2FEZA

Mycobacterium tuberculosis embr
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
373
structure length
373
Chain Sequence
RLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable regulatory protein embR
total genus 129
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2005-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fezA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fezA02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2fezA03
3R0AA 2OOEA 4L0ZB 1W3BA 4PDKA 3R60A 2UZKA 3KP6A 2C2LA 4PZJA 1T6SA 1UJXA 4P5OA 5BS6A 2JPEA 3CDHA 2GAUA 2QQBA 4LLGF 4KUMA 2FQ3A 1DP7P 4K2EA 2V1UA 3U3WA 4I2OA 3H92A 3WTZA 5G05C 4N3AA 3QOUA 2R3SA 5HDKA 3BWGA 4BAYA 4UVAA 2IF4A 3WGGA 3LY8A 2HGCA 4KN4X 4EJOA 2QLZA 4GO1A 1IXSB 1JHFA 4MGRA 1KYZA 1ZGAA 2LF8A 1GXQA 1FLIA 4F3VA 4WNFA 5CHEE 4EVIA 1USSA 4E70A 2YHCA 3QPHA 3J7AO 1W7PA 1YS6A 4I98B 1EV7A 5FD6A 1MZKA 3OXLA 5KVRA 2L01A 4N0BA 2EA2A 2OQRA 4L0YB 3OOPA 4NB5A 5FZRA 2DBAA 2BYVE 3SXYA 2BGCA 1YQAA 2KRFA 4XRFA 2DK5A 1JHHA 2IA1A 5HVQC 4M9XA 3ZFWA 2XEVA 1DUXC 5IT3A 3Q5FA 3LCAA 3F3XA 2O6GE 1DDNA 2CYYA 2ZXJA 2K86A 4KBQA 2H6BA 2P7VB 2V1DA 3F6VA 4O5VA 5DCMB 4RAZA 3L00A 3F22A 1YFHA 2GA2A 4W9RA 4H7XA 1X3UA 2XGOA 1TJCA 4EMSA 2RC4A 2QFCA 4N2SA 2KCVA 3RYPA 2QZ8A 3ZN3A 1MKMA 2K7LA 4B09A 2VC0A 3OXGA 5A7DB 4BYYA 3J81Z 2HQNA 1UCRA 3MEKA 5ARFA 3QAHA 4EM2A 2HTJA 3UQ3A 2YU3A 2EFOA 2A6HF 2A69F 3ZN1A 2JQJA 1KU9A 1XMKA 4U0SA 1REPC 2BE5F 5G04C 1KYWA 3JW4A 1G3SA 1KU2A 4ZH4F 1V4RA 3P9CA 3W6KB 5LCWC 4JA7A 3GZ1A 2WC2A 2XRNA 2XCBA 1FX7A 2P6SA 4A2UA 2P5LC 4EV0A 2EFQA 4OIRF 2MH9A 1P2FA 1IF1A 1WRJA 1QZYA 3KT9A 3TO6A 2KIMA 2O0YA 5TRDA 2ACJA 2LSUA 5HLIA 2ZNZA 2ZMEB 4IRIA 2M87A 5FLXK 1HKQA 4ENKA 4A5NA 4I01A 2Z3YA 1YS7A 3TO7A 2ONDA 3V8KA 4U7DA 2PEXA 5E17F 3E3VA 1O7LA 2XAQA 3LY7A 3OXFA 1IYGA 1MDMA 5HOOA 5K5RA 1UHTA 3IRQA 3GF2A 1QBJA 4AWXB 3F8NA 2MA3A 3ABTA 1CF7A 4LB5A 4ON0A 3N97A 4ZYEA 1YJ5C 2IPQX 2WTEA 1RUNA 1B59A 1KT0A 5D6EA 2Z5UA 2UY1B 1KQ9A 5LBQA 1B89A 1R58A 2J9QA 2MC3A 2HS5A 3QKYA 1STZA 1BI1A 4KIGA 3QPTA 1QU5A 3FX3A 1FC3A 4LK1F 4Q48A 3AS8A 1FBQA 3J80K 4HX4A 2PFBA 3UOTA 4H0EA 4L18B 2FA5A 4HOUA 3CVNA 4HOBA 1XGMA 3DV8A 3GW2A 1R1UA 3BDDA 4RGXA 2WPVA 2UWMA 4OMZA 3I71A 1KA8A 5DBKA 4GYYA 2CWEA 5KJMA 2PBIA 3QP6A 4P9UA 3SZ7A 3I4PA 4WXDA 4NQ0A 3VB2A 3HRUA 4ZYDA 6PAXA 1LDKB 2W24A 4RB0A 4XSXF 4DNCA 5E8GA 5A2QZ 4CO8A 3C3WA 3TDZC 4HW0A 2PQNA 5LGUA 5LGTA 3GZ6A 5EEHA 3TAXA 4D0PA 1YIOA 2KKOA 4I0BA 2IA2A 3LQQA 4Y6WA 3BP8A 5KK1A 2VE8A 2MLGA 3MV3B 2XGMA 3E5XA 4UNOA 1FHRA 3RPQA 3O6BB 1W5SA 2D45A 1IUYA 1BIAA 3GLXA 2VQ2A 1BBYA 1H9GA 5KJLA 1OR7A 2EV5A 4BQAA 3DXJF 2OQGA 4G7HF 4S04A 3GO5A 4MHGA 3GVAA 4WXHA 4N9HA 4N3BA 4UI9C 1HXDA 3QP5A 3HUFA 2IJLA 3C18A 1CGPA 3KEQA 3O2PE 2OU2A 3ISPA 4GPKA 3HRMA 3EQLF 5FZSA 1IXCA 1JE8A 3S7BA 4LG0B 3VA4A 1QQIA 3ZN0A 2J5OA 4I2ZA 1HBXG 5FO5A 3SZTA 4ZYHA 2R7FA 2QYOA 5CVJA 2PJPA 1FOKA 1LDDA 4RB3C 3VTYA 1XGNA 4QCJA 4U0ZA 2XASA 2W3OA 3CUQB 4H87A 5HDGA 1XDUA 3I53A 3HIFA 1A04A 2VODA 2QBYA 3K9IA 2RV8A 1T2KA 2PI0A 3Q9VA 1HW5A 5EEGA 1FBSA 1LEAA 5LHIA 3TG5A 3TOBA 3LAJA 3ZMUA 5D0OD 4J8EA 4M72A 3IWFA 1ZU2A 4RB2C 1F4KA 3M7GA 3GYHX 5LHHA 2KC7A 1J4OA 1I1GA 4GZ5A 1R23A 1TNTA 2HTSA 2IP2A 4KT5C 1L0OC 3ZPJA 3WTSC 4ESFA 4U7BA 4I2WA 3E6CC 3V7CA 1XGOA 5CCMA 4WXCA 2G1LA 2EV0A 1NA3A 2BBYA 1V3FA 1YW9A 3MQ0A 2GZWA 1O3TA 2BRFA 1XDSA 2QQAA 2JZYA 1XCBA 3F8MA 4AIJA 4WK8F 5A8IA 1G4DA 2A6EF 2X0LA 5D5XB 2X4HA 1HZ4A 5CJ9A 4ME2A 1ONVA 1YTYA 4I7HA 1IRFA 2YPRA 3U1DA 5L3CA 4G1TA 5FJYA 4ENJA 3GWZA 5BW8C 1U5TC 4EJUA 3L2CA 4CHUA 1QO0D 3R61A 4MEXF 4AD9A 3GYZA 2COMA 5AONA 4OIQF 1T38A 3HSRA 3R6SA 3FM8A 1P4WA 2D1VA 4UI9J 1IXRC 2XGXA 5LGNA 3V8JA 3LKUA 5E1XA 3WODF 2VOPA 5ICEA 3ABUA 4MQVA 4FT8A 3IHUA 2W57A 4M6YA 2P7CB 3IC7A 4UHTA 4H7YA 3RO2A 1KU3A 2JLBA 2JKDA 2VBWA 2XAJA 5FFXA 4FX4A 4YNDA 5L3EA 3FXRA 1FYMA 4EGXA 2HDCA 2PL2A 2PLYA 1MDMB 2HR3A 4EGZA 1D3YA 4CGWA 4IJAA 2PZIA 3I59B 4BTAA 5CVIA 1E2XA 4M9ZA 1OPCA 4LEUA 1G3GA 1QZ2A 3POAA 4XBFA 3FP3A 1PP7U 1XD7A 2VGYA 3ELSA 3PQJA 3IL2A 4UQYA 5HS7A 3KP3A 5H20A 1OKRA 2BV6A 5E1ZB 5L3FA 2L3DA 2XROA 1E17A 1BC8C 4I9EA 3TKYA 3FMSA 2P5KA 4N3CA 1FPQA 2BEOA 3RKVA 3E97A 3D5LA 4ZYGA 2PMUA 5K1YA 2M45A 3ZHEA 1F1ZA 3N71A 2OZUA 2W84A 2FRHA 1K7AA 3JTHA 1ZREA 4CICA 4A0XA 1Z1DA 1RNLA 2Y0MA 3RU0A 2PQ8A 3OV8A 1TW2A 3CLOA 4BNCA 4BT8A 5E50A 5HQ8A 3C1DA 2IT0A 1ZG3A 2FEZA 5DIZA 2JT1A 3QWVA 2XCCA 1R1TA 3WTUC 2WQHA 5JHUA 4HOQA 1ZG5A 4G7OF 2EFWA 2ZCWA 2YQ8A 3M9AA 1H9TA 2ZKZA 2DAOA 4JK1X 4KYOB 4IRHA 1ZG1A 2QQ9A 3BJOA 1E96B 1R21A 1YW8A 3KAEA 5HDNA 3AS4A 2A0TA 1SD7A 3I54A 4LB6B 2P4WA 1RZ4A 2VN2A 3MAJA 4L9VA 4HF1A 2L6JA 2XAGA 1XSDA 3M8EA 2UXXA 3ASDA 1NHAA 2KCLA 3COAC 1PDNC 2DPDA 4HV6A 4HOTA 3BJAA 1Z91A 4M73A 4MTDA 3F8CA 4F7ZA 2LF7A 2VXZA 1TBXA 2ZMEA 1XSVA 4KXKB 5CYVA 3WTXC 1YO5C 3F8BA 1S3JA 1TQPA 1UB9A 4JHRA 3U9GA 2L54A 5CVVA 2V79A 2Q8KA 2P58C 3CV0A 3MV2B 3KLOA 3KE2A 4NRHB 3T8TA 3CUQA 4IVNA 1P92A 3DPTA 3TDUC 2QWWA 5HI7A 4GA2A 1B6AA 1ZYRF 1ELWA 1P4AA 4HORA 4ETSA 4A6DA 4O6JA 2F2EA 3LYAA 2HQRA 5DYMA 3RJPA 4WCGA 2C0MA 5FT9A 2V1XA 