 4I1MA 2F2EA 3EHMA 3V2XA 2CFOA 4XN0A 4IPAA 1WV3A 4RAZA 3L2RA 1KU2A 2OUMA 1Z67A 4H87A 5GPCA 4CICA 3CCRI 3U66A 2IS1A 3U9WA 5EGOB 3T8TA 3F8NA 4RLYA 2XF6A 4ASNA 2VJJA 2MHKA 3C2GA 5FLXK 3HIZA 3CVXA 2E2HJ 4PDKA 1QPMA 5IY5H 3QWVA 3C7JA 1ZRDA 4U0YA 5F08A 3UOTA 3IUOA 4A93J 5C44J 1U2WA 2WV0A 2X6YA 3OIOA 3K0LA 1FT9A 3ZCOA 4BESA 1MZBA 2FF4A 2LKSA 3M1CA 4M3DA 2PZIA 3CK7A 3U4TA 3I0NA 5A6CA 5GAGJ 3TGOA 3CUQA 2ZSIB 2DZOA 3Q47B 4LERA 3S8PA 2X6JA 4EJQA 4KMOA 4WNDA 1SD5A 4WRRA 4G7OF 4MQVA 4JC8A 3OYNA 3ZYLA 2L4MA 3NARA 3F22A 3HC7A 4C9YA 5AIJA 2ETCA 3SQVA 4I6ZA 2JA8J 3FH8A 2QV7A 3IHVA 5HS9A 3SF4A 1P7IA 5CVRA 3I4GA 3ZHEA 2A5EA 4OAUC 3GF2A 3DU6A 2VGXA 3SQNA 2OU2A 3PNYA 4G94A 4LB5A 3I64A 2W3OA 5BT1A 1N0RA 5ICEA 1LGPA 2CUEA 1IC8A 2VE8A 5FKMA 2GZWA 3OYHA 3FTUA 5LOZA 3UIPC 4GGGA 1WSUA 3HXLA 2V26A 3JW4A 3H3VK 3UT8A 5ENQD 2L9SA 2DMUA 2PQRA 5K7ZA 1GXQA 2B63J 4UQXA 4J8DA 3T5VA 5DUIA 3FZVA 3L2VA 1QU5A 1S70B 2HDWA 3IP4B 1Z91A 4GYYA 1VQ8I 4DX1A 4W97A 4Q96A 1TQMA 3V79K 2BGCA 1P6RA 3ISMC 2PQ8A 2RAEA 2R7TA 4CYDA 4V24A 3BZ6A 3BG3A 3GTOJ 1B59A 2IGMA 2N8GA 2WAQA 1P2FA 4I09A 4D5FA 3RAUA 4ANVA 4OIQF 2M63A 2XRYA 2WBMA 1MMDA 4KT5C 1W7PB 4IULA 3UM0A 4FP7A 3ZUVB 2IF4A 2FO1E 3MKQA 2X48A 4MFDA 2RNGA 5CKTA 2DCPA 3CGHA 2R5SA 2UY1A 2NVQJ 5JERA 1HE8A 1ENHA 2E7WA 3EUKL 4A3KJ 1U8BA 2K3FA 1BL0A 3CQGB 3HL2A 2HS5A 2QEXI 3OYLA 4V19K 2VGEA 4OOIA 3FIWA 4HZFA 4PDXA 5J1YA 2L54A 3KEOA 5J4YA 4R9PA 4IL6C 1K7AA 3HTSB 3ABLH 3R9AB 3W2WA 5J47A 1RC9A 3V4GA 2DFEA 3ZQLA 2AHQA 5DTDA 4Y4RA 4DI4A 1D8KA 4M3GA 2G9WA 1HCRA 2L5QA 3RQ4A 2FX0A 1FYMA 2CHZA 3Q73A 2EZHA 1T6SA 5FKLA 4W9RA 3OV8A 3C3WA 1MMGA 2GRNB 5TISC 2H09A 5FKOA 5LFAA 1IRGA 1B8IB 4U8YD 2MD0A 4A3LJ 1I50J 1OWPA 2FMYA 2QZ8A 5JEOA 4KICA 1TC3C 3U1KA 3KEZA 3ONQA 1U5TC 1BI2A 5BMZA 3IV5A 2ZXWH 1EYHA 3JTHA 1ZH5A 4PZJA 2I2CA 1SVXA 2XSDC 2XPWA 1T98A 2IFUA 5IYCJ 3E5XA 2DMPA 3QPLA 3PZ3A 5B5EC 3TWQA 1TT5B 3DTIA 1EDUA 2IJGX 1Y6IA 1JWFA 1FZPB 2XZDG 1QNTA 5F0CA 4XBFA 1HDDC 1USSA 2LKXA 3SXYA 2XZTG 4E6KG 2H27A 1NZNA 2CG3A 3D9NA 1SFEA 2DA3A 1TW2A 5FKNA 2ZGDA 2XAFA 3E30A 4Q94A 2O61A 5HDNA 2YR2A 1B72B 2JWTA 4XORA 3C2BA 1I3QJ 3RIRA 