2FEZA

Mycobacterium tuberculosis embr
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
373
structure length
373
Chain Sequence
RLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable regulatory protein embR
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 129
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2005-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fezA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fezA02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2fezA03
3E5UA 4GCVA 3RIBA 3ZN0A 1Z91A 2F2EA 4UUVA 3ZMSA 3WTTC 3J81Z 5CYVA 3ELKA 4UVAA 2PZIA 3GZ6A 1TNSA 2FBIA 5TJJA 3IWZA 4YFKF 1ZGAA 2P8TA 2LF7A 2VSYA 2BEOA 3D5LA 3NQOA 2ZCWA 2PI0A 1R5HA 3RKYA 2KB3A 1ZRCA 4OINF 5E1ZB 4IJAA 1SD4A 1YW9A 2LDUA 3HOSA 2PQRA 2A0TA 2O8XA 2RGVA 1BC7C 3ZQ7A 2JPEA 3DKWA 5HLHA 3I58A 4UVBA 2PFBA 3M8EA 5FTPA 3HHHA 3WGHA 2V1DA 4CGZA 2JKDA 1UJXA 2EFPA 1SD5A 5JJTA 2YX7A 3M9AA 5FFZA 4M71A 4OOIA 2DTRA 2M8EA 5D4SA 3L09A 4I7HA 4G94A 1EH7A 1XSVA 5FZRA 2Q0OA 2JT1A 1W7PD 5F64A 4N2QA 4MTEA 1ZU2A 2K02A 2DW4A 3CUQB 1FSHA 2OZUA 1USTA 2FRHA 3EUHA 2YX4A 3GFIA 3KZYA 2V5FA 2V1XA 4GGGA 4RGRA 3WTYC 2HO1A 1YQAA 3KZZA 4PCQA 3HUGA 2R5SA 4UI9K 1DMZA 1QZYA 5EEHA 4KNYA 2KFUA 1SFUA 1J7KA 5D5VB 5CLSA 2HOEA 1G4DA 1Z05A 3CK7A 3QU6A 3ECOA 1SFXA 1J4OA 4Q5SF 4G23A 1P5QA 1MJAA 1STZA 2KIMA 2XAGA 2DLLA 2J5OA 2IW5A 3ASGA 1PP8F 4XLPF 1B9NA 1P4WA 5ARFA 2QM3A 4CXFA 4QCJA 1TBXA 3CV0A 4UQYA 3CUQA 1QQIA 5EX3A 2R7DA 1UCRA 4UQXA 5D5UB 2P5KA 4MEYF 2WPVA 3ZGQA 5LCWJ 2O6GE 1K79A 2CSWA 5ICFA 5CJ9A 5HDNA 4GPKA 5CHEE 1ON2A 2W25A 4HQMA 3WTXC 3K9IA 1XDSA 2YSRA 1O3RA 5D8LB 1FOKA 1H9GA 5BW8C 1TW3A 4P96A 2PEXA 3FFLA 5FD6A 3V8JA 3EETA 3FMSA 3E5XA 1K78B 2HQRA 1XN7A 5E20A 3LA2A 4G2VA 3I54A 3B02A 3T5XA 3NRVA 3BDDA 4U88A 3QWVA 2H94A 4FX0A 3V8KA 3U1DA 4HF1A 3KEOA 3GYHX 5L3BA 4BNCA 2P6TA 4D0PA 3DPLC 4G7ZF 4IVNA 3DFGA 2BYVE 2KC7A 1ZAOA 3GLXA 5C1DA 5HDGA 1GXPA 2CG4A 5CVIA 5KVRA 5A2QZ 4IF4A 1MGTA 5JHUA 1IRFA 3GO5A 4R8HA 4RB1A 3QWPA 2H6BA 5D0OD 2DPDA 1F1ZA 2M30A 5M72A 2JQLA 1PDNC 1BN5A 1YW8A 2XAJA 5AONA 3N97A 2IFUA 3HOTA 3JAMZ 4EM1A 2V9VA 1U5TC 1R1TA 3TG4A 3IRQA 2F5FA 1HSJA 2LSOA 3TQNA 4HBLA 3KE2A 3LA3A 1BJAA 1O57A 2IP2A 4HX7A 4QLCU 3UN0A 5D8KB 4ZYDA 1R00A 2ACJA 1CF7B 3Q4AB 1K3JA 1FZPB 3K1NA 3P9IA 1K3QA 2AVPA 1TQIA 4Q47A 2FBNA 4KUMA 1L3LA 4S05A 3SZ7A 3BP8A 3HSFA 2DK5A 1O3QA 1OYWA 1JGSA 2PBIA 1XDUA 4ENNA 5FZSA 2XAQA 4U0YA 1UHMA 3IKTA 2HEOA 4BH9A 3E3VA 4WK8F 2V1UA 3FMQA 2A3SA 4A5MA 2RN7A 3Q47B 1WRJA 2CO5A 1T39A 3R60A 3CJNA 3KP4A 4I0BA 3J7AO 1IAWA 1OUVA 1J5YA 2ESNA 5HLIA 3GVAA 3ZHEB 1J75A 5FO5A 3PE3A 4LGWA 1MZKA 1HKTA 3K2ZA 1CF7A 1J0RA 2DU9A 4L18B 4CZZA 1R1UA 4N39A 4JK1X 1IUYA 4KIBA 1Z1DA 1YS7A 1ELRA 4KYWA 4N3AA 2X0LA 4KMFA 1U78A 2PG4A 5DUIA 2D2WA 4ZYGA 3WTWC 4ENJA 1JE8A 1H0MA 1UHTA 4G7HF 2FF4A 4YVOA 3F8FA 1HXDA 3J81K 5JI6A 2VOPA 3KP6A 2EJRA 2LF8A 2EA2A 4AY5A 3ELVA 2C2LA 3H92A 4M74A 2L54A 2FQ3A 4GO1A 1TQMA 4AY6A 1KU3A 4WXCA 3VPYA 2XRNA 4ESFA 4AIFA 4OU0A 1ZHFA 3L7WA 3WU0A 5LEJA 4TV7A 3LY8A 1TQPA 3RYPA 1D8KA 2CWEA 5KJKA 4L5JA 2IA1A 1ON1A 3IHUA 5FB2A 1C0WA 2KCLA 3GUDA 4CDRA 3QU3A 3ZHEA 3VTXA 2Z33A 3JSPA 2V79A 1IW7F 5G04J 3GX4X 5G05J 4APOA 2FNAA 5HOOA 4CDGA 4HOBA 3CVQA 3LY9A 1QQEA 3FWVA 3RKWA 3FX3A 3U9GA 5D6FA 2OQRA 3GW4A 4J8DA 3MQ0A 1ZREA 2UY1A 2O3FA 4HORA 3VTYA 3WTSC 1S29A 1FP2A 1S3JA 4NQWA 5DJOA 4Z2YA 1ODDA 2F5CA 1FX7A 4RAYA 4BT8A 1FYLA 1G3TA 4O5VA 3FM8A 2VOOA 3F72A 4L9JA 5DBKA 2J5PA 2D1HA 3R0AA 4RB3C 3F3XA 2NNNA 4AIKA 2FNPA 4IRIA 1JHHA 4BTBA 2EFOA 4GYGA 1BI0A 2BV6A 2O0YA 3KP2A 1AWCA 1ZG3A 2DBBA 3QOPA 3CVNA 1Y0UA 1KQ0A 3BWGA 5E50A 1VTNC 5G04C 1FCHA 2O03A 3CTAA 2KATA 3CKBA 4N9IA 1MDMA 1G6GA 3CK8A 1BIAA 3GEZA 3PQJA 1W4MA 1IF1A 2ZFWA 3ABTA 4LJZF 4KN7X 1FHQA 5BPDA 2NRAC 2AXLA 3I64A 2VC1A 4U7DA 2M5WA 4PGHA 5FFXA 3T8RA 5FLXZ 1W5SA 1ELWA 1IN7A 1U6GA 2QFCA 1G6NA 3QOUA 3M7GA 5L3EA 2ZO4A 4O6FA 1FNNA 5FGMA 1DP7P 3R0JA 3UPVA 4J8EA 5ICGA 5LBQA 4I2OA 2L4AA 2EFQA 3BJOA 5HLGA 4P9UA 3ULQA 2HR3A 4EJOA 3K1PA 1KA8A 1ZRFA 3GYZA 3U3WA 3MZYA 3KFWX 1ZLKA 3C3WA 1E2XA 3HYMB 4RS8A 2VGXB 5BS6A 1HKSA 3ZMVA 2L02A 2JQIA 4G1TA 3WTVC 2A5YB 1OR7A 3E5QA 4WXHA 4Y17A 2CGPA 2OZ6A 1RUNA 3RIRA 3ASHA 3ZPJA 1F5TA 4UXNA 4KXKB 4R1HA 3ML6A 3W6KB 4I09A 2MH2A 1U5TB 5BMZA 3AS4A 1MD0A 1OYYA 4AVPA 2HTJA 2QWWA 2IVMA 3GQSA 3B73A 4B09A 5CCMA 4GYIA 5A2QK 2ZMEA 1YYVA 3IWFA 4HV5A 4YG2F 2KKOA 2Z99A 4ME2A 3LA7A 2YHCA 3MEXA 5IT3A 4ESBA 4HOUA 1S8NA 2RC4A 1T2KA 2KIUA 2ZNYA 3V4GA 3ZP5A 3RU0A 4XIFA 3AAFA 3AS8A 1X3UA 4GXOA 1SAXA 3ASDA 3F22A 1YIOA 2M87A 1HZ4A 4M9SA 2BE5F 3FZVA 1U5TA 3CO7C 1I1SA 4FT8A 1HKQA 3Q5FA 1W7PA 2XHKA 1YFHA 3TOAA 1IN8A 2DFIA 2XCBA 1BOAA 3QKYA 4YIIA 3KETA 2H09A 3LAJA 2IF4A 4BHBA 3ZMZA 2VE9A 5LHGA 1YS6A 1YJ5C 4UI9J 2FE3A 2XASA 3MKRA 4N5CA 4IXAA 1QZZA 3RPQA 2EH0A 5KJNA 4RB2C 4HOQA 4JONA 1HSTA 3U2RA 4U0SA 1I27A 1IXSB 4ETSA 1LDKB 2FSWA 1ZBPA 4EJWA 2DK8A 3TO6A 2Q2EA 1Q1HA 1FWZA 3CVLA 2E7WA 4Y6WA 4OIOF 2C0LA 3WE2A 2UWJG 3LPZA 4L0YB 2A07F 4A6EA 2OD5A 4WNEA 1B4AA 1J4PA 2PLYA 4BHPA 4KFCA 4KMUX 3Q9SA 4WNFA 2CYYA 2G9WA 2LSUA 