4O6FA 1LEBA 4NHJA 4LK0F 3MEXA 1S7AA 3V7SA 2XVCA 3C7JA 4LD5A 1WWXA 2M30A 1I6XA 4U0UA 1YA0A 2DBBA 2EK5A 4GXOA 3UN0A 3GUDA 2RNJA 2VGXA 3AAFA 5LLQA 2NC9A 2F5DA 2L4MA 2GW1A 2OA4A 1IN4A 1C0WA 4XLNF 1BIBA 3QDNA 1TTYA 4G9YA 1TLHB 5JI6A 3BROA 2B0LA 3ZQ7A 3GFJA 4L9TA 5KJNA 3O48A 1IZ1A 1HW2A 2FNAA 5EX3A 2ZFWA 4A5MA 3DQVC 4AIFA 1K78A 1ZRCA 2CGPA 3BPXA 3E5QA 2XHKA 3R4KA 3T1BA 1TW3A 3B02A 2M8EA 4Q5SF 3TG4A 5FB2A 4G25A 3TGNA 1XCVA 2A68F 3KCCA 1BN5A 1GXPA 2NS0A 5DD8A 4RGSA 2C0LA 4L5JA 4HQEA 2RN7A 2ZNYA 1LGPA 4XIFA 5ICGA 2HYGD 2H09A 4LG0A 4RG9A 3GXOA 1K6OA 2XPIA 3ELVA 3I59A 5D4RA 3N4MA 5D5UB 2ZJ2A 2RVCA 2Y75A 3ZHEB 4OINF 1SD4A 3PFIA 4JBAA 4GZ3A 5CCLA 3CUOA 3QRFF 4ABNA 3I6UA 3G73A 3E6DA 3BPVA 5LRSA 3KP7A 2FBNA 2V5FA 4UUVA 1Z6TA 1ZARA 2DQRA 3JAMZ 2D2WA 3I6WA 3EYIA 3CKCA 2GXGA 5FFZA 5EX0A 3FZVA 3QU6A 4R79A 1XNFA 2STTA 4CXFA 3PQKA 2DQLA 2FI7A 4G2SA 2PN6A 3E6MA 5E18F 4HQMA 3HHGA 5D5VB 3Q4AB 5F1RA 1L3LA 3LA7A 2J5PA 4Y13A 2YX7A 5ILUA 2G9WA 2H94A 4KICA 1G3WA 2KJCA 4LLNA 4GYGA 2W85A 3F8FA 4S05A 4GA0A 3HX1A 5HLHA 3K69A 4YIIA 3MFKA 4J8FA 1I27A 2ZO4A 2QUFA 3RI4A 1IRGA 4G24A 1I1SA 5D6FA 3PDNA 1W4MA 3HSEA 1ZGJA 3LAPA 3FWVA 2Y48A 2FNPA 4UI9K 1BC7C 4KA4A 1FYKA 2Q7FA 4GYIA 1LB2A 1HSTA 5DEQA 3RKYA 1HXIA 4WNEA 3WTTC 3ERED 4KFCA 1RI7A 3ULQB 5A2QK 3W6JB 3FHZA 4HX8A 3KP5A 4EJWA 2E1CA 5F64A 3LA3A 1O3QA 1ZRFA 2CFXA 2HZTA 3WG9A 3ZMSA 4KIFA 5ICFA 4B94A 3TQNA 4MNUA 3I0TA 2LC1A 3IEGA 3U4TA 1KT1A 1J2XA 3FM5A 4WNDA 1XB4A 3EDTB 4HX7A 5ILVA 2EB7A 2FE3A 5DV5A 4PCQA 4CGVA 1IAWA 2P8TA 4P55A 5LEKA 1IN6A 3LWFA 2VGXB 2E1NA 2FXAA 2VOOA 1FT9A 2UXNA 4LGWA 3L09A 5DUIA 4Z2YA 2QM3A 3M8FA 3QU3A 5HLGA 1BI3A 4ESBA 1YW7A 4CDGA 2RKHA 3HYIA 5F6FA 3KS2A 3CKBA 1G3TA 3VEPA 1SFEA 1EH6A 3CO7C 1MJ9A 3CJNA 1FWZA 4GCOA 5H6RA 2R7DA 3FXUA 3K1MA 2A07F 1R36A 2MBFA 4J0UA 3LPZA 2NAZA 4CGZA 4EQQA 4KDPA 1ZLJA 2Z99A 5LCWJ 3KP4A 4GA1A 2E2EA 5DCFA 3Q49B 3HTSB 4KMUX 5LEJA 3ULQA 1ODDA 4ENNA 3E4BA 4AY6A 2HWVA 4M74A 1NZNA 3I64A 2DO7A 1P6RA 1KGSA 2JSCA 2W25A 4A12A 3KP2A 2AXLA 3RYRA 4BT9A 1S7OA 1P5QA 4HLYA 4YVQC 1FSEA 5A6CA 4U0WA 2FBHA 5M72A 1HKTA 2VBZA 5D8LB 3RJVA 4KIBA 3GFIA 4JONA 2PIEA 2DI3A 3ZMDA 1B9MA 3ASGA 4HAMA 4ZZDA 3ZPLA 2AVPA 2DT5A 3H3ZA 1ZHFA 2ADUA 3KZZA 1WQ2A 5G04J 2WV0A 1SD6A 5CVRA 2LKPA 3ECOA 5CLSA 4CYDA 3MZHA 1ZRDA 3ZMVA 4FHTA 3ASHA 3DF8A 4BXUA 5HS9A 5ARGA 3SFZA 2JPCA 4CZZA 2V9VA 3PO8A 4HZFA 4GCVA 3CVQA 4YFXF 2OZ6A 1WV3A 4RAYA 2JTVA 2XKPA 1OYIA 5E1WA 3DFGA 4U0VA 2C6YA 2K02A 1WI9A 3RO3A 4AVPA 1W7PD 3P9IA 1NA0A 1LGQA 1K3JA 5DD4A 4A0EA 4UVBA 4EM0B 3IKVA 2A3SA 4HA8A 1JGSA 4EQFA 3UNNA 1J59A 4M6XA 4IHTA 3P9KA 3IRRA 1Q1HA 4LJZF 3RTRA 1MJBA 1U78A 5AYWD 4I17A 2HFHA 4G6DA 2AS5F 1RIOH 2PQRA 2M5WA 3FXQA 4PGGA 2F5FA 1TQMA 2XAFA 1FYLA 4CDRA 3ASFA 1I5ZA 2VYIA 3KZYA 4FX0A 3E6BA 4I0AA 2IFUA 4IPAA 2HYZA 1DPUA 3UNMA 1YYVA 3PE3A 1GXCA 1ON1A 1Z05A 1LJ9A 4U07A 3Q15A 5J8FA 4A0ZA 4KMFA 3UUXA 4OOIA 1QNTA 1K78B 2O03A 3EETA 2HR2A 1R5HA 1DPRA 2KCKA 5EKQD 5C1DA 3G3ZA 3D0SA 1K2NA 2LDUA 2LSVA 2HEOA 4DQ2A 3Q9SA 4OIPF 1J7KA 4LFUA 2VC1A 2VSYA 3QOPA 1MJAA 2FOKA 5G05J 3JSOA 3KEOA 2Y4UA 1KU7A 4P9FA 2ZBKA 4YG2F 3J81K 2RDPA 4A6EA 2CW0F 4P96A 2E7WA 1S29A 3FWEA 4MEYF 3UPVA 5JJTA 4WWCA 4RB1A 1AOYA 1YJMA 1SFXA 4R1HA 1O3SA 4GGGA 2A61A 3GX4X 1GHCA 4HOSA 4WF2A 1SAXA 2ISZA 2HO1A 1J4KA 3HTUA 4UQZA 1OYWA 4RG6A 3J80Z 4ZZLA 2EA4A 3V8LA 2F5CA 3K1NA 1J4QA 5H6QA 5LHGA 1J9IA 1TQIA 1O3RA 3GFLA 1PP8F 4J8DA 2HKOA 1K79A 1PUEE 4RGRA 1U2WA 4WUYA 3PE4A 2XGSA 4OMYA 3RIBA 2OD5A 2VT2A 5BPIA 3CK7A 1BJAA 4R8HA 2KATA 1OYYA 3U2RA 3JTGA 2WWYA 3HOTA 2K4BA 3L9FA 5BQTA 3I5UA 1ZBPA 3RKWA 1U5TB 4G6QA 4HLXA 4QWQA 4AM9A 2FSWA 2EJRA 3RKXA 4OIOF 1UHMA 2KB3A 1FP1D 2L4AA 1B4AA 3WGHA 3Q5MA 4EJTA 5ERIA 5FLXZ 5J6XA 1J0RA 3K1PA 1R5GA 2KIFA 1JXSA 5ILSA 3CVPA 4EM1A 3I0MA 2CSWA 4AIHA 3MZYA 2FBKA 1ON2A 3HYMB 3CUQC 2P6TA 1QQEA 1DMZA 4WNGA 4OU0A 1O57A 1ZAOA 1BI2A 4G94A 4L5IA 2XKOA 3JYSA 3DP7A 3NRVA 4MQ9F 3WTYC 1YLFA 3I58A 3VODA 2VT3A 4Y17A 3NEUA 4D9VA 4XLPF 4ASNA 2ESHA 5E20A 4G26A 4EGYA 3KD7A 2JQIA 5L3BA 2FMYA 1AWCA 1J75A 3HSFA 4HDVA 2GA1A 3M1EA 2QBYB 2OAZA 2TDXA 3CO6C 1G6GA 3LSTA 1ZLKA 3MCZA 4AIKA 4G7ZF 2LSOA 2R5SA 2OBPA 4ENMA 4PGHA 5DUKA 4GYWA 2XAHA 3HUGA 5L3GA 1SMTA 3HRTA 2VONA 2H27A 4GYOA 2YSRA 3DEUA 4L9NA 2VBXA 3MA5A 4M71A 3B73A 1EH7A 2GWRA 5BOXA 3EUHA 1WAO1 5D8KB 4Q4ZF 3LY9A 2MLKA 3ELKA 3CK9A 3KLNA 1HW1A 3FF5A 3QWPA 2NRAC 2G7HA 4N9IA 3ZP5A 4HYEA 1IW7F 3DPLC 3Q47B 5JR3A 3AS5A 1U6GA 3F6OA 2FMLA 2ELHA 2NNYA 3K2ZA 1QGPA 3MKRA 1D8KA 3VFZA 3HOSA 4MTEA 2G7UA 3CTAA 4GZ6A 5FTPA 1BI0A 3R9AB 4Y6CA 4IXAA 2M1BA 1VTNC 1KLXA 1HKSA 1Y0UA 3ZMTA 2DTRA 1MZBA 1TNSA 3S7FA 1W7PB 2D1HA 2DK8A 2YX4A 3P7NA 5LRRA 4YFKF 1SFUA 4KNYA 1HH8A 2IW5A 4L9JA 5JJ6A 1HQCA 1WKMA 4IN3B 3ZGQA 1R7JA 2IA0A 3WE2A 2GIVA 2O61A 1XSXA 4JQFA 5IT9K 2UY1A 4A1SA 1UFMA 1F9NA 1YG2A 2PMHA 2HYFA 4RGUA 4G8XA 2BUGA 1Z9CA 1J4PA 1ZN2A 2XUBA 1R22A 3VTXA 2DW4A 1B1BA 1PC2A 4N2QA 4TV7A 5JFRA 4U04A 3WU1B 4EJQA 1T98A 3OUNA 2KFUA 1J5YA 3BEEA 4YFNF 1FHQA 3O3KA 1MD0A 4N5CA 1QZZA 4XI9A 1XMAA 1R00A 1B9NA 5FZQA 2NNNA 1FP2A 3WTWC 3BZ6A 5E8IA 