2FEZA

Mycobacterium tuberculosis embr
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
373
structure length
373
Chain Sequence
RLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable regulatory protein embR
total genus 129
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2005-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fezA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fezA02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2fezA03
1JHFA 1T38A 1BOAA 4M74A 1O3RA 3JSPA 3F23A 1O7FA 2ISYA 1KU9A 4ON0A 4ZYGA 2XGXA 2K27A 3GZ5A 5EEGA 3TOBA 2YU3A 1BIBA 2RQPA 5IT9K 1O3QA 3QRFF 4BTBA 4QCJA 5ED4A 5TRDA 2C0LA 2FU4A 3SF4A 4EVIA 3GW2A 1XSDA 1IN7A 2FEZA 2GW1A 3HRSA 2MLKA 3C7JA 4U7BA 2P5VA 2M5WA 2YX7A 1F9NA 4AVPA 5LHHA 2CG4A 4ENJA 4G9YA 1J4PA 1HKQA 2M8EA 2ISZA 4YIIA 3Q5FA 4M72A 2HWVA 4LJZF 2FA5A 1BC8C 3B73A 3ZMDA 4U7DA 3V7CA 3C1DA 3H3UA 2EFWA 4G7HF 3IHUA 4RAYA 3GLXA 1TQPA 3M1EA 5CYVA 4G7OF 1ZYRF 3M8FA 1OYIA 2LC1A 3QDNA 5DDGA 3ASFA 3VB2A 1L3LA 4L5JA 3ROUA 1AOYA 4N3BA 1J75A 3GVAA 4YVOA 4CXFA 2PLYA 2UWJG 4GYYA 4HX4A 3MAJA 3AS8A 2F2EA 1LQ1A 5HQ8A 3FXRA 4UV9A 2K7LA 1XSXA 4G6DA 4KNYA 5E50A 2XVCA 2FSWA 3RU0A 3TO9A 3TG4A 3UNMA 3WTWC 4KUMA 4YVQC 4ETSA 3MEKA 3BJAA 1KYWA 3H3ZA 5FZRA 3MKRA 2E2EA 4NB5A 3RPUA 3K9IA 3KP6A 2KJBA 2NNNA 3WGGA 5DD4A 3WGHA 3LYAA 2H09A 1IXSB 4W9RA 1K2MA 1T39A 3CUQA 3KP7A 1Z7UA 3CTAA 1LEBA 2P6SA 5BPDA 3QU3A 3EDTB 2ZMEA 1B89A 1FP2A 5HLIA 1O57A 3RKYA 3KZZA 4PDKA 2PQNA 2RNJA 3LQQA 2WC2A 1DPUA 4GA0A 2WV0A 4LK0F 5BMZA 1GXPA 3F21A 4KXKB 1MJAA 3GZ1A 3HRTA 5E17F 2JTVA 4OIPF 2XHKA 2O61A 1VTNC 1YTYA 3OUNA 3LWFA 2V1XA 4I02A 4QWQA 3MQ0A 4LG0B 2A68F 3I5UA 4L5IA 2PJPA 3FZVA 3VFZA 4ZZLA 3BPXA 3ELKA 3I58A 4I01A 2EFOA 2HOEA 4F3VA 4UV8A 1R00A 5LGUA 2FOKA 2W57A 3V8LA 5D0OD 3I53A 3K1MA 4U0WA 2RGVA 3CK7A 2PMUA 3Q9VA 3WTSC 1CGPA 1O7LA 2O6GE 1J2XA 4RB0A 1BM9A 2CFXA 1KU2A 2RKHA 4J8FA 1GXCA 5FZSA 3ZHEA 2DBBA 3KE2A 1G6NA 1T0FA 1J4LA 5HDKA 3VTXA 2IJLA 5F6FA 5CHEE 2FBHA 2EA2A 1FWZA 1CF7A 2DTRA 1MZKA 2O8XA 4I17A 1WI9A 3ULQB 4HF2A 2H6CA 1IHGA 1IN6A 2HYGD 4A1SA 1KYZA 2YQ8A 5LEKA 1WWXA 2JQIA 1GXQA 3U1DA 1ZH5A 2IW5A 4O6FA 1BI1A 4PCQA 2EV0A 3BPVA 3V7SA 1J9IA 2P8TA 5DUIA 3FWEA 1I6XA 1BBYA 3MV2B 3P9CA 3QU6A 4RG9A 4HZFA 4U0VA 4Y13A 4XBFA 2ZCWA 4EM0B 2JPCA 1ZAOA 4I2ZA 4B94A 2XROA 4GCOA 4GYOA 4N39A 3GW4A 4UHTA 2LKPA 4HYEA 2DO7A 4FX4A 1EV7A 4EGXA 1OPCA 2O0YA 2VN2A 1EH7A 4ZZDA 2NC9A 4M6YA 1KT0A 2J5PA 4KICA 3CVPA 3MEXA 1U78A 3VODA 3DPLC 1HKTA 2KIMA 4GZ5A 1S7AA 3TAXA 5D8LB 3LPZA 5A7DB 1MKMA 1LEAA 4P9UA 4MNUA 2FBNA 3OXGA 4HX7A 4JONA 2M30A 3DFGA 5AIPA 1HXDA 1LNWA 2QQBA 2UY1B 2FRHA 2H6BA 4S05A 5CVRA 5DEQA 1KA8A 1P4WA 2XIGA 1R58A 4ZYDA 2QUFA 3L09A 1L0OC 3BJ6A 4LLNA 2RC4A 3HHHA 4XRFA 3PDNA 3EETA 2KCLA 2XAJA 5BNWA 4N2QA 3PQJA 1UJXA 1ELWA 1NHAA 3DXJF 2DK5A 4HF1A 4GYWA 2D1VA 1J0RA 4YFNF 3E6CC 2LSUA 1D8KA 1XD7A 1WSUA 4LLLA 2XT9B 1HQCA 5CCLA 3MDBA 2OD5A 4WX9A 4GYIA 2CQKA 5ARGA 3VTYA 4RB3C 3C3WA 2HS5A 2KATA 5D5UB 3E3VA 4IHTA 1KQ9A 2MHKA 3BROA 2JPEA 3KP3A 5LHIA 4OIQF 4ABNA 4H87A 4ZH4F 4U0SA 1IW7F 4OINF 5EEHA 2G7HA 3I0TA 4WUYA 3O48A 2EFNA 4N0BA 1HZ4A 3RTRA 1ZGAA 4GZ6A 1YW8A 5DJOA 3U3WA 2VOOA 3ASHA 3KFWX 2VQ2A 1ZLKA 4JA9A 1FYMA 4M9SA 1YW7A 1AWCA 2DPUA 4HORA 4GO1A 2UY1A 1WRJA 4ZYEA 1UFMA 2VGXA 4FT8A 1W7PA 4O6JA 3DPTA 4WNGA 2MA3A 2OAZA 2YPRA 2QBYA 3QWPA 4BAYA 1FCHA 3JW4A 3ESKA 2KCVA 3WTTC 1WAO1 3P9KA 1J4KA 5F64A 2JKDA 2A3SA 3TDZC 1OYYA 2E7WA 1RNLA 1SFEA 4U88A 5G04J 4IPAA 2RN7A 2KC7A 1HW5A 5E8IA 4YIFA 4JK1X 4BT8A 3JSOA 4EMSA 2EWNA 1B6AA 4L9NA 3AS4A 5FTPA 2FNPA 3ZMTA 3ZN0A 1A04A 3SHFA 4N2SA 3ZMZA 2GZWA 4HQEA 5E1WA 3ZPLA 2R7DA 2JLBA 4AM9A 3WODF 2KKOA 2BRFA 3FX3A 1I1GA 2VBWA 3GFLA 2IA0A 3E5QA 4I0AA 3I0MA 1E96B 1BIAA 4G8XA 1I5ZA 3BY6A 3DQVC 2FNAA 3Q5MA 3WTVC 1DDNA 4KBQA 2YSRA 1LJ9A 5JFRA 2O03A 2IPQX 1DP7P 5ICCA 1YQAA 1J5YA 2PI0A 3E6DA 3PFIA 2ESHA 2EV5A 3CKCA 1IXRC 1Z9CA 3UMZA 3W6JB 3RO2A 1J4OA 2LSOA 1G3YA 1TNTA 1TBXA 3ELSA 2R5SA 3MWMA 3CO6C 1EH6A 4U0YA 1F1ZA 1J7KA 2M87A 2ZKZA 3KP4A 1ZRFA 4CO8A 2XV4S 1YJ5C 3HSRA 2EA4A 3I64A 5D5XB 2ZNYA 1W5TA 2TDXA 4ENMA 5C1DA 3E6MA 2HQNA 4XI9A 5JR3A 2NAZA 5BS6A 1IUYA 3ZMUA 2LSVA 1QO0D 2XGMA 2X4HA 1YW9A 2LNBA 4MQ9F 1MD0A 2ETHA 3U2RA 4AIKA 3VA4A 1WLNA 1DMZA 5DCFA 3N71A 2GXBA 4KT5C 1LDJA 4HX8A 3W6KB 2FMLA 2KJCA 4NRHB 2C0MA 1LGQA 3QAHA 5HDGA 1ZRCA 1TTYA 4HDUA 3FM3A 3WG9A 1IRFA 2PFBA 3TKYA 2PQRA 5EX0A 3HSFA 3TO7A 4CDRA 2VGXB 3J7AO 4Z2YA 1EH8A 3HYIA 2LDUA 1ZG5A 4U0UA 3UOTA 4HAMA 5J8FA 4LB5A 4CYDA 2R3SA 3LSTA 4N9HA 1R22A 3L7WA 4G25A 2HYZA 3KP2A 2GWRA 4RGSA 2FBIA 4L0ZB 2V79A 2JZYA 1U8RA 2V5FA 1SFXA 2GXGA 1QNTA 2FBKA 1SFUA 3UNNA 3HTUA 3REOA 1DPRA 4WNDA 1WKMA 3ECHA 4HOSA 4BXUA 2EFPA 3QP6A 2QQAA 1OYWA 4BTAA 4A0XA 4BH9A 4P55A 4IRGA 4L9JA 4LFUA 5DD8A 5A2QZ 1XGOA 3CUOA 4RB2C 4UQZA 3R9AB 6PAXA 1SD7A 1FX7A 5FLXK 1OKRA 3TG5A 3HX1A 2IF4A 3K0LA 3KT9A 3KCCA 3F8NA 2OU2A 4LLGF 3WU0A 2CO5A 3HHGA 1ZRDA 2Z5UA 4L9VA 4Y6WA 2VYIA 3QOUA 4P5OA 1HH8A 3QWWA 5LBQA 3SQNA 5G05J 4Q47A 1K6OA 3IL2A 3GO5A 4G7ZF 1SMYF 2IT0A 2P4WA 2A6HF 4L9TA 2UXXA 4B09A 