3TDUC 1TLHB 4D9VA 5L3CA 1T6SA 3WGGA 4LG0B 2W24A 5DDGA 4HDVA 5ILVA 2K4BA 4HLXA 1F9NA 3GWZA 4HF2A 5CVUA 1WV3A 2X4HA 2GXGA 4UI9C 5A8IA 1XMAA 4Y6CA 2JPBA 3RJPA 4I2WA 2DQRA 2QENA 2VBZA 3J80K 4OIPF 4GYWA 2NS0A 2A69F 4ZYEA 1KYWA 1K6OA 3GFMA 4U0WA 2FEZA 3BOQA 1AOYA 3RJVA 1D3YA 3CUOA 1XGNA 3KLNA 1XB4A 3UQ3A 1U8RA 1YLFA 3OOPA 2JTVA 1USSA 1KQ8A 2ELHA 4E70A 4ABNA 2Y75A 5LGNA 5HS8A 4JQFA 5KJLA 1R22A 5JJ7A 4LG0A 4N2SA 3HIFA 3O2PE 4KA4A 4L0ZB 4AWXB 4WUYA 3G73A 4Y15A 3JTHA 3V7RA 1I1GA 3HRMA 3FMRA 2Q8KA 1T38A 4ZZDA 5EX0A 4MQ9F 4MQVA 3QPTA 3LWFA 5CVJA 4A6DA 3S2WA 4KT5C 2G7UA 2MA3A 4LD5A 1B6AA 4N3CA 3HRTA 2COMA 4BYYA 4GA2A 5JR3A 3LYAA 4O3MA 2A68F 5J8CA 2FMLA 4XRFA 3FP3A 3BROA 5CVRA 3P9CA 1ZARA 1XCVA 1YJMA 2R3SA 3LSTA 2FMYA 3QP6A 4GA0A 2QLZA 3KAEA 1EH8A 1K7AA 3QAHA 5J8FA 2FXAA 2P58C 4XSXF 3KP7A 1V3FA 4UNOA 4KBQA 2F5EA 3DPTA 3LQQA 3TKYA 2P5LC 1DPUA 5IT9Z 4A1SA 4P55A 3WTZA 1WKMA 4W9RA 4I0AA 1K78A 1XCBA 2WC2A 2WTEA 3LFKA 2KRFA 3TAXA 4I01A 4P9FA 2I6HA 5FLXK 4A0XA 2QBYB 1ONVA 3UUXA 3HUFA 2VONA 1LGQA 2A61A 4GCOA 4NRHB 2VODA 3R6SA 3ASFA 2XGMA 4FHTA 2JZYA 5LHIA 3I0MA 4EM2A 2VGYA 1BBYA 2XEVA 5BPIA 1R58A 1U2WA 1ZRDA 4M73A 3JTGA 2KJBA 2ZJ2A 4P5OA 4GZ5A 1R23A 1YG2A 5E17F 1HW5A 1DUXC 3H3ZA 4G24A 1F4KA 3WXXA 4LFUA 5ED4A 2OOEA 3RKXA 3PFIA 1J9IA 2XGOA 4H87A 1ZN2A 4JA7A 3GF2A 3R4KA 4EQQA 4EMSA 5FT9A 3VA1A 3ABUA 3SZTA 3UNNA 4G6DA 1B9MA 1IXCA 1P4XA 4OIQF 4G9YA 1QZ2A 1A04A 2UZKA 3IRRA 3Q15A 4MGRA 2FA5A 1KU7A 2JPCA 3L9FA 3QPHA 3S7DA 1B1BA 4NB5A 4EGYA 1TJCA 4B8XA 2YR2A 1QBJA 2PQNA 4LB5A 4RGUA 1XMKA 2ONDA 1FLIA 4BHCA 2STTA 5ERIA 4I17A 2FBHA 1KYZA 2C0MA 2HTSA 4WNGA 3K1MA 3K0LA 2ZXJA 2XCCA 1J4QA 2IA2A 3FHZA 3H3UA 3SXYA 4LK1F 5A7DB 2P5VA 2TDXA 4HW0A 3C1DA 3FXQA 3SF4A 3EQLF 1JHFA 3PO8A 5JJ6A 2WV0A 2DBAA 1ZLJA 2PIEA 1RIOH 4IPAA 1HW2A 3EDPA 4U07A 5ARGA 4UV9A 3I0NA 4XLNF 3FXUA 3VOEA 2XV4S 1G3SA 3BEEA 5BNWA 4NHJA 3D0SA 1OKRA 2GW1A 4MEXF 4CGWA 1LGPA 4ZYHA 2LC1A 3WODF 1SD6A 4M6XA 5HQ8A 3UMZA 3K69A 1KLXA 1GVJA 1FBUA 5LGTA 2H6CA 2UXNA 2P6SA 1ULYA 2ISZA 2CFXA 1P92A 1RUOA 1ZH5A 3R9AB 3E6BA 2YU3A 4HOSA 3EYYA 2QZ8A 2HYGD 2NC9A 2JRTA 1EV7A 2G1LA 1W3BA 1R1VA 2NAZA 3Q49B 3SFZA 3R61A 2G7HA 1EH6A 6PAXA 2XKOA 1G3YA 4BXUA 1FHRA 1FSEA 3UOTA 3QWWA 1SD7A 2XAFA 1QGPA 1QPMA 4J8FA 2MBFA 2L3DA 3F6OA 1KT1A 2K4JA 2A6EF 3GFJA 1XSXA 2DO7A 1QO0D 2ZNZA 1S7OA 1J2XA 5K5RA 5DCMB 3RDIA 3VFZA 2A6HF 2DT5A 3N4MA 4IRHA 1FBSA 1YTYA 3PDNA 1HQCA 2VBYA 3MEKA 1J4LA 3O48A 1R36A 2PQ8A 3FWEA 1ZYRF 4L5IA 5CVVA 1OPCA 2K27A 1V4RA 1UB9A 1KT0A 2RVCA 4Q48A 1O3TA 1G3GA 4EV0A 2L6JA 1FPQA 4LLGF 1XNFA 5FD5A 1KQ9A 4A12A 2EA4A 2QQ9A 4MHGA 2VSNA 3F8NA 3CO6C 3NF1A 2KCKA 2WQHA 2L01A 3POAA 2ADUA 1Z7UA 4PDKA 2XAHA 3KLOA 2YPRA 1Z9CA 1W5TA 4G7OF 4U0UA 5HDKA 2H27A 1WQ2A 2MH9A 4IHSA 1SMYF 4BQAA 3G3ZA 5DCMA 2AFFA 3Q5MA 5J6XA 3ERED 2L4MA 1FBQA 1LJ9A 3IC7A 2R7FA 3KS2A 2FOKA 3E6DA 4HV6A 4PZJA 5BT1A 3TO7A 1DDNA 3HUEA 1PC2A 4AIJA 2P7VB 4RB0A 1E96B 3M1EA 2D1VA 1LVAA 2EV5A 4AM9A 2XKPA 4IHTA 2K86A 2HKOA 3URZA 2M1BA 3RO3A 2GA2A 5L3FA 1K2NA 5LEKA 4YFNF 4UV8A 1FY7A 4H7XA 2LNBA 2QVOA 1MJ9A 4HYEA 3HSEA 4GZ6A 4LB6B 3V7SA 1HW1A 3S7FA 2XGXA 3WG9A 2STWA 2Y4TA 2LSVA 3K9TA 3T1BA 4EVIA 1D5VA 2F5DA 2QQBA 4GYYA 2LNIA 3TO9A 5JFRA 5H20A 4A0EA 2GA1A 5E8IA 5IT9K 5E1WA 3COAC 2QUFA 4M72A 4LEUA 1NHAA 3ROUA 3JAMK 1BIBA 5DCFA 1YO5C 2VGXA 1LB2A 3MA5A 2CQKA 2RKHA 4EGZA 2VXZA 4DQ2A 2RNJA 4OMYA 5H6QA 5DYMA 3C18A 2UWMA 4YFXF 4G26A 2D45A 2AS5F 2EV0A 5K1YA 5D5WB 3TGOA 4RG6A 1SMTA 2JSCA 1DPRA 4GZ3A 3I6UA 3MFKA 2Y0MA 1S6LA 1MKMA 1FYMA 2NNYA 2VT2A 4ZZLA 4WCGA 5ICEA 5D4RA 2GAUA 1MZBA 4JA9A 3RYRA 4GYOA 5K5OA 2KB4A 3W6JB 2XIGA 4JHRA 1R7JA 4HQEA 2JLBA 3F21A 1RNLA 3LKUA 4L9TA 1IRGA 3RO2A 3V7CA 4F3VA 3I0TA 2OQGA 1LDDA 1TNTA 2CSOA 2M45A 1A17A 4EGXA 2BBYA 1LDJA 5KJMA 1K2MA 4HA8A 4N9HA 5CCLA 2DPUA 3TOBA 2WWYA 3LCAA 3WTUC 3CEQA 4CO8A 2HGCA 1J4KA 4IRGA 1XGOA 5D0QD 3HTSB 4DNCA 3P7NA 5FJYA 3IL2A 2CW0F 2E2EA 4UHTA 1FYKA 2BRFA 4KICA 2MC3A 3S7JA 3MCZA 4HX8A 1JXSA 2KCVA 1T0FA 4LLLA 3E97A 4ASNA 4J0UA 1UFMA 3M8FA 3TGNA 3CK9A 2XPIA 2PMUA 4MTDA 1LNWA 4EJQA 3MV2B 5EEGA 1T98A 1RI7A 3PE4A 4I98B 4XSZF 4R79A 4CHUA 2MHKA 4KN4X 3WGIA 3LY7A 2XGSA 1P4AA 1NA0A 2RV8A 2GXBA 4WXDA 1PUEE 2HYFA 1L0OC 2VC0A 3V8LA 5TRDA 3REOA 2IPQX 3BPXA 4BT9A 1PP7U 3F6VA 2FO7A 4G25A 1TTYA 3UNMA 3OUNA 4LK0F 1LEBA 5HS7A 4HZFA 3BZ6A 1WSUA 5ICCA 1ZGJA 5KK1A 3BJAA 1XSDA 3KP5A 2HDCA 5DEQA 3QRFF 4M9ZA 3LAPA 3VB2A 1I6XA 3HX1A 1WI9A 1FC3A 3ZPLA 1G3WA 4BWRA 2W84A 3F23A 3E4BA 1WM5A 1O7LA 2OAZA 2ZKZA 4ENKA 4BTAA 2XUBA 4KIFA 3HYIA 1WLNA 1KU2A 3I59B 3WU1B 4RG9A 2VBXA 5DD4A 2OU2A 3F8CA 5AYWD 3RKVA 1HH8A 1TW2A 1FP1D 5L3GA 4EQFA 2VT3A 2KJCA 3ZMUA 3HTUA 5D5XB 2FU4A 4EJUA 5LHHA 3PQKA 3JYSA 3RPUA 1BI2A 5LCWC 3I4PA 3KCCA 4HDUA 2PJPA 1O7FA 1IN4A 2VE8A 1BC8C 1Z6RA 1Z6TA 3U4TA 4MNUA 3ECHA 4KYOB 2JQJA 2Z3YA 4A0YA 3L00A 1ZG1A 3AS5A 4WNDA 2VBWA 1O3SA 1MJBA 3DEUA 3E6CC 4O6JA 5ILUA 1BI1A 1IN6A 5LLQA 3I6WA 3I71A 3GXOA 2FBKA 2RQPA 3I59A 2Q7FA 1QNTA 3GZ1A 4L9NA 1NZNA 3DF8A 3JW4A 3ISPA 1XD7A 3T8TA 3MDBA 5BOXA 2Z9OA 1IN5A 3ZN1A 3MZHA 2XVCA 3VEPA 4KIGA 1BM9A 