4XOPA 3GYHX 2BKGA 2VUMJ 3ASNE 3GFIA 1OKRA 2E2JJ 1CF7A 2R7OA 2HYZA 2A07F 1MBFA 5E1ZB 2ZXHA 3W3CA 2XDVA 3H1CA 1BR2A 2HVQA 3AS4A 4E7SA 5EKQD 4XONA 2MD5A 5KHDA 2BF0X 3T5PA 1RIOH 4RGRA 5J3LA 4UI9K 1BI8B 4KYOB 2JK3A 5BOXA 4BDYA 2CV0A 2XHEA 2VC1A 4HDVA 3CCYA 2PX9A 4LNUD 4EQFA 4YIFA 3QOUA 3ZNGA 2XPIA 3TBIA 1MZKA 3I53A 3ZOBA 3HRMA 5H6QA 4Q4ZF 1FTTA 3V31A 2K4BA 5T4YA 4X6AJ 4U8HA 4WWNA 2DMTA 2DTRA 2VSYA 4GTOA 4CGWA 1K2MA 3FBNB 4NC8A 1MDMB 1SD4A 1HG2A 1H0AA 3LY7A 1FY7A 4FHKA 3E5QA 3CUQC 4N5QA 3G1OA 1YYHA 1ZLJA 5AENA 3MEKA 5DCFA 5F0HA 4RDUA 1ZKGA 1UG2A 3IC7A 3G73A 3IKOB 4PS8A 3NRVA 1S5LC 3LCAA 2QKLB 3MCZA 2V6EA 4GTVA 2STWA 4BSZB 1LEAA 3ULYA 2E60A 4EGYA 1SFXA 4IEJA 4RGUA 1MW7A 4BE2A 3S2DJ 1ACIA 2KC7A 3BJAA 3CJTB 4KISA 4HFGA 4AIFA 2BYVE 2VN2A 3F0CA 3MA5A 3R60A 5EILA 2KRCA 4ZYEA 3M07A 1J4LA 5F27A 1WH5A 2OJED 2DBBA 3E6MA 4Y7NJ 3MCXA 4XKCA 3GZ5A 4MLOA 1YJ9I 2BBYA 5AIPA 4UQZA 1WJFA 4PS3A 4CT4A 1RR8C 3IBEA 4PUCA 3JAMK 1IXCA 2DDBA 5GAHJ 3FDYA 2R7XA 4FTHA 2QUFA 4UUSB 2GXAA 3DKYA 4AD9A 1D8DA 4G7ZF 1VQLI 4LK1F 3TWTA 2ZCWA 4RGXA 4HRIA 3I4NJ 2RQQA 3I5UA 1D8EA 3C3QA 1MMSA 3FM8A 1HW2A 4DLOA 3CCMI 2XAQA 5L3DA 1KGSA 3U3WA 4P1WA 4GO1A 2DQRA 3GMEA 4E6HA 4YELA 1U7FB 5DHSA 2E34A 4ZZLA 2B9SA 2L2OA 3TWXA 3L09A 4M7CA 3E0JB 2JKDA 5KAFC 2CMPA 5EIDA 2R7RA 1TBXA 3H35A 4JHKA 3ULQB 1E8XA 4ANWA 1BIBA 3RRMB 2DTZA 1U0TA 1PP8F 2DU9A 1K79A 3CMEI 2KM4A 3O6BB 3RYPA 3UNGC 3PIOF 5TRDA 2DYSH 3DF8A 2CG2A 2QSGX 2LH9A 3IAS2 2LC2A 3V7YA 2VQHA 4HAMA 2JSCA 4BT8A 2Q5FA 3BDDA 1MIJA 2L9VA 3HB9A 1IRZA 2A5UA 3B6AA 1BW6A 1XCVA 2VXZA 4GZCA 2LY9A 3HXEA 4WNFA 3KS2A 4ANUA 3I4MJ 4KITB 3F6VA 4BJ5C 3QPTA 1X1PA 3A2KA 2F5CA 1T56A 1KQ8A 3MN2A 2MLKA 3D9KA 4FHTA 2WXNA 3ZN1A 4UWKA 1OISA 1SFKA 4B8AA 1IUFA 3NWTA 5EIBE 3HUGA 1Z7UA 2A69F 3FBIB 2F37A 3KP5A 2WXLA 3QP6A 1K3JA 5LHIA 2JPEA 2RD0A 2DIWA 3L22A 5HQ8A 2QM3A 3CC2I 3EUVA 3MDBA 1E3PA 3QAHA 1QZZA 1U7FA 2D1HA 3FWVA 1QBJA 4A0YA 1U3EM 1QQEA 5JHUA 2D2WA 3I54A 3CVLA 5BPIA 2FSWA 2BW3A 1DNPA 1MBKA 3WTTC 3SFYA 2IEJA 3V7CA 1FYLA 2CHXA 3FUNA 1FHQA 2KDZA 4Y52J 4E85A 3ENEA 4E4HA 1YO5C 4AVZA 5D5XB 4V2FA 1OXJA 4WWOA 3KCCA 1T0FC 3KIOA 1IN4A 