4NQ0A 1BI0A 2DBAA 4KA4A 4RAZA 5JJTA 1PUEE 3DEUA 2A6EF 3AS5A 3GF2A 1R5HA 5J8CA 4HBLA 3BP8A 3GX4X 2GIVA 2LF7A 4N5CA 2GA2A 1K2NA 4LMYA 1V3FA 3LA3A 1D5VA 3RJVA 3F72A 3U4TA 4I2WA 4IVNA 3L2CA 3ZPJA 1SMTA 3FXUA 2EH0A 4J0UA 2AFFA 1UB9A 5DIZA 1XMKA 3F8MA 4S04A 4XI0A 5L3CA 1YFHA 4ZYHA 1T2KA 2OQRA 3R6SA 4I0BA 2D2WA 5ILUA 4R79A 5KJMA 3UN0A 4ESFA 5ICEA 2PL2A 2F5FA 1W5SA 1YO5C 1R1VA 4I9EA 1PC2A 2BEOA 3I4PA 2AVPA 3ML6A 2Y75A 1KU7A 3H92A 4CGZA 1FYKA 3LKUA 4JBAA 3T1BA 2Z99A 4MTEA 1P6RA 1Z91A 5D4RA 4I7HA 2L3DA 1E17A 4KMFA 2DQLA 4XSZF 2P5LC 5FD6A 2FE3A 2CW0F 2BV6A 4A5MA 4BT9A 4QLCU 4NQWA 4ME2A 5G04C 2HO1A 3WTZA 4GA1A 1FSEA 4KIFA 4BHPA 3F6VA 1ULYA 2ACJA 1TLHB 1MJBA 1UHTA 1TW2A 2Q0OA 4HOTA 2JQJA 3U9GA 1G3TA 2CSOA 4J8DA 4WCGA 2VBYA 2BGCA 1PP8F 4DNCA 4ENNA 2E7XA 4KYOB 2L01A 3RDIA 1FP1D 2DW4A 1OMIA 2VC0A 4KN7X 3MCZA 1T6SA 1MDMA 1USSA 1CF7B 2NYXA 5M72A 3PO8A 1KU3A 3TGOA 1C0WA 5J6XA 5JJ7A 4EJOA 2G9WA 1RUNA 4UUVA 1HKSA 3PE4A 2XGOA 2MC3A 4BNCA 2XGSA 2AS5F 2EV6A 2ZJ2A 3SXYA 2C6YA 1JHHA 5LEJA 4L18B 2XPIA 1UCRA 1B9NA 4WXDA 2BUGA 4A2UA 1S8NA 2JSCA 1W7PD 2OQGA 5CVJA 2HFHA 5HDNA 3FFLA 5KK1A 1GHCA 2XKPA 2F5EA 3FF5A 4CGWA 1ON1A 4MQVA 4UNOA 2M1BA 2HTJA 1I27A 3TO6A 5FZQA 5BOXA 2G7UA 4L0YB 3FMRA 2QFCA 3IRQA 1YG2A 2WQHA 1R1UA 2W3OA 5CLSA 3OXLA 5JI6A 4UI9C 5TJJA 2STTA 4G2SA 3KD7A 4EJUA 3QP5A 2G1LA 3I71A 4XLPF 2DLLA 1ONVA 1FLIA 3KS2A 4MHGA 5DBKA 2L54A 3UV0A 4UQXA 2RVCA 3O3KA 2J5OA 1OUVA 3K1NA 2Y0MA 2UWMA 1MGTA 3WTXC 5FJYA 3ZMSA 3LY7A 1BC7C 3S7JA 3L00A 2XUBA 5D4SA 3LAJA 1B1BA 2GAUA 5JHUA 4R8HA 2V1DA 5DV5A 1ZREA 3L9FA 4JHRA 1K78B 3CJNA 3CUQB 4CZZA 2XAGA 2Y48A 1B59A 3WTUC 1FBUA 1W7PB 2EK5A 3V8JA 4O3MA 1QZ2A 5DUKA 2ELHA 4HOUA 1FBQA 4EJVA 4U0ZA 2ZO4A 1Z6TA 2ZNZA 3DF8A 2EJRA 5L3BA 3OXFA 1MDMB 3QKYA 4G26A 4YG2F 5HVQC 2HR3A 1Y0UA 5F1RA 1TQIA 4EQQA 1K3JA 2XCCA 1XDUA 5ERIA 3VA1A 5CVUA 4UI9J 3RYPA 1LDDA 2COMA 2ADUA 1R7JA 2QVOA 5K5QA 3COAC 1YS6A 2DU9A 5E1ZB 1W4MA 5HLHA 5LRRA 2DQRA 1ZGJA 3M9AA 3GZ6A 1O3TA 2VT2A 1D8JA 1WM5A 1P2FA 1G4DA 1F4KA 1Y8MA 5KJLA 5ILVA 2H94A 2YR2A 4KDPA 5FFXA 4KIGA 2ZBKA 2AXLA 2LNIA 4KN4X 2CGPA 2GA1A 3ECOA 3N4MA 4A6DA 3J81K 2CWEA 1U5TC 3QPTA 3CKBA 1R23A 3UPVA 1TJCA 4GYGA 3LY9A 3VEPA 3M7GA 3ZN1A 2A0TA 1NZNA 3F22A 3K69A 4HOQA 2J9QA 3WTYC 4A12A 4AIHA 4A0EA 2VT3A 5EKQD 4OMZA 5CJ9A 2IA2A 1YIOA 3TDUC 1R5GA 1IAWA 1DUXC 3RI4A 2STWA 4U04A 1WV3A 5IT3A 2YX4A 5IT9Z 4HDVA 4ENKA 2V6CA 3Q49B 3WE2A 4TV7A 2ZXJA 5DYMA 2IRFG 4H7YA 4PGHA 5D5WB 5H6QA 3F8FA 1P4XA 4IRIA 4YNDA 3P9IA 5KVRA 2K4BA 1S29A 3ZQ7A 3DV8A 5D6FA 1STZA 1G3SA 2XASA 3HTSB 3Q47B 5L3GA 3S7DA 3I6UA 1ZLJA 4LEUA 4OIRF 1K79A 1IN8A 2IP2A 4MTDA 3CK8A 1RUOA 4J8EA 3PQKA 5A6CA 2JQLA 3WU1B 3ERED 1NA3A 2NS0A 3PE3A 1HXIA 1FPQA 5HI7A 3Q9SA 3IKVA 4D0PA 1G3WA 4K2EA 2PQ8A 3TOAA 5CVVA 4RGUA 1F5TA 1KQ8A 1J59A 4RG6A 1BI3A 2P7CB 2R7FA 2QENA 2UZKA 2WTEA 3LA2A 3OV8A 1ZG1A 4CHUA 1XDSA 2DFIA 2L6JA 4JA7A 1G3GA 4GCVA 1FC3A 2HR2A 3V8KA 5AYWD 3E5UA 1ZHFA 3F8CA 2BBYA 2DK8A 3OOPA 3T8TA 2PIEA 2KB3A 3UQ3A 4UVCA 1TW3A 1BJAA 3GYZA 3LQRA 4AIFA 2HZTA 2D45A 3HOSA 1K3NA 2DT5A 2OBPA 2W24A 5ICGA 5L3FA 5L3DA 5JVTA 2VGYA 1SD4A 4AY5A 3ZHEB 4YFXF 4APOA 5G05C 3HYMB 3D5LA 4F7ZA 5BW8C 3BEEA 4I98B 4G24A 3R0JA 2JT1A 1R36A 3WXXA 1FHQA 2ESNA 2O3FA 4Y6CA 1E2XA 3RIRA 1ZN2A 4CICA 4IF4A 2CYYA 4FX0A 2DI3A 2IVMA 2XRNA 4I1AA 4GXOA 2K4JA 1FNNA 2EB7A 4WXCA 3V7RA 5AIQA 2FO7A 2KKLA 3FM5A 4UXNA 5LLQA 1R1TA 4I09A 1TQMA 2PG4A 2HGCA 3F3XA 3CVQA 4UVAA 1XGNA 4GZ3A 4ESBA 1BN5A 1KGSA 2XAHA 1QU5A 4A0YA 5FD5A 2KFUA 1G6GA 5FGMA 4AIJA 1X3UA 3HRUA 2HKOA 2PZIA 5BT1A 4FHTA 2IFUA 1H9TA 4Q5SF 3ABUA 1YS7A 1Z6RA 1Q1HA 2MD5A 3JTGA 4WF2A 3G3ZA 1JXSA 5DCMB 3ZP5A 4EM2A 1YYVA 4EJWA 2RDPA 3IWFA 3I59A 1D3YA 2FQ3A 5HS7A 4G23A 2FF4A 1U6GA 2MH9A 2Q7FA 1K78A 4IXAA 4Q4ZF 4LB6B 2D1HA 2Y4UA 3GFJA 4RGRA 1B9MA 3GUDA 1JE8A 2HDCA 2W25A 3RPQA 1PP7U 1QQIA 2L4MA 3CEQA 4I2OA 1P5QA 3EQLF 3LCAA 2JPBA 1RI7A 2C2LA 5ARFA 4WWCA 2Z33A 3RKWA 4EJTA 5K1YA 3DKWA 3HRMA 1ON2A 5D8KB 1PDNC 2FI7A 1S3JA 4B8XA 5LHGA 1Z05A 3O6BB 4BHCA 4KIBA 3I6WA 3NRVA 1QBJA 2XKOA 2LF8A 1YJMA 1P92A 5ILSA 3ASGA 5E18F 2XAFA 4M9XA 2QZ8A 3JTHA 1MJ9A 2KIUA 4ESJA 5BPIA 4D9VA 4RS8A 3K9TA 5HS9A 1TNSA 3MZYA 2X0LA 3LAPA 2Q8KA 3VPYA 1Z1DA 4MGRA 3FP3A 3JYSA 3HIFA 3CVLA 1ELRA 1U2WA 1O3SA 2QYOA 1KQ0A 1ZG3A 3KLNA 4CDGA 2QBYB 4P96A 5E8GA 3CK9A 3ZGQA 5EX3A 3FWVA 2P58C 5LRSA 3VOEA 3GWZA 2BE5F 2DPDA 3GFIA 1XN7A 3EUHA 2VOPA 2ZMEB 3Q4AB 2VSYA 3ABTA 2VONA 5FT9A 2K86A 4HOBA 3NF1A 3CLOA 3P7NA 3V4GA 4U07A 4AD9A 3O2PE 2FXAA 1IN4A 4EM1A 3ELVA 5CVIA 4UI9K 3HUGA 1FZPB 3G73A 5FO5A 3I59B 3GFMA 1RZ4A 3EYIA 1J4QA 1QZYA 3ZN3A 5HOOA 4N9IA 4HV6A 1RIOH 3IC7A 4PGGA 2DAOA 4BYYA 2QQ9A 2XEVA 3R60A 3R4KA 3C18A 1SAXA 2OZ6A 5KJKA 3E97A 4AWXB 1U3EM 3K1PA 4M73A 3F6OA 4LK1F 3KP5A 4XLNF 3S7BA 2QWWA 1I1SA 2VSNA 2W84A 5H6RA 2YHCA 1R21A 4EJQA 3RKVA 3BDDA 3RO3A 1K7AA 5KJNA 3S7FA 3M8EA 4LGWA 3SZTA 4KYWA 4GGGA 2NNYA 2CSWA 2KB4A 2P6TA 4HA8A 5FFZA 1XB4A 4MEYF 4HLXA 3IRRA 4HLYA 5FLXZ 3T5XA 3J80K 2A69F 1LB2A 4NHJA 4Y17A 1W3BA 2M45A 3CUQC 3IEGA 4EGZA 1S6LA 5ICFA 2PN6A 4JL0A 4O5VA 3I0NA 1HSTA 