2P7CB 3WE3A 3GFLA 3I53A 4HAMA 3MAJA 4RAZA 4ON0A 1GHCA 4A2UA 1R5GA 4A5NA 1HXIA 3ZMDA 3JSOA 1LEAA 4EM0B 1B89A 2DAOA 5DV5A 3IEGA 3F8MA 2KKLA 4IN3B 1RZ4A 4G2SA 2QBYA 2DI3A 1B59A 4WX9A 3ZMTA 4U04A 3O3KA 2E1CA 4ESJA 3ELSA 3RI4A 5ILSA 3OXLA 4AIHA 3KD7A 3FF5A 2VYIA 5A6CA 4RGSA 5HS9A 1IXRC 2EB7A 3OXGA 2BGCA 2HWVA 3ESKA 4KDPA 3VA4A 1D8JA 1J59A 3S7BA 2BUGA 3OXFA 1QU5A 1YA0A 2DQLA 3BY6A 2E1NA 4K2EA 4A0ZA 4JL0A 4BAYA 2LKPA 5LRSA 2NYXA 3CLOA 2QYOA 2GWRA 5L3DA 3T0YA 2ETHA 3F8BA 3SHFA 3BJ6A 3ZFWA 2O61A 3CUQC 2OA4A 3N71A 4FX4A 3TG5A 5DD8A 4UQZA 3ZN3A 2UY1B 4I9EA 2XT9B 2ISYA 4F7ZA 3CDHA 4B94A 3EDTB 2P4WA 3J80Z 4G6QA 1SFEA 1P2FA 4Y13A 4AD9A 3FM5A 2IRFG 4H7YA 5E1XA 2EFNA 4OIRF 2K7LA 3KP3A 4Q4ZF 4HF0A 2W57A 4CICA 4JBAA 4LMYA 3OV8A 1H9TA 4U0ZA 1GXCA 3HHGA 1MDMB 3KT9A 3GZ5A 4WF2A 2MD5A 3Q9VA 2HZTA 2IJLA 3GZ2A 2HFHA 5DIZA 2W3OA 3O6BB 2J9QA 4G8XA 1YW7A 2MLKA 3HRUA 1GXQA 4I9CA 5HI7A 3LQRA 3DP7A 3UV0A 3DV8A 3HSRA 1R21A 2GZWA 1XGMA 2GQQA 2EFWA 4N0BA 3CKCA 2PL2A 2IA0A 4N3BA 3CVPA 2PN6A 1FT9A 1E17A 4I2ZA 5D6EA 3FM3A 4YVQC 1KU9A 4HOTA 2HR2A 4ZH4F 1P6RA 1XGSA 1ZG5A 4XI0A 2EK5A 3L2CA 3HRSA 3ULQB 4CGVA 2Y48A 5F6FA 4CYDA 1WAO1 5G05C 4I1AA 1CGPA 4XBFA 3C7JA 4QWQA 4HLYA 1I5ZA 5FZQA 3DQVC 2Z5UA 2ESHA 2GIVA 4WWCA 5JVTA 3I5UA 3MV3B 5DUKA 2HS5A 5LRRA 3NEUA 2Y4UA 3IKVA 4XI9A 5F1RA 3EYIA 2W85A 4S04A 2VN2A 1U3EM 4YIFA 1LQ1A 3E6MA 3RTRA 2MLGA 2YQ8A 4EJVA 1OMIA 4OMZA 2UXXA 4M9XA 4ENMA 4L9VA 2C6YA 2ZMEB 4RGXA 4PGGA 1HBXG 2PMHA 1S7AA 2XROA 1OYIA 1WWXA 2FI7A 2B0LA 5LGUA 1IYGA 5H6RA 1REPC 3KEQA 1K3NA 2OBPA 5HVQC 2HQNA 4NQ0A 5AIPA 4EJTA 1NA3A 2E7XA 3SZPA 5EKQD 4GCNA 3DXJF 3P9KA 2QQAA 2V6CA 3MWMA 5BQTA 5E8GA 4YNDA 3SQNA 1UHWA 3QDNA 4H0EA 3FXRA 1IZ1A 1W7PB 1Y8MA 4U0VA 1IHGA 2RDPA 3QP5A 4U7BA 2ZBKA 5AIQA 1KGSA 3TDZC 4LLNA 4HX4A 2HYZA 4I02A 5K5QA 2KIFA 2IT0A 3VODA 3BPVA 4UVCA 2HKXA 2EWNA 5E18F 4M6YA 4GA1A 1BI3A 3GW2A 2EV6A 2VQ2A
chains in the Genus database with same CATH superfamily
4OYSA 3E5UA 4GCVA 3RIBA 2EBIA 3FUHA 3ZN0A 5C2YA 4HNAD 1Z91A 4IHYA 2ZISA 4CZCA 2A6TA 3SFXA 2F2EA 3H0DA 4UUVA 3ZMSA 2DA3A 1MBKA 3LNQA 3WTTC 2ZFUA 4HNTA 3J81Z 1BW6A 5B1AE 5CYVA 4B93B 3ELKA 3S1MJ 3QB2A 4UVAA 1S64A 2PZIA 4X8QA 3GZ6A 1TNSA 3GMJA 2FBIA 5TJJA 3FH7A 2CQ7A 5EYRA 3IWZA 3PUKA 4YFKF 1ZGAA 1GLNA 2XS8A 2P8TA 2LF7A 1Q2ZA 2P9SG 2VSYA 2BEOA 3D5LA 1NL4A 3NQOA 2ZCWA 2PI0A 3I4NJ 3JCKC 2JK3A 1ZB1A 1R5HA 3G1OA 3RKYA 3CCLI 4Z6YA 2KB3A 2K3FA 1ZRCA 1QVUA 1SZ9A 3FULA 4OINF 1B72B 2PJRA 5AJLA 3H5NA 3DU5A 5E1ZB 1OLTA 4IJAA 3V42A 2GRLA 2LK2A 3HUGB 1SD4A 1YW9A 2LDUA 4RM3A 3L2RA 4XQFA 2DMUA 4B0ZA 3RSNA 3HOSA 2PQRA 2LBFA 2JVGA 2A0TA 2O8XA 2RGVA 1BC7C 3VZCA 3ZQ7A 2JPEA 5LOZA 4BEHA 3DKWA 5HLHA 3E37A 4BE2A 3I58A 4UVBA 5C4JJ 2M4KA 2PFBA 4KITB 1DVPA 3MKQA 3M8EA 1BD8A 1HC8A 3HHHA 3WGHA 2KT0A 2V1DA 3OYEA 4CGZA 5EF6A 5FTPA 3DWLE 2VKEA 2JKDA 1UJXA 2EFPA 2TCTA 1Z5SC 3RK6A 4WRRA 1TN6A 3LJ3A 1SD5A 2R7TA 4KT6B 2PNNA 3PZDA 5JJTA 4XL9A 4BUPA 1KONA 2YX7A 5IYDJ 3F9KA 2GGFA 2HE0A 2YHEA 3SBTB 2VTBA 3M9AA 5FFZA 4A3EJ 2X1CA 1AU7A 4M71A 5EGOB 1GVDA 4OOIA 2VLAA 3JXIA 2DTRA 2KIQA 3CMAI 2M8EA 5ENRD 4K5AB 1TT0A 5D4SA 5EEAA 3L09A 2VPLA 2B63J 3DBRB 4L02A 4I7HA 4G94A 1EH7A 2FJ1A 4BQQA 1OXJA 1XSVA 4XM3A 2HDDA 2IS1A 5FZRA 2Q0OA 1MX6A 2JT1A 1W7PD 5F64A 2FO1E 4N2QA 4MTEA 1ZU2A 1OT8A 2K02A 2DW4A 3CUQB 1FSHA 2OZUA 1USTA 4JEUA 2FRHA 2LAHA 3EUHA 4HLEA 2YX4A 3GFIA 3KZYA 5DHSA 1INZA 2BF0X 2V1XA 4GGGA 2V5FA 5J1UA 4GTQA 5F08A 2ZIRA 4RGRA 3WTYC 1QVTA 1BL0A 2HO1A 2EIJE 4Y3OA 3HOXJ 1B72A 1YQAA 1T56A 3KZZA 4PCQA 3HUGA 2R5SA 4UI9K 4CDNA 1QZYA 1DMZA 1SEUA 5EEHA 4KNYA 5E3OA 3S1NJ 1SFUA 3CVWA 4I1OB 1J7KA 2KFUA 5D5VB 1EYHA 2EIJH 5CLSA 3T5PA 3D9OA 5DS9A 4BACA 2HOEA 1E7VA 1G4DA 1Z05A 2X85A 4CA0A 3CK7A 3QU6A 3BTJA 1SFXA 3ECOA 1J4OA 2JRMA 1MBEA 3TP0A 3ZXSA 1UW4B 3CIAA 2YS9A 4HSRA 2LFBA 3HXCA 3EHQA 2OF7A 4Q5SF 4G23A 5AAOA 1P7IA 4BXFA 4XRMA 5E75A 1SVMA 1P5QA 2X9DA 3GTGJ 1MJAA 3DTKA 4UB8C 4LRZA 1STZA 4CDMA 2KIMA 1NFIE 3PJRA 2XAGA 5EGOA 1LD8A 2DLLA 2J5OA 2IW5A 3FTVA 3ASGA 4QIWN 2OUMA 1PP8F 3B95A 1JPLA 4XLPF 1NK3P 3G1LA 1B9NA 1P4WA 5ARFA 3L2WA 2QM3A 4CXFA 2PX9A 1Z0SA 1FEXA 5FQ7A 4QCJA 2E1MB 1TBXA 2ZC2A 1K6YA 3JRFA 3CV0A 3EU5A 3CUQA 1QQIA 4UQYA 3H36A 4GB9A 2R7DA 1UCRA 4UQXA 5EN5D 5EX3A 5D5UB 3HGGA 1VFCA 2P5KA 5BV0A 4MEYF 3DBLB 2WPVA 3SZGA 3ZGQA 2R7RA 5LCWJ 2DOEA 1CQTA 3QYEA 2O6GE 1K79A 2CSWA 5ICFA 5CJ9A 5HDNA 3G2TA 2I2BA 5H2FC 4RA2A 4Y7NJ 4GPKA 1OJLA 4II3A 1IC8A 1BA5A 5CHEE 1ETYA 1ON2A 1RPWA 2W25A 3DTIA 4HQMA 1XTAA 3WTXC 3K9IA 1Y1WJ 3B7UX 3FU6A 5ENQD 3OS2A 4A3JJ 1NK2P 4PS7A 1XDSA 1BPOA 4URKA 2XXSA 4JX5A 2YSRA 2R5ZB 2P81A 1O3RA 3VDXA 1OCTC 2Y69E 5D8LB 2DA6A 1FOKA 2Y1LE 1H9GA 2VSOE 3FU3A 2JN6A 2RNGA 3L6AA 5BW8C 1TW3A 4P96A 2LLKA 2PEXA 3FFLA 5FD6A 4WWNA 3HC7A 3FKIJ 2Y69H 3V8JA 3EETA 1OCCE 3FMSA 3E5XA 2JMWA 4PFOA 3TXNA 3L2QA 3B7RL 1K78B 2HQRA 1XN7A 4FCYA 2VJJA 2DFHA 5E20A 3LA2A 2K85A 1K1AA 1Y56A 2KDOA 3LDZA 3UM1A 4G2VA 3I54A 1OCCH 3B02A 3W2WA 2V1NA 3FXJA 5BPPA 4QSHA 5EJCA 3QAQA 3AAAC 4E85A 4Y4RA 3T5XA 2YNQA 5JEOA 3NRVA 4D7MA 3BDDA 1J09A 2DFEA 2ME0A 4U88A 4GTVA 3QWVA 4TRQA 