4HRMB 2QVLA 2MW8A 5EJHA 1FC3A 1F36A 2Y2ZA 4N0BA 4AP2A 5DHTA 5DHQA 4JW1A 3Q7AA 2BXZA 5E3NA 1IHBA 5T3RA 3D9JA 2L9NA 2I29A 3KP7A 2P5KA 3SY2A 4BE0A 4JONA 3S1QJ 5D0OD 1YS7A 2B7EA 3SFIA 5K5RA 4EZKA 2DAOA 2PQNA 1IHGA 1OPCA 4GMLA 4BYYA 3FXOA 4KT6A 1WI3A 5FWQA 4XLFA 2R5YA 4GPMA 4GU5A 2XGCA 2QY7A 3EDTB 1U2VG 3HRSA 1ZBPA 3TDUC 4GRIA 4XSZF 2HDDA 2DW4A 1I39A 1OCOH 1KA8A 2PMZN 1NFIE 2XCCA 4LIVA 1REPC 3L82A 2TDXA 5EDSA 2PMHA 2XGEA 4DQ2A 2NVUB 1KT0A 3UM1A 3T1BA 3BZKA 5J8CA 4BY6A 1FCHA 4I2OA 2DODA 4UB8C 4UUVA 2A3SA 3K4LA 1MHQA 3JQ0A 4U7EB 4ABZA 1IGNA 3UR3C 1KU3A 1UFMA 3CLOA 3QKYA 2DA4A 2E5NA 3BR5A 2YS9A 2MFZA 5DM6F 4WWCA 1IXVA 4PH4B 2IP2A 3H9QA 5D2MC 3UI2A 4QPQA 4Y6WA 3OL3A 4LITA 2IJLA 1ELRA 1WJBA 3ULEG 2LAIA 2VYIA 3HBLA 3BG0B 4XI9A 5L3GA 3ZIMA 4QIWN 3G2VA 1Y39A 3OXGA 1HC8A 2AVPA 4B93B 4B43A 3G6EI 4A3IJ 2FMLA 2M4KA 3CF5F 5FB2A 1TL8A 3TXMA 1J4QA 3L6AA 1J75A 3R9MA 5KWDA 1K78B 4CCOA 4HORA 3BG6A 4NB5A 3QWLA 2VJ4A 2VT2A 2XGDA 4B3XA 1QNFA 4JIWD 3BQZA 2KCLA 3GW4A 4XRMA 1W3BA 2C6YA 1B1BA 2CJJA 1P4AA 2OV8A 4GCVA 3C5RA 3SFXA 2EH3A 2EH0A 2NOGA 4P55A 1K3QA 2XPZA 1QYMA 3DBSA 1TN7A 1B6AA 5D5WB 4RB1A 3Q5FA 1KU7A 2LSUA 2GA2A 3BR6A 1YX3A 3CTAA 3VTXA 4BX9A 3EU9A 2JA5J 2VQ2A 2DCEA 3ABUA 3JRBA 1J2FA 2WMOA 2AQEA 2OVFA 2HR2A 1XTAA 4EJOA 3CJQB 4BL0B 2GIVA 3I0MA 3VLFA 1FJLA 1IZ1A 4CH7A 2CUJA 1TEZA 5EYRA 5CPRB 3QPSA 4PJ0C 4A3GJ 5E3OA 1HXDA 5HI7A 5BV1A 3K4MA 1IO2A 4HNTA 1FBSA 4OAYA 2O0YA 1JUPA 1S9HA 2EILH 5DDGA 4K03A 4U95D 4BTBA 1YHQI 2WMNA 3R7QA 1KYWA 4Z68A 1YMPA 2BOLA 1LNWA 2MC4A 2IONA 4C2MJ 3PE3A 4L2YA 3TWUA 4LMYA 3OYAA 3TWVA 3DSSA 2CYYA 1CQTA 4BT9A 3QU3A 5HKPA 1U0RA 3W6KB 3I3NA 4GAAA 3HM5A 4LRZA 1XMAA 4ETSA 3PDNA 2B6CA 3L9TA 5LLQA 4E7JA 1RESA 4CXFA 3J7AY 2OTLI 2ACJA 3F3XA 1S63A 5DIZA 4EZJA 4GB9A 3BPXA 3APCA 3EU5A 3LY9A 2BW3B 5J90A 1FP2A 1HG5A 5J8FA 4XLHA 2W85A 5HS7A 5DM7F 5H7PA 1RETA 5LGTA 4BDZA 1HF0A 2JLBA 4RB2C 1WJ5A 4PK4A 2PMZA 1R9TJ 1B8IA 2Y48A 3RKYA 4ILGA 3K1PA 3UKRG 5B1AE 3G2UA 2GOXB 3NAWA 5IP7J 4XE0A 5EEGA 3CD6I 2HYGD 2OF7A 1AP7A 2QQBA 2AW6A 4LLLA 1FIPA 2R7VA 3BR0A 1D1BA 3GXOA 3KAEA 3K2ZA 2CS3A 2OC6A 3MAJA 4RB0A 2RDPA 2JEKA 