1Y8MA 3RDIA 3V7RA 4Q47A 1U3EM 3SF4A 3JSPA 5IT9Z 1R1VA 1XN7A 3TGOA 1IHGA 4RS8A 2EFPA 3V4GA 2EFNA 3WU0A 5D0QD 5FGMA 2DFIA 3IKTA 2I6HA 3S7JA 4LMYA 1IN7A 2DLLA 1ULYA 3VPYA 3T8RA 5J8CA 1T0FA 1XGSA 3BJ6A 3NQOA 2K27A 4IF4A 2RGVA 2XT9B 5BMZA 2VBYA 5D4SA 2DU9A 3ZMZA 3JAMK 2QVOA 2KJBA 5BT1A 2YR2A 4I02A 1RUOA 2EWNA 1FSHA 3VOEA 5JVTA 5DCMA 1WM5A 2Q0OA 3TO9A 2ISYA 2FU4A 2MH2A 4HV5A 5K5OA 1KQ0A 4NQWA 4XSZF 4I09A 1ELRA 5FD5A 1WLNA 1LVAA 3ROUA 4U0YA 1Z6RA 1A17A 2VSNA 3MWMA 3RIRA 3BOQA 4GCNA 1D8JA 3SHFA 1U8RA 2GQQA 3WGIA 2CSOA 1WSUA 3WE3A 2F5EA 4EJVA 1OMIA 3FMQA 4HF2A 4HBLA 3BY6A 3ESKA 4UV9A 1K2MA 1F5TA 2CG4A 4QLCU 1S6LA 5KJKA 4BWRA 1MGTA 3GW4A 2EH0A 2VE9A 2XIGA 2P5VA 5AIQA 3EYYA 2STWA 4YVOA 3UMZA 1SMYF 3K9TA 3HUEA 4IRGA 3F72A 3T5XA 2KKLA 5JJ7A 2LNIA 2MD5A 1LQ1A 1S8NA 4JA9A 4ESJA 1P4XA 2DPUA 2QENA 5BPDA 3URZA 3HRSA 4JL0A 3K0LA 1IN5A 4IHSA 3VA1A 2KIUA 3FM3A 4BH9A 4I9CA 1O7FA 3UV0A 1FBUA 3MDBA 5K5QA 2K4JA 1J4LA 5DDGA 3KETA 1ZH5A 2CO5A 2MHKA 3CK8A 3KFWX 1LNWA 2ETHA 3CEQA 4BTBA 2V6CA 5BNWA 1H0MA 2E7XA 2UWJG 3GEZA 3SZPA 3REOA 4N39A 2IVMA 4WX9A 4KYWA 3EDPA 5CVUA 2EV6A 3I0NA 2HOEA 4APOA 3RPUA 1D5VA 4BHCA 3LA2A 2LNBA 4YIFA 3F23A 3S2WA 1EH8A 4G23A 2Z33A 2FO7A 3F21A 2PG4A 4UXNA 4O3MA 3S7DA 2AFFA 1CF7B 3GQSA 1OUVA 1HSJA 3DKWA 4G2VA 1FNNA 3QWWA 4UVCA 1QPMA 3WTVC 1FY7A 1LDJA 2A5YB 1IN8A 2NYXA 3GFMA 4UV8A 4XI0A 1USTA 1UHWA 3ML6A 2IRFG 3L7WA 3GZ5A 1BOAA 2JQLA 2O3FA 5HS8A 2Q2EA 2Y4TA 4KN7X 2GXBA 1BM9A 4I1AA 5ED4A 2ESNA 4M9SA 1G6NA 3SQNA 2O8XA 4HF0A 5AIPA 3LQRA 2CQKA 3FMRA 4BHBA 2KB4A 1Z7UA 3FFLA 2Z9OA 5TJJA 2JRTA 3E5UA 3NF1A 1U5TA 3T0YA 2HKXA 1KQ8A 3H3UA 2RQPA 1SD5A 3IWZA 2FBIA 4Y15A 3WXXA 1FZPB 5L3DA 2L02A 2H6CA 3HHHA 5DJOA 4U88A 2XV4S 1FCHA 1T39A 1W5TA 2FF4A 1K3QA 3R0JA 3CVLA 3GZ2A 3TOAA 4B8XA 4UQXA 4A0YA 4BHPA 2JPBA 3ECHA 5ICCA 1G3YA 4HDUA 1GVJA 1K3NA 3LFKA 5D5WB 4AY5A 4LLLA
chains in the Genus database with same CATH superfamily
3R0AA 2OOEA 5LD2C 4BJ5C 4BDZA 2N8GA 4L0ZB 1W3BA 4PDKA 4L2LA 2HU9A 2DN0A 3R60A 4B3XA 3DTIA 1EYHA 2FD5A 2UZKA 3KP6A 2C2LA 4PZJA 1G2HA 4GTSA 1T6SA 4PK4A 1UJXA 3V80A 4KISA 4P5OA 5BS6A 2PM6A 3CDHA 4L1BA 2JPEA 2GAUA 2QQBA 4LLGF 1OLTA 3MVPA 3RAUA 1E8YA 4KUMA 2FQ3A 1H8AC 3DU6A 2DFFA 2O9LA 5FRMA 1DP7P 4K2EA 2B7EA 2V1UA 3D9NA 3U1KA 1VQOI 3H92A 3WTZA 4I2OA 3QNKA 5BV0A 5G05C 4N3AA 1W1WE 4A69C 3QOUA 2R3SA 5HDKA 4ANWA 5FROA 3BWGA 1D1CA 4BAYA 3S3MA 4HLLA 1KONA 2XZTG 2LY9A 4UVAA 3WGGA 2IF4A 2OCCE 3LY8A 2HPIA 2A05A 2M4KA 1U9OA 3H5RA 2HGCA 4Y3OA 4KN4X 4MFDA 3FTUA 4K5AB 4EJOA 4UB6C 2QLZA 5FKOA 2LG4A 4GO1A 1IXSB 1HDDC 3FUEA 2VSOE 1JHFA 4MGRA 4AUXA 1KYZA 4D1QA 1ZGAA 2LF8A 1GXQA 1FLIA 4F3VA 1EA3A 2XS1A 4ZTJA 3HVEB 3MCXA 4WNFA 3FTYA 1Z5SC 3S8PA 2X6WA 1BPOA 4EVIA 4A3MJ 3I4GA 5CHEE 1USSA 4NC8A 1IG7A 4E70A 2YHCA 3QPHA 3J7AO 3IH4A 1W7PA 2V9KA 3A01B 1YS6A 4I98B 2R7TA 1EV7A 5FD6A 2E2HJ 1MZKA 4ZDLA 2JRMA 3OXLA 2VQGA 3TWVA 4LUNU 4LIVA 2JA7J 5KVRA 2AXUA 3UM2A 2L01A 4N0BA 2EA2A 2OQRA 2J4BA 4L0YB 3A4CA 4OVVA 5CEAA 3OOPA 4NB5A 4G11A 1PYVA 4U8HA 1N75A 3G1LA 5FZRA 4GRIA 2DBAA 2BYVE 3D3MA 3ZNGA 3ZQFA 3SXYA 2BGCA 2KFDA 2LD5A 1YQAA 3ZYQA 1IUFA 4BETA 2KRFA 2WA0A 3ZQGA 3ZGQA 1Z3XA 4XRFA 3GTJJ 2DK5A 3L2VA 1E8WA 4ANUA 1JHHA 2FULA 5FRNA 5IOYA 1DD1A 3CMYA 1Z0UA 2IA1A 3CJTB 1JKOC 5HVQC 4XLCA 4M9XA 4OWRB 3ZFWA 4MO7A 2XEVA 5H7PA 4CSWA 2Y69E 3IH3A 4MLOA 1X2MA 4MFEA 4B93B 1DUXC 5IT3A 3Q5FA 1ZKGA 5IY5E 3LCAA 3F3XA 2O6GE 2AXZA 1DDNA 4F1PA 2CYYA 2ZXJA 3FIWA 2K86A 4LNUD 1MNEA 3HVEA 3RRUA 4KBQA 4BE0A 2OC6A 5CMYA 2H6BA 2DFEA 2XB0X 1K8KG 2VKHA 2P7VB 2V1DA 2F4IA 3EUKL 3F6VA 4O5VA 1WJCA 1IHBA 2TRTA 5DCMB 4B48A 2JQ7A 4RAZA 3CR3A 2AW6A 3L00A 3F22A 1QNFA 3BG5A 2I2FA 1YFHA 2GA2A 3CDIA 5E75A 4W9RA 4PJNA 4H7XA 3OL3A 3CF5F 4C0EA 1WH5A 1X3UA 4I1OB 1QRYA 2XGOA 5AN8A 1TJCA 4MS6A 3ENEA 4EMSA 3H35A 2J49A 2WXQA 1A35A 2WVIA 1N78A 4IHYA 5AENA 3ABLH 2RC4A 2QFCA 2M7BA 2M2EA 2TCTA 3OWTA 1H89C 4N2SA 1NG7A 2ME6A 3RYPA 2IS2A 1QVUA 2QZ8A 2I9CA 2KCVA 3S1MJ 3ZN3A 4X1EA 1MKMA 4FADA 3BG3A 1LE8A 2HDWA 1B8IB 2K7LA 5CRUA 4B09A 2VC0A 5TGTA 2WAQN 3OXGA 2ECCA 4BYYA 5A7DB 4CYMD 3J81Z 2HQNA 1UCRA 4LSZE 3MEKA 1OJLA 1Y8RB 3E0JB 3QAHA 4EM2A 4IKFA 3BU8A 3D5RC 3CQGB 2HTJA 3NB2A 1X1AA 3L2UA 3T9KA 2WXKA 1Y39A 3UQ3A 4C3IJ 3AG4E 2YU3A 2EFOA 2R5ZB 2A6HF 2EIME 2A69F 3ZN1A 3DKYA 3PREA 3SO8A 4JX5A 4BESA 2EQXA 2ZISA 3E32A 2JQJA 1T56A 3FXLA 3OIQA 1JKQC 1KU9A 3U66A 4HNTA 1BR2A 2K5CA 2XPUA 3DEWA 4ZJZA 4V3IA 4FISA 1ZELA 1XMKA 2R7UA 4U0SA 1DU0A 5FLMJ 4HEA2 4J6IA 2Q1ZB 3RCOA 1REPC 3HGGA 3CCSI 2L7FP 1NI1A 2BE5F 2M63A 4URKA 5G04C 3VDXA 1FJLA 5EJFA 3ASOE 4DLQA 5CRVA 1KYWA 3FEYA 3PS6A 5T8IA 1I50J 3S15J 4OVUA 1MK2A 3JW4A 1G3SA 2FJ1A 1KU2A 1S63A 1V4RA 3P9CA 3W6KB 1QVTA 4E7SA 4ZH4F 5LCWC 4FJYA 4ACKA 4JA7A 1FOXA 2J4DA 3GZ1A 4IULA 2Y0SN 4B43A 2WC2A 2XRNA 2XCBA 1FX7A 1OQYA 2P6SA 4A2UA 2LXMA 3B6AA 3J5QB 3FUNA 2Q2EB 4XM3A 3GCMA 2P5LC 2ID3A 2ZJRF 3U9WA 4EV0A 2EFQA 2XF6A 5CKTA 2LOOA 4BL0B 3CC7I 4OIRF 3ZYMA 2MH9A 3ONLA 1P2FA 3DLLF 1IF1A 3LEWA 1WRJA 2FX0A 1QZYA 2IEKA 3JXIA 3KT9A 1PJRA 1ETQA 3TO6A 2KIMA 2L7ZA 2EPFA 2O0YA 5TRDA 2ACJA 2LSUA 5HLIA 