4EBAG 2H94A 4FX0A 5ANLA 3V8KA 3U1DA 4HF1A 1ACIA 2LY2A 3KEOA 1E3PA 4IX7A 2XGDA 3GYHX 5L3BA 4PSXA 2F4IA 3IXEA 3OYAA 2DMTA 3KIOA 4BNCA 2P6TA 4D0PA 4XKVA 5IP6A 3S15J 4A3LJ 3DPLC 4G7ZF 3DSUA 4A55A 4IVNA 3EPZA 3ZU7B 2CUFA 3DFGA 1KZPA 2BYVE 3SFYA 4HEA2 2KC7A 2WMOA 4O1PA 1XC5A 1ZAOA 2BHZA 3GLXA 3W6VA 5C1DA 2WY7Q 4LERA 5HDGA 1GXPA 2CG4A 4MLPA 5CVIA 3E0JB 5KVRA 4GTPA 5A2QZ 1NG7A 5B66C 1MX2A 2RKKA 3DXKG 3PEUB 4IF4A 1MGTA 4XOPA 5JHUA 3GLLA 1IRFA 2CUJA 2KPMA 3GO5A 4R8HA 4RB1A 3MX3A 3QWPA 2CMPA 2H6BA 3E7LA 5D0OD 2R7WA 2DPDA 1F1ZA 4ACKA 2M30A 5M72A 2JQLA 1MZCA 1PDNC 5AQBA 2W7NA 1BN5A 4NDLA 4NACA 1YW8A 2XAJA 3CMYA 2IS6A 5AONA 3BUAA 5T8IA 3N97A 2IFUA 2Y3AA 3HOTA 3BCBA 4ABZA 4EM1A 1R4NB 2V9VA 5J3LA 1U5TC 1R1TA 3JAMZ 2Y9ZA 2OEWA 5AQ9A 1IO2A 3TG4A 4RMNA 1TNYA 2Z16A 3IRQA 4C2TA 3I3LA 1PUFB 3L17A 1WJBA 4XOTA 2ME6A 3ZQCA 2E5ZA 2BHYA 3S3MA 3K70C 2F5FA 1FJLA 1W36D 1HSJA 3L54A 4QQIA 5KNLA 2DA1A 2LSOA 3TQNA 4HBLA 2I1KA 2QC9A 3KE2A 3EUAA 3TWUA 3LA3A 4G11A 1BJAA 1O57A 1WJCA 2M9HA 3T8MA 2IP2A 3CCMI 4HX7A 1DNPA 4QLCU 4CSWA 2R03A 3UN0A 1RESA 5D8KB 4ZYDA 1R00A 2ACJA 1K1BA 4J7WA 1CF7B 1POGA 3Q4AB 1LKXA 1K3JA 4RLFA 3FDYA 1FZPB 5FRMA 3K1NA 3P9IA 1K3QA 2YU9J 3UIPC 3TW7A 2AVPA 3NOCD 2I5UA 1XX5A 3HL2A 1OFCX 1TQIA 2DJNA 4Q47A 2FBNA 3LVQE 4KUMA 3T5VA 4A3KJ 3S3OA 1L3LA 4S05A 2AW6A 3SZ7A 2IBDA 2WAQA 5J4VA 1MJ0A 3BP8A 3HSFA 2DK5A 1O3QA 4NNJA 1OYWA 4BY7J 1JGSA 2PBIA 1XDUA 2K9MA 1NI1A 4ENNA 3K7AJ 3FY4A 4HI8A 3D9KA 5FZSA 3V30A 2XAQA 4U0YA 2CH0A 1UHMA 1UG3A 3IKTA 1E8WA 3NQPA 2HEOA 1K8KG 4BH9A 2DA7A 3E3VA 4WK8F 4HRLA 2V1UA 3LVRE 3CCJI 3ZOBA 4CCMA 3L2UA 1V54E 1HU3A 3FMQA 3MGBA 2A3SA 5GP9A 4A5MA 3K2AA 3TW6A 3JRBA 2XZTG 2K5CA 2RN7A 2DA5A 1AHDP 3Q47B 1ZK8A 4IZZA 4ZYAA 3PNTB 1WRJA 4WAFA 2CO5A 1V54H 1KHUA 1Y0NA 3FKJA 1RKTA 1T39A 1Y3HA 1PUFA 2XAUA 1YRNB 4M3OA 2W1OA 4U8YD 5JA4D 3B6CA 4BY6A 2ZGDA 2XB5A 1T0FC 3R60A 3R9MA 3CJNA 1ETVA 2R5YA 3KP4A 4I0BA 3J7AO 2MG4A 2GRRB 3OIQA 1IAWA 3FUFA 4IO9F 1OUVA 3PIPF 2L0IA 1J5YA 1FOXA 2ESNA 5HLIA 3FH5A 3BTLA 3ESLA 3FU0A 3K4LA 3AU4A 3GVAA 2XGCA 3ZHEB 1J75A 5FO5A 3CCSI 3PE3A 4KJZA 4LGWA 1YE9A 5FRNA 4GRIA 1O1RA 1MZKA 5KWDA 1HKTA 2R92J 3K2ZA 4PJLA 1CF7A 1J0RA 2DU9A 4L18B 1UZCA 5EYLA 4B1RA 1PAQA 3D9HA 1MR1A 4CZZA 4RBOA 1R1UA 4N39A 1OCPA 4JK1X 4MFDA 1IUYA 2OPTA 2LR8A 4KIBA 1N0RA 1Z1DA 3IH4A 4GMLA 2I2OA 1HS6A 1MH3A 1YS7A 1ELRA 1Z67A 2X6HA 3PZ2A 4KYWA 4N3AA 2X0LA 4KMFA 4KISA 2LXMA 1U78A 5EJHA 2PG4A 5DUIA 3X2QE 3BG6A 2D2WA 3MVPA 2XDVA 3UINC 1HO8A 1W5CC 4ZYGA 3WTWC 2K9SA 4ENJA 1JE8A 1H0MA 1FVFA 1V55E 4JB8P 2ELJA 1UHTA 4G7HF 2FF4A 3H9GA 4CYCB 3F8FA 1HXDA 3J81K 5JI6A 2VOPA 1N54A 2AWIA 4YVOA 2V26A 3KP6A 1I39A 3X2QH 1JWGA 1OCZE 4U63A 2EJRA 3N05A 3EUKL 1RETA 4FA6A 2LF8A 4D5FA 2EA2A 2Y31A 4AY5A 3ELVA 2C2LA 4WERA 2VQGA 3H92A 4M74A 2L54A 3M1CA 1WH7A 2DZNA 2GRMA 3E32A 2KP6A 2FQ3A 2HDWA 4YDYA 4CYMD 4GO1A 1TQMA 1O4XA 1KU3A 1OCZH 3PNTA 2MSYA 2XRNA 4WXCA 4ESFA 4AY6A 3L1PA 4AIFA 4OU0A 1ZHFA 3L7WA 3WU0A 5LEJA 2DA4A 2IS2A 2LRDA 4EATA 4PDXA 4TV7A 4B89A 3LY8A 4M3FA 4JHJA 1TQPA 3ONLA 2CV0A 3RYPA 3HIZA 1D8KA 2CWEA 5KJKA 2ZXWE 4L5JA 3GTJJ 1YHQI 2IA1A 1ON1A 2QSFX 3IHUA 5FB2A 1C0WA 3KYLA 1A31A 2KCLA 4EZKA 3GUDA 3OMYA 4CDRA 3QU3A 1KHXA 1H0AA 3ZHEA 2V9KA 3VTXA 3ZYMA 2Z33A 5J40A 4IHXA 4WWOA 4C9BB 3O8HA 2ZSIB 4AVZA 3JSPA 3BR0A 1QBQA 3MD2A 2ZXWH 4OAYA 2V79A 1IW7F 3DSVA 5G04J 1VF9A 1FMVA 3SNXA 3GX4X 5G05J 2VKHA 2L9SA 2WAQN 2FNAA 1FOWA 4PJJA 4APOA 5HOOA 4CZ2D 2MFZA 4CDGA 3I55I 4HOBA 2GXAA 4GU5A 3C2HA 3I9V2 3WHCA 2BW3B 2M2EA 3CR3A 3CVQA 3LY9A 2L7ZA 1V5EA 1QQEA 4J8YA 1TC3C 4GZCA 3OSFA 3BQYA 2F4MB 3FWVA 5ENTD 5IY5E 5LFAA 5J47A 3FTSA 2KM4A 3TWVA 3RKWA 3HOVJ 2J8SD 1YJNI 3FX3A 3U9GA 5D6FA 2OQRA 4BQOA 1ETXA 1X81A 3MQ0A 1ZREA 3GW4A 4CYCA 4J8DA 3APFA 2UY1A 1D0ZA 2O3FA 4HORA 3VTYA 5IY5H 4E7HA 3KSQA 3WTSC 3OYIA 2R7ZJ 2DT7B 2X6KA 3OOUA 1JUSA 2L9NA 3W9GA 5B5EC 2J08A 2VKDA 1S29A 1FP2A 1S3JA 4NQWA 1D8DA 3EU9A 5EIBE 5DJOA 4Z2YA 3FK6A 2X6XA 1ODDA 3MKWB 2MRIA 3CCRI 3W2VA 3OYCA 2F5CA 1FX7A 4RAYA 2J09A 1FYLA 2LXLA 4BT8A 2QVLA 1RRJA 2H6HA 1G3TA 2GBYA 4O5VA 5F0HA 1OWOA 3FM8A 2VOOA 3F72A 4L9JA 2M34A 1IUFA 5FKKA 5DBKA 2J5PA 2D1HA 3R0AA 4RB3C 3F3XA 2NNNA 4AIKA 4ZDOA 4V2FA 3HDXA 2FNPA 4IRIA 3ML8A 4J6IA 1JHHA 3VYUB 4BTBA 1D8EA 5CMWA 3QK0A 3PREA 3MKYB 2EFOA 4GYGA 1BI0A 2BV6A 2OVFA 3VYTB 2W82A 2O0YA 2TRTA 3CP2A 3KP2A 5EZHA 1AWCA 1R4MB 1ZG3A 3O4ZA 3P2BA 3HOUJ 2DBBA 3DEPA 2CHZA 1JUMA 3QOPA 3CVNA 1Y0UA 4DZJA 1KQ0A 3BWGA 1GW6A 1VTNC 5E50A 5G04C 4UWGA 1R6RA 5J1YA 2XSJC 3A02A 1FCHA 2O03A 3CTAA 3H9QA 1DEVA 1T08B 4C30A 1QYMA 2KATA 4Z68A 3CKBA 4N9IA 1MDMA 1G6GA 5IYBJ 3U66A 3K4MA 3CK8A 1BIAA 2O9LA 4BETA 3V8QA 5CBNA 3ZRGA 1D1CA 3GEZA 1D1BA 3PQJA 2EZLA 1W4MA 1IF1A 2ZFWA 4A3GJ 3ABTA 4NBQA 2W00A 2X6FA 1ETKA 4LJZF 4KN7X 1FHQA 5BPDA 3PS6A 2QCOA 2NRAC 2P9LG 4UWFA 2LTPA 1IJWC 4XLFA 2L9RA 4RDUA 3ISMC 2AXLA 4C9YA 3I64A 4DI3A 3CVYA 4UWHA 3NOGD 2VC1A 4GTSA 4U7DA 2GLOA 5AARA 3JRCA 2M5WA 4PGHA 5FFXA 3T8RA 2EZKA 1A35A 5FLXZ 1W5SA 1ELWA 4C2UA 1IN7A 3PSFA 2DN0A 1U6GA 1VZ0A 1G6NA 2ECCA 2HYJA 2W48A 2W4SA 3ONQA 3OYBA 2QFCA 3M7GA 3QOUA 