2UXNA 1KLXA 1A17A 3JAMZ 2KCKA 5D5VB 4IHSA 1QQEA 2P5KA 2E1NA 2OA4A 2HTSA 3URZA 4GCNA 1ZU2A 3KAEA 3GQSA 2VC1A 3KLOA 2F5DA 2V9VA 2MH2A 1H0MA 2P7VB 3E5XA 2A07F 1XGMA 4LD5A 4HQMA 1FY7A 2K02A 3BOQA 5LGTA 4OIOF 3TQNA 2VODA 1LDKB 5BQTA 3ZFWA 4P9FA 1XNFA 3ASDA 1UHMA 2XCBA 3HSEA 1T98A 3HUFA 2WPVA 3K2ZA 1XCVA 3GYHX 4EGYA 1FT9A 4XIFA 4GPKA 3Q15A 3N97A 3B02A 4N3AA 3UUXA 4OMYA 1MZBA 3RJPA 3IKTA 1GVJA 3HOTA 1OR7A 2KRFA 3RIBA 1SD5A 3LA7A 4EV0A 1FOKA 3MA5A 2F5CA 2V1UA 4R1HA 1QGPA 1REPC 3D0SA 5K5OA 2IA1A 4GA2A 3SZPA 1U5TB 4I9CA 4WNEA 4KFCA 1NA0A 4H7XA 1QZZA 3WGIA 4XSXF 2QM3A 4M6XA 3KETA 2GQQA 4WXHA 2H27A 3NQOA 4A5NA 2Z9OA 2PEXA 3TGNA 2L4AA 3LY8A 1FSHA 3BZ6A 1HSJA 3FMSA 3RKXA 3LFKA 5AONA 4JQFA 1JGSA 4DQ2A 4EQFA 3ULQA 4HW0A 2FMYA 4BHBA 4A0ZA 4HV5A 5D0QD 4BWRA 1LGPA 3CVNA 1BI2A 2XAQA 5D6EA 3R0AA 5HLGA 5H20A 3GZ2A 4G1TA 2VE8A 2JRTA 1H9GA 3DP7A 3E4BA 2W85A 1B4AA 1WQ2A 2Q2EA 3WE3A 4RGXA 2ZFWA 5E1XA 5LCWC 2OOEA 4G94A 3CO7C 2Y4TA 3QWVA 4CGVA 3FHZA 5HS8A 5A8IA 2QLZA 2Z3YA 1QPMA 2EFQA 5LGNA 5E20A 4UQYA 3RYRA 4RB1A 2OZUA 4A6EA 4WNFA 1V4RA 3BWGA 3J81Z 1YA0A 3EYYA 4ASNA 2MBFA 1IRGA 3T8RA 3BJOA 1HBXG 3QOPA 2A5YB 3FMQA 1UHWA 4IJAA 1ODDA 1S7OA 3IWZA 4M71A 5A2QK 3NEUA 4Y15A 2L02A 3MFKA 2I6HA 2ONDA 4OOIA 3S2WA 2KIFA 3POAA 5LCWJ 5FB2A 2NRAC 4N3CA 1XSVA 2A61A 1LVAA 3CV0A 3KEQA 4KMUX 3ZMVA 3JAMK 1IXCA 1IZ1A 2VE9A 1YLFA 2PBIA 5L3EA 4G2VA 4LG0A 1XCBA 1XGSA 1IF1A 1XMAA 1FYLA 1P4AA 4IN3B 3FM8A 2E1CA 2B0LA 3GEZA 3FXQA 4Q48A 5K5RA 3KEOA 4BQAA 3CDHA 3J80Z 1USTA 4OU0A 2PMHA 4E70A 1SD6A 1FHRA 3EDPA 3E6BA 5CCMA 1IN5A 4G6QA 3AAFA 3KZYA 1FBSA 2RV8A 4PZJA 3R61A 4HF0A 3QPHA 2VBXA 2BYVE 3F8BA 3HUEA 4YFKF 1IYGA 1U5TA 2VBZA 4UVBA 2VXZA 1HW2A 3GXOA 1KT1A 2HQRA 2HKXA 3I54A 3MZHA 1ZBPA 2WWYA 1K3QA 2MLGA 4H0EA 5DCMA 4M9ZA 3MV3B 4IRHA 3SFZA 4WK8F 1HW1A 3ISPA 2HEOA 2HYFA 3T0YA 1ZARA 3SZ7A 4AY6A 5JJ6A 4MEXF
chains in the Genus database with same CATH superfamily
1JHFA 1B72A 1GV2A 1T38A 2B0OE 1K61A 4F6RD 1BOAA 3E0JB 4M74A 4B1RA 4E7LA 3HOUJ 2YU9J 2KP6A 5CEAA 5HODA 1O3RA 3NAUA 3JSPA 4NNJA 3F23A 1O7FA 4BY7J 2ISYA 1IHBA 1O1SA 3C72A 1QVTA 1VQLI 1KU9A 4ON0A 4ZYGA 5BVIA 2XGXA 5IOZA 2K27A 3SJMA 1E7UA 2Y0BG 3GZ5A 2VKHA 5ENRD 2I2BA 2ICWG 1GLNA 5EEGA 3TOBA 2YU3A 4IZZA 1BIBA 3BR0A 4F52A 2RQPA 5IT9K 1K4TA 1BW5A 5E76A 1O3QA 3QRFF 3BZCA 3DLLF 2D5VA 2WBMA 3LOCA 3UKGA 1YCSB 4BTBA 4XONA 3AL0C 4QCJA 3RAUA 5ED4A 5TRDA 2K9SA 2C0LA 2FU4A 3G2BA 3SF4A 4EVIA 5HLTA 2LO6A 3GW2A 3WHBA 3EUHC 1VDYA 3OOUA 5TGTA 3S14J 4ANJA 1OWMA 1XSDA 1HX8A 1IN7A 4YDOA 2FEZA 3OYKA 2RNGA 2GW1A 3HRSA 2MLKA 3C7JA 4Q94A 2K3FA 3AFHA 4U7BA 3HXCA 3AL0B 2OCEA 3SQVA 3W9GA 5FQ6A 2P5VA 3CJRB 2M5WA 1BD8A 4HLEA 1P9QC 1Q1VA 3LSKA 2YX7A 1F9NA 3OWTA 4W97A 1WFXA 4AVPA 5LHHA 2CG4A 4ENJA 2R92J 5C2YA 1X1AA 2EZHA 4PJJA 4G9YA 2JVHA 1Z5SC 2HU9A 3FK7A 3UINC 1J4PA 1HKQA 3ZU7B 2M8EA 2X6OA 2ISZA 4YIIA 2R7QA 3Q5FA 1JUMA 2R7VA 1BR4A 4DIQA 4M72A 3RSEG 2HWVA 5F0FA 1UG0A 4LJZF 4GU5A 2FA5A 3Q0VA 4B3XA 1BC8C 2IBDA 1DU0A 3B73A 3ZMDA 4U7DA 4DI4A 3V7CA 3C1DA 3H3UA 2EFWA 4G7HF 3PZDA 1MX2A 4GMRA 4C0EA 5JHBA 3IHUA 4RAYA 3GLXA 1TQPA 2LBFA 3M1EA 5CYVA 4G7OF 1ZYRF 3M8FA 5IP9J 3GMJA 1OYIA 1UELB 2LC1A 3OYNA 5DTDA 3H9JA 3QDNA 3UIOC 3QODA 3CIAA 1X3ZB 2XB0X 4BS9A 5DDGA 3ASFA 3K4BA 2VJ8A 3VB2A 3HPGA 1L3LA 4L5JA 3ROUA 2JVGA 1AOYA 4N3BA 1EF1C 2WY7Q 2X6HA 2CJJA 1U8BA 1J75A 3KEAA 1JCQA 1DGWY 3GVAA 3MN2A 4AYBN 4RLFA 3J7AY 4YVOA 4CXFA 2PLYA 1YHQI 2UWJG 3W3CA 3B7RL 4FASD 2H6IA 3D9OA 3FXKA 4GYYA 3JCUC 1ZTRA 4HX4A 3MAJA 4AJWA 3AS8A 3S1QJ 3ASNH 4J00A 2JUCA 3BQOA 1I6HJ 1O5MA 2F2EA 2ILRA 3LJNA 1LQ1A 3UMVA 5HQ8A 5CQGA 2L7FP 3FXRA 4UV9A 1TC3C 2I29A 3DSXA 2DJNA 4B44A 5EJHA 2K7LA 1XSXA 2DODA 4G6DA 4KNYA 4WWPA 2RREA 2ZU6B 5E50A 5J4YA 2XVCA 2XPVA 2FSWA 2YHEA 3RU0A 5J90A 2JWTA 3HXFA 3TO9A 4FU3A 3TG4A 2XPUA 3IV5A 4GMJA 1OT8A 3UNMA 1X2MA 2A05A 4XX5A 3NBNB 4FULA 3WTWC 4KUMA 4YVQC 4ETSA 3MEKA 3FTZA 3BJAA 1T8IA 5E3MA 1KYWA 3H3ZA 1SZAA 1HFAA 5FZRA 4ZHBA 2DOEA 3S3OA 3OL3A 5FLMJ 2EIKH 2E2EA 3MKRA 2EQXA 4I6JA 4NB5A 3RPUA 4ANWA 1X1CA 3K9IA 5IYBJ 3KP6A 2KJBA 2NNNA 3WGGA 4APFA 3DU5A 5T4YA 1SANA 5DD4A 3WGHA 3LYAA 2H09A 2IGMA 1IXSB 4W9RA 1N95A 1K2MA 1T39A 2NS7A 3QOEA 4BUPA 1TEZA 3CUQA 3CHRA 5E3OA 4OWRB 3KP7A 5IOYA 1Z7UA 2WXOA 5FJ8J 1I3QJ 1JKOC 2R93J 2XS8A 2ZXIA 3CTAA 2P6SA 3CCSI 5BPDA 1LEBA 1U3DA 3IBEA 3UXGA 3QU3A 3I55I 3VYUB 1OCOE 3BG7A 3EDTB 5AIJA 3PIPF 4LUNU 1YYHA 2ZMEA 1B89A 2BW3A 2ZMEC 1FP2A 2WXJA 3RRUA 3LNQA 5HLIA 1O57A 3RKYA 5GAEJ 3KZZA 2DMUA 4KZCA 4XEIG 4PDKA 1IV8A 2PQNA 2RNJA 4XQFA 4C9YA 3LQQA 2BKKB 2ELKA 2WC2A 3PEVB 1DPUA 3FTYA 4GA0A 2WV0A 4LK0F 5KAFC 2ETBA 3X2QH 2IS1A 5BMZA 1GXPA 3F21A 3KSQA 3Q75A 3FUHA 4KXKB 3TWTA 1MJAA 3GZ1A 3HRTA 5E17F 3WHCA 2JTVA 4D5CA 2IOSA 3PZ2A 4ZTFA 4OIPF 2XHKA 2AXTC 2O61A 1J2FA 3ABMH 1VTNC 1YTYA 3OUNA 1S70B 2AN1A 1BR2A 3LWFA 2V1XA 1MIJA 4I02A 4QWQA 2BEDA 3MQ0A 4LG0B 2A68F 2Y30A 4JHJA 4QQIA 3I5UA 4H4KC 3FUJA 4L5IA 4II2A 2PJPA 3FZVA 3VFZA 4ZZLA 2IEJA 3MGBA 2KM4A 4C3IJ 3AG3H 3LJ3A 4FJZA 3BPXA 2WAEA 3ELKA 3I58A 4I01A 4B43A 2EFOA 4CCJA 4FHKA 2WXFA 2HOEA 5IY5H 2DWZA 5C4VA 