1S9HA 1U7VB 2ZNZA 2ZMEB 5M5YJ 2M87A 4IRIA 1TWAJ 5FLXK 1VI0A 1UELB 2K40A 2WAFA 2R03A 3K4LA 2KDZA 1HKQA 4RAGA 4ENKA 4A5NA 5BVIA 4I01A 1X3ZB 2Z3YA 4Z6YA 3E7LA 2BZTA 1YS7A 3TO7A 1U3DA 3HOVJ 2ONDA 4JIVD 3V8KA 4U7DA 4E7HA 2PEXA 3FDHA 5E17F 3E3VA 1LUJB 1O7LA 2XAQA 3LY7A 3OXFA 1IYGA 2BONA 1MDMA 3D9OA 4WERA 4CDMA 1MBJA 4F1SA 4J7WA 5HOOA 5K5RA 1YJNI 2DZOA 2DT6A 2M4GA 3CHRA 1UHTA 3IRQA 3OL4A 1QHHD 1V5FA 2VJ4A 3GF2A 1QBJA 4XOTA 1T8IA 4JPSA 1MX4A 4BQNA 3A0BC 4KITB 4AWXB 3F8NA 2MA3A 2WB1A 3ABTA 1CF7A 4LB5A 4ON0A 3N97A 4ZYEA 1X5BA 4OAUC 1YJ5C 1YJWI 4MRUA 1Y1VJ 2IPQX 2WTEA 4PJLA 1B59A 1RUNA 1KT0A 1OCRE 1UJJA 2QF7A 5D6EA 4JX4A 3KPHA 4BEPA 1XX5A 2IS1A 5KBAA 3PFNA 4BSXA 2Z5UA 3M1CA 2UY1B 1KQ9A 5LBQA 2XZDG 2EZHA 3RK6A 5E79C 1B89A 1JUPA 3JRDA 1R58A 2ZGDA 2J9QA 2ETAA 2MC3A 4FTHA 3PEVB 1VZ0A 3HOYJ 3ZGKA 3Q7FA 2HS5A 3QKYA 1STZA 4LOCA 1BI1A 4KIGA 3QPTA 3HG9A 3G2WA 5FQ4A 1QU5A 3FX3A 1FC3A 4LK1F 4Q48A 4DW6A 3AS8A 4HPQA 1FBQA 3J80K 1P7IA 4HX4A 2PFBA 2WXJA 4H0EA 3UOTA 1ELKA 2EILE 4L18B 2FA5A 2ELJA 4HOUA 2MC4A 2R7ZJ 4M6VA 4I43A 2KISA 3FH8A 1IQUA 3ML9A 3CVNA 4HOBA 1XGMA 1OCCH 3DV8A 1RR7A 3GW2A 3WU2C 1R1UA 3BDDA 1NH3A 1QYMA 4RGXA 2WPVA 2UWMA 3PEUB 5F0HA 4JZYA 2IEJA 4APFA 3JRGA 2R7OA 4OMZA 2JA5J 3I71A 4PS3A 1WHUA 2LBFA 5C2YA 2B0OE 4GB9A 1KA8A 5DBKA 5LOZA 4GYYA 2QV7A 2CWEA 5KJMA 2PBIA 4ITVA 2WXRA 3KEYA 2OJED 3QP6A 1HLVA 1V54E 2I1JA 4BUPA 4Q96A 4P9UA 1DGRM 5JLWA 4PFOA 4L7TA 3SZ7A 3I4PA 3GZNB 2VSXE 4WXDA 3FUMA 4MBGA 4NQ0A 4U87A 3VB2A 3OYGA 4A4YA 3HRUA 4ZYDA 3DU5A 4LG3A 3UX4A 3V42A 3BTJA 5FJ8J 1LDKB 1M1EB 2CJJA 2EINH 6PAXA 2W24A 1B72A 2P9IG 4RB0A 4XSXF 1Z21A 3VSLA 5JELA 2QGUA 5E8GA 4DNCA 5A2QZ 4CO8A 3I5PA 2P1RA 3C3WA 2CUFA 3TDZC 4HW0A 3LSRA 2LMDA 2PQNA 2GGFA 4AU7A 4GTPA 3ESLA 5LGUA 3OYBA 5LGTA 4YELA 3GZ6A 5EEHA 2ETCA 2WXOA 3TAXA 3D1NI 4D0PA 1YIOA 2KKOA 4DLOA 5C44J 5B1BE 4FC8A 2VTBB 1BOBA 1SANA 4I0BA 4CCAA 1YX3A 4BS9A 2EINE 2VPRA 3FKJA 1OY3D 3B7RL 3DBSA 1OWNA 2IAIA 3DBRB 1Z0XA 2IA2A 3I56I 1VQLI 4L23A 1ZK8A 3LQQA 3BP8A 4Y6WA 5KK1A 2VE8A 2MLGA 5J90A 1SZ9A 5BXUA 2XB5A 2DOEA 2DZNA 3BG9A 4CCMA 3ZQLA 4XNFA 3P5JA 4D7MA 3MV3B 4NQWB 2XGMA 1WJDA 2CQXA 3E5XA 2PMZN 2CMPA 4UNOA 3OYHA 1R4MB 1FHRA 3DEPA 2LVSA 3O6BB 3RPQA 3MX3A 1W5SA 2D45A 1IUYA 1TNUA 1BIAA 3GLXA 2IO2C 3Q9UC 2VQ2A 1BBYA 1ETXA 1H9GA 2M0CA 1OR7A 3X2QH 5ITZF 5KJLA 2EV5A 1H6KA 1XG1A 3MD2A 4BQAA 3DXJF 5JVGF 2OQGA 2ZXHA 1E3OC 3LJ3A 4II3A 4S04A 4G7HF 5AIJA 1N4QA 1HOMA 3GO5A 4MHGA 1A36A 3GVAA 4WXHA 4RMNA 2XC7A 4N9HA 3DSWA 3LSKA 4FA6A 1MW7A 2NSZA 4UY8I 3FY4A 3PUJA 4M7CA 4N3BA 4KMOA 1HXDA 3QP5A 4UI9C 1NK3P 2PMZA 3QYFA 3EHRA 2IJLA 3CHMA 4GZDA 3C18A 3HUFA 1NTCA 4E7LA 4X6AJ 1RETA 1CGPA 2MD0A 1D0YA 2DA7A 2OU2A 3KEQA 3O2PE 2BY1A 3ISPA 3KIOA 2DYRE 2QC9A 3FU3A 4UWLA 3HRMA 4GPKA 1GDTA 3BR0A 3EQLF 2DXIA 5FZSA 1IXCA 1JE8A 2BKGA 4LG0B 3S7BA 3VA4A 3CQCB 4UWFA 4BEHB 4DK5A 3TXNA 1QQIA 3ZN0A 2K3FA 2J5OA 2V26A 3DCFA 4I2ZA 1HX8A 2KT0A 1HBXG 2UUZA 2VPLA 1ZB1A 4S0HB 5FO5A 3SZTA 3L54A 5F0CA 1JUMA 4ZYHA 2V4HC 3QPSA 2R7FA 2BW3B 1H6PA 5CEDB 2QYOA 5CVJA 4WWNA 2PJPA 1FOKA 2NS7A 1LDDA 4RB3C 3L9TA 4D10C 2RNGA 3VTYA 2BY0A 1XGNA 1Y6IA 2J08A 4QCJA 4WAFA 1TP4A 3RPUD 4U0ZA 2DWZA 3NAUA 4C3JJ 3O4ZA 4ZTFA 2XASA 1OCCE 4JEHA 3FTVA 2WY8Q 1XGWA 4I1MA 5KHDA 2W3OA 1YJ9I 3CUQB 1BLXB 5HDGA 2H8RA 1XDUA 3JUIA 3K7AJ 3I53A 4U8YD 1IO2A 3HIFA 1UOHA 4NNJA 3CD6I 2YHEA 3UTMA 4BERA 4IL6C 1A04A 3BR3A 2R5YA 1BL0A 2VODA 2NXNB 2QBYA 4RVBA 3K9IA 2RV8A 3M07A 1T2KA 1S5LC 3BQZA 5E3LA 2PI0A 3MZLB 3Q9VA 2DA5A 4E7IA 1HW5A 2DVWA 5EEGA 1FBSA 2QCOA 1H6OA 1LEAA 5LHIA 3TG5A 4KVMA 2EILH 1NFIE 3TOBA 3ZMUA 3LAJA 5D0OD 1JUQA 2CG2A 3M8JA 4J8EA 3J5PA 3CLQA 3TWXA 4M72A 4QFVA 3IWFA 1D0XA 2YS9A 1LFPA 2VQLA 3BLYA 2NVYJ 3ONQA 9ANTA 4RB2C 3CDLA 1F4KA 1ZU2A 1U0TA 3V8MA 4ANJA 3M7GA 3GYHX 5C4JJ 1AU7A 5LHHA 4XONA 4A3IJ 2KC7A 3LJNA 4EHMA 1J4OA 5HNFA 1I1GA 1Q1VA 1YYHA 4GZ5A 1R23A 3A01A 1XTAA 4LNGA 4YDWA 1TNTA 2EBIA 2HTSA 2IP2A 3GTKJ 5GTHC 4KT5C 1L0OC 3BG6A 1RRJA 2Y1LE 3FTXA 3NOGD 3HZJA 2HXOA 2E1MB 2DIWA 3ZPJA 4XOPA 3WTSC 4ESFA 4U7BA 5FIOA 4I2WA 1O4XA 5ANRA 3GTLJ 5TISC 1LVKA 1OWOA 3E6CC 4O1OA 3V7CA 1XGOA 2P9SG 5CCMA 4WXCA 2G1LA 2EV0A 1ENHA 1BI8B 1U7FB 1BR1A 1EF1C 1NA3A 1MBKA 2BBYA 1V3FA 1YW9A 5BV1A 2OTJI 3DSUA 3MQ0A 2Y31A 1I39A 1R6RA 4B4CA 2PJRA 4MKTA 1GW6A 4V24A 2BOLA 5FWQA 1R4NB 2GZWA 4CDNA 3UM1A 2L9VA 3ASNH 1O3TA 3R7QA 3LS8A 4JX6A 3IXEA 1JTYA 3JQ1A 2BRFA 1AKHA 1XDSA 3TWUA 4DI3A 4XKWA 2QQAA 2JZYA 2CRGA 3UNGC 1J2FA 1XCBA 3F8MA 2VIXA 3CCJI 3HIZA 3SBSA 1P9QC 4AIJA 3SNXA 4EPZA 1Y8QB 2BHZA 4WK8F 3FUKA 5A8IA 3ASOH 3Q0WA 3K70C 1G4DA 2WXFA 2A6EF 2X0LA 1EDUA 3X2QE 4GTRA 3DBHB 3GTQJ 3DSXA 5D5XB 4TXPA 3UT8A 2X4HA 1TN6A 2MGQA 3FHNA 4XKVA 1FPPA 2Z16A 3AU5A 1HZ4A 5CJ9A 4ME2A 1R5ID 3QWLA 2V9PA 1ONVA 4W1UA 4JHJA 1YTYA 4I7HA 1IRFA 2YPRA 3U1DA 5L3CA 5EGOA 4G1TA 4ENJA 1AHDP 5FJYA 3GWZA 5BW8C 1U5TC 3CHSA 4DOZA 3DBLB 4WWOA 5J40A 2W48A 4EJUA 2ZB9A 3L2CA 3U64A 2BXZA 3CCMI 5EZHA 4CHUA 2KHMA 3ZQHA 4D5FA 3MYVA 3ZIMA 1TNZA 1WVRA 1QO0D 3R61A 4MEXF 4AD9A 4KVOA 3GYZA 2COMA 3V79K 5AONA 4OIQF 2MABA 3EHMA 1T38A 3HSRA 5J1UA 