1U8RA 5LX8A 4CZZA 2CQQA 3T8KA 2P8TA 4M3FA 2J49A 2JZYA 1MJ0A 2PNNA 1H19A 1N4QA 3W2AA 4YRVA 2Q0OA 2EA2A 3RI4A 3QRFF 1D5VA 1P4XA 1OJLA 3BPVA 1V5GA 1TNTA 3F8FA 3M1EA 4XRSG 3K70C 1A31A 3CQCB 3SBSA 1Z0ZA 1IUYA 2V9VA 1ELWA 5EYLA 2I2FA 3KYLA 3EHNA 1HO8A 2O8KA 1GDTA 4DX2A 1EF1C 4N3BA 4JPSA 4CYCA 3Q3SA 2A4ZA 4GYOA 3OYFA 3RJPA 3OSFA 2VSNA 4N4OB 1XPXA 1KONA 2EIJE 2OZUA 1UHWA 3PNTB 1WDYA 4II2A 4GYWA 4UVCA 5AIQA 4BERA 1HU3A 3OTNA 3HIFA 2BEOA 3DBHB 3Q7FA 4LNBA 3PUKA 1W0UA 2HQNA 3CQZJ 4JA7A 1E8ZA 2LYCA 3OSGA 2L4AA 4CCNA 2MA3A 3K9IA 1E8YA 3FU5A 4DX5D 5F04A 5FFZA 3RPUA 4LUNU 3CCEI 1USTA 5FQ6A 1SMTA 4XIFA 3EUAA 3ASOH 1U9NA 1VI0A 2Q2EB 4YDYA 3ZGQA 3OYMA 3LA2A 1X1BA 4XMYA 5IP6A 4QWQA 1W0TA 4EV0A 5D0QD 3A4CA 2ECBA 5B3SH 4J8YA 1A6QA 1D1AA 1IG7A 4G11A 3SHFA 2FE3A 3UPVA 3OYDA 3V30A 3DEUA 3ZPLA 3LJNA 3CR3A 4EQQA 2QQ8A 1H6PA 4UV8A 1HLVA 3JYSA 1H6KA 4K5AB 1JGSA 4A6EA 4Y13A 2HQ5A 1QPIA 1PUFA 1BJAA 2JRTA 1H6OA 3FY4A 4U7DA 1TWGJ 2BVMA 2CG4A 2P81A 4EEFG 3HRAA 1S6LA 3EJNA 1FSEA 4RM3A 5E8GA 2V4HC 3PEVB 1TP4A 4RGSA 4FLHA 4KIFA 4RG9A 2Z33A 1QVTA 2WB1N 5DCMB 3BQYA 1X2NA 4JOMA 5FTPA 1B4AA 4EJUA 4H0EA 2QQAA 3AG2E 4CHUA 4H7XA 2KL4A 5JLXA 3P9CA 4PFPA 4U87A 3VSLA 3W9FA 4CCAA 4CDRA 3B7TA 1YRNA 1P5QA 4C0EA 4I1AA 5IYBJ 1HW5A 4BHCA 2CSOA 3KLNA 4HEA2 1D0ZA 3SZPA 2QA4I 4YVQC 3HUEA 2RC4A 4U04A 1P92A 4G2SA 1UG3A 3FXRA 2WA0A 2X1EA 3PUFA 4UUCA 3SDBA 1K61A 3JRFA 4B09A 2BY3A 1YJ5C 5JELA 1FT1A 2P58C 2LK2A 5FZQA 4ABNA 3HVEB 3WTSC 1O5MA 1HKTA 2AXVA 2JUGA 1JGGA 1MNEA 2PBIA 2Y9YA 3JRAA 3LYAA 1Z0UA 4HNVA 1MGTA 1TJCA 2RGVA 4NQWB 5JI6A 1X81A 1Y3HA 2WB2A 2ZC2A 2XV4S 4N3CA 2V4JC 3O2PE 2DQLA 3KZZA 5CEDB 4LJZF 3F8BA 3VYSB 5FLXZ 5GADJ 3VTYA 3ESWB 4MHGA 3UQ3A 1YIJI 1A36A 4OIOF 1ETYA 3HEFA 4I2ZA 5F6FA 3A01A 2DA1A 2F4OB 4B94A 1D0YA 4LGWA 4QPOA 5GAEJ 4B8XA 4HNUA 2BY2A 3MEXA 2LSOA 2P9KG 1RZ4A 1BM9A 2KBXA 4YVOA 2VB6A 2Y9ZA 3I4RB 1W7PD 3DSXA 5J6XA 3FHZA 5ITZF 1KHXA 1FOXA 4X0GA 3L2WA 1TNYA 1LDJA 3O8HA 3FXQA 1BC8C 3VZDA 3ZMSA 4FULA 3J5PA 3TJPA 2X6KA 5D6FA 1W1WE 2X51A 4ESFA 2W82A 1AWCA 2UWMA 2J9QA 2ETBA 3RQIA 4Y3OA 1WRJA 4D0PA 3PEUB 4GCOA 1YRNB 3WHCA 1ZR4A 1SD7A 1W4MA 