4F3VA 4UV8A 1R00A 5LGUA 1QA6A 3C3OA 1E8YA 2FOKA 2W57A 1ETVA 3V8LA 4BQNA 1MNDA 4CCNA 5D0OD 2AHQA 1HA8A 2RD0A 4JOMA 3I53A 3H5RA 3ASOH 3K1MA 1YJ9I 4U0WA 2EIMH 4M7CA 5ENPD 3ZQGA 2RGVA 2V4JC 1IQUA 1MZCA 3CK7A 5LP0A 2PMUA 2VB6A 3PNYA 3W6VA 3Q9VA 2MRIA 3QK0A 5ENQD 3WTSC 2L9RA 1CGPA 1O7LA 2IGNA 4X1EA 4O1PA 4IULA 3K4CA 2O6GE 4G8KA 1UN9A 3L82A 4GTMA 1S0PA 1J2XA 2Z1DA 4RA2A 3LXUX 4RB0A 3TWVA 1SVXA 3H5NA 3Q0WA 2ZIRA 1BM9A 2CFXA 3GTQJ 1KU2A 2RKHA 2R03A 4J8FA 4ANXA 3CLQA 1D8DA 3FBNB 1IKND 5EN5D 1GXCA 5FZSA 1IUFA 3ZHEA 2DBBA 3KE2A 1ETWA 1G6NA 1T0FA 4XRSG 1J4LA 5HDKA 3VTXA 2IY0C 2IJLA 5F6FA 5CHEE 5EDNA 2FBHA 2EA2A 3BG9A 2DYRE 1FWZA 4NACA 1VQNI 3CCJI 1CF7A 4YDWA 5B1AE 2DTRA 1MZKA 2QCOA 2O8XA 4I17A 1WI9A 3ULQB 4CDNA 3TW6A 1PUFB 4HF2A 1WY6A 4HI8A 2H6CA 2BY2A 3DBRB 1IHGA 5JEMA 1JTYA 3MX3A 1IN6A 5H7PA 4HAOA 2HYGD 4IQJA 3FXMA 2P9UG 4A1SA 1Z67A 2M4GA 4V2GA 4DX5D 1KYZA 2YQ8A 5LEKA 1JT0A 3ZYLA 1WWXA 4D9JA 1OISA 2JQIA 3CD6I 1GXQA 1MJSA 3PFNA 2PJRB 2CUEA 4LITA 2JN6A 4E7ZA 3J7ZI 4AUXA 2XSDC 3GTLJ 2WB2A 3FU6A 3BR3A 5CKTA 3U1DA 1ZH5A 1ETKA 2IW5A 4IOCF 1X1DA 4BDZA 2FUG2 1WZ2A 3ONLA 4O6FA 3TWUA 2Y2ZA 1BI1A 3NB2A 4X6AJ 1FIPA 3PNTA 3S3MA 4E7HA 4PCQA 2CQXA 1MH4A 4EATA 2EV0A 1PJRA 3BPVA 4L5EA 3VPRA 3V7SA 4AC0A 1J9IA 3L9TA 2P8TA 2X51A 5DUIA 1T95A 3FWEA 1I6XA 3CCUI 3JUEA 1BBYA 2CFOA 3P9CA 3QU6A 2QSHX 3MV2B 4GTPA 3QYEA 4RG9A 2GOMA 2WMNA 4HZFA 4U0VA 3DKYA 4XBFA 4Y13A 2ZCWA 1VFCA 4DBRA 1DD1A 1IXVA 4EM0B 2JPCA 1XGWA 3HEFA 3B6CA 1ZAOA 5EYPF 5B1BE 4I2ZA 3UM2A 3HC7A 2E1MB 1AKHA 1I50J 2VQLA 2XROA 4GCOA 4GYOA 4B94A 4EEFG 1QBQA 4N39A 2X6WA 4W1UA 2YNQA 3GW4A 2QGUA 1D1CA 1ORKA 1S5LC 3G1OA 1XMXA 4UHTA 2LKPA 3RCOA 2IJGX 1OXJA 4HYEA 2DO7A 2X9DA 4D7MA 1ZQ3P 1UZCA 4FX4A 1MSEC 5FIOA 1EV7A 5K7HA 4EGXA 1OPCA 2WAFA 2O0YA 3V42A 2VN2A 1RR8C 1EH7A 4ZZDA 1NL4A 2NC9A 2V1NA 4PJ0C 5FRMA 4M6YA 4XLHA 2RG8A 3DSVA 2R7ZJ 3OTNA 3A0BC 3L1PA 1YRNB 3KPHA 3DLAA 1PAQA 1KT0A 2J5PA 4KICA 4P29A 1U0RA 3DSWA 3HUEA 3QNKA 2DA2A 3CVPA 3MEXA 1JGGA 1U78A 4F1PA 1V5FA 3VODA 4BGDA 3D9HA 3DPLC 5ANRA 1HKTA 4LNGA 2KIMA 4GZ5A 1YITI 1S7AA 3HZJA 4DX2A 3P1UA 3DSHA 2LOOA 3TAXA 3QQAA 4J7WA 2GRPB 5D8LB 4CDMA 3LPZA 5A7DB 1V5GA 1WPKA 3S2HJ 1MKMA 2I1JA 1LEAA 2ZJQF 2XEEA 4LNUD 4P9UA 5LOZA 1X1PA 3AJIA 4PSXA 1TT5B 1JT6A 4JIVD 4MNUA 2V4HC 2LBFB 2FBNA 4TV3A 3HGGA 5BNGA 3OXGA 2OVBA 1VQ5I 5E3LA 5JLWA 4HX7A 3ZXSA 4JONA 4R9PA 2AXUA 1ENHA 2M30A 3DFGA 4DYCA 5AIPA 1ZOQA 3BQZA 4JX5A 1HXDA 1LNWA 3P2BA 4FLBA 3C3RA 2QQBA 4Y52J 2NXPA 3JRFA 2UY1B 1OCOH 1G3NB 2DMPA 2FRHA 1VQMI 2H6BA 4CRWA 4CCKA 5BV0A 4S05A 5CVRA 1JJ8C 1MMGA 5DEQA 3E34A 3DBHB 3SEQA 2XRZA 5KAIC 1FIAA 3PNVA 1KA8A 4HNTA 1P4WA 1TWHJ 3L2RA 4ZFHA 4E7JA 2XIGA 1BPOA 1R58A 4ZYDA 2E2IJ 3JRBA 3LSJA 5GPAA 4G11A 2QUFA 2QC9A 4X8QA 2WXLA 1MBGA 1L0OC 2BZTA 3L09A 3HB9A 3BJ6A 1UHSA 4BY1J 3PVLA 4LLNA 2RC4A 3HHHA 3KX2A 3CF2A 4XRFA 1QHGA 3EETA 1RRJA 1FVFA 2KCLA 3CLJA 3Q3SA 2WQ7A 2XAJA 4QTRA 4A93J 5BNWA 4N2QA 3PQJA 4PS8A 1UJXA 2M7BA 2B63J 1ELWA 1NHAA 1MYOA 1U7FA 1JCRA 1A6IA 3DXJF 2DK5A 4CA0A 2QYJA 5F1JA 4HF1A 4GYWA 2D1VA 1J0RA 4YFNF 4EBAG 2WADA 4CZ2D 3K7AJ 5CBOA 3E6CC 3K4NA 2LSUA 1D8KA 2VSOE 2MYOA 1XD7A 5GP9A 2R5ZA 1WSUA 3UX4A 5G55A 2I2FA 4LLLA 2NVUB 2XT9B 1HQCA 5CCLA 3MDBA 3LMMA 5DHQA 4G12A 2OD5A 2NVYJ 4IOAF 3HOVJ 4WX9A 2DDBA 2GIZA 4GYIA 2CQKA 4Y4RA 2X6YA 3OMYA 5ARGA 3VTYA 3S8PA 2K40A 4LG6A 3SYTA 3DSUA 4RB3C 3C3WA 2HS5A 2KATA 5D5UB 3E3VA 1TYQG 4IHTA 1KQ9A 2MHKA 4PFPA 1NFIE 3BROA 2LAHA 2JPEA 2ELJA 3KP3A 5J1UA 5LHIA 2PM6A 3F6QA 4OIQF 4AEZC 3D9IA 4ABNA 3H36A 1TWCJ 2KRHA 4H87A 4ZH4F 3K4JA 4U0SA 3HUGB 1D0ZA 1IW7F 2CW7A 2E36A 3AG2E 3FTWA 2HOTA 1IDZA 4OINF 3RQIA 1D5YA 3T8KA 2L7MP 2AQFA 3BG0B 4XKBA 2H8RA 2KXPC 5EEHA 2AO9A 3FDHA 2G7HA 3I0TA 4WUYA 5FKKA 3O48A 1FPPA 2EFNA 4N0BA 3BC8A 3RTRA 1ZGAA 1HZ4A 4GZ6A 2R17C 3ZYMA 1YW8A 2LY2A 4FADA 1LPQA 1R71A 2F5VA 2X6JA 5DJOA 5CQEA 4F53A 2VOOA 3U3WA 5EX0A 3ASHA 3PUFA 2WXIA 2NSZA 5FT9A 4ATGA 3KFWX 1K83J 2VQ2A 3UM3A 3V8MA 1ZLKA 4JA9A 1FYMA 2M9HA 1V5EA 4M9SA 5EJFA 1WHUA 1H88C 1YW7A 2KRCA 3EHRA 3H0DA 1EKEA 1AWCA 3MKQB 2AQEA 2DPUA 4HORA 1DNPA 4GO1A 2UY1A 1WRJA 3AG4E 3PO3J 3FUKA 5KBAA 4ZYEA 1UFMA 2V0PA 2VGXA 4FT8A 1W7PA 4O6JA 3V8QA 3DPTA 4WNGA 1MMNA 4J01A 2MA3A 2R59A 3FU3A 5ITZF 2EZKA 2OAZA 4E7KA 2YPRA 2QBYA 4L7TA 3K10A 3LFUA 3CCRI 3PSFA 2LH9A 3QWPA 3KZIC 2DJIA 4BAYA 5GAHJ 3OYCA 1FCHA 3C2HA 3JW4A 1ZKGA 3ESKA 3L08A 4TXQA 3LVQE 2KCVA 3WTTC 2LFBA 2M34A 3DBLB 3ZQHA 4Q96A 4L2LA 2LXLA 1WAO1 3P9KA 4AVZA 1IO2A 1F36A 1ITYA 1OWLA 5AN8A 5B1BH 4DI3A 1J4KA 5F64A 4C2UA 3BCAA 2JKDA 4I99C 2EINE 2A3SA 3LSIA 2LKSA 2IS2A 3TDZC 3BG5A 2WXKA 1OYYA 2E7WA 2NS8A 2TCTA 3KYDB 1RNLA 4FHJA 1OCCE 1SFEA 5ENTD 2LG4A 4U96D 4U88A 2HVQA 4RAGA 2VLAA 3CGHA 5G04J 2KBXA 3OYGA 3JRHA 4TUUA 2OJED 2ID3A 3G1LA 2W00A 3HXLA 2RN7A 4IPAA 4MFEA 4K5BA 4RQIA 2KC7A 1HW5A 2MW8A 5E8IA 4YIFA 1YRNA 1HDPA 1YMPA 4JK1X 4RM2A 4BT8A 2E34A 3JSOA 1UN8A 5DHTA 4EMSA 4KU0D 2EWNA 1B6AA 4L9NA 1KZPA 4DUIA 4QSHA 4F93B 2IO3C 2V9PA 3AS4A 3HIZA 4JEUA 5FTPA 3OYJA 1APLC 1ERDA 2FNPA 3LSPA 3ZMTA 1ETYA 4G6TB 3ZN0A 1PY1A 2OV8A 4A1GA 4XM3A 