5CERB 4PS3A 3ERMA 2CFZA 1O5MA 4NUBA 5L3EA 2ZO4A 4DX6D 2R4GA 4O6FA 1FNNA 5FGMA 1DP7P 5IPAA 4HNVA 3R0JA 3TWQA 1MHQA 4A3VA 2FQ4A 1FVHA 4J8EA 3UPVA 5ICGA 2FD5A 5LBQA 4I2OA 3EJNA 2IXSA 1VQ9I 2ECBA 3CQZJ 2XHEA 4BSZB 2IGMA 2L4AA 2EFQA 2JQ7A 3EHRA 1DGRM 3BJOA 3OAWA 4XRSG 1E8ZA 5HLGA 2E2HJ 4NIKA 2LKXA 4P9UA 2LAIA 4FLBA 2VXDA 3ULQA 2HR3A 2KZVA 3K1PA 4PFPA 4EJOA 1KA8A 1ZRFA 2GRPB 1DQUA 3DBSA 3GYZA 3MZYA 3KFWX 3ABMH 1HA8A 2IONA 3BG9A 2F8XK 1ZLKA 3VPYA 3B7SA 2Y0SA 3ABKE 3MMYB 3C3WA 4EBAA 1E2XA 3HXLA 3HYMB 2XEEA 3C3RA 4ZDLA 4RS8A 3PVLA 2VGXB 5C4VA 3FUEA 5BS6A 3SI5A 1HKSA 3M3YJ 3TMOA 2L02A 3ZMVA 2A5UA 3SO8A 4BERA 2JQIA 4G1TA 3WTVC 3EHMA 4I6ZA 3E30A 2A5YB 1OR7A 3E5QA 5HS0A 2O5RA 3EHNA 4HVBA 4WXHA 4Y17A 2CGPA 2GRQB 3V8NA 1UHSA 3V8RA 3ZYQA 2OZ6A 1RUNA 3RIRA 1U3CA 3ASHA 4ILGA 2G0EA 3ZPJA 3CC7I 1WG0A 3BQOA 1F5TA 4UXNA 4PJMA 3EIQC 3U3WA 4KXKB 4R1HA 1K4TA 3ML6A 2WXKA 3W6KB 4I09A 2LO6A 3A77A 1ETQA 1U5TB 2MH2A 3CDLA 5BMZA 4HRIA 3AS4A 4A3MJ 3C5RA 3UT4A 4AP2A 2HZDA 4AC0A 1MD0A 3CF5F 4ANWA 1OYYA 1JKOC 4AVPA 1HG2A 1X3WB 3I5PA 5CRVA 2HTJA 1DD1A 2QWWA 2IVMA 3JQ1A 3CZ6A 3BG1B 4L1BA 2HOTA 3GQSA 5CRUA 3B73A 4BX9A 2IGKA 4B09A 2M8GX 2R05A 5CCMA 2QSGX 4FC8A 1N11A 5BXOA 4GYIA 5A2QK 2ZMEA 4W1UA 4Q69A 2NSZA 2AXTC 1YYVA 3IWFA 3OY9A 4A3IJ 1IDZA 1JTYA 1N9AA 2FOWA 2KXPC 1MNEA 3IAM2 4HV5A 4YG2F 2KKOA 1LPQA 2Z99A 3K6GA 1RC9A 1FTTA 2MC4A 2X51A 3LA7A 2YHCA 4ME2A 4BKXA 3MEXA 3HKZA 5IT3A 4ESBA 1OY3D 4B8AA 2F8YA 1QNFA 4HOUA 1S8NA 3PNVA 4AYBA 3S16J 2RC4A 3JRIA 3VLFA 5F27A 2VKVA 4DX1A 1T2KA 4DYRA 4DX7D 2KIUA 3FTZA 2R7UA 3PFNA 2ZNYA 2KDZA 4V2GA 2E2JJ 4RSYA 4JP0A 3V4GA 2MABA 4F92B 3ZP5A 3UKRG 5D2MC 3RU0A 4XIFA 2Q2EB 3AAFA 1QU3A 3AS8A 2DOAA 1X3UA 4GXOA 1SAXA 3ASDA 5BXUA 4FJYA 1U0TA 4FE7A 3E1SA 3QODA 1MYOA 1O1TA 4FLHA 3F22A 2DWZA 3ML9A 4L23A 1YIOA 5B1AH 3CMEI 5FKOA 2M87A 1HZ4A 4M9SA 2OV7A 2BE5F 3FZVA 1WY6A 5KNHD 4BX8A 3FTUA 3BZKA 5TGTA 2QSHX 2BY1A 2JJ7A 1U5TA 2CU7A 3DKXA 3CO7C 4H4KC 1OQYA 1I1SA 4FT8A 3UI2A 1HG5A 1HKQA 3GBGA 1IDYA 4GTTA 1TT5B 3Q5FA 2V8SE 4YDWA 1W7PA 4FU3A 2XHKA 1YFHA 2KBXA 3CVUA 3TOAA 2CHXA 1IN8A 2DFIA 2XCBA 1BOAA 3QKYA 1TWCJ 3G4SI 4YIIA 3KETA 1X4OA 1D0YA 2VUMJ 3I4GA 2PMZA 2H09A 4HPQA 1ORKA 3VYSB 3LAJA 1BJZA 5HODA 2IF4A 4BHBA 3ZMZA 2VE9A 5LHGA 3L2VA 1VI0A 4JYKA 1YS6A 3R7QA 1YJ5C 4UI9J 2FE3A 2Y0SN 2XASA 3MKRA 2DFFA 4IXAA 4N5CA 5JELA 3LFUA 4WWPA 4M3EA 3TL5A 2CFUA 3I3NA 1QZZA 3RPQA 2L9VA 2EH0A 5AJDA 1WH5A 4RB2C 4HOQA 4N5QA 5KJNA 2KHMA 2BY0A 4JONA 1HSTA 3U2RA 4U0SA 5DHRA 1A6QA 1I27A 1X1DA 1XS9A 3PO2J 2LY1A 1IXSB 4ETSA 1MH4A 1LDKB 2FSWA 3NARA 3BG3A 1ZBPA 4EJWA 5FKLA 3FXKA 3CJRB 2DK8A 2M7BA 3TO6A 2Q2EA 3DEOA 4KZ0A 1Q1HA 1FWZA 2VGEA 1UJKA 3CVLA 3BT9A 2E7WA 3K70D 5HLTA 4Y6WA 4OIOF 2C0LA 3W3CA 2R7XA 3WE2A 2UWJG 3LPZA 1ETWA 4L0YB 1TYQG 1AKHB 4PJ0C 2A07F 4A6EA 1MBHA 3VYRB 3D9PA 2VJ5A 2GOXB 1BR4A 2OD5A 4HNUA 4WNEA 1SA5A 4JX6A 1B4AA 1YGSA 1AA7A 3LSHA 1JKPC 3PRZA 3CHSA 1J4PA 2PLYA 4BHPA 4KFCA 4KMUX 3Q9SA 2NXPA 2QEXI 1FT1A 4ILHB 4WNFA 2CYYA 2G9WA 3K10A 1IQRA 2LSUA 3TDUC 3HDDA 1TLHB 1VQNI 3PZ1A 4D9VA 1T6SA 5L3CA 3WGGA 4LG0B 2W24A 1TWAJ 5DDGA 5C44J 4HDVA 5ILVA 2RD0A 3C72A 4IOCF 2K4BA 4HLXA 5KCMA 1F9NA 5DTDA 1N77A 3GWZA 4HF2A 4LCTA 3EUVA 5CVUA 3G1MA 5EG0B 5B1BE 1YMPA 1WV3A 5ENOD 2QA4I 2X4HA 2GXGA 2E1OA 4KT6A 3HKZN 3CHMA 1E3HA 3S8PA 3OR1C 2ZB9A 3FH8A 5CMYA 5TISC 4UI9C 5A8IA 4AYBN 1XMAA 4BGDA 3TWWA 1UJ8A 4Y6CA 5AN8A 4CCKA 2JPBA 3HG9A 3RJPA 4FHJA 1MW7A 3QWLA 5B1BH 1F43A 1MNDA 4AIDA 2WXHA 4F55A 3M8JA 4ZTJA 2B6CA 4AU7A 4I2WA 2XGEA 4GPMA 1SUWA 2Z2SB 2DQRA 2QENA 4DYQA 2VBZA 3J80K 5M3FJ 4OIPF 4GYWA 2NS0A 2A69F 3Q0UA 4ZYEA 1EJ9A 1N4QA 2VQCA 4C48B 3BR6A 1KYWA 2Y9YA 1K6OA 3GFMA 1PJRA 2FEZA 3BOQA 4U0WA 3Q7FA 3V7UA 3ONKA 1AOYA 2HQ5A 1S70B 3RJVA 1X58A 3RQIA 4JX4A 1D3YA 3CUOA 1FIPA 1XGNA 2X1DA 2HVRA 3KLNA 4K0RA 3G6EI 1XB4A 1H6PA 3UQ3A 1U8RA 2CUEA 1AKHA 1YLFA 3OOPA 2WQ7A 2JTVA 4CT0A 2XPUA 5GTHC 3Q0WA 4YELA 1USSA 1KQ8A 2ELHA 2WXRA 4E70A 1MMNA 4ABNA 2Y75A 2WQ6A 1DC2A 4ITVA 5HS8A 5LGNA 4JQFA 5G2NA 2HOSA 3LXUX 4G6TB 3LSJA 2LD5A 5JHFA 5KJLA 1R22A 1LUJB 4DUIA 3HPHA 3AFOA 4X1EA 2PMZN 2WXNA 4JZYA 1OISA 5JJ7A 4C0EA 4LG0A 1YI2I 2GOMA 4QPOA 4N2SA 4RQIA 2XB0X 3HIFA 3O2PE 3JREA 3RRMB 1NG6A 1YX3A 4KA4A 4XICA 4HRNA 4L0ZB 4XIDA 4AWXB 2HVQA 3LEWA 4XX5A 4WUYA 2QV7A 3OL4A 4Y15A 3G73A 1FT2A 3JTHA 3V7RA 1I1GA 4QPQA 2LC2A 2N8GA 3HRMA 3K4CA 3FMRA 5IOZA 2X6OA 1RR8C 2Q1ZB 3ZW3A 2Q8KA 1TN8A 2XS1A 1T38A 4ZZDA 2M4GA 4MQ9F 1LVKA 5EX0A 4M6VA 4MQVA 3ZYKA 3QPTA 3GCMA 3AJIA 2Q5FA 3LWFA 2VJ4A 3ESWB 5CVJA 4A6DA 3PZ3A 1L5JA 5EJFA 2LKSA 3S2WA 4KT5C 1YCSB 1G2HA 2ID6A 2G7UA 2MA3A 2QYUA 4LD5A 1B6AA 3HOYJ 3HRTA 4N3CA 2HM8A 2COMA 3OYKA 1RW2A 1Z0XA 1M1EB 2NOJB 4BYYA 3QARA 2OTLI 2BVLA 4ATGA 4GA2A 3QYFA 1JJ8C 1QA6A 5JR3A 1U7FB 3KEZA 2ELKA 3LYAA 1IV6A 1HF8A 4O3MA 2A68F 5J8CA 1UAAA 2FMLA 4XRFA 4XN0A 3FP3A 3BROA 1Z3YA 3P9CA 1ZARA 5CVRA 1MX4A 5EILA 1XCVA 1YJMA 3RZDJ 1IRXA 3IV0A 1TNBA 4BFRA 3AG1E 2R3SA 3LSTA 2FMYA 4MFEA 3QP6A 1VQ5I 4GA0A 3UTMA 2QLZA 3G71I 4ZHBA 4BBRJ 3KAEA 1EH8A 1K7AA 4KU0D 5IP9J 5BVIA 1N95A 3QAHA 5J8FA 2FXAA 3CF2A 3D5RC 