4ANJA 3AS8A 3BJ6A 3HOZJ 1JI8A 4U0ZA 4YIIA 2J5PA 2E71A 2KATA 2GRLA 5FLVA 3J81K 6PAXA 2E2IJ 1Y1VJ 3H3UA 4MTEA 4A3CJ 2UWJG 4BQNA 4IHSA 1U9OA 5E50A 2IY0C 4U0SA 3OOUA 3HPGA 2YINA 4U0WA 1TWFJ 2ZB9A 4IQJA 4KA4A 4ANXA 2L01A 3FKJA 3K4KA 4C9BB 1ON2A 1ONVA 1RRJA 3NOCD 2JQIA 3S7BA 4XOTA 2WXOA 1DU0A 3WGGA 4HLEA 2EZKA 4FA6A 3VFZA 2XEEA 3LAPA 3PE4A 5JHFA 1RR7A 1MBGA 1LDKB 3AG3H 3K4CA 3DITA 1XDUA 5BW8C 3SNXA 4YEJA 2KZTA 1SVLA 1O1RA 1ZG1A 3FMQA 1AHDP 3S2HJ 1BOBA 1P4WA 4O3MA 2F4MB 3H92A 4IN3B 2M45A 3OOPA 3I59B 3O8GA 4LG0A 3DPUA 5GP9A 2P1RA 2BVLA 4A3JJ 4A5MA 4U0VA 3D9PA 3NZUA 3SYTA 3WTWC 2HPMA 3BG5A 5HNHA 2NVTJ 5JEJA 5E76A 4PS7A 1OLTA 4XLAA 1AWCB 4GTQA 1GT0C 2R5ZA 3I56I 3AG4E 1IN7A 3LNQA 3BY6A 1MZCA 5BV0A 2HQAA 1SAUA 1OCCH 1SQMA 3Q0WA 3S16J 1IDZA 3AU4A 3LSHA 4L9JA 4FX4A 2G1LA 4EATA 5CRVA 5E3LA 1AA7A 4KFCA 2WV1A 2KKOA 1HBXG 4E70A 3E6BA 1N4PA 1IXSB 2M2EA 2IW5A 2F8YA 1IYGA 4AIDA 3OR1C 3LMMA 4KN7X 4WXDA 3GTMJ 3JCKC 4IRHA 5LCWC 3L9FA 4HAOA 1R1TA 3CJRB 3HOWJ 4MEYF 1UJ8A 3ZN3A 1UMQA 3ZMZA 4DBRA 2QWWA 2E1MB 2LG4A 5EZGA 2J8SD 5EJIA 4IHXA 1ETOA 5EF6A 3M4OJ 5E17F 2BY1A 2PJRA 1MJSA 4G8KA 4B48A 3EDPA 2FQ4A 1N94A 2WAFA 4JX4A 1OWOA 2H8WA 2LDUA 2IEKA 1VFCA 2K27A 1MMAA 4ENNA 2QBYA 1CGPA 3FUHA 3CC4I 4D1QA 2EK5A 4MS6A 3PZ1A 3BG1B 2QYOA 1D0XA 1OWNA 2YHCA 1JPLA 4JEUA 1K1BA 2CFXA 3BR2A 3AAAC 1JTXA 2L7MP 4BXFA 2VPRA 1SA4A 4WX9A 1TNOA 4MBGA 3CKBA 2PFBA 3WU0A 3RKQA 4TUMA 5HOOA 1EF4A 2XC7A 2HTSA 3VYUB 2VKHA 3ASHA 1K78A 2GRRB 4DX7D 2XB0X 1H2VC 1WM5A 2P0WA 2FA5A 2BONA 2GRPB 3CEQA 1UHSA 2ELJA 3SGHA 1SVMA 2KIFA 5LBQA 2UXXA 2D45A 2F48A 4WNEA 4CGVA 3KYCB 1MSEC 2KRHA 2A5WA 3GLXA 4M73A 2NAZA 1LE8A 1X5BA 3JTGA 4PJJA 2XS1A 3HG9A 3IAM2 3DEPA 2JPCA 3G2SA 1OYIA 1G6GA 5ICGA 1JKRC 3I9V2 4FE4A 2NXNB 4WUYA 5JEKA 1A5JA 4DYQA 2PM6A 1FBUA 5JMND 3CMAI 2OVBA 2H94A 2VTBA 2K86A 4AEZC 3HRTA 1X1CA 1MX4A 4IRGA 1LDDA 3V42A 4UI9C 1H9TA 3U2RA 2V6CA 1K6YA 4ZYDA 4R1HA 3IEGA 4A5NA 4DUIA 2HPIA 3FX3A 3HDXA 3CVWA 1TQIA 1X1DA 3RIBA 1R1VA 3KE2A 4CO8A 3S7JA 2O03A 1HA8A 4JA9A 2Y69H 2GA1A 5C4VA 4BY1J 2JQLA 3QYBA 4IYPA 2OA4A 4I0BA 2R05A 2VQLA 3TL4X 1Y8MA 2EZIA 2OEVA 2WXFA 2XF7A 3Q9VA 