3R6SA 1P4WA 2D1VA 4UI9J 3FM8A 3HXDA 5BNGA 1IXRC 2XGXA 1WFXA 2HI3A 5LGNA 4N5QA 4HAOA 2LP0A 1YMPA 2X51A 4PH4B 1V5EA 2O7OA 3V8JA 3LKUA 3B95A 3RQIA 1FTTA 3BR1A 5E1XA 3WODF 2I10A 1JJ8C 2VOPA 5ICEA 3ABUA 3A02A 3QYEA 4MQVA 4FT8A 2XF7A 2QA4I 3PUKA 3KYLA 1SW6A 3IHUA 2W57A 4M6YA 2P7CB 3IC7A 5AAOA 3IUOA 4UHTA 4H7YA 3M4OJ 1YOVB 3Q3SA 1Z7LA 2CQQA 3RO2A 1KU3A 3C98A 2JLBA 4JYKA 2Y0SA 4NIKA 2JKDA 1VF9A 2VBWA 3ZKJA 1QWTA 2XAJA 5FFXA 4FX4A 2CV0A 4YNDA 3NBNB 5GPAA 5L3EA 1ETWA 3FXRA 1WDYA 4B8AA 3BG7A 1E90A 1FYMA 4EGXA 3CP8A 1BJZA 2Y69H 2QYJA 1V55E 4L02A 2HDCA 2PL2A 2RKKA 2PLYA 1MDMB 1P7JA 3K10A 3V7WA 2Z2SB 5IYBJ 1XPXA 3S1QJ 2HR3A 2XHEA 2IGKA 4EGZA 1D3YA 4CGWA 4XE0A 2PJRB 2DA3A 2LBFB 4IJAA 2PZIA 2XF5A 3I59B 4BTAA 5CVIA 1E2XA 3FBIB 4M9ZA 2XPYA 1OPCA 3U3WA 3A77A 3JRAA 4LNBA 2AXTC 4LEUA 1G3GA 3LXUX 3S3NA 2HQAA 3SFIA 4D7NA 1QZ2A 1OCZH 3POAA 1FOWA 4XBFA 2P9LG 3FP3A 3I55I 2MYSA 1WY6A 3TWWA 1PP7U 2BXYA 3LSGA 2KZVA 1XD7A 2LC2A 3IAS2 5LX8A 2VGYA 3TP0A 3PQJA 2R05A 2ETBA 3ELSA 3IL2A 3PNTA 5EGOB 4FE4A 3HL2A 5HS7A 4UQYA 4HRIA 4GMRA 3KP3A 5H20A 3V8QA 1OKRA 2BV6A 2VI6A 3TP3A 2BHYA 4C3HJ 3PNVA 4DBRA 5E1ZB 5L3FA 3OYMA 2L3DA 2XROA 1E17A 3DPDA 4NBQA 2WAQA 1LD7A 1BC8C 1SVLA 4I9EA 3TKYA 1X1BA 2XPZA 2FO1E 1XMXA 3ONKA 2BEDA 3FMSA 2DYSE 1X1DA 2P5KA 2COBA 2VTBA 3K6GA 4B8CB 4N3CA 1FPQA 1POGA 5B3SH 2BEOA 3S1NJ 2X1CA 5ENNA 5AQBA 3RKVA 4E6HA 2P9NG 3UMVA 3E97A 3D5LA 4ZYGA 2PMUA 1Y3IA 5K1YA 2M45A 1HF0A 3ZHEA 1F1ZA 4XRSA 4XEIG 3FULA 3HHMA 3V31A 3L2QA 4CT0A 4Z68A 2GLOA 1TR4A 3N71A 2DMNA 2OZUA 2K3PA 2W84A 2R7QA 1JWGA 2FRHA 1OXJA 2V0PA 1XS9A 1K7AA 3JTHA 2R7SA 4I6GA 1ZREA 2KMUA 4A0XA 4CICA 2IOLA 1TWHJ 1RNLA 1Z1DA 2QY7A 5EIBE 2W4SA 2Y0MA 3RU0A 1IC8A 3AFHA 2CHWA 1V55H 3L08A 2PQ8A 2Y0BG 3OV8A 2ZJPF 1UJKA 3HPHA 1TW2A 3CLOA 4BNCA 2KDOA 4BT8A 5E50A 2VQCA 5IYCJ 5HQ8A 3C1DA 2IT0A 1ZG3A 2FEZA 2O8KA 2HDDA 2I2AA 5DIZA 3SDBA 2JT1A 1MX6A 1RR8C 3QWVA 3A1YA 3BC8A 3EPZA 3DSTA 2XCCA 1R1TA 1H0AA 3WTUC 2WQHA 5JHUA 3JQ0A 3CVXA 5CMWA 3DITA 3W9GA 1MZCA 4HOQA 1ZG5A 3K4CA 1IDYA 4G7OF 5AJLA 4AC0A 2EFWA 1U7VA 3OYFA 5EIDA 2ZCWA 2LK2A 2YQ8A 3APDA 5A23A 4B47A 2MW8A 4XX5A 2BF0X 2R59A 3M9AA 4G8LA 3OYAA 1H9TA 2ZKZA 2DAOA 2VB6A 4JK1X 3DSHA 4GTOA 3TEDA 4KYOB 3ZCOA 4V2FA 4IRHA 4C2MJ 1ZG1A 2QQ9A 3AG2H 3BJOA 3PIOF 1E96B 1R21A 1U9NA 1YW8A 3KAEA 1MMAA 3SEZA 5HDNA 3AS4A 2A0TA 1SD7A 3I54A 4LB6B 2P4WA 1RZ4A 2VN2A 3MAJA 4L9VA 3OYLA 1VQ7I 4HF1A 1HFAA 2I1KA 1BU9A 1D9SA 1UN8A 2L6JA 1TT0A 2XAGA 3NARA 5GP9A 1XSDA 3M8EA 2UXXA 2P81A 1N4RA 3ASDA 3LFKA 3MJWA 5KNHD 2V1NA 5HLTA 2CG3A 1NHAA 2ZSHB 4HQDA 2WXHA 1DGWY 2OPTA 3P1UA 2JUGA 3NWSA 1YHQI 1E3PA 2KCLA 2H1LA 4HNAD 5EDSA 3COAC 4A3EJ 1L5JA 2ZXWH 1PDNC 2DPDA 4HV6A 2CW7A 4HOTA 3BJAA 2D5VA 1N0RA 1Z91A 1PY1A 4M73A 4FP7A 1TNBA 1DP3A 4MTDA 2BTDA 2XRZA 1ZGWA 4E7ZA 3F8CA 3PJRA 4F7ZA 2LF7A 2VXZA 4C9YA 3H3VK 1TBXA 2ZMEA 3GTMJ 1XSVA 1JKRC 3QARA 1MMSA 3V30A 3HB9A 2MG4A 5CYVA 3L1PA 4KXKB 1N0QA 3WTXC 4HB5A 2X1EA 1YO5C 3F8BA 1WJ5A 1S3JA 1TQPA 1UB9A 4JHRA 4GFBA 2BY2A 1FVHA 3U9GA 2L54A 5CVVA 2BVLA 2V79A 2Q8KA 2P58C 3VSKA 3CV0A 3MV2B 2AHQA 3KLOA 3KE2A 3BG0B 5CBOA 2DCEA 5GAHJ 4GMJA 4NRHB 3T8TA 2CFUA 2H6FA 4CEMA 1APLC 3CUQA 4IVNA 2R5ZA 1P92A 2XSJC 1V5GA 3DPTA 3TDUC 2QWWA 2IO3C 4UWGA 1RKTA 5HI7A 4GA2A 4FU3A 3M3YJ 2IU1A 1B6AA 1ZYRF 2VXDA 1ELWA 4MIMA 4X0GA 2DOFA 1P4AA 1U3CA 3L16A 2X1DA 1SQMA 4HORA 4ETSA 3ABKH 1IKND 2L9BA 4A6DA 3V8RA 4O6JA 2F2EA 4AYBA 1WJBA 2HQRA 2X3MA 5DYMA 3RJPA 3LYAA 4GAAA 4WCGA 2C0MA 5FT9A 4N4OB 2V1XA 4O6FA 1N77A 1LEBA 4NHJA 1DU6A 4LK0F 3MEXA 1S7AA 1TC3C 4Y33A 2LKSA 1JT0A 3VWBA 2HVQA 5EJIA 2KRHA 3V7SA 1FTZA 2XVCA 5ENRD 3H9JA 2KLOA 3SGHA 3C7JA 4LD5A 1WWXA 4RBOA 3G2SA 2M30A 3FTZA 1I6XA 1Z3YA 5FLVA 4U0UA 1YA0A 4J19A 2DBBA 4DYCA 4RSYA 3LL7A 2HZDA 5FINA 3FEXA 4YDOA 2EK5A 4GXOA 2QKMB 1DNPA 2DCPA 1IRZA 3UM3A 3UN0A 3OR1C 3K4KA 1E7VA 3H36A 2F8YA 4IHVA 1N9AA 4HBDA 4LCTA 3H5NA 4XK4A 4HRNA 3KX2A 1W36D 3GUDA 2RNJA 3B7SA 3UKUG 2VGXA 3AAFA 4U96D 3ML8A 5LLQA 1YI2I 2NC9A 1MNMC 2F5DA 4AXHA 4BBRJ 2MOWA 1LD8A 3C2BA 2L4MA 2GW1A 3BCAA 4EECA 3N05A 1K3ZD 3FUFA 2OA4A 4DX2A 1IN4A 1C0WA 3JREA 3SJMA 3K4BA 4XLNF 1H2VC 1IV8A 5ENTD 1BIBA 1VQMI 1S64A 4XL9A 3QDNA 4OAVB 1TTYA 4G9YA 1TLHB 5KNLA 3ZW3A 5JI6A 3BROA 4XLAA 2B0LA 3ZQ7A 3GFJA 4L9TA 1UAAA 2GRQB 3B6CA 5KJNA 1AP7A 2ZMEC 3O48A 1IZ1A 2IBDA 2L7KA 4EEFG 1HW2A 2FNAA 5EX3A 3ZYKA 3PSIA 1JCSA 2ZFWA 3DEEA 3DQVC 4A5MA 4AIFA 5JEMA 2DDAA 4A3CJ 4XQFA 1K78A 1ZRCA 2CGPA 3BPXA 2DFHA 1B72B 2KRCA 3E5QA 2XHKA 3IP4B 3R4KA 3T1BA 4NDLA 3VZDA 1LFUP 1TW3A 3B02A 2M8EA 5IP7J 3BR6A 2R7WA 3S14J 4Q5SF 5FB2A 2WAEA 4G25A 3TG4A 3PZDA 3TGNA 1BD8A 2ELKA 3L2WA 2MRIA 3VZBA 1VQNI 3Q79A 1XCVA 2A68F 1BW5A 3PNTB 1YGSA 3KCCA 4XLHA 2Z1DA 1BN5A 1FMWA 2K85A 1GXPA 4NURA 2NS0A 5DD8A 4RGSA 1E8XA 2C0LA 1S0PA 4L5JA 4HQEA 2RN7A 4GDFA 2ZNYA 1HE8A 1LGPA 2OCCH 4XIFA 5ICGA 3G2TA 3FTSA 2HYGD 5IP9J 2H09A 2LO6A 3IV0A 4LG0A 4BQOA 4RG9A 3CCUI 3GXOA 2KM4A 1K6OA 2XPIA 5DM6F 1ZR4A 3ELVA 3I59A 2X38A 5D4RA 4DBQA 4PS8A 4K03A 5DM7F 3N4MA 3ABKE 5D66A 4BX8A 3HXFA 2EIJH 4AJWA 5D5UB 4EATA 1F43A 2ZJ2A 2RVCA 2Y75A 3ZHEB 