4XONA 2R5ZA 3AG1H 2P58C 4XSXF 3KP7A 1V3FA 2OJED 4UNOA 4RM2A 1BI7B 1U8BA 1UN8A 1I3AA 1MMSA 4KBQA 2F5EA 4IHWA 1SFKA 1F36A 3DPTA 3LQQA 3TKYA 3SQVA 2P5LC 5AQAA 1TNOA 5LD2C 1NH3A 1LFBA 1DPUA 5E3LA 2IO3C 4BESA 5IT9Z 3JRAA 3TWSA 3CJQB 4P55A 3WTZA 4A1SA 1WKMA 2XRLA 3FBNB 3BLYA 4W9RA 4I0AA 4FQGA 2P9NG 1K78A 1XCBA 3SGHA 2WC2A 2WTEA 1APLC 3HPGA 3LFKA 2KRFA 3AG3E 3HB9A 3TAXA 4I01A 1HDDC 4P9FA 3M4OJ 2I6HA 2J4DA 3ZXPA 5FLXK 4A0XA 2QBYB 2MYSA 4TXRA 1Y8QB 1ONVA 3UUXA 4P1WA 4XRSA 4UWKA 3HUFA 3TL4X 2VONA 3LL7A 1LGQA 2A61A 2DOFA 4E7LA 4DYCA 2CG2A 3OYLA 4GCOA 3AG3H 4NRHB 1TWHJ 1ZOQA 2VODA 3R6SA 3ASFA 3FUJA 5GAGJ 1HF0A 1U7FA 2XGMA 3OWTA 2NVYJ 2JZYA 4FHTA 2FX0A 5LHIA 5DM6F 3OYMA 2KZGA 2NVQJ 2XQ0A 4EM2A 4M7CA 3I0MA 2VGYA 1BBYA 1PYVA 4FASD 1R58A 1U2WA 2KISA 5BPIA 1MQSA 1ZRDA 2XEVA 3CHRA 3G2UA 4OVUA 4C3HJ 3RKQA 4M73A 2E0IA 3UX4A 3JTGA 1XPXA 2KJBA 2ZJ2A 4RAFA 1IGNA 3VZDA 4P5OA 3A01B 4GZ5A 1R23A 2DVWA 4PUCA 1YG2A 5E17F 1ZR2A 1HW5A 1DUXC 2CQQA 3HBLA 3H3ZA 2X3MA 1QRYA 4G24A 3FEYA 4XLHA 1G59A 1F4KA 3Q75A 4A93J 2UUZA 1G3NB 1JWFA 3WXXA 2E60A 4D7NA 1TL8A 4LFUA 5ED4A 5E3NA 2BXZA 1A6IA 2OOEA 2P0WA 2ZJPF 2BXYA 3PFIA 3RKXA 1JCSA 3GTOJ 1J9IA 2HPMA 1YX5A 2VSXE 2XGOA 3FTWA 4H87A 2IEKA 4HLLA 1ZN2A 4JA7A 2K3PA 3GF2A 2EZIA 3R4KA 2QF7A 3OS1A 1OCOE 5KNGA 4YIRX 4EMSA 4EQQA 3MN2A 5FT9A 4E4HA 4NC7A 4LITA 3ABLE 2ID3A 3VA1A 5JERA 3PEVB 3ABUA 3GTPJ 3SZTA 3FDHA 1DU0A 3UNNA 4G6DA 4U8VD 1B9MA 1KPSB 1IXCA 2DJIA 1P4XA 4OIQF 4G9YA 1U2VG 1QZ2A 1A04A 1N0QA 2UZKA 3Q9NC 3ABLH 3IRRA 4V19K 2LREA 1S9HA 3PSIA 3Q15A 4MGRA 2FA5A 4I43A 3R7RA 2O7OA 2IQCA 1KU7A 2JPCA 2CG3A 3L9FA 3QPHA 3A4CA 4XORA 1R9TJ 3S7DA 4I1MA 1B1BA 2LP0A 4NB5A 3A1YA 4EGYA 1TJCA 4B8XA 1WJEA 1X3ZB 2YR2A 1QBJA 2XC7A 2PQNA 4LB5A 1UN9A 2P9UG 5ANRA 1MK2A 4RGUA 1XMKA 2ONDA 3I4MJ 4F6RD 1FLIA 1E8YA 4BHCA 3S3NA 3CD6I 4DOZA 5ERIA 2STTA 3A01A 4EHMA 4I17A 3BQZA 2FBHA 1JT0A 1KYZA 2C0MA 2HTSA 2HQAA 1JKRC 4WNGA 5EIDA 3UM0A 1XG1A 3K1MA 2VQHA 3K0LA 4M3DA 3WU2C 2ZXJA 3FK7A 3WG7E 5FLVA 2XCCA 4PK4A 1J4QA 2IA2A 5AENA 2E71A 4GMRA 3FHZA 3H3UA 4K5CA 3SXYA 3ULEG 1ENHA 3PNLB 4Y52J 4LK1F 3LSRA 3V31A 1MBJA 5A7DB 1GV5A 4XR6A 2P5VA 3WG7H 1V55H 2WXQA 2XF7A 1SW6A 2TDXA 2XPWA 2XEHA 4EZJA 4HW0A 3HXEA 2OVBA 3C1DA 3LSPA 2XZDG 3FXQA 3SF4A 4AOFA 3EQLF 4PUSA 3RAUA 1JHFA 4AM3A 3PO8A 5JJ6A 2WV0A 2DBAA 2V4LA 1ZLJA 3J7AY 2PIEA 3V79K 4BE0A 3V8PA 3ZQLA 1RIOH 3KEAA 1YRNA 2R2LA 4IPAA 4A63B 2L5QA 4DGWB 1HW2A 2JGRA 1T95A 3S17J 2DA2A 4R7LA 3G2VA 4DI4A 3EDPA 1MBFA 2DMNA 3M07A 4U07A 4XKCA 3CESA 5ARGA 2HU9A 3CSFA 4UV9A 3I0NA 4XLNF 3FXUA 4RLQA 3VOEA 3S2AA 2XV4S 2CW7A 1G3SA 3Q9UC 1N94A 3BEEA 3HJEA 2WXFA 2EIKE 1Z21A 2AXUA 3S1QJ 1S5LC 5BNWA 3TXMA 4NHJA 3D0SA 4CH7A 4LG6A 3DITA 2F5VA 1OKRA 2GW1A 2LOOA 5JVGF 4MEXF 4X6AJ 2RG8A 4CGWA 1LGPA 4ZYHA 2LC1A 3WODF 2EIKH 1SD6A 4UUCA 3NWSA 4M6XA 4DPRA 2H8RA 1VNDA 4GTRA 5HQ8A 2BKGA 5DHTA 3CC2I 3UMZA 3K69A 1KLXA 3CQGB 1GVJA 4TXQA 1SVLA 1FBUA 2VI6A 2VPRA 5LGTA 2H6CA 2UXNA 3SD5A 2P6SA 1ULYA 1LE8B 1WVRA 3HXFA 2ISZA 4I76A 2CFXA 1P92A 1RUOA 1QHHD 1ZH5A 3A0HC 5ENSD 3E33A 3R9AB 3E6BA 2YU3A 1X19A 3DKYA 4HOSA 3EYYA 1Z77A 2E34A 2HYGD 2QZ8A 3APDA 2NC9A 1D5YA 2JRTA 3B6AA 1EV7A 2BZTA 2G1LA 1W3BA 1R1VA 2NAZA 3Q49B 3SFZA 3TP3A 2L0TB 4NC8A 2V4HC 3R61A 2G7HA 1EH6A 4RVBA 6PAXA 2A5EA 1IQUA 2XKOA 3B13A 1G3YA 4BXUA 1R71A 1FSEA 1VQ4I 2WADA 3UOTA 1FHRA 3QWWA 3K4KA 1SD7A 2XAFA 5DHPA 1QGPA 2E1MC 1QPMA 4J8FA 2GRNB 3T8KA 2MBFA 3D9NA 4IQ4A 2CRGA 3CHQA 2L3DA 3F6OA 1JCRA 1Y1VJ 4BE1A 1KT1A 2J07A 2K4JA 3RCOA 3HGYA 2WB1A 2A6EF 4HAOA 1TWFJ 3GFJA 1OWMA 5CKTA 1ZQ3P 3KYDB 3ZEFA 1XSXA 3ZQGA 3L9TA 4F52A 2DO7A 3CGHA 1QO0D 2ZNZA 1S7OA 1J2XA 1UELB 5K5RA 1QHGA 5DCMB 1W36C 4GDFA 3RDIA 3C2GA 3VFZA 2A6HF 2Y2ZA 3AL0C 2DZOA 2R59A 2DT5A 3KYCB 3N4MA 2I29A 3BG7A 1PY1A 3FXLA 4IRHA 1FBSA 4F1SA 5GADJ 1YTYA 3PDNA 1HQCA 3LSMA 2VBYA 4U87A 4F91B 3FUNA 2BW3A 3MEKA 1IRZA 4BQNA 5ITZF 3CMMA 3O48A 1R36A 2PQ8A 1J4LA 2OV8A 1WZ2A 1GT0C 2QKMB 1HX8A 1WJAA 3FWEA 1Y6IA 2NVTJ 1ZYRF 1E8XA 1BI8B 1TNZA 4L5IA 5CVVA 2H6IA 1OPCA 2K27A 1V4RA 1UB9A 1KT0A 2RVCA 4Q48A 2I2FA 1O3TA 1G3GA 2HXOA 2WXPA 4EV0A 4DLOA 3H5AA 2ZJRF 5IOYA 2L6JA 1FPQA 2ZXIA 3JRGA 3MZLB 4LLGF 1XNFA 5FD5A 2CQNA 1KQ9A 4A12A 3S2DJ 2EA4A 3IHVA 2QQ9A 4MHGA 4J19A 1YITI 2VSNA 3F8NA 1A5JA 3CSTA 3CO6C 4QFVA 3TWXA 3V2XA 4CCJA 2EH3A 3NF1A 5K7ZA 4BL0B 5KHDA 1FMWA 3B7TA 2K9LA 2KCKA 2WQHA 2L01A 2WXGA 4JC8A 1LD7A 3UNGC 4CUGA 3POAA 3OYFA 2ADUA 1Z7UA 4PDKA 2J4BA 2XAHA 3DPUA 2YPRA 3GZNB 3KLOA 1Z9CA 3G2SA 4LNUD 1K3ZD 4DRXE 5JHAA 1JT6A 1W5TA 4G7OF 2MD0A 4U0UA 2XPVA 4IQJA 1HFAA 5HDKA 4DX5D 2H27A 1MBGA 1WQ2A 2MH9A 1ERDA 4IHSA 1SMYF 1IHBA 4A3FJ 4BQAA 3G3ZA 3JUEA 4LNBA 5DCMA 2AFFA 3Q5MA 3JUIA 5J6XA 1OWLA 3L22A 1Z3XA 2DDAA 2R7QA 3ERED 2L4MA 1FBQA 1LJ9A 3IC7A 1SQMA 3CJTB 4B4CA 2R7FA 2P2CP 1B8IB 2FOKA 5BNGA 3KS2A 1GV2A 3E6DA 4HV6A 3PNYA 4PZJA 3HOZJ 4AEZC 5BT1A 3TO7A 1DDNA 3HUEA 3S14J 1PC2A 2EIME 3C3OA 4AIJA 2F37A 3QNKA 2P7VB 4RB0A 1E96B 1MIJA 4LIVA 4MO7A 3ZUVB 4YEJA 3ABKH 3M1EA 2R17C 2D1VA 1LVAA 2EV5A 3FXOA 4V3IA 4AM9A 2XKPA 3OR2C 1YIJI 2EIMH 4IHTA 2K86A 2HKOA 2CQXA 3RRNB 