1A04A 3SFIA 3SHFA 4N2SA 2OVFA 3H35A 2GZWA 3ZMZA 2K5CA 4XN3A 5ENSD 4HQEA 5E1WA 2I2AA 1IV6A 3ZPLA 2R7DA 1OCRE 2JLBA 3CDLA 4AM9A 3WODF 2XSJC 2KKOA 3RRMB 3FX3A 1I1GA 2VBWA 4ITVA 2V8SE 3GFLA 2BRFA 2IA0A 3E5QA 2V5QC 4I0AA 2BVMA 3I0MA 1E96B 3JRDA 1K1BA 3B95A 1BIAA 3TJPA 3CVXA 2LLKA 3WG7H 3A1YA 4G8XA 1I5ZA 3BY6A 2P9IG 1RR7A 2OUMA 2FNAA 3DQVC 3Q5MA 3WTVC 1DDNA 4MFDA 4A3IJ 2KQRA 2DIWA 1S72I 2P9NG 4KBQA 1DC2A 2YSRA 3QPLA 1LJ9A 2PX9A 2O03A 5JFRA 2IPQX 1DP7P 3SDBA 3BU8A 2XPIA 5ICCA 4MLPA 5DHRA 1YQAA 1J5YA 3BG6A 2PI0A 3FKIJ 3PZ4A 2EQRA 2A5EA 5B3SE 3E6DA 4XORA 3FDYA 3DPUA 4A3MJ 2YINA 3SBSA 2WAQN 2ESHA 3PFIA 5JA4D 4MKTA 4DJAA 2EV5A 5AAOA 3CKCA 4DW6A 4WRRA 1IXRC 1Z9CA 3UMZA 3W6JB 3RO2A 3Q9NC 1J4OA 4E6HA 2LSOA 3BR5A 1G3YA 1TNTA 1BU9A 1TBXA 4N4NB 2F4MB 3ELSA 4AVXA 2R5SA 4C30A 3MWMA 1BI7B 1VF9A 3ZQFA 5FKOA 4XOPA 4YELA 3CO6C 1AU7A 1N4QA 4A3KJ 1EH6A 2XRLA 4U0YA 5EIBE 1Z0SA 1F1ZA 2A6TA 3FK6A 1J7KA 2M87A 2ZKZA 3KP4A 4CO8A 4BE1A 2XV4S 1ZRFA 2LXMA 1YJ5C 3TWXA 1FTZA 2WXNA 4ILIA 3J7YJ 1UOHA 3VLDA 2W7NA 3HSRA 4M3BA 2EA4A 2WXHA 3I64A 3TMOA 1X81A 2QKLB 3E30A 3T5VA 5D5XB 5E79C 2E0IA 2MC4A 1GV5A 1TJFA 1MR1A 3VYTB 2E5ZA 4YIRX 3S16J 5IPAA 2ZNYA 1FOXA 2CV1A 1W5TA 4BEPA 3L2WA 2TDXA 4XOTA 3SEZA 2R5YA 4C9BB 3FUEA 4ENMA 5C1DA 3H9GA 3ZR8X 1BLXB 1SW6A 3OYIA 3E6MA 2HQNA 4XI9A 5JR3A 2NAZA 5BS6A 1IUYA 4XMYA 5E75A 2WY8Q 3ZMUA 2QYUA 2LSVA 2O9LA 1QO0D 1TNBA 2XGMA 3FTSA 1A5EA 2Y31A 5EGOA 2NVTJ 2DCPA 2X4HA 2JRMA 2DMQA 1YW9A 2LNBA 4MQ9F 2X1EA 1MD0A 2ETHA 2HYJA 3U2RA 4AIKA 2KZVA 3VA4A 3MKWB 2O7OA 1WLNA 2P9SG 4PJMA 4ANVA 2J07A 1DMZA 2E35A 3OSFA 3AG2H 2QA4I 5DCFA 3N71A 2B9SA 3BTJA 2V4LA 2G0EA 2DOFA 2GXBA 2P9LG 3HPHA 5EJGA 1G59A 1MBEA 4KT5C 1LDJA 4HX8A 3W6KB 2FMLA 2KJCA 2QSGX 2Y69E 2BY3A 2C0MA 3DEOA 4NRHB 1LGQA 3QAHA 5HDGA 3G2UA 4J8SA 1ZRCA 3FXOA 3GTOJ 3HOWJ 2XHEA 1I39A 1TTYA 2H1LA 5HNHA 4XICA 4BX9A 1UJ8A 4BJ5C 5C4JJ 4HDUA 3FM3A 1RPWA 4ZC3A 3WG9A 4E4HA 1VQPI 2GRRB 1XX5A 3D3MA 1IRFA 4DY6A 2PFBA 3TKYA 3BTIA 1DU6A 3HSFA 3TO7A 2J8SD 2PQRA 3DSTA 3VSLA 1ZGWA 3L13A 2RFAA 3TW7A 4CDRA 2VGXB 3K70C 1BJZA 1H89C 3J7AO 1E90A 4Z2YA 1SVLA 2B7EA 4ZJZA 3PSIA 4IHWA 1EH8A 1DVPA 3HYIA 2LDUA 1ZG5A 3FH5A 3V80A 3DBSA 4U0UA 1SC7A 4FE4A 3UOTA 4HAMA 5J8FA 4R7LA 4M3GA 4LB5A 1N54A 4CYDA 3CMEI 3FU0A 3W2VA 2R3SA 3ZGKA 4D5FA 2ECBA 4ANUA 2BVLA 1Z77A 3LSTA 4N9HA 1R22A 3L7WA 3CC4I 4HEA2 3APDA 4G25A 3MKLA 1IJWC 2HYZA 3CHQA 2GRLA 5BXOA 2HI3A 3KP2A 4GDFA 2GWRA 4RGSA 2FBIA 4L0ZB 1CQTA 2V79A 2JZYA 3ZQCA 1U8RA 3ABME 2V5FA 3HXBA 1SFXA 2GXGA 4U87A 2LP0A 3GZNB 1SVOA 1YIJI 3FXJA 1QNTA 2FBKA 1SFUA 2PMZA 2VI6A 2CMPA 2HNHA 3HTUA 4M3EA 1DPRA 3REOA 1H2VC 2ZJRF 4WNDA 1WKMA 5JHAA 5CRUA 1YE9A 3ECHA 4A3LJ 4HOSA 4BXUA 2EFPA 2P9PG 2BXZA 1LE8A 3PUKA 2WA0A 3QP6A 4AV7A 2QQAA 3VZCA 2DFEA 3QARA 3M07A 1OYWA 4BTAA 4A0XA 3IV0A 3NQPA 3V7UA 2VL8A 4BH9A 2O5RA 1W36C 1MHQA 1HS6A 4P55A 4IRGA 2J08A 3IHVA 4L9JA 2CW8A 2M8GX 3EIJA 4GTQA 5J40A 4LFUA 5DD8A 3KSLA 3FHEA 2ZB9A 5A2QZ 1XGOA 3CUOA 4RB2C 2GGFA 3ZCOA 3L2QA 2ME0A 4UQZA 3AG1H 2GXAA 1SD7A 6PAXA 3R9AB 1FX7A 5FLXK 1OKRA 1OR7C 3TG5A 3HX1A 1HF0A 4V2FA 2IF4A 3K0LA 4IQ4A 3KT9A 3KCCA 1XTAA 1RETA 3F8NA 2OU2A 4PS3A 1D1AA 3KEYA 4LLGF 3WU0A 3IH4A 2VSXE 2CO5A 1J09A 3HHGA 1ZRDA 1TWFJ 2Z5UA 4L9VA 4BEHB 1HG5A 2Q5FA 4Y6WA 3KIOA 4ACLA 2X1CA 5DM6F 2VYIA 3QJZA 3PZ1A 3QOUA 2M0MA 4P5OA 1Y6IA 1HH8A 3QWWA 5LBQA 3QYBA 2KHMA 3SQNA 5G05J 1SAUA 4Q47A 2WV1A 1NG7A 1K6OA 2MOWA 3IL2A 3F0CA 3GO5A 4G7ZF 4FE7A 5J1YA 1SMYF 1Y8RB 2IT0A 1MW7A 2P4WA 2A6HF 4L9TA 2UXXA 4B09A 2VIXA 2DYRH 2EZIA 4NQ0A 3BR1A 1BI0A 3HOXJ 3EJNA 2DBAA 2WB1A 4KA4A 5FRNA 4WWOA 4CH7A 2NVQJ 3HKZA 1V55H 2EH3A 4RAZA 3RRNB 5CEDB 5JJTA 1PUEE 3DEUA 2A6EF 1WJDA 3AS5A 2CG3A 5B5EC 3G2TA 4EHMA 1KONA 3GF2A 1R5HA 5J8CA 3I3NA 4NDLA 1TT0A 4HBLA 3DSSA 3BP8A 3MVPA 4DX6D 1IDYA 2LY1A 1NI1A 5M5XJ 3M8JA 1BL0A 3GX4X 3ULYA 2I10A 2IGKA 1R9TJ 2GIVA 2LF7A 2NVXJ 2UV1A 4GTVA 2H6HA 1GT0C 3PO2J 4N5CA 1UMQA 2XGDA 2GA2A 3BT9A 1VQ4I 3PFYA 2LR8A 4LIUA 1V3FA 4LMYA 1K2NA 3LA3A 4FQGA 3VDXA 1D5VA 5EDSA 3RJVA 1ZR2A 4WERA 4EZLA 3F72A 4DK5A 2EIJE 3HVEB 1NP7A 3U4TA 2JSPA 4I2WA 2ZGDA 2P9KG 4QIWN 4BQOA 4IVNA 3L2CA 3C2BA 3HXDA 3ZPJA 2XF7A 3EU9A 3V8NA 4I76A 1SMTA 3FXUA 3OYBA 5EYLA 2EH0A 4J0UA 2AFFA 4I43A 1UB9A 5DIZA 2E2JJ 2HE0A 1XMKA 3F8MA 4S04A 2M3AA 5L3CA 1YFHA 2I9CA 4ZYHA 4XI0A 1LUJB 2E19A 2I2DA 4N4OB 1T2KA 2OQRA 2DTZA 1DEVA 3R6SA 2LAIA 3I4MJ 4I0BA 5JELA 2D2WA 5ILUA 3CHSA 4R79A 3CHOA 1KPSB 5KJMA 3UN0A 4ESFA 5ICEA 2VJIA 2PL2A 5EZGA 2F5FA 1W5SA 1YO5C 3ENEA 3ONKA 3GCMA 4HNAD 3HBLA 4JEHA 4Z68A 2XS1A 4MS6A 4TXPA 4U7EB 5AENA 1R1VA 2L9VA 4I9EA 4HB5A 3IKOB 2AW6A 2J09A 1PC2A 2BEOA 3VSKA 3I4PA 2JA7J 2AVPA 3ML6A 5DS9A 2Y75A 1KU7A 1OWOA 3VYSB 2M7AA 3H92A 4CGZA 1FYKA 1JUQA 3LKUA 4JBAA 3MMYB 2QZAA 4GZCA 5FWQA 3T1BA 1MSFC 2AXVA 2K9QA 2Z99A 4A3BJ 3D9MA 1WJFA 4MTEA 3ZYQA 3CVWA 1QYMA 1P6RA 1Z91A 5D4RA 4I7HA 3UT4A 2I5UA 4E85A 2L3DA 2HQ5A 3TWSA 3N05A 1E17A 4KMFA 1LE8B 1MK2A 2DQLA 3CJQB 4HSTA 2E1MC 4XSZF 5FD6A 2P5LC 2FE3A 2CW0F 2BV6A 4A5MA 4BT9A 2N8GA 4QLCU 2Z2SB 4NQWA 4ME2A 5G04C 1MBKA 3S1RJ 2HO1A 3WTZA 5JVGF 