4OINF 2RG8A 1SD4A 3PFIA 4JBAA 5CERB 4V19K 3HKZN 4GZ3A 1OWPA 5CCLA 3CUOA 3QRFF 1SA4A 3CGHA 4ABNA 2XENA 4QPQA 1E7UA 5IP6A 5B1AE 3I6UA 5E76A 4M3EA 3VZCA 3G73A 2R2LA 3E6DA 1Y3HA 1HG2A 3BPVA 5LRSA 4UUSB 1I3AA 3KP7A 1HDPA 2WMOA 3NQPA 2NVUB 3S2DJ 2JVGA 2FBNA 4HG2A 3VLFA 2JSPA 2ID6A 4XRSG 2V5FA 1JGGA 2GRNB 4UUVA 1GLNA 3Q78A 3QPLA 1Z6TA 4PS7A 5M5WJ 1S72I 3FXKA 1I3QJ 5F27A 1W36C 1ZARA 2DQRA 3IH2A 3JAMZ 2D2WA 3MGBA 3ULYA 3I6WA 3EYIA 3CKCA 2R92J 2GRMA 4MLPA 4M3FA 2WQ6A 1EKEA 3CSFA 3S40A 2GXGA 5FFZA 2I2DA 2KXPC 3S32A 5EX0A 4F7AA 3FZVA 3QU6A 4R79A 1XNFA 2STTA 4J8YA 4CXFA 2B63J 3PRZA 2E2IJ 3PQKA 4UWHA 4AVXA 1RC9A 2DQLA 2A4ZA 2FI7A 3OS2A 2CHZA 2F37A 4G2SA 3Q9NC 2PN6A 3E6MA 5JLXA 5E18F 4HQMA 2AWIA 3HHGA 5D5VB 3Q4AB 1TNOA 5F1RA 5IOZA 3TXMA 2A5UA 1LKXA 1L3LA 4IEJA 1X58A 3B7TA 3LA7A 3CMEI 2J5PA 4Y13A 1IXVA 3PZ4A 2G0EA 2YX7A 5ILUA 4PJ0C 3B7BA 5AQ9A 2G9WA 3FXOA 2J07A 2R7VA 4FASD 4A1GA 4UWKA 3PZ1A 2H94A 3OYIA 3P2BA 3KYDB 1G3WA 2KJCA 4KICA 1K61A 4LLNA 4GYGA 1T95A 2W85A 3DPUA 5FKMA 3F9KA 3F8FA 3VPRA 5IY5H 4S05A 4A3LJ 3EUHC 1X4PA 5HLHA 4GA0A 3K69A 4YIIA 3MFKA 3JUEA 3HX1A 3MMYB 4J8FA 1I27A 2ZO4A 2DODA 2QUFA 3RI4A 1IRGA 4G24A 1ETKA 2KIQA 4DPRA 1I1SA 3CC4I 5D6FA 3ZQQA 3PDNA 4DX1A 4QQIA 1W4MA 3HSEA 1ZGJA 4AYBN 3LAPA 3FWVA 3LFUA 1RW2A 4DI4A 2Y48A 2WBMA 3UIPC 2FNPA 3G6EI 4GTVA 4EBAA 4UI9K 1BC7C 5FKNA 5GPCA 1VQ6I 4GTQA 3ZXSA 4ANVA 4KA4A 1FYKA 2Q7FA 4GYIA 1LB2A 4JVSA 1HSTA 3KEZA 1RPWA 5JEKA 1LPQA 3K4JA 5DEQA 1SC7A 1QU3A 3RKYA 1HXIA 3OR2C 1TWFJ 3WTTC 4WNEA 5J08A 4KJZA 3ERED 4KFCA 2GBYA 1RI7A 3EIJA 1WPKA 1Z0ZA 3ULQB 3AKZA 5A2QK 4FLHA 4UUSA 3V7UA 4KU0D 3BZCA 3W6JB 2GIZA 4BGDA 2HOSA 3FHZA 4HX8A 4FE7A 3KP5A 4EJWA 2E1CA 5F64A 2VJJA 3CVYA 3LA3A 1YE9A 1O3QA 1ZRFA 4Y4RA 1JCQA 1OCPA 2CFXA 3APCA 2HZTA 3WG9A 2R17C 2VKEA 3ZMSA 2WXMA 4KIFA 1D8EA 5B5EC 4H4KC 5ICFA 3EJNA 4B94A 5LP0A 3TQNA 3D9KA 5H2FC 4MNUA 3I0TA 4PJMA 2LC1A 4BKXA 3IEGA 3ASNE 3U4TA 1E3HA 1KT1A 2WB2A 1YT5A 2I2BA 1MBFA 1J2XA 4JW1A 3FM5A 4WNDA 1XB4A 2IGNA 3D5SC 4ZDOA 3EDTB 4HX7A 1KPSB 5ILVA 2EB7A 2FE3A 4RLFA 5DV5A 2L0KA 4GMLA 3UXGA 4BJ6C 2VJ8A 2OV7A 2JGRA 2CS3A 3G4SI 4C2UA 3SFXA 4KZ0A 1AA7A 4PCQA 1FVFA 2H6HA 1T08B 4CGVA 1IAWA 4PSXA 2LRDA 2P8TA 4P55A 5LEKA 1IN6A 2CW8A 2LUHA 3QODA 3K4NA 1A5JA 3PM1A 5E3MA 3LWFA 2VGXB 3GMEA 5JHFA 2E1NA 5F1JA 2FXAA 5EEAA 3JRBA 3C2HA 2VOOA 3ZU7B 1FT9A 4RQIA 2UXNA 2Y9YA 3FISA 4LGWA 2A5EA 3L09A 5DUIA 2LAHA 4Z2YA 4ATZD 1INZA 2QM3A 1W0TA 3M8FA 2E35A 2X6OA 3LVRE 4FULA 2ECBA 2XDVA 3QU3A 1BI3A 5HLGA 4ESBA 1ZOQA 1YW7A 2JA6J 4CDGA 2KBXA 1UG0A 2RKHA 4ZFHA 3HYIA 1T33A 5F6FA 2BKKB 3KS2A 1GV2A 3IKOB 2RFAA 3CKBA 1G3TA 3VEPA 1SFEA 4DUIA 4HS2A 1EH6A 3CO7C 1MJ9A 1X81A 3CJNA 2I2OA 1FWZA 3FBNB 4GCOA 5H6RA 2DA2A 2R7DA 1X1PA 3FXUA 1OCRH 1NG6A 3K1MA 2B6CA 2HQ5A 4BY7J 2A07F 1R36A 2MBFA 1MMNA 2VGEA 2YINA 1JI8A 4J0UA 4RAFA 2JN6A 3LPZA 2NAZA 4CGZA 2R93J 4EQQA 3S17J 4M3BA 4HRLA 4KDPA 5CBNA 3A0HC 3FXMA 3QC1A 1ZLJA 3CLJA 2Z99A 2LAIA 5LCWJ 3KP4A 4J01A 1PUFA 3BQYA 3FK6A 3A03A 4GA1A 1TT5B 2E2EA 5DCFA 3AG1E 3Q49B 5KWDA 3GTGJ 4XR6A 3CCEI 3HTSB 3BQOA 3ESWB 4A3GJ 4KMUX 1G8XA 5LEJA 2QYUA 3ULQA 4KZCA 1ODDA 4ENNA 3FU5A 2RAEA 2RQQA 2BVMA 4XORA 4DX7D 3CCVI 3E4BA 2HWVA 4M74A 4AY6A 1NZNA 1YRNA 3I64A 2DO7A 4BDYA 1P6RA 4F53A 1KGSA 4C48B 1JPLA 2JSCA 2W25A 4A12A 2HYJA 3KP2A 2AXLA 5JHAA 3RYRA 4BT9A 2FOWA 1S7OA 3CP2A 5BXOA 1P5QA 4HLYA 2FQ4A 3FH5A 1N11A 4YVQC 1MMGA 1FSEA 2M34A 5A6CA 4U0WA 2FBHA 5M72A 1HKTA 2EH3A 4CRWA 1O5MA 4A55A 4IHWA 2HNHA 4UUTA 1GV5A 2VBZA 5D8LB 1O1SA 3RZOJ 2JA2A 3RJVA 1LF8A 4KIBA 1IRXA 3GFIA 4JONA 3PVLA 3UR3C 4TV3A 2PIEA 2DI3A 3TL4X 3ZMDA 1B9MA 3ASGA 4ATGA 4HAMA 4ZZDA 3ZPLA 2AVPA 3OYCA 5CPRB 3HOWJ 2DT5A 2QSHX 3AL0B 2IONA 3H3ZA 1ZHFA 2ADUA 3SEQA 2DMQA 3KZZA 1WQ2A 3EIQC 5G04J 3J7ZI 4ZC3A 2ZJQF 2WV0A 1SD6A 5CVRA 4HSTA 4XKCA 3OIOA 4U63A 2VQHA 1SFOJ 2F4MB 5G55A 3UIOC 3VLDA 3FDYA 3WG7H 2LKPA 5HKPA 1MSEC 3ECOA 5CLSA 4NC6A 3KZIC 4CYDA 3MZHA 1ZRDA 2WM9A 3KEAA 3PNYA 3DKXA 4I76A 3ZMVA 4FHTA 3ASHA 3DF8A 4BXUA 3D9LA 3C5RA 5FKKA 1HS6A 4BQQA 5HS9A 2GROB 2HPMA 5ARGA 1DEVA 5EG0A 3SFZA 2JPCA 1K4SA 1K6YA 3EUAA 2EZIA 1X4OA 1UG3A 2W00A 1VQPI 2CFOA 4CZZA 1Z67A 1HO8A 4DIQA 1K1AA 3R7RA 2QEXI 2V9VA 3PO8A 3OOUA 1A6IA 4HZFA 4GCVA 4II2A 3CVQA 2HOTA 2DJIA 2OVBA 4TXQA 3DSSA 1U7FA 2DMUA 3QK0A 4K5BA 3MKQB 4YFXF 1OISA 3G1MA 1MQSA 2OVFA 2XEHA 3AJIA 2OZ6A 1U8BA 1ITYA 1WV3A 4RAYA 3J7YJ 3HXLA 2JTVA 2XKPA 3C72A 1OYIA 4FJZA 5E1WA 3LDZA 1MR1A 3DFGA 4U0VA 1JCRA 2C6YA 2K02A 4ACLA 3JRCA 1WI9A 4AEZC 1UMQA 3NWTA 4TXRA 3RO3A 4E7KA 5IYDJ 1X2NA 1BA5A 2EIKE 3HC7A 4AVPA 1W7PD 2J09A 1N54A 2DTZA 2IJGX 3P9IA 4BBSJ 5EZGA 1NA0A 1PUFB 3CC2I 3ZYLA 1LGQA 1K3JA 1FIPA 5DD4A 4A0EA 4UVBA 2HXIA 2VL8A 2XXSA 1D0ZA 2DA6A 4EM0B 1A5EA 1YIJI 3IKVA 3IBEA 3SBTB 3WHBA 3UNNA 2A3SA 4X8QA 4HA8A 1JGSA 4PJJA 3I3LA 4EQFA 3I3NA 3NOCD 2E5ZA 4M6XA 1J59A 1QA6A 3P9KA 3MKYB 4IHTA 3FUIA 4BX9A 3TJPA 3CCRI 3IRRA 4CYCA 1Q1HA 4LJZF 5K7HA 1FEXA 1VQ5I 2M0MA 4HRMB 3RTRA 3GMJA 2CUEA 3G2UA 1MJBA 4BXFA 3HG0D 3BZKA 1U78A 3PNLB 4O60A 4XICA 4G6TB 5AYWD 1MYOA 2XRLA 4I17A 2HFHA 2CV1A 4EBAG 2L0TB 4G6DA 