1ZREA 3B13A 4ACKA 3V7WA 2Y4TA 3AG2H 2FUG2 2VKEA 3HOXJ 4CYMD 4GA2A 2M3AA 4XEIG 2IPQX 2P5VA 4GZ5A 2ICWG 5ENNA 2PG4A 2CQNA 2K9SA 2O5RA 2R7WA 4B3AA 2LMDA 4MQ9F 5FGMA 2VASA 4NQ0A 2DYRH 3VSKA 3CCUI 4KZ0A 4ZDOA 1E7VA 2M8GX 1R5ID 3QJZA 4AY6A 2IOLA 1ETXA 5CERB 3NF1A 3L7WA 1KHUA 3ULQA 5CJ9A 1R5HA 2XS8A 1AKHB 3WXXA 3UM3A 5BPPA 3ZQFA 4L0ZB 2WAQN 3T8MA 4APOA 4JL0A 1QWTA 3KPHA 1B9MA 1VQKI 3DXKG 4HRNA 3O3KA 3ASFA 2D1VA 1BI7B 2W84A 3ZHEB 4UWLA 1GVJA 3MV3B 1S8NA 4G9YA 1R4NB 3BU8A 3TL5A 3JR9A 2ZJQF 4F92B 5G2NA 5CCLA 2IA0A 3D5LA 1Q1VA 3GLLA 2H6HA 2KXPC 3P2BA 3JXJA 2EWNA 4N39A 2P9IG 3MZYA 3QU6A 3OXFA 2E7XA 5LP0A 2LUHA 1QHGA 4FISA 3HOVJ 1UN8A 1XNFA 4WK8F 2P7VB 4CUGA 4DI3A 4R79A 3GBGA 1UW4B 4LK0F 3G2BA 5L3CA 3LVQE 3GO5A 1F9NA 1TLHB 2A6HF 1WJAA 3HOSA 1YW9A 1TJFA 4XQFA 3PUJA 5CMWA 2A0TA 1WWXA 1XB4A 2DA2A 5HDGA 1MKMA 2RKHA 2ISZA 1OCPA 4CA0A 2DWZA 4EJVA 1BI3A 1Z0XA 3M3YJ 1WJDA 4BAYA 4GA0A 1DMZA 2NVYJ 1J59A 4G23A 4I6JA 4EJTA 2FD5A 4UV9A 2WPVA 2DMQA 1OFCX 4WWPA 5G04C 3DTKA 2ZMEC 4Y17A 2WAEA 4ZDPA 3TAXA 1ZELA 3ZVVA 3A02A 4WAFA 3ELVA 4K2EA 4ON0A 3EYYA 5C1DA 4I9EA 3BG9A 1GHCA 4N9IA 4A3VA 5BNGA 4R8HA 3MQ0A 4DGWB 5HNFA 2X1DA 1ZGJA 2R7QA 1ZLKA 1DPUA 1XC5A 2HQRA 2YU3A 2I8DA 5B1AH 1YITI 1G3YA 4FT8A 1TR4A 3R7RA 2I2DA 1WPKA 3OIPA 2FBHA 5HLTA 3SEQA 1OYWA 1N75A 3F8CA 5ED4A 5KNLA 4RM2A 3GYZA 4UY8I 4CGZA 4I01A 2YX4A 5JEMA 2LRDA 4IHYA 3CIAA 2AO9A 5ARGA 2I1WA 2MABA 5AAOA 4OU0A 2VONA 5ENSD 4G8XA 3HGYA 2ID3A 1S0PA 4LG6A 1LF8A 5DS9A 2O3FA 4BQOA 2CV2A 1E3OC 4C2TA 1I5ZA 2K9NA 2Y69E 4OVUA 2J5OA 2P7CB 4BXXJ 2EFNA 3EUHC 4BACA 1BLXB 3HDDA 2FO7A 5ARFA 2OAZA 5ILUA 2V8SE 4KIBA 5IOZA 4KDPA 1E17A 3F23A 2LD5A 3UM2A 5KJMA 3V2OA 4P9UA 3HOYJ 3BZCA 2DFFA 2BV6A 2R7DA 1V55E 3WU2C 4HI9A 4MKTA 3E97A 2KFUA 1IAWA 3CJNA 2KIUA 2VOOA 3GTKJ 2A5YB 4WF2A 1VTNC 3ZQHA 1SW6A 2E1CA 2X6OA 4KVOA 1JJ6C 1DC2A 3D9OA 4IOAF 4C2UA 3BOQA 4ACLA 1MD0A 4HLYA 4BKXA 1D8JA 4HNAD 3GVAA 4S05A 2DOAA 3JRHA 1DCQA 4AUXA 2Y0SA 3C72A 2RG8A 4ZZDA 1IJWC 3MKRA 4G26A 3ZFWA 4S04A 1XG1A 1SANA 2VKVA 2F5VA 3HHHA 1T39A 3AG1E 3CK8A 4FC8A 3CVVA 1J4KA 2OTJI 2KJCA 3IH3A 1E90A 3MZHA 4AIHA 4CDNA 1ZG5A 4QSHA 