4GA1A 2H6FA 3UNGC 3BG3A 3UTMA 2I2CA 1FSEA 2RAEA 4KIFA 4BHPA 4DBQA 4Y7NJ 1JJ6C 1NTCA 4HRIA 3R9MA 3F6VA 1MMDA 3CQCB 1ULYA 5FKMA 1TLHB 2ACJA 4PJNA 3UKUG 3RKQA 1MJBA 1UHTA 3ZQLA 1TW2A 1VQ7I 2A5WA 2Q0OA 1QPIA 3HG9A 2EIME 2H6GA 4HOTA 2JQJA 3U9GA 1G3TA 2CSOA 3OYFA 4J8DA 2ID6A 4WCGA 5KNLA 2VBYA 3DXKG 3OYMA 2BGCA 3L2VA 1BOBA 1PP8F 3SBTB 4JZYA 4DNCA 2CUZA 2M0CA 1N78A 4ENNA 2E7XA 4XZ4A 4KYOB 4E7SA 4JW1A 2L01A 3LEWA 5CBNA 4BSXA 3RDIA 1FP1D 4XK4A 4GFBA 3V2XA 1EF4A 4UWHA 5AQ9A 2DW4A 2IGOA 1PUFA 1OMIA 2VC0A 2BKGA 2DA5A 2I8DA 3MCZA 4KN7X 5F0CA 3ZRGA 4BETA 1T6SA 3BR2A 1MDMA 5LD2C 1USSA 1CF7B 3A2KA 4C2MJ 3GTMJ 1TNOA 2GOXB 2IEKA 1Y3IA 2NYXA 5M72A 1U7VB 2XF5A 3CDIA 3PO8A 1KU3A 2KIQA 5AQ7A 3TGOA 4X0GA 1C0WA 5HKPA 4IHVA 2R2LA 5J08A 2ZGGA 4BY6A 2QF7A 1ZK8A 5J6XA 5JJ7A 3C5RA 4GTRA 1RC9A 4EJOA 3V8PA 2G9WA 2ECCA 1LFUP 4GAAA 4F7AA 4M6VA 1RUNA 2WVIA 4F3QA 2LYCA 4UUVA 2JABA 1HKSA 1X5BA 4URKA 3PE4A 1UAAA 2IXSA 1EYHA 2OEWA 2XGEA 1TWAJ 2XGOA 3Q7FA 1G88A 3RQ4A 1QWTA 2MC3A 4BNCA 2XGSA 2ETCA 2AS5F 2EV6A 1K6YA 1H6PA 2ZJ2A 2KT0A 3SXYA 2HOAA 2C6YA 2CHZA 1JHHA 5LEJA 4L9PA 1GUUA 4L18B 1T08B 1UCRA 1B9NA 4WXDA 4A3JJ 4A2UA 2HXOA 2BUGA 1S8NA 4UB8C 1JUSA 2JSCA 1W7PD 2XAUA 2OQGA 4JX4A 3U66A 2VJ4A 2HFHA 5CVJA 5HDNA 3FFLA 4FETA 1N0RA 5JHFA 2EPFA 3OIQA 2AWIA 2L6BA 3T9KA 5KK1A 4MBGA 1GHCA 5AQAA 1OCCH 2XKPA 1W0TA 2F5EA 4FCYA 3FF5A 4EBAA 1ON1A 3DEEA 4MQVA 3CCQI 4UNOA 1KZOA 4CGWA 2M1BA 2DXIA 2HTJA 3OIOA 1WJEA 2VQGA 2KZGA 1I27A 3TO6A 3H3VK 1ACIA 1N4SA 2Z16A 5BOXA 5FZQA 3ZUVB 2G7UA 4L0YB 3FMRA 1BA5A 2QFCA 1MX4A 2F4OB 4UUSB 3IRQA 4BE2A 1MBHA 1YG2A 2JJ7A 2WQHA 1HF8A 4AM3A 4PUCA 1R1UA 1RKWA 2W3OA 5CLSA 3BUAA 3H0GJ 3OXLA 1YX3A 2DA6A 4DZPA 5JI6A 4UI9C 5TJJA 1IGNA 2STTA 3HHMA 4G2SA 3KD7A 3L6AA 5AJDA 5D2MC 4EJUA 3QP5A 4EECA 2K9LA 1V54H 3SFXA 2Y9YA 2G1LA 2HVSA 3I71A 4XLPF 4GRIA 1K8KG 1EDUA 3QB2A 2DLLA 1ONVA 1SVMA 1FLIA 3PM1A 4MHGA 3KS2A 5DBKA 2L54A 3DPDA 1AP7A 1LF8A 3UV0A 4UQXA 2IU1A 2RVCA 1QVUA 3PUBA 3O3KA 2J5OA 1OUVA 3DXMG 3K1NA 5KCMA 2Y0MA 2UWMA 1MGTA 3WTXC 5F27A 3DTKA 2WXQA 5FJYA 3ZMSA 4I1MA 2MD0A 3LY7A 1BC7C 3S7JA 3L00A 2XUBA 5D4SA 3LAJA 2CUJA 1B1BA 2GAUA 5JHUA 3LSGA 3OYLA 4HSRA 2IONA 4RMNA 1U0TA 4UWKA 1K3ZD 4JC8A 1Z0ZA 4R8HA 2V1DA 5DV5A 1ZREA 3S17J 3IH2A 1OWPA 3L9FA 2L9NA 4BE0A 3Q7AA 1FT2A 4JHRA 1K78B 3OY9A 2OPTA 3L17A 3CJNA 1BI8B 3CUQB 3B6AA 3CVYA 4CZZA 4OYSA 3G2VA 1VQOI 4GTSA 3S3NA 1N25A 2VQCA 3E1SA 1T33A 2XAGA 2J4DA 1YOVB 2Y48A 1B59A 1S7EA 3WTUC 2QEXI 1IRXA 5J1RA 1G2HA 1FBUA 1W7PB 2EK5A 3O8GA 4BXXJ 3HG0D 3V8JA 2M63A 1X58A 4O3MA 1QZ2A 5DUKA 2LY9A 2ELHA 2ZSIB 1FBQA 4HOUA 3ZQIA 3LVRE 1Z3YA 4EJVA 2X48A 4U0ZA 3SGHA 3IHYA 5EIDA 3UKRG 3SNXA 4Z6YA 3H1CA 2ZO4A 4DYRA 3DRAA 1MBFA 5FKNA 3JRIA 3FHNA 1Z6TA 2ZNZA 3DF8A 4HI9A 1RESA 2EJRA 5L3BA 3OXFA 5C3EJ 4CCOA 1MDMB 3HDXA 3QKYA 4G26A 2HDWA 4YG2F 3VWBA 1MJ0A 4L02A 5HVQC 2Y1LE 2HR3A 5IP6A 1Y0UA 5F1RA 1TQIA 4EQQA 4RDUA 3FY4A 4U63A 4ATZD 1K3JA 2XCCA 1XDUA 1D8EA 1TP4A 5ERIA 3VA1A 2R7SA 2QKMB 3CZ6A 2WAQA 5CVUA 4UI9J 3EHNA 3RYPA 3DITA 1LDDA 2COMA 2ADUA 2F4IA 1R7JA 2F0YA 1HCRA 2QVOA 5K5QA 2BHZA 3COAC 5JEKA 1YS6A 5EEAA 3I9V2 2DU9A 2BF0X 2XENA 4GB9A 4NC8A 5D66A 5E1ZB 2CS3A 3PS6A 1W4MA 2AXZA 4DX7D 1UG3A 1R4MB 1U7VA 2JGRA 3ISMC 5HLHA 5LRRA 1OJLA 2DQRA 1ZGJA 4ACKA 2CQ7A 2XGCA 1WVRA 3M9AA 3GZ6A 2V7FA 1O3TA 2VT2A 2CQQA 4YRVA 3OS0A 3D9JA 4P1WA 1X4PA 1D8JA 1WM5A 1P2FA 3S15J 1G4DA 1F4KA 1Y8MA 5KJLA 1TZLA 5F08A 1W0UA 1A31A 5ILVA 2H94A 3B13A 4NC6A 3FEXA 2YR2A 1Z0XA 4CCAA 4A69C 4KDPA 2LKXA 5FFXA 4KIGA 2ZBKA 2AXLA 2LNIA 4CEMA 4DGWB 4KN4X 3RK6A 1NG6A 2R5ZB 2R05A 2CGPA 3BZKA 2GA1A 3ECOA 3N4MA 3ONQA 3FUDA 3SI5A 2CV2A 4A6DA 3A03A 3J81K 2CWEA 3JR9A 1E0EA 2QVLA 3UT7A 2MG4A 1Y8QB 4A3CJ 1BR1A 1MBJA 3C98A 4A3TA 1U5TC 3QPTA 3CKBA 4RSYA 4UWFA 3B7UX 1R23A 3UPVA 1NK2P 4GYGA 3CESA 1TJCA 3LY9A 4JPSA 3VEPA 1YT5A 3M7GA 3ZN1A 2WM9A 2A0TA 1H19A 3NWSA 1NZNA 3F22A 3MD2A 1NH3A 1ZELA 3OAWA 2ZSHB 3K69A 1RKTA 2HOSA 2IAIA 4II3A 4XKCA 3FULA 3UI2A 4HOQA 5LX8A 4UB6C 2A4ZA 2J9QA 3WTYC 4A12A 4AIHA 3UNNA 2VJJA 2VT3A 1S64A 3HVEA 5EKQD 4A0EA 2JA2A 4M3FA 4OMZA 3W2WA 1IG7A 5CJ9A 2IA2A 1YIOA 3TDUC 1HG2A 1U9OA 1R5GA 4DPRA 1IAWA 1DUXC 4M3DA 3RI4A 2STWA 4U04A 3UIPC 3TWQA 2R0QC 2VKVA 3HOZJ 1WV3A 5IT3A 2YX4A 5IT9Z 4HDVA 4ENKA 2V6CA 4L1BA 2E60A 1GVDA 4PUSA 3Q49B 3WE2A 4TV7A 2ZXJA 5DYMA 2IRFG 3L22A 4LIVA 3D9LA 3FUFA 4PGHA 2DYSE 1DCQA 4H7YA 4JHKA 5D5WB 1Y3HA 4GTOA 3A01A 3CQGB 2AJAA 5H6QA 1OCTC 3F8FA 4B0ZA 4EPZA 1P4XA 4IRIA 4YNDA 4RLYA 3P9IA 2Y9ZA 5KVRA 4B89A 1LFPA 2K4BA 3S93A 3M3YJ 1S29A 3ZQ7A 3FTUA 2ME6A 3DV8A 5D6FA 4XIDA 1VQKI 4JD2G 3JRGA 4KJZA 3ZYKA 1STZA 1IC8A 2KL4A 1UW4B 4AIDA 1G3SA 3GTPJ 1JKQC 2WXPA 3D5RC 1B8IB 2XASA 3HTSB 3Q47B 3RZDJ 3D9NA 3ESWB 5L3GA 1WCMJ 3S7DA 3CVVA 5CMWA 2X1DA 1P7JA 5H2FC 1VQ8I 3I6UA 1ZLJA 4LEUA 4OIRF 1K79A 2E2HJ 1IN8A 1S9HA 2IP2A 3BR6A 3MKYB 1EJ9A 3BTCA 2J49A 1D0YA 2CU7A 4MTDA 3MJWA 5KWDA 3CK8A 1RUOA 1MX6A 4J8EA 3EPZA 2Y3AA 3PQKA 4XLFA 4V3IA 1WDYA 2KDOA 4CZCA 5A6CA 2JQLA 3OIPA 1JKRC 3WU1B 1I3AA 2X6KA 3D9KA 3ERED 4HRNA 4D10C 4JYKA 3Q78A 4BXFA 1NA3A 2NS0A 2XRYA 3PE3A 4ZYAA 