2M1BA 3URZA 1RKWA 4OAZA 2DYSE 3IHYA 3RO3A 2GA2A 3HXBA 5L3FA 2HXIA 2JSPA 2ETAA 5LEKA 1K2NA 1MNMC 4YFNF 4UV8A 1FY7A 4JIWD 4H7XA 2LNBA 4MKTA 2QVOA 1MJ9A 4HYEA 4UB6C 3HSEA 2DYSH 4LB6B 3JCUC 2I8DA 4GZ6A 1EF1C 3NAWA 4ZTFA 2IO2C 1TEZA 3V7SA 1HW1A 1ZR4A 1X1PA 3CVVA 3S7FA 2WB1N 3K4NA 2JABA 2XGXA 3WG9A 2STWA 2L7KA 2Y4TA 4HQDA 1TJFA 2LSVA 5T3RA 3K9TA 3T1BA 2ZJQF 1JUQA 2HPIA 2KQRA 4DX2A 4EVIA 1G88A 3MCXA 1D5VA 2F5DA 3OIPA 1JTXA 2QQBA 3ASNE 4BEPA 5M5YJ 1T33A 2H1KA 4GYYA 2LNIA 2QYJA 1SVXA 3TO9A 3PUBA 4L9PA 3D9IA 4DY6A 1WHUA 1FIAA 1X1CA 1P7JA 3CCEI 5JFRA 5H20A 5D66A 3ASNH 4A0EA 2GA1A 4A69C 5E8IA 1X1BA 3L08A 5JEJA 5IT9K 5E1WA 3QOEA 3COAC 2QUFA 2LBFB 5C3EJ 5FIOA 3ZRHA 4R9PA 3FISA 3LSGA 2R93J 4M72A 4LEUA 1NHAA 3ROUA 3JAMK 4BEHB 3LMMA 1BIBA 2R7OA 5DCFA 1YO5C 2VGXA 4JXTA 2I2AA 3NAUA 2R0QC 1LB2A 1VQKI 3MA5A 3MKQB 4OVVA 1AP7A 4ATZD 3BG5A 2CQKA 2RKHA 4EGZA 2VXZA 4DQ2A 2RNJA 4OMYA 2CJJA 2LYCA 4CT4A 1W0TA 4JOMA 5H6QA 4UWLA 5DYMA 3PL8A 3C18A 1DU6A 2V9PA 4CCNA 1BR2A 2UWMA 4YFXF 2R7SA 4G26A 5LP0A 2D45A 3O8GA 1ETOA 3UM3A 5JMND 2L6BA 2AS5F 2EV0A 4UUTA 5K1YA 5D5WB 3NZUA 4RG6A 1SMTA 4GTOA 2JSCA 2ILRA 3UXGA 3TGOA 1DPRA 1U0RA 3AKZA 1Q1VA 2JA2A 3GTQJ 2BKKB 3FUKA 3Q0VA 3S40A 4GZ3A 3I6UA 4U95D 2FUG2 3MFKA 2Y0MA 1S6LA 1YT5A 3MYVA 1HE8A 4AUXA 3DSHA 3UR3C 3ZQHA 1VDYA 3QJZA 4L2YA 1MKMA 4ZDPA 1FYMA 2DXIA 5J1RA 2NNYA 5GPCA 1FPPA 2IY0C 4G8LA 2VT2A 4ZZLA 4WCGA 4S0HB 3QQAA 5ICEA 2A05A 5D4RA 4ILIA 4DJAA 2GAUA 2I10A 3JRDA 1MZBA 1E0EA 5AQ7A 4JA9A 3RYRA 2F4OB 2V5QC 4GYOA 5K5OA 5J08A 2KB4A 2BY3A 2DTZA 2XIGA 3DCFA 3W6JB 1SA4A 3JQ0A 5CPRB 5LX8A 4JHRA 1R7JA 4HQEA 3D1NI 1JI8A 2JLBA 3BR2A 3F21A 2X6JA 3ASOE 1RNLA 4O60A 1YOVB 3LKUA 4L9TA 1BR1A 1IRGA 3RO2A 3V7CA 3DEWA 4F3VA 3I0TA 2OQGA 1D0XA 2GM4A 1BW5A 1LDDA 4Y33A 1TNTA 4QTRA 4N4OB 4CRWA 2EILE 5FROA 2CSOA 4LG3A 3FTYA 2M45A 2BVMA 1A17A 4EGXA 1D9SA 4JVSA 5EYPF 2BBYA 1LDJA 3ASOH 5KJMA 1K2MA 4HA8A 1HDPA 4N9HA 1BLXB 5CCLA 2DPUA 4IL6C 3TOBA 2WWYA 5HRYA 3LCAA 3WTUC 1K61A 2X6YA 3CEQA 4CO8A 3BZCA 5E76A 3VLDA 2HGCA 4HG2A 2EILH 3TWTA 4IRGA 4ACLA 4C2MJ 3AG2E 4E6HA 1XGOA 5D0QD 3HTSB 2P9PG 1ZKGA 4G8KA 4DNCA 1I6HJ 4EZLA 3P7NA 3LS8A 2KLOA 4E7ZA 2DCPA 4HI9A 5FJYA 4JEHA 3IL2A 1K4SA 1X2MA 4MS6A 1KZOA 3S1RJ 3H5RA 5EJGA 2CW0F 5K7FA 2AXVA 3AG2H 2E2EA 2BONA 4UHTA 3Q7AA 1FYKA 2BRFA 2XRYA 3HHMA 3Q73A 1XMXA 2YUSA 4KICA 2MC3A 3S7JA 3MCZA 4HX8A 1H2TC 2IAIA 3BCAA 3IKOB 1QPIA 1JXSA 3Q78A 4KZCA 2KCVA 1T0FA 4LLLA 4JHKA 2UV1A 4M3BA 3E97A 3DSWA 2QQ8A 4ASNA 4J0UA 1UFMA 4UY8I 3M8FA 3TGNA 2M0CA 3CK9A 5J90A 1U0JA 4XN3A 2NYJA 4MRUA 2XPIA 4JW1A 3H35A 3APCA 2PMUA 3DWLG 1VQLI 4HBDA 3ZKJA 4MTDA 4O1OA 4J8SA 3QPSA 2LG4A 4XMYA 4IULA 1LNWA 4EJQA 3MV2B 5EEGA 1T98A 2ZXHA 1RI7A 5ENNA 3PE4A 3NB2A 4MLOA 4EPZA 1WFXA 2L2OA 2VIXA 4I98B 3JXJA 4ZC3A 5AIJA 4XSZF 3ZR8X 4R79A 2JA5J 4CHUA 2WVIA 2MHKA 3CLJA 2O8KA 4NURA 1ZGWA 1Z0ZA 3DLAA 1OCRE 1T8IA 3DSXA 4KN4X 3WGIA 3LY7A 1WDYA 1P4AA 3SFIA 1NA0A 2XGSA 5CQEA 2QZAA 2RFMA 3G2WA 2RV8A 2HVSA 2GXBA 3I4RB 3J5QB 4WXDA 5JHBA 4AJWA 1PUEE 2WXLA 3UT8A 2H1LA 2XPYA 1OCRH 1MSFC 2HYFA 3SJMA 4W97A 1SFOJ 2K9NA 1L0OC 2VC0A 4XKBA 1JUPA 3V8LA 5TRDA 2WV1A 3G2BA 3REOA 5M5WJ 4F1PA 2IPQX 2L7FP 4L7TA 4F53A 4DBQA 2BEDA 3VZBA 3VPRA 3BPXA 2NS8A 4BT9A 1PP7U 3F6VA 2FO7A 5E79C 3JR9A 5CQGA 5J4YA 4G25A 3GTKJ 3NZSA 1TTYA 4GAAA 3OUNA 4LK0F 3UNMA 1UG2A 3IV5A 1LEBA 3C98A 5HS7A 3PZ4A 1U9OA 4HZFA 3BZ6A 2AXZA 3BR3A 3DEEA 1OWPA 1WSUA 2JUCA 5ICCA 1VQMI 2X6WA 5EG0A 1ZGJA 1Y8RB 1W0UA 2E19A 2HNHA 5KK1A 2I1JA 2JEKA 3FUIA 3GTMJ 3BJAA 4TV3A 1XSDA 3KP5A 3H0GJ 2HDCA 2DYRE 3AL0B 5DEQA 2WXMA 3QRFF 1DCEA 2L9BA 4M9ZA 3LAPA 5DHQA 3VB2A 1I6XA 3GMEA 2KFDA 1WI9A 3HX1A 2R02A 1FC3A 3CCUI 3L16A 4FULA 3VLEA 1OR7C 3ZPLA 1G3WA 4BWRA 1WPKA 4HSTA 2DYRH 1SZAA 3BR5A 2W84A 4IEJA 1SVOA 5M3MJ 4I99C 3F23A 2PM6A 2ICWG 3E4BA 3K4JA 1O7LA 2XSDC 2V6EA 1WM5A 3BG0B 4IYPA 4E7KA 5B3SE 2WY8Q 1SAUA 2OAZA 2ZKZA 4ENKA 4FTHA 1O1SA 1N4SA 4BTAA 4OAVB 2XUBA 4KIFA 3HYIA 3GTLJ 2XRZA 1WLNA 3DTEA 4Q96A 1KU2A 3OSGA 1EA3A 3SDGA 5B3SH 3F0CA 3CCYA 3I59B 2AO9A 3WU1B 1S72I 4RG9A 2VBXA 5DD4A 2OU2A 3F8CA 5AYWD 3RKVA 1WCMJ 1HH8A 2WXIA 1SANA 1TW2A 2E35A 2H8WA 1FP1D 2F0YA 2ZSHB 2X6IA 5L3GA 2QY7A 4EQFA 3NWTA 2ZMEC 1Z0UA 2VT3A 2KJCA 3ZMUA 2COBA 2EINE 1ZTRA 3HTUA 5D5XB 5FWQA 2FU4A 4IRUA 4EJUA 2VJ8A 2XENA 5LHHA 4XE0A 3PQKA 3JYSA 3RPUA 3KX2A 1BI2A 5LCWC 3I4PA 1X2NA 3KCCA 4HDUA 2PJPA 3FU5A 1O7FA 1IN4A 2EINH 2VE8A 1NTCA 2ZU6B 1BC8C 3CC4I 1Z6RA 1Z6TA 4FE4A 4BXXJ 3U4TA 3CP8A 4LSZE 5EDSA 3LOCA 4MNUA 3ECHA 3P5JA 4DIQA 4F7AA 3OYDA 4D1QA 3HVEB 2IS4A 4KYOB 2JQJA 4PSWA 2Z3YA 4A0YA 3L00A 5HNFA 2X38A 4EECA 4C3JJ 1ZG1A 1TWGJ 3RQ4A 4B43A 1UOHA 3AS5A 4JPSA 2KMUA 4WNDA 3UM2A 5F0CA 2VBWA 1O3SA 1MJBA 1HLVA 2FULA 3A0BC 1QZEA 3DEUA 3IBEA 3IP4B 1RR7A 1Z7LA 3E6CC 1MJSA 1E7UA 4O6JA 5ILUA 4KVOA 4JIVD 2AJAA 2KZTB 1MSEC 2A4ZA 2I2CA 2DDBA 1G8XA 4J01A 1BI1A 1U9NA 2NOGA 1IN6A 3DU6A 4AVXA 5LLQA 4D10C 2CUZA 3I6WA 3I71A 4AV7A 3F6QA 4BDZA 3IH2A 3GXOA 3RPUD 2FBKA 2RQPA 3I59A 2VB6A 2Q7FA 4B3AA 1QNTA 3GZ1A 1DCQA 3RSEG 4L9NA 1NZNA 5EZGA 2R5YB 2E36A 3OIOA 3DF8A 3JW4A 1N25A 4A3TA 