2AS5F 3QOEA 2DYSH 1RIOH 5KAFC 2UV1A 5C4XJ 2PQRA 3AU4A 2M5WA 3FXQA 4CCNA 1XC5A 3S2HJ 1ETOA 4PGGA 3HDDA 2F5FA 1TQMA 3D9IA 2XAFA 3C2GA 2LKXA 3BG1B 3CJQB 1FYLA 2R7RA 4BXXJ 3ASFA 4BFRA 4CDRA 4F6RD 1I5ZA 5EG0B 2VYIA 4L9PA 3KZYA 1SVOA 4FX0A 3E6BA 2AXVA 3FHEA 3CQZJ 4I0AA 4XMYA 2K9NA 3L6AA 1TWCJ 3Q73A 2H1KA 2IFUA 4IPAA 2HYZA 5J1YA 3OYDA 3RZDJ 1DPUA 3OYJA 3UNMA 1YYVA 3HGYA 3W2WA 3JRIA 3PE3A 4PSWA 1TEZA 1KZOA 3CHOA 1GXCA 1ON1A 4JOMA 1Z05A 1LJ9A 3OAWA 5J3LA 3JRFA 4U07A 3Q15A 1PAQA 5J8FA 2K9SA 1MH3A 2CH0A 4A0ZA 5HODA 3BCBA 4KMFA 3UUXA 4OOIA 1QNTA 1K78B 2O03A 4C30A 3EETA 2EIKH 4W97A 3O8GA 1R5HA 2HR2A 3EHNA 3F6QA 4BSZB 1DPRA 2KCKA 2DDBA 5EKQD 3PH0C 5C1DA 3G3ZA 5DHSA 3MKQA 3D0SA 1K2NA 2E34A 3OIPA 2LDUA 3RSNA 2LSVA 3DTEA 5ARFA 2HEOA 2Y3AA 4PFPA 4DQ2A 5DS9A 5E3NA 3Q9SA 1ERDA 2KZGA 1HG5A 3HKZA 5JMND 4OIPF 1J7KA 4LFUA 3VYSB 2VC1A 4G12A 2X9DA 2VSYA 3UM0A 2F8XK 2DOAA 2JWTA 3QOPA 2DYRH 1MJAA 2FOKA 5G05J 3JSOA 1NL4A 2KZTB 2W82A 2NXPA 3S1RJ 5EJGA 3KEOA 3S93A 2Y4UA 4UUCA 1KU7A 4P9FA 3OYEA 3HXEA 4RM2A 2ZBKA 1D5YA 3UT7A 4YG2F 1QBQA 3J81K 4IOAF 2RDPA 3LNQA 4A6EA 4AVZA 4ABZA 2CW0F 4P96A 2E7WA 1S29A 4L2YA 2LR8A 3FWEA 3HOUJ 3H9GA 3RKQA 2Y30A 4MEYF 3I4MJ 5FQ8A 5CECB 5JJTA 3UPVA 4WWCA 2X6YA 1S7EA 4JP0A 4RB1A 1H88C 1AOYA 2AN1A 5EYLA 1HU3A 1YJMA 3GTOJ 4Y7NJ 1SFXA 1OWMA 4R1HA 5GADJ 4IZZA 4YDEA 2XEEA 3SY2A 1O3SA 4GGGA 2A61A 3GX4X 3CVVA 1GHCA 4HOSA 3HOXJ 4LIUA 3DSVA 3FUJA 4WF2A 2DT7B 1SAXA 2AQEA 2ISZA 2HO1A 3C3RA 1J4KA 3HTUA 4F93B 4UQZA 2ICWG 1WZ2A 1OYWA 3DWLE 5EYRA 3AG3E 4RG6A 2PX9A 3J80Z 1Y0NA 4ZZLA 2WB1N 2EA4A 3V8LA 2F5CA 3K1NA 1J4QA 4N4NB 5H6QA 5LHGA 1J9IA 3F0CA 1TQIA 3PFYA 1O3RA 3UKRG 1HCRA 3GFLA 1PP8F 4J8DA 2ZXWE 5D2MC 2HKOA 3L2RA 1K79A 3HDXA 1J09A 3LOCA 1PUEE 3AG1H 4RGRA 1U2WA 3OSFA 1ZQ3P 4WUYA 3PE4A 4DGWB 2XGSA 4OMYA 3ABMH 2I1WA 3RIBA 3TWSA 5JEJA 5J4VA 4E7JA 3FUDA 2OD5A 3T5PA 2Y9ZA 2VT2A 3MN2A 2KQRA 2GOMA 5BPIA 2NOGA 3C3QA 3CK7A 2ZGGA 4B89A 3OYNA 3H9QA 1BJAA 1EJ9A 4F52A 4R8HA 3QYBA 2OV8A 4NC7A 2KATA 1OYYA 2WY7Q 3LSJA 1IQRA 2M3AA 2AJAA 3U2RA 1X1CA 3VYRB 1JT6A 3JTGA 3SD5A 4BY6A 5CQGA 2WWYA 3HOTA 2VJIA 2B9SA 3LSPA 4BU2A 2K4BA 2OEVA 4HNUA 3L9FA 3ZOBA 5BQTA 5B1BH 1W0UA 1FT1A 3NAWA 3I5UA 1ZBPA 2JUCA 3RKWA 1U5TB 1OWLA 3PZ3A 4JL0A 5EJHA 4G6QA 4HLXA 4QWQA 4AM9A 3G1OA 2FSWA 2EJRA 3RKXA 3QQAA 3EU9A 4OIOF 1UHMA 4OAYA 2KB3A 1FP1D 3K70D 1O1RA 2L4AA 2M9HA 1JKPC 4FLBA 1B4AA 3WGHA 3CJRB 2CV2A 5ENPD 1KHUA 1Y56A 2X6XA 3Q5MA 2OUMA 1B8IA 4EJTA 5ERIA 5FLXZ 5AQ7A 5EYPF 3EUVA 5J6XA 1J0RA 3K1PA 1R5GA 2KIFA 1JXSA 5ILSA 3CVPA 4EM1A 4GZCA 3I0MA 1G59A 2CSWA 4AIHA 4JIWD 3MZYA 3ZUVB 2FBKA 1ON2A 2CU7A 3HYMB 3CUQC 2P6TA 2NVQJ 4M3OA 1QQEA 4YIRX 1Q2ZA 1DMZA 4WNGA 2R4GA 5GAEJ 4OU0A 1O57A 2GOXB 1SVXA 1VNDA 3HBLA 1SAUA 5J4YA 3DLAA 4PDXA 2X6JA 1ZAOA 2GXAA 1BI2A 1VQ8I 4G94A 4HI8A 5KNGA 2OF7A 3FKIJ 4L5IA 3PL8A 2XKOA 3UINC 3JYSA 3NZSA 3DP7A 3NRVA 4CA0A 4M3GA 4MQ9F 4TUMA 3WTYC 1YRNB 3S3OA 1YLFA 2MFZA 4QIWN 2V5QC 3ZVVA 2EQRA 1Z77A 2L9SA 2NVTJ 4ANXA 2Q5FA 2IY0C 3BT9A 3I58A 4E4HA 3JRHA 2P9KG 2RD0A 3VODA 4GTTA 4U95D 5FQ6A 3H0DA 2VT3A 4CZCA 1E0EA 4Y17A 4ZYAA 5F0FA 3CVUA 3NEUA 4CCJA 4I99C 4D9VA 3ZRGA 4XLPF 1X3WB 4ASNA 4AM3A 2ESHA 5E20A 4BJTA 4G26A 2ME0A 2ZSIB 3O8HA 4EGYA 2IOSA 3KD7A 3H5AA 2JQIA 5L3BA 2FMYA 3FXJA 1AWCA 4B0ZA 2NS8A 4HI9A 3OY9A 1OCZE 1J75A 1IGNA 2X6FA 5EN5D 3HSFA 4HDVA 3L13A 1GVDA 5C3EJ 3W9FA 2GA1A 2XRYA 5T4YA 1RESA 3M1EA 2QBYB 2CUZA 3Q7AA 4C0MA 2OAZA 1WJAA 2TDXA 3CO6C 2F0YA 1G6GA 1Z0SA 5K7FA 3JXJA 2XAUA 3LSTA 4ZDPA 5HS0A 1ZLKA 2QSFX 3MCZA 1JUSA 4IOCF 4AIKA 1WGXA 2R7XA 3GZSA 1N95A 3PO2J 2V8SE 1LE8B 4G7ZF 3D9MA 4HVBA 4Y52J 2NVXJ 2GRPB 2LSOA 2R5SA 4LERA 2OBPA 4ENMA 4PGHA 4V2GA 2E0IA 3DXMG 1N25A 5DUKA 4GYWA 2XAHA 3HUGA 2L0IA 4DX6D 5L3GA 1SMTA 3HRTA 4IHXA 1KZHA 2VONA 4A3BJ 2H27A 4GPMA 2YSRA 3DEUA 2XQ0A 4GYOA 4WRRA 4A3DJ 1QZEA 4L9NA 3CCLI 2VBXA 1SEUA 3HXBA 2V6EA 2XPVA 3MA5A 4M71A 4YRVA 2RFMA 1ZR2A 4JC8A 3B73A 2LLKA 3NZUA 1EH7A 2GWRA 3KYCB 4R7LA 5BOXA 2F48A 2NOJB 1OT8A 4BEHA 3EUHA 2XGDA 3JR9A 4DYRA 1WAO1 2AQFA 5FQ7A 5D8KB 4Q4ZF 3PUFA 3LY9A 2MLKA 3ELKA 3CK9A 3KLNA 4CH7A 1HW1A 3FF5A 1VFCA 3SDGA 1YITI 4A3KJ 2XSDC 2G7HA 2NRAC 3EHQA 4N9IA 3QWPA 2MYOA 3RRMB 3CF2A 3ZP5A 3E33A 4HYEA 1MNDA 4AV7A 1IW7F 3DPLC 3AG2E 3Q47B 3WHCA 5K7ZA 4BACA 5JR3A 3AS5A 1U6GA 3F6OA 1HA8A 4C9BB 1A31A 3LSHA 2FMLA 5F08A 1N52A 4HFGA 2ELHA 1PVEA 4QSHA 3VYUB 2NNYA 2DMTA 3JCUC 2WXNA 3FH7A 3K2ZA 1ACIA 1QGPA 4A63B 3MKRA 1D8KA 4Q69A 2I8DA 1TZLA 3VFZA 5EF6A 3HOSA 1DCEA 4K0RA 4MTEA 2G7UA 3CTAA 1YCSB 4XZ4A 2P9PG 1SUWA 2L9RA 4GZ6A 1UZCA 1R71A 5FTPA 1HC8A 4EZJA 1BI0A 5GTIC 2JMWA 2QQ8A 5AQAA 3R9AB 4A3JJ 4R9PA 4Y6CA 4IXAA 1UJ8A 2M1BA 1VTNC 1WI3A 1HKSA 5KAIC 1KLXA 2R02A 3AG4H 1Y0UA 1EPUA 3ZMTA 4JEUA 3ULEG 2DTRA 2EIMH 1MZBA 2QKLB 1TNSA 4LITA 3QB2A 3T5VA 1X19A 1N94A 2QVLA 3S7FA 2E1MC 3OS0A 1W7PB 1DQUA 2D1HA 2VJ5A 2DK8A 3H1CA 4JHKA 3T8MA 2YX4A 3P7NA 5LRRA 4YFKF 5EDNA 1D1BA 1SFUA 3E30A 3OTNA 1OCOH 4KNYA 3GTPJ 1HH8A 3B13A 4BE1A 2VLAA 2IW5A 4L9JA 4YDYA 5JJ6A 1KHXA 1HQCA 1ORKA 5CQEA 1SFKA 3DRAA 1WKMA 4IN3B 1N4SA 3VLEA 1R7JA 2IA0A 3ZQIA 