3HXEA 2WB1N 3HRAA 1HXIA 5EJIA 4FJYA 1FPQA 1YJWI 5HI7A 3Q9SA 3IKVA 2V6EA 4D0PA 3CMYA 1HC8A 3IXEA 1F43A 4JXTA 2XPZA 4LERA 1G3WA 4K2EA 2PQ8A 3TOAA 4WAFA 4FP7A 5AJLA 5CVVA 5JEOA 4YEJA 4RGUA 4KITB 4FC8A 5FROA 2FOWA 3ZXPA 1Y1VJ 3F9KA 1F5TA 1KQ8A 2YUSA 4XLEA 3LSRA 3Q0UA 1J59A 1LD8A 1BI3A 2P7CB 2WXGA 3JRAA 3JXJA 4RG6A 1VZ0A 5EG0A 2R7FA 2I2OA 2R7XA 2QENA 2UZKA 2R7RA 2WTEA 1KZHA 4N5QA 3UT8A 1OCZE 3LA2A 3OV8A 4ABZA 1ZG1A 2HDDA 4CHUA 1XDSA 4A3DJ 4HPQA 3U21A 2DFIA 2MFZA 2OTLI 1EPUA 2L6JA 1VNDA 1SA5A 4O1OA 4JA7A 4BJTA 1G3GA 4GCVA 1FC3A 2HR2A 4PH4B 1X4OA 3V8KA 5AYWD 4I6EA 3E5UA 4A4YA 2XQ0A 2ZXWH 2PJRA 1ZHFA 4OAZA 3F8CA 2F37A 3AFOA 1PVEA 2BBYA 2DK8A 2DA3A 3CJTB 3OOPA 3T8TA 4F91B 1R49A 1MQSA 2PIEA 2CHXA 3TWRA 2KB3A 3UQ3A 3ABLE 4UVCA 1JI8A 2K9MA 1ETOA 1W5CC 1HDDC 1TW3A 3L16A 1BJAA 5C44J 3GYZA 4IHXA 4K0RA 3SY2A 2Q1ZB 3LQRA 4AIFA 1D0XA 2HZTA 3D1NI 2D45A 2COBA 1A5JA 3HOSA 1K3NA 2DT5A 2OBPA 2W24A 5ICGA 4RM3A 3LDZA 5T8IA 5DHPA 4C3HJ 5L3FA 5L3DA 3CMAI 3S1NJ 5JVTA 3HL2A 4EZJA 1OLTA 2VGYA 2WXRA 2VKDA 1SD4A 4AY5A 3ZHEB 4YFXF 1TNYA 5G05C 3HYMB 4APOA 3K70D 3D5LA 4F7ZA 1GW6A 5BW8C 2NYJA 3BEEA 2R7OA 2VJ5A 5J3LA 3CCLI 5KNGA 3H5AA 4I98B 4XN0A 3R0JA 3JUIA 4G24A 4A3VA 1ELKA 5M5WJ 2JT1A 1R36A 3PNLB 2QY7A 5DM7F 3WXXA 3AU5A 1FHQA 2X6XA 2ESNA 2O3FA 3M1CA 1WG0A 3CSFA 3I4GA 4K5AB 4Y6CA 2IS4A 3MZ8A 5K7ZA 2CRGA 3G4SI 1DCEA 1E2XA 2HM8A 3RIRA 1ZN2A 3ZW3A 1SQMA 3GZSA 1YI2I 4HFGA 4F1SA 4CICA 4IF4A 2CYYA 5F0HA 1WH7A 1Z0UA 4DRXE 3DTIA 3NAWA 4FX0A 3C3QA 3SFYA 1Y1WJ 1JCSA 5ANLA 5KHDA 2DI3A 2IVMA 1JUPA 2XRNA 4B8CB 5EGOB 4I1AA 5JERA 4GXOA 1E3PA 3I5PA 2K4JA 1FNNA 2EB7A 3K4KA 1H8AC 1E8ZA 3DWLG 4WXCA 3ML8A 3EHMA 3PZ3A 3ESLA 3K6GA 4HRMB 3V7RA 5AIQA 4XLAA 2FO7A 4B48A 4NIKA 2PMZN 1JTXA 9ANTA 1FMWA 3FM5A 4UXNA 5LLQA 2KKLA 4IX7A 4JVSA 4I6GA 1R1TA 4I09A 1TQMA 2PG4A 2HGCA 3F3XA 3CVQA 1R5ID 5BV1A 4XRMA 4UVAA 1XGNA 2GRNB 4GZ3A 3CC7I 4ESBA 4I6ZA 4C0MA 2L9SA 3ERMA 1BN5A 3ASNE 1KGSA 2XAHA 4PSWA 3TXMA 2EBIA 2OCCE 1GDTA 1QU5A 3ZEFA 1B72B 4A0YA 3K4LA 4CSWA 3OYEA 5FD5A 5J4VA 1G6GA 2KFUA 5FGMA 4AIJA 2R5YB 1X3UA 3HRUA 4HXIA 2HKOA 2ZC2A 1ETXA 4BX8A 3S32A 2PZIA 3C2GA 3NOGD 3E7LA 3ZRHA 1X3WB 4FHTA 2IFUA 1H9TA 5BT1A 4Q5SF 2UUZA 3ABUA 4RAFA 2EIJH 1YS7A 1Z6RA 1Q1HA 2LK2A 2MD5A 3L54A 1TNZA 4UUSA 1SFOJ 3JTGA 1AKHB 4FTHA 3K4MA 4WF2A 3NOCD 3G3ZA 1JXSA 5DCMB 1PYVA 3ZP5A 3CSTA 4KT6B 4EM2A 1D1BA 1AHDP 2OEVA 1YYVA 4J6IA 3VLFA 4EJWA 2RDPA 5FKLA 2HPIA 3IWFA 3I59A 2OF7A 4MIMA 3OS2A 2LUHA 3MKZA 1D3YA 1WGXA 2FQ3A 3D5SC 5HS7A 1NK3P 2GM4A 2KZTB 3JCKC 4G23A 2EZLA 1LD7A 4WWNA 2JMWA 1T0FC 2FF4A 1U6GA 2MH9A 1TN6A 2Q7FA 3A77A 1K78A 4IXAA 4Q4ZF 2GRMA 2J4BA 2GLOA 4LB6B 2D1HA 4AYBA 2R7WA 5KNHD 2Y4UA 3GFJA 1OWNA 2H1KA 4LRZA 4RGRA 5IYDJ 1B9MA 2F6CA 3GUDA 1JE8A 5G2NA 1QZEA 2W25A 3RPQA 2HDCA 2KZTA 3KYCB 5GADJ 3ABKE 1PP7U 1QQIA 3CR3A 2L4MA 3CEQA 4I2OA 4PDXA 4BL0B 3DEWA 1P5QA 5HNFA 3J5QB 1FOYA 3EQLF 3LCAA 4GPMA 2JPBA 3EUAA 1RI7A 2C2LA 1WJ5A 3FXLA 4WWCA 3D9PA 4IO9F 2DA1A 5ARFA 3FIWA 3P5JA 2LRDA 3RKWA 2Z33A 4EJTA 5K1YA 2WQ6A 3DKWA 4GMLA 3HRMA 1ON2A 5D8KB 1PDNC 3O8HA 2FI7A 1HO8A 2I1KA 5BPPA 1FMVA 1S3JA 3JRCA 2P81A 4HQDA 4B8XA 1WH5A 5LHGA 1LVKA 2DA4A 1Z05A 3O6BB 4BHCA 2W82A 1A6QA 3AG1E 3BLYA 4K5CA 4KIBA 3PH0C 3I6WA 3NRVA 4PK4A 3FH7A 3V31A 4FISA 3ZQQA 4MLOA 1QBJA 2XKOA 2W1OA 2NXNB 3CCMI 3R7RA 3Q79A 2LF8A 1YJMA 4BBSJ 1P92A 5ILSA 3OYDA 3ASGA 3FU5A 5E18F 2XAFA 4M9XA 2LD5A 3PEUB 4C48B 4BDYA 4Q69A 2R7TA 3TXNA 2QZ8A 1N0QA 3CVUA 1SUWA 3JTHA 4XNFA 1N4RA 1MJ9A 2KIUA 4ESJA 5C4XJ 5BPIA 3DWLE 4RS8A 4D9VA 3K9TA 5J47A 5HS9A 3OYAA 2DFHA 1POGA 2GBYA 1TNSA 3MZYA 2L0KA 2X0LA 2VXDA 4Y3OA 2Q8KA 3LAPA 3OS1A 3VPYA 1Z1DA 1TWGJ 3SZGA 3H9QA 1TL8A 2K9NA 1A35A 4KZ0A 3HKZN 1X19A 2OCCH 2XDVA 4MGRA 3HIFA 3FP3A 3JYSA 2XF6A 3CVLA 5JMND 1ELRA 4U8VD 1U2WA 2BOLA 1O3SA 2QYOA 4LOCA 1KQ0A 1ZG3A 1YGSA 3KLNA 1V55E 4CDGA 2QBYB 4P96A 5E8GA 5EYRA 3I3LA 4IL6C 1VQ9I 3CK9A 4B47A 2JQ7A 2CFUA 5TISC 4FA6A 2KMUA 1N75A 3L2UA 4V19K 5CECB 3ZGQA 1OQYA 5EX3A 3FWVA 2P58C 5LRSA 1UG2A 3VOEA 3GWZA 4PJLA 4TUMA 1W36D 2BE5F 2LMDA 2DPDA 4OVVA 3SDGA 2L5QA 3U64A 3GFIA 3ULEG 1XN7A 3EUHA 2RQQA 2VOPA 3UM1A 4YDEA 2FO1E 4MRUA 2BW3B 2DCEA 2ZMEB 3Q4AB 4JB8P 2VSYA 2KISA 3ABTA 2VONA 1DGRM 3MKQA 4HRLA 3ZOBA 1FOWA 2FQ4A 2K86A 4HOBA 2KDZA 3G6EI 2WXMA 3CLOA 3P7NA 3NF1A 4UWGA 3V4GA 4U07A 4AD9A 3O2PE 5DHUA 1E3HA 2FXAA 4OAYA 4PS7A 5A23A 2VTBA 4TRQA 1IN4A 1U9NA 1AA7A 3ZIMA 5AQBA 1W1WE 4RLQA 4EM1A 3ELVA 2W4SA 2H8WA 5CVIA 1WJCA 3IAM2 5K7FA 4IKFA 1QNFA 4UI9K 3S40A 3HUGA 1FZPB 3G73A 5FO5A 2L7KA 4G8LA 4CYMD 3S1MJ 4FLHA 3I59B 1N9AA 3WU2C 5EILA 5FQ4A 3FEYA 1U0JA 2CQNA 1INZA 4B4CA 2E5NA 3GFMA 2V26A 1RZ4A 3EYIA 1DQUA 1QZYA 3ZN3A 4BESA 1J4QA 5HOOA 4N9IA 4HV6A 5EJCA 3IC7A 1RIOH 4PGGA 2DAOA 3RPUD 1E8XA 2JA6J 5EG0B 3Q9UC 5EZHA 4NC7A 4BYYA 2QQ9A 4XRSA 2IS6A 1FT1A 2DDAA 2OC6A 4K03A 2X85A 1R6RA 4OAVB 2HVRA 4U8HA 4B3AA 2XEVA 5M3MJ 3OR2C 2IOLA 3AU4A 3IH3A 3R60A 5M3FJ 1JPLA 3VZBA 3EU5A 3R4KA 3G1MA 3GLLA 3C18A 1SAXA 5E3NA 2OZ6A 1SEUA 5KJKA 1N11A 2CH0A 2GRQB 3B7BA 3V8RA 3E97A 2IQCA 3A02A 4AWXB 4A55A 2JA8J 3OR1C 4LCTA 1V54E 