1D1AA 3IH3A 3ISPA 1XD7A 3T8TA 3MDBA 2CFOA 5BOXA 1IN5A 2Z9OA 3ZN1A 4PJNA 4IKFA 3NBNB 3MZHA 2JA7J 2XVCA 3VEPA 4KIGA 1JJ6C 1BM9A 3J7YJ 3WE3A 2P7CB 3FUMA 4A4YA 3GFLA 3I53A 4EEFG 4XZ4A 2BOLA 3ENEA 4HAMA 4I6JA 3RRUA 2K40A 2WMNA 4ANJA 3S32A 3MAJA 4RAZA 3E34A 9ANTA 1LFPA 4ON0A 1N52A 3OYNA 1GHCA 4BBSJ 3AU5A 5CEAA 4A2UA 3AFHA 3V2OA 2V7FA 1R5GA 2V0PA 4A5NA 1HXIA 3PIOF 2V4JC 3ZMDA 3JSOA 1LEAA 4EM0B 3TEDA 3CCVI 2OTJI 1B89A 2DAOA 4MIMA 4D9JA 1S0PA 2WM9A 3VWBA 5DV5A 4IOAF 3IEGA 3F8MA 3BR1A 3VSKA 2JA8J 4IN3B 2KKLA 1PVEA 3HVEA 5DHUA 3CHOA 1RZ4A 4J00A 4BJTA 2DT6A 5CBOA 4G2SA 4PH4B 1JCQA 1OCOH 2WXOA 2QBYA 2DI3A 1QWTA 1H2UA 1B59A 3EUHC 4WX9A 5HKPA 3ZMTA 4U04A 1UMQA 3O3KA 5DM7F 4ESJA 2E1CA 4HXIA 5T4YA 4XK4A 3ELSA 5JEKA 1N4PA 1EKEA 2JVHA 2B9SA 1H6KA 3CVXA 2KZTA 5IP7J 2K9QA 3RI4A 3IUOA 2WBMA 1UJJA 1VQ7I 4P29A 5ILSA 3H9JA 1SC7A 1H19A 3OXLA 5HNHA 1H8AC 2J49A 4AIHA 3DLLF 1WI3A 2DCEA 4G12A 2JWTA 1YJWI 3LJNA 3SY2A 1IKND 3KD7A 3FF5A 3D5SC 4FISA 3U1KA 2I2DA 1UG0A 2VYIA 2B0OE 5FKNA 5A6CA 3W9FA 5EJIA 3EIJA 4RGSA 5HS9A 2E2IJ 1IXRC 3PUJA 2IEJA 3VSLA 1JKQC 2EB7A 3CDIA 3OXGA 2WXJA 2BGCA 2HWVA 3ESKA 4KDPA 3VA4A 3CQCB 3DSTA 5H7PA 3ULYA 1D8JA 2BTDA 4LOCA 1J59A 3Q3SA 4A3CJ 2P9KG 2PM7A 3S7BA 1LF8A 2BUGA 3TJPA 2DODA 3OXFA 4DBRA 2B7EA 4XNFA 3ZQFA 1QU5A 1YA0A 2DQLA 3TWRA 4BJ5C 2GIZA 3BY6A 2E1NA 4K2EA 4A0ZA 1N4RA 4JL0A 2F6CA 5KAIC 4A3DJ 4A3BJ 4BAYA 2LKPA 2LUHA 3FIWA 5LRSA 3PO3J 2AQEA 3J7ZI 4II2A 4PS8A 3PH0C 3WHBA 5GTIC 2NYXA 3CLOA 4FHKA 5FKMA 3H1CA 3TBIA 4BU2A 2QYOA 1IV8A 3L82A 4C0MA 2GWRA 5A23A 3DPDA 5L3DA 3T0YA 2M0MA 4JD2G 2ETHA 3F8BA 3SHFA 2AQFA 1GUUA 4TUUA 3BJ6A 4I6GA 3ZFWA 4NC6A 4Q94A 5CEDB 4FP7A 2O61A 5FQ4A 3CUQC 2A5WA 2OA4A 4FADA 3BTCA 3N71A 4FX4A 1X5BA 3TG5A 1BU9A 5DD8A 1VQ8I 4K5BA 3FEXA 2UY1B 4UQZA 3ZN3A 4I9EA 2XT9B 4GZDA 3U21A 1TZLA 4DW6A 3FTXA 4ANUA 2ISYA 1ZELA 2IGNA 4F7ZA 4IHVA 1LTXA 3CDHA 3MKZA 3C3QA 3SBSA 4NQWB 4B94A 2L7MP 1A36A 2JUGA 3EDTB 2P4WA 3J80Z 3MKLA 5GAHJ 4GMJA 3T9KA 1VQOI 3MZ8A 4G6QA 4OWRB 2CHWA 1IG7A 2KL4A 2ETBA 1SFEA 1P2FA 4APFA 4KVMA 4Y13A 1MMGA 3K4BA 5GAEJ 4ANXA 3L13A 3HEFA 3FM5A 4AD9A 3Q79A 2AN1A 3KZIC 4A1GA 3OS0A 2IRFG 1I50J 1W1WE 1YJ9I 4H7YA 3QYBA 5E1XA 4U8HA 5FQ8A 3UT7A 3CCQI 2EFNA 4RLYA 2LVSA 2DMQA 3ZVVA 3DSSA 5F0FA 4OIRF 1AWCB 2DIWA 3MJWA 2K7LA 3KP3A 4Q4ZF 4HF0A 4B47A 4CCOA 2W57A 4CICA 2XF5A 3D9MA 1E3OC 2RAEA 1J4KA 4JBAA 4LMYA 5FLMJ 1TP4A 3OV8A 1H9TA 4U0ZA 1GXCA 3HHGA 4M3GA 4F93B 1MDMB 2XPZA 3KT9A 3GZ5A 3LSIA 4WF2A 4KMOA 4AXHA 4CCLA 1IXVA 3UKGA 1FOYA 2MD5A 2WAEA 3Q9VA 2HZTA 3JRHA 2EPFA 2IJLA 4L5EA 2HFHA 4BS9A 3GZ2A 3O6BB 2J9QA 5DIZA 3CHPA 2W3OA 3SYTA 2CV2A 4UUSB 4G8XA 1YW7A 2RREA 2BY2A 2MLKA 2IU1A 2MW8A 3DXMG 5C4XJ 3HRUA 3DPYA 4YRVA 3ZQQA 2QKLB 1GXQA 5JLXA 2R7VA 1S63A 3HXDA 3QC1A 3A03A 4I9CA 3LQRA 5HI7A 1J2FA 3BU8A 2LMDA 3DP7A 1P9QC 2AHQA 5JLWA 3UKUG 3UV0A 3DV8A 2WAFA 3CLQA 4XLEA 2M63A 3HSRA 1EDUA 4MBGA 4D5CA 4CCAA 4B48A 1R21A 2GZWA 3FHEA 1XGMA 3S2HJ 2GQQA 2EFWA 1ITYA 3D3MA 4N0BA 1V5GA 3I56I 2VL8A 1GDTA 2PL2A 3CKCA 1YYHA 2IA0A 4N3BA 3CVPA 5CECB 1R5ID 2PN6A 1FT9A 1E17A 3ZIMA 5IYCJ 3W2AA 1FTZA 3V8MA 1NP7A 1VQ6I 1U3DA 4I2ZA 1WGXA 5D6EA 3ZYLA 3FM3A 5KAFC 4YVQC 2MOWA 1KU9A 4DZPA 1LE8A 3V7WA 2EQXA 2WA0A 4HOTA 3V80A 2HR2A 3BTIA 4RAGA 4ZH4F 1P6RA 2CV1A 1XGSA 3OYJA 1ZG5A 2I1WA 5JEMA 4XI0A 3ZCOA 2EK5A 3RZOJ 3L2CA 4GTMA 4B3XA 3HRSA 3ULQB 3U9WA 4B44A 1H89C 2Y48A 5F6FA 4CYDA 1WAO1 4CGVA 2H6FA 2DMPA 5G05C 4I1AA 2QGUA 1MMAA 4YDEA 3FXMA 3ZQIA 2OCEA 2KRCA 1K83J 2NVUB 5EDNA 1N75A 1CGPA 3LSKA 4XEIG 4XBFA 4K03A 3C7JA 2OCCE 4X0GA 4BY1J 4QWQA 2LH9A 4HLYA 1HOMA 1I5ZA 4GFBA 1V5FA 3D9JA 5FZQA 3DQVC 2MYOA 2Z5UA 5ENPD 2ESHA 2GIVA 1U7VB 2D5VA 4WWCA 4CEMA 1S7EA 4U96D 1EF4A 5JVTA 2OCCH 3I5UA 4UUSA 1N78A 3HG0D 3MV3B 3OTNA 1MMDA 3DRAA 2Z1DA 4DK5A 3KPHA 2HS5A 5DUKA 1DP3A 1OWNA 5LRRA 3FHNA 3AG4E 3NEUA 3HRAA 2Y4UA 3IKVA 1KZHA 4XI9A 5F1RA 4XLAA 5GPAA 4E7JA 4HFGA 3EYIA 2NS7A 2W85A 4S04A 1X4PA 2HI3A 2H6GA 1DGWY 3PUFA 3AG4H 1ELKA 3FUDA 3A2KA 2VN2A 1TNUA 1U3EM 2EZHA 2ETCA 2CW8A 4YIFA 4L2LA 1LQ1A 3J5PA 3E6MA 5M5XJ 3RTRA 2MLGA 2YQ8A 2ZGGA 2HOAA 3KEYA 5KBAA 2EQRA 3SDBA 4EJVA 3H3VK 2CS3A 2JA6J 1OMIA 4OMZA 3D9LA 1LFUP 1H6OA 1I3QJ 2RQQA 2UXXA 2VQLA 2XF6A 4M9XA 2OEVA 4ENMA 2YINA 2VASA 3ABME 5FJ8J 3C2BA 4LNGA 4L9VA 2C6YA 2ZMEB 3HZJA 4RGXA 4XKWA 1TN7A 4TUMA 5FINA 4PGGA 2OC6A 3GZSA 1HBXG 4U7EB 4HRMB 4OAUC 2M7AA 1Y3IA 2PMHA 1S7AA 4C3IJ 4E7SA 2XROA 2IGOA 4YDOA 3U64A 5G55A 3ZNGA 1OYIA 1WJDA 1XGWA 4LIUA 5BUZA 1WWXA 2FI7A 4E6KG 3P1UA 2P9IG 2B0LA 5LGUA 1R49A 1IYGA 3KSLA 3FBIB 5H6RA 5F1JA 1H2VC 4BSXA 2Y0BG 1REPC 5FQ6A 4N4NB 3KEQA 5F04A 1E90A 2OBPA 1K3NA 2E5NA 5HVQC 5E3MA 1U7VA 2HQNA 4NQ0A 1WJFA 1H88C 4HB5A 4XLCA 5AIPA 4EJTA 1NA3A 3OL3A 2RFAA 2X48A 4ZJZA 3V7YA 3DBHB 3B7BA 2E7XA 4ZFHA 3HOWJ 2IOSA 3SZPA 4TXPA 5EKQD 4GCNA 3DXJF 3P9KA 2X1EA 2NVXJ 2QQAA 2V6CA 3MWMA 5BQTA 4BDYA 3QPLA 5E8GA 1TR4A 4YNDA 2LY9A 3SQNA 2I9CA 2M3AA 3IAS2 2KRHA 1UHWA 3UIOC 3QDNA 4H0EA 2PJRB 4V24A 3UMVA 3OYHA 2WB2A 3FXRA 1IZ1A 4F3QA 3BC8A 2IOLA 1W7PB 1Y8MA 4U0VA 3OYGA 1B8IA 3HM5A 1HCRA 1IHGA 2RDPA 3ZGKA 3S93A 5K7HA