1D1AA 3WE2A 2GIVA 2O61A 1XSXA 4JQFA 1D8DA 1U2VG 2KZTA 3AAAC 1UHSA 2JABA 5IT9K 3Q75A 2UY1A 4HLEA 3R9MA 3ZR8X 4A1SA 4A3TA 3KSLA 4E6KG 1UFMA 1VQ4I 2V4LA 1F9NA 1MBHA 1YG2A 3FK7A 2WQ7A 1K83J 2PMHA 5DHUA 3IHVA 3CHPA 1F36A 2HYFA 4G8XA 4RGUA 2IGOA 2H8WA 5ENQD 1BR4A 3RSEG 1RKWA 2BUGA 4AOFA 1Z9CA 2HOAA 3H0GJ 3OSGA 1J4PA 1ZN2A 5B66C 3LMMA 2XUBA 3K2AA 1R22A 3VTXA 1I6HJ 2DW4A 1B1BA 1PC2A 2CHXA 2K9LA 2WXPA 4N2QA 1IJWC 4TV7A 5JFRA 1VQ9I 5DHQA 2K9MA 4U04A 5JA4D 3WU1B 4DZPA 4GU5A 4EJQA 3J7AY 1T98A 2DA1A 4ILIA 1S70B 2L9NA 3OUNA 2KFUA 1JWFA 1TN8A 1J5YA 3CCQI 3BEEA 3PUBA 4YFNF 5EILA 4FQGA 3UKGA 1FHQA 3O3KA 2M8GX 4E85A 1MD0A 2VASA 2P9UG 4KT6B 4N5CA 5BPPA 1QZZA 2E19A 4XI9A 1XMAA 1R49A 3I4NJ 3D9JA 1R00A 1B9NA 2LREA 4C2TA 3ZXPA 4YEJA 5FZQA 3DPYA 5JHBA 4P1WA 2F4OB 2DA4A 3G2BA 4K5CA 2NNNA 3TL5A 1BI7B 3V7YA 2GRLA 3HRAA 1WJFA 1FP2A 3WTWC 3E37A 3BZ6A 4B1RA 5E8IA 3AFOA 4M3DA 3D9PA 1Y8MA 3OS1A 3RDIA 3V7RA 4Q47A 1U3EM 3SF4A 3JSPA 5IT9Z 5B3SE 2IXSA 5GAGJ 1R1VA 1XN7A 3PSFA 1U0RA 3TGOA 1TYQG 2IS6A 1IHGA 1MBGA 2KP6A 1UW4B 1DCQA 3CHQA 4RS8A 2EFPA 2V4JC 3V4GA 1HF8A 1MX2A 2EFNA 3WU0A 2WXLA 5DHRA 5D0QD 1MHQA 1U0JA 3FU6A 5FGMA 2DFIA 5IPAA 2HVRA 3IHYA 5M3MJ 3WG7E 3IKTA 1VQKI 2BW3A 5M3FJ 1QPIA 4U8VD 2I6HA 3IV5A 3S7JA 3UT4A 4U7EB 4LMYA 3SYTA 3MKLA 1EF4A 3SI5A 1IN7A 2DLLA 2WADA 2FUG2 4A3VA 3HM5A 4F3QA 1ULYA 3RQ4A 3T8RA 3VPYA 3BR5A 5J8CA 1T0FA 4ILHB 1VDYA 1XGSA 3BJ6A 2F6CA 3NQOA 1WJEA 2I5UA 2K27A 3LSMA 1WH7A 3TBIA 4IF4A 1DC2A 2A5WA 2RGVA 4BY1J 2J8SD 4L5EA 2XT9B 3ABME 1TWGJ 2DJNA 4IRUA 4Q94A 4UB8C 5BMZA 2VBYA 2GRRB 5D4SA 2R5YB 2PNNA 2DU9A 4JXTA 2M7AA 2L5QA 3ZMZA 3JAMK 2QVOA 3RRNB 4G8KA 2KJBA 5BT1A 2YR2A 4I02A 2I2CA 2L2OA 1RUOA 2EWNA 2X6IA 3V2OA 1IV6A 3VOEA 5JVTA 5DCMA 1FSHA 2Q0OA 1WM5A 3TO9A 2ISYA 5T3RA 2FU4A 2MH2A 4HV5A 5K5OA 5EJCA 1KQ0A 2LTPA 4NQWA 1UN9A 4DJAA 4WWPA 4XSZF 1ETVA 4FETA 4I09A 4CYCB 4A3FJ 1ELRA 5FD5A 2F5VA 1WLNA 1LVAA 3I9V2 3W2VA 3ROUA 3VYTB 1Z6RA 4F92B 4U0YA 1KZPA 4TRQA 1A17A 1OR7C 1MJ0A 2PM7A 2VSNA 1FOYA 3TWRA 3MWMA 2JK3A 3RIRA 3W3CA 2E5NA 3BOQA 2K9QA 1OCOE 4GCNA 1YX5A 4J8SA 1D8JA 4B3AA 1JTXA 2JJ7A 5DHPA 3SHFA 3ZEFA 4PUCA 2CUJA 3WGIA 2GQQA 3DTKA 1U8RA 2ZFUA 2H6GA 5BUZA 4FHJA 4XKBA 2CSOA 1WSUA 2YU9J 3WE3A 2F5EA 4EJVA 1OMIA 5J1RA 2JA8J 2WMNA 2LY1A 2IGMA 3FMQA 1SVMA 4HF2A 4HBLA 3BY6A 1E8ZA 4UV9A 2BY3A 1MSFC 3ESKA 1K2MA 1K1BA 1F5TA 2CG4A 4QLCU 3SFYA 2IS4A 1S6LA 1TJFA 5KJKA 4BWRA 4I6ZA 1MGTA 3GBGA 3GW4A 2EZKA 3S16J 2VE9A 4EZKA 2EH0A 2XIGA 2P5VA 4RLQA 5AIQA 2ZIRA 4P29A 3MKZA 3EYYA 1FT2A 4IQ4A 4CT4A 1N4PA 4I6JA 3T8KA 2STWA 3Q0VA 4YVOA 3UMZA 2WXGA 2OCEA 2VKVA 1SMYF 3K9TA 2LY2A 1WCMJ 3ABLE 3HUEA 3EU5A 4IRGA 3F72A 2V7FA 3T5XA 3PZ2A 5LFAA 3L82A 3SQVA 2KKLA 3IAM2 5JJ7A 2W7NA 2LNIA 2MD5A 1LQ1A 1S8NA 4JA9A 4RLYA 4NACA 4ESJA 1P4XA 4J00A 2DPUA 4A93J 5JERA 2QENA 4QTRA 5BPDA 3URZA 4XLEA 2EZLA 3HRSA 1LFBA 1H2UA 2W1OA 3K0LA 2H6IA 2VUMJ 1IN5A 4D5CA 1OCTC 3HUGB 4IHSA 2VKDA 3VA1A 2LH9A 2KIUA 3FM3A 4BH9A 1CQTA 4I9CA 1O7FA 1Y1WJ 2CQ7A 4ILGA 3GLLA 4UQXA 3HJEA 1FBUA 3MDBA 3UV0A 5K5QA 2K4JA 3E34A 3U21A 3JCKC 3CESA 1J4LA 5DDGA 4XRMA 3A2KA 3KETA 5F04A 1ZH5A 2CO5A 5AJDA 4IX7A 3DXKG 1TL8A 3C3OA 2MHKA 3OYKA 3CK8A 3KFWX 1LNWA 3Q0UA 2ETHA 4FCYA 5ENSD 1MJSA 5B1AH 3CEQA 4OYSA 4BTBA 1MBEA 2L7MP 2V6CA 5HRYA 5BNWA 2X85A 4DZJA 1GT0C 4D9JA 1H0MA 2L6BA 2E7XA 2UWJG 3GEZA 4AP2A 1G88A 1MH4A 4IYPA 3SZPA 4LRZA 2JVHA 4I6EA 1G3NB 3REOA 2KPMA 5KCMA 2P2CP 4FHKA 5ENOD 1GUUA 2IVMA 4N39A 3BTCA 4NUBA 4IO9F 4WX9A 4KYWA 3EDPA 5CVUA 1TNYA 3BTIA 3TWQA 3V2XA 2EV6A 3G2VA 3CVWA 2ZU6B 3I0NA 5FKLA 1H2TC 3CMMA 2P0WA 2HOEA 5G2NA 1DVPA 3RPUA 4APOA 2XGEA 3KSQA 1H19A 1D5VA 4BHCA 4O1PA 4CCLA 4CCOA 1LTXA 3LA2A 2LNBA 3ISMC 2YNQA 4RA2A 4YIFA 3F23A 4ZHBA 3S2WA 1EH8A 4G23A 3BR2A 2Z33A 3CIAA 4CZ2D 4HNVA 1NK2P 2FO7A 2HVSA 2YUSA 3V8PA 2E2JJ 4F55A 3F21A 1NP7A 5J47A 1ETYA 3ZQCA 2PG4A 4UXNA 3I4RB 1R9TJ 5M5XJ 4O3MA 3L17A 3S7DA 2XPWA 2AFFA 1CF7B 2EIJE 2E71A 3GQSA 1OUVA 1MMDA 2GM4A 3LSIA 1HSJA 3DKWA 4XIDA 3K4MA 2Y2ZA 1FNNA 3G71I 3HOZJ 2WV1A 4G2VA 4RDUA 4QPOA 3QWWA 3PIPF 2XGCA 2ZC2A 2CQNA 3E1SA 4UVCA 2R0QC 2XS8A 4BE2A 1QPMA 3WTVC 3CSTA 3TWTA 1FY7A 1LDJA 2A5YB 3MZ8A 3SZGA 1AKHB 2RREA 1A6QA 3W2AA 1SZAA 3QJZA 3FUHA 3DWLG 4GTMA 1IN8A 2NYXA 3GFMA 4UV8A 3AL0C 1USTA 4XI0A 1UHWA 1ZTRA 2MSYA 2AO9A 3ML6A 4B44A 2IRFG 1MIJA 2I29A 2LXLA 3L7WA 3GZ5A 1BOAA 2JQLA 3OMYA 2O3FA 3PO3J 5E3OA 3DEOA 5HS8A 2Q2EA 2Y4TA 5DHTA 4KN7X 3D9HA 2GXBA 2KL4A 4F91B 3B7UX 4JD2G 2DMPA 4DY6A 3HEFA 3CMAI 1FIAA 2HM8A 3V8NA 5ANLA 4DYQA 1BM9A 4I1AA 2NYJA 4DRXE 5ED4A 2ESNA 4M9SA 1G6NA 3SQNA 2E60A 4AIDA 1WG0A 4RM3A 1QHGA 1W5CC 2O8XA 2OTLI 2OEWA 4HF0A 5AIPA 5AARA 3LQRA 2CQKA 3FMRA 4BHBA 3AG3H 2KB4A 2E1OA 2JEKA 1Z7UA 4HSRA 3FFLA 3MKWB 3FU0A 3W6VA 3HXCA 4CUGA 2Z9OA 2LYCA 3TW7A 5C4VA 5TJJA 2JRTA 2X6HA 2X48A 2ZXIA 1TN7A 2O5RA 1AWCB 5JEOA 3E5UA 4IQJA 3LVQE 3NF1A 1U5TA 3T0YA 2HKXA 1T0FC 3TMOA 3H3UA 1KQ8A 1K4TA 5HNHA 3CZ6A 2RQPA 1SA5A 1SD5A 3L22A 3IWZA 2FBIA 4PUSA 4Y15A 3S2AA 3WXXA 1FZPB 2HE0A 4HXIA 4XN0A 4OAZA 5L3DA 2L02A 2H6CA 3HHHA 4CCKA 3FTWA 4DX5D 4JB8P 5DJOA 2A6TA 2QSGX