4XE0A 1U3EM 4A3FJ 4YDYA 3PL8A 3K1PA 4M73A 3MZLB 3F6OA 1U7FB 4LK1F 3KP5A 4XLNF 3S7BA 2QWWA 2VPRA 4NQWB 1I1SA 2VSNA 3TP0A 4AOFA 2W84A 5H6RA 2YHCA 2KLOA 3T8MA 1Y0NA 2R02A 1R21A 3PRZA 4EJQA 1VQ6I 3RKVA 3BDDA 3JREA 3RO3A 3KEZA 2K3PA 3IAS2 1K7AA 5IY5E 2X6FA 2CUFA 5KJNA 3S7FA 2O8KA 2XEHA 4IHYA 5HRYA 3M8EA 3AG3E 5FQ8A 3BQYA 4F55A 1N52A 3UM0A 4LGWA 4XKWA 1VI0A 1FJLA 2LREA 3SZTA 3W2AA 4GGGA 4KYWA 4HLLA 3ZKJA 2ZXWE 3BCBA 2QV7A 2NNYA 3BG1B 2CSWA 4AU7A 4DYQA 3LL7A 3K2AA 4L23A 2Y69H 2KB4A 2P6TA 4HA8A 3U1KA 1ZB1A 3V79K 1LFBA 5FFZA 2L9BA 5DHSA 5ENNA 1HOMA 3SO8A 1XB4A 1Z3XA 3CP8A 2QQ8A 4HLXA 4MEYF 3IRRA 1Y39A 2R7UA 2VASA 4JP0A 2EILE 4J19A 4HLYA 1FVHA 3FH8A 5FLXZ 1SFKA 3T5XA 3CF5F 3J80K 1MMSA 2A69F 3UR3C 1LB2A 4NHJA 1AWCB 4BKXA 4Y17A 3A01B 2ETAA 1W3BA 2M45A 3CUQC 1LKXA 3WG7E 1H2TC 3IEGA 4ZDPA 4EGZA 2JUGA 1S6LA 1O1TA 1O1RA 3NARA 2IO2C 5ICFA 2PN6A 4JL0A 4NURA 3MYVA 2YS9A 2E71A 2PNNA 4O5VA 5GTHC 3I0NA 1HSTA 2UXNA 1KLXA 1S63A 4BSZB 2DOAA 4KMOA 3PDNA 2LC2A 1A17A 3JAMZ 2KCKA 4CT4A 5D5VB 4IHSA 1QQEA 3ML9A 2P5KA 1B8IA 3J5PA 2OA4A 2E1NA 2HTSA 4HS2A 4XKVA 3URZA 4CCLA 2DZNA 2XB5A 4XR6A 4GCNA 5B1AH 1ZU2A 3HJEA 3KAEA 1LTXA 3TL5A 2CV0A 2VUMJ 1JWGA 1N77A 2VC1A 5CPRB 2B6CA 3GQSA 1MH3A 3KLOA 3ASOE 4AXHA 3LSMA 2F5DA 3CHMA 4CYCA 2V9VA 2MH2A 1H0MA 5T3RA 1Z7LA 2P7VB 3E5XA 2A07F 1XGMA 4LD5A 3TWWA 4HQMA 1Q2ZA 1FY7A 1FTTA 3VLEA 2VGEA 2K02A 3BOQA 4AP2A 3OYHA 4RBOA 4U95D 1ETQA 5LGTA 4KISA 3PUJA 4OIOF 2X3MA 3TQNA 2VODA 1LDKB 5BQTA 2ZFUA 2DVWA 3JQ0A 3Q73A 4UY8I 5CERB 1ZR4A 2VPLA 3ZFWA 4JIWD 2XZDG 2BY0A 4P9FA 1XNFA 2OTJI 1U2VG 4CCMA 2RFMA 1UHMA 3ASDA 2OV7A 2DT7B 2XCBA 2I1WA 3HSEA 1T98A 3HUFA 2LTPA 1OY3D 3TBIA 5M5YJ 2WPVA 4QFVA 4CUGA 3K2ZA 1XCVA 2MABA 4HNUA 3GYHX 1FT9A 1MMAA 4EGYA 4A3EJ 3CC2I 2W48A 5GPCA 3FUMA 4XIFA 3Q15A 3N97A 3B02A 4N3AA 4GPKA 3UUXA 1KHXA 3HOYJ 2MGQA 3TP3A 4OMYA 1MZBA 2XZTG 3CHPA 4M3OA 4HBDA 3RJPA 3T5PA 3I4NJ 2M4KA 3IKTA 3S2DJ 3APCA 1GVJA 3HOTA 1OR7A 2KRFA 3BTLA 4BACA 2P2CP 3RIBA 1SD5A 3LA7A 4EV0A 2HQAA 1FOKA 3MA5A 2F5CA 4HG2A 2V1UA 1U3CA 4BEHA 1KHUA 4DZJA 4R1HA 2DZOA 4IRUA 4U8YD 3M4OJ 1QGPA 1REPC 3CP2A 3D0SA 4C3JJ 5K5OA 2RKKA 4GTTA 3DCFA 4ZTJA 3QWLA 2DMTA 2IA1A 4GA2A 4MO7A 2MYSA 3FKJA 3SZPA 4UWLA 4OAUC 4A63B 4DLOA 1U5TB 4GZDA 4I9CA 4V24A 4WNEA 2L7ZA 2FX0A 4KFCA 2XXSA 1NA0A 1R4NB 1QZZA 3WGIA 4H7XA 2P1RA 4XSXF 2QM3A 4E7IA 3PNTB 3ABKH 4M6XA 4DOZA 3KETA 2X6IA 2GQQA 4WXHA 4BU2A 5BXUA 1XG1A 2H27A 3NQOA 4A5NA 4TXRA 2E1OA 2Z9OA 5LFAA 4ZDOA 1TN8A 5FQ7A 2PEXA 4Y33A 2L4AA 3TGNA 3LY8A 4DX1A 3GTGJ 1FSHA 4D7NA 3NWTA 3BZ6A 1N94A 1HSJA 3FMSA 1Y56A 2M2EA 3RKXA 3LFKA 4HNVA 2ZISA 3EIQC 3EUKL 5AONA 4JQFA 3ZVVA 5CRVA 4BBRJ 2R4GA 5B66C 1JGSA 1G8XA 4DQ2A 4EQFA 3E32A 4B93B 4NBQA 1OFCX 3ULQA 2HPMA 4HW0A 4J8YA 5BUZA 2FMYA 3FTXA 4BHBA 4C2TA 2DA7A 4HV5A 4A0ZA 5D0QD 1HU3A 4BWRA 1LGPA 3V2OA 3CVNA 1H6OA 5EF6A 3ZNGA 3PIOF 1BI2A 2FJ1A 2XAQA 3SD5A 1P7IA 5D6EA 4L2YA 3R0AA 3DU6A 3G2WA 5HLGA 2F8XK 5H20A 3GZ2A 3G71I 3CCEI 2VE8A 4G1TA 2VQHA 3IUOA 2JRTA 2Y0SA 1H9GA 2VTBB 3DP7A 3V30A 2HXIA 2F48A 3E4BA 4LNBA 1H6KA 2W85A 1B4AA 1WQ2A 2Q2EA 3WE3A 1XC5A 4RGXA 2ZFWA 5E1XA 2BTDA 5CMYA 5LCWC 3A0HC 2OOEA 3ABLH 1WI3A 4G94A 3CO7C 2Y4TA 3E37A 3EUVA 2MSYA 3CMMA 4OVUA 2BONA 1E7VA 3V7WA 5IP7J 2ZJPF 3AG4H 3CQZJ 3QC1A 3QWVA 4KVOA 4CGVA 3FHZA 2WMOA 5HS8A 3V7YA 5A8IA 2QLZA 2Z3YA 3DKXA 3FBIB 3JQ1A 4LSZE 3GTJJ 1QPMA 2EFQA 5LGNA 2Q2EB 4I1OB 5E20A 3E33A 4UQYA 2L0TB 1HLVA 3VZDA 2ZXHA 1O4XA 4BFRA 3RYRA 4RB1A 2OZUA 1A36A 4A6EA 1JWFA 3LS8A 1V4RA 2XPWA 2DYSH 3BWGA 3J81Z 1YA0A 4IYPA 4WNFA 3FTVA 2NOJB 3EYYA 4ASNA 4F92B 2MBFA 5GAGJ 1H2UA 1UJKA 1IRGA 3RSNA 1E3OC 3U9WA 3T8RA 3BJOA 5IYCJ 3MCXA 5GTIC 3QOPA 1HBXG 2A5YB 3FMQA 1D9SA 3GMEA 4EZKA 5JLXA 1UHWA 1WJAA 4IJAA 1QU3A 1ODDA 1S7OA 4A3GJ 3IWZA 1XPXA 4M71A 5A2QK 5HS0A 3NEUA 3PJRA 2L0IA 5FINA 4Y15A 3FUIA 2L02A 2PM7A 3NZSA 4DLQA 2DMNA 4D1QA 3MFKA 2I6HA 2ONDA 3AKZA 3DTEA 4OOIA 3S2WA 2KIFA 4XLCA 1XS9A 1DP3A 1K1AA 2XC7A 1RW2A 3EHQA 3FUNA 1Z21A 2Y0SN 3POAA 3QPSA 3RZOJ 5LCWJ 5FB2A 2NRAC 2GROB 4N3CA 1XSVA 5AARA 2A61A 3OL4A 1LVAA 5F04A 3DPYA 3CV0A 1X2NA 1YJNI 3KEQA 4KMUX 3ZMVA 2JA5J 4LG3A 3JAMK 2DFFA 1IXCA 1IZ1A 2VE9A 1YLFA 3GBGA 2PBIA 5L3EA 3TEDA 2F8YA 1MNMC 1EA3A 5JEJA 4G2VA 4LG0A 1XCBA 1XGSA 4JX6A 3A4CA 1QHHD 1IF1A 3FISA 1K4SA 1XMAA 4BERA 1FYLA 1P4AA 4ZDLA 1IRZA 1SA4A 3DEPA 4IN3B 3S2AA 3FM8A 2P0WA 3APFA 2X38A 2E1CA 2TRTA 2CHWA 1IQRA 2B0LA 3AAAC 1N4PA 1WJBA 3GEZA 2FD5A 3FXQA 4Q48A 1TNUA 5K5RA 3KEOA 3I4RB 4BQAA 3HDDA 2L2OA 3CDHA 4PFOA 2CG2A 3J80Z 4E6KG 3KYLA 1H0AA 2JEKA 1USTA 3CCVI 1JKPC 4OU0A 2BXYA 2CFZA 2PMHA 4E70A 1SD6A 1FHRA 1SZ9A 3EDPA 1OCZH 4S0HB 2K85A 3E6BA 2A5UA 3G2SA 5CCMA 5B3SH 1BW6A 1IN5A 4G6QA 3AAFA 2DN0A 3KZYA 2LVSA 1HE8A 3NZUA 3QAQA 4CT0A 1FBSA 2BHYA 2KFDA 2RV8A 4PZJA 2KPMA 4QPQA 3OSGA 3R61A 4HF0A 3QPHA 2VBXA 2BYVE 3F8BA 3IP4B 4IEJA 4YFKF 2EIKE 1MNEA 1OCPA 4KVMA 1IYGA 1U5TA 3W9FA 2VBZA 4UVBA 4XL9A 5ENOD 2VXZA 3CCYA 4BJ6C 1HW2A 2QSFX 3GXOA 3HM5A 1X1BA 2NOGA 1KT1A 2HQRA 1TN7A 4ILGA 4RVBA 2HKXA 3I54A 3MZHA 1QRYA 4QPOA 1ZBPA 2FULA 3I56I 3O4ZA 3B7SA 2WWYA 4CYCB