4RSYA 5G05J 5FLMJ 2O8XA 3OMYA 4FHJA 3DEEA 3RKXA 1Y8RB 2DT7B 3KLOA 4OMYA 1HS6A 4YNDA 4CZCA 1UZCA 2VBYA 3V8QA 1OMIA 3B73A 2VLAA 1AKHA 2CV1A 1Q1HA 2DT6A 1PC2A 1XSXA 4UWFA 5CCMA 1EJ9A 1L5JA 2ESHA 3I6UA 1JKOC 1VF9A 4GPKA 1G3GA 2DMNA 5D6EA 2DI3A 2VPLA 1NG6A 3K7AJ 4LG3A 4HQEA 4ENJA 3NQPA 5CMYA 5JHAA 2CQXA 1I3AA 2JQ7A 3DKXA 1DGRM 4KMUX 2I1JA 1V3FA 1B89A 2LVSA 4ITVA 2QSHX 3KP6A 4BEHB 3CVYA 1ZHFA 2AN1A 1UJKA 5ANLA 1NK2P 1KU9A 4YFKF 5BXUA 2WC2A 5C4JJ 3C18A 3BC8A 4XK4A 4I1OB 4TXQA 1I1GA 2K3PA 3PQKA 4CDGA 2FU4A 1U5TB 4AV7A 3TWWA 3FP3A 2XXSA 5J1UA 5BS6A 3SO8A 2DO7A 1KZPA 3BQOA 1U6GA 1EH8A 1P9QC 2JRMA 2XHKA 1FP1D 1O57A 1R4MB 4QTRA 3CLQA 2DOEA 5H2FC 3L1PA 3DWLE 2PJPA 2P9UG 1MYOA 3KSQA 3IV0A 3PO3J 2OCCE 1XX5A 1BU9A 4JVSA 2CW8A 3IHUA 4XN3A 1DGWY 3HYIA 5AONA 2EBIA 4M6VA 3OYCA 4I9CA 3F8MA 3CUQB 1R49A 3Q75A 2A05A 2TCTA 3SJMA 1XSDA 1BD8A 4JXTA 4BWRA 3E6DA 1NH3A 4AYBA 1OR7A 2HXIA 1FOWA 1YOVB 1WY6A 4N3AA 5G04J 3RKVA 3RU0A 1IN6A 4J19A 4F52A 3MKLA 1XN7A 3EPZA 3ZMUA 4Q48A 2KPMA 2ZFWA 4N4NB 3OS1A 4ILIA 1JE8A 4C0MA 2RREA 5DUKA 1UOHA 1JXSA 3DQVC 1QHHD 3CV0A 1IN5A 1U3DA 3GFJA 2F0YA 3U9GA 5DV5A 4HOSA 2NS8A 2JPBA 5A8IA 5D4SA 1TNSA 5GTIC 3JAMZ 4V2GA 3L2UA 2WXKA 3LSIA 2WXMA 1TNZA 3JXIA 3JREA 4PGGA 4DJAA 3HG0D 3R61A 2ID6A 3FXLA 4MEXF 2J4BA 3X2QE 2R5ZB 1A5EA 2V9KA 4GFBA 4AOFA 4RA2A 4B89A 1LGQA 2CSWA 2Y31A 3IRRA 1X3UA 1H2TC 1BR4A 2G0EA 4BJTA 1WKMA 2W57A 4AM3A 1MX2A 3C98A 3GZ2A 3ZW3A 4O6FA 1POGA 4QLCU 1BR1A 5ICFA 3QOPA 4RAYA 4ZTJA 1ULYA 2F6CA 5HRYA 2NOJB 4XLEA 2R3SA 1ZK8A 3L08A 1WZ2A 3L54A 4ZHBA 3F9KA 5D5VB 3JSOA 5KJNA 2I10A 3LA3A 2JSPA 4P96A 4M6YA 2Y1LE 1ZR2A 3MYVA 3GZ6A 3ECOA 5EX3A 4LEUA 4EVIA 3CHQA 4XIDA 3DFGA 3QODA 4E7IA 3H36A 1C0WA 4ILHB 3BG7A 3BR1A 4OMZA 3H3ZA 4BEPA 4HF0A 2FJ1A 1LFPA 1SVOA 3CP8A 2IQCA 2P9PG 2V5QC 4J01A 3AU5A 3IXEA 1XGMA 3FM3A 5ENTD 2EQRA 2W48A 3A03A 2RN7A 2GXGA 2R03A 1OQYA 3LPZA 2PI0A 5CRUA 3FXKA 3H5NA 4RLFA 4ME2A 2LC1A 3I71A 3GMJA 4I43A 3VZBA 1JTYA 3UMZA 2TRTA 1FOKA 1YIOA 2XPUA 4NUBA 2ZJRF 2GGFA 2WXHA 4ATZD 1WH7A 4DLQA 2Z3YA 3LSJA 4HX4A 4JQFA 4E7KA 3FXUA 3V8PA 2OCCH 3UT7A 1J5YA 3CP2A 2XROA 2XF5A 2BKKB 3J7ZI 2KCKA 4D9VA 1RUOA 3I4PA 5GPAA 1GV2A 3CHMA 4RLQA 3CCSI 1U0JA 5J08A 1KZOA 4UI9J 4O1PA 1ETKA 3S3OA 2HXOA 1H88C 2K02A 3GTGJ 2FEZA 3SBTB 3CSTA 2V5FA 3DSHA 2ZFUA 4KXKB 3TG5A 3DEOA 2AXLA 1MMNA 3HHGA 4JX6A 2EINH 4B47A 4M3EA 5FINA 3FH7A 4FADA 4UXNA 4BEHA 2JUCA 3ESKA 5A2QK 2LF7A 3BEEA 3KP4A 4JX5A 4KN4X 5DYMA 2EFWA 2ZMEB 2LNIA 5AQBA 2ONDA 3PZDA 3MZ8A 1JCQA 2L7KA 2F4IA 4AU7A 2X6FA 4F7AA 5M5WJ 9ANTA 2PIEA 5C3EJ 5E79C 4GZ6A 1O4XA 2EV5A 1WJCA 4BH9A 3ESLA 3D9LA 2HVSA 3IHYA 4EHMA 3VODA 1VQPI 3FUMA 4L5IA 3OYJA 2HOTA 4JB8P 2FI7A 1WFXA 2HM8A 1J0RA 2RKKA 5FJ8J 2HZTA 2KLOA 2IOSA 3PZ4A 3Q5MA 1G3TA 1RI7A 2HE0A 5IPAA 2YSRA 2JA2A 2WXGA 3WU1B 4J7WA 1ERDA 3ERMA 2KKLA 1T8IA 2AXZA 3ZMDA 4JEHA 4GCNA 3UXGA 3I0TA 3CDLA 2YQ8A 3L16A 5IYDJ 2XEVA 5EN5D 4C48B 2GXBA 4G2VA 3Q79A 4UUTA 5ANRA 3K69A 1VQNI 1NA0A 4J8SA 1XD7A 2H1LA 2M8EA 3GCMA 1XMKA 3GFLA 3SZTA 4A3EJ 3RZDJ 5CQEA 4IVNA 2LBFA 3ABTA 3J7AO 2ZO4A 3ONKA 2OQGA 4GA1A 3J7YJ 4Z2YA 2BY0A 2E0IA 4XR6A 2L0KA 3ECHA 4GYIA 2CGPA 1N54A 1E2XA 3S32A 2DBAA 4RBOA 3L13A 3WGHA 1V54E 3KX2A 1MJAA 2ZNZA 5JR3A 2LFBA 2QLZA 4FJZA 1N95A 2ZISA 4HB5A 2AXUA 5K7HA 3PM1A 2M0MA 1MBEA 3PQJA 2WY8Q 3DLLF 2M0CA 4FE7A 1JJ8C 1X58A 2ZSHB 2XCBA 1R21A 2Z9OA 5G55A 3BCBA 2Z99A 1AOYA 3F72A 5G05C 4GTTA 5EGOA 2M5WA 3PS6A 4HQMA 2W24A 3NOGD 4I2WA 2FBKA 1VZ0A 3K70D 3PFNA 4GTSA 3H0DA 3FUJA 3BUAA 4GTPA 1UN9A 1W5CC 3QB2A 4EM2A 1N4RA 3FK7A 3EIQC 2PM7A 1V54H 2BXYA 3JSPA 3WTYC 1K6OA 1G59A 2MYSA 2VT3A 4O1OA 3PO8A 3HSFA 3H0GJ 2G7UA 3HRUA 3S1NJ 4HLXA 5LEJA 4DNCA 3OS2A 1D9SA 1BOAA 2UXNA 4O6JA 2DA6A 3QOEA 4AIKA 1QZEA 3CUOA 3JRIA 3PJRA 2VBZA 5HLHA 1FYKA 4F6RD 2QFCA 1YA0A 2CUFA 1FVFA 2R7SA 4YDEA 3LSRA 2L7ZA 3FWEA 3B7UX 5D66A 5B1BE 3FEYA 3ZQ7A 2WM9A 2A6TA 4CCJA 2FOWA 4A12A 3UTMA 3PUBA 2VGXB 4APFA 3LL7A 3UT4A 2KP6A 3IH2A 4HW0A 4XRFA 3APFA 2EFOA 2GM4A 5CVUA 2KZGA 2P6TA 1Z3XA 4J0UA 3ASOE 5IP9J 2ZBKA 1MNMC 3W6VA 4GMRA 4EBAA 2VXDA 2L02A 1BN5A 4J00A 4AJWA 4GZ3A 3IL2A 2ELHA 2QCOA 4XICA 1ZQ3P 2OV7A 2L0TB 5BNWA 3T8RA 3MFKA 1FPQA 4QFVA 2HGCA 1YYVA 2IS6A 4D5CA 4A1GA 3ZQCA 1NHAA 3L2CA 1R23A 3GX4X 2OEWA 3CVQA 5M72A 4LLGF 1VQ5I 3CCQI 2EQXA 2EJRA 2H8RA 3FUKA