2FEZA

Mycobacterium tuberculosis embr
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
373
structure length
373
Chain Sequence
b'RLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable regulatory protein embR
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 129
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2005-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fezA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fezA02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2fezA03
3IHUA 4AIFA 5A2QK 2IJLA 3CK9A 4XSZF 2ISZA 1KQ0A 2VE9A 3OV8A 1T98A 5J6XA 3GYHX 3LYAA 2Z99A 2HTSA 3HYIA 3I58A 2UY1A 2YPRA 2VBXA 5LRRA 4DNCA 1HXDA 3LAPA 3SQNA 3RU0A 3QU3A 2DT5A 2ZJ2A 1C0WA 3QPHA 4JHRA 4RAYA 5BPDA 1OKRA 3QPTA 5A6CA 4HDUA 1WM5A 1KYWA 1HXIA 2PBIA 1YG2A 3WTWC 2XVCA 2E1NA 3TAXA 4N39A 4HV6A 3TGNA 3WU0A 3DPTA 3QP5A 2F5CA 4D9VA 4KBQA 4FHTA 1J2XA 4I98B 2VQ2A 2FA5A 2XHKA 4ESFA 5FFXA 2IA2A 5LHHA 2YR2A 2XEVA 3BPXA 1V4RA 5FTPA 4HLXA 2BUGA 5LCWJ 2QBYB 1OUVA 2HGCA 3QWPA 4ABNA 3VEPA 1ZHFA 4N2QA 2JLBA 5FLXZ 3NRVA 4AWXB 4U04A 2A61A 4HBLA 3I53A 2P7VB 3JTGA 1LVAA 3L9FA 1QQEA 1W7PA 3WTUC 3O3KA 1I5ZA 5HS9A 4EM0B 1IXCA 1R58A 1ZU2A 3R4KA 3W6JB 4GYYA 2A6EF 4XSXF 3SHFA 4D0PA 1Y8MA 3TO9A 4UVCA 3LY8A 1PC2A 4GZ5A 5H6RA 4ESBA 3R0AA 4Q4ZF 1R22A 3KP7A 3ZN3A 5L3DA 3N71A 5DYMA 1G3GA 2OAZA 3WODF 1QGPA 4BH9A 3SF4A 4G6DA 4OIOF 1B59A 1AOYA 2Z5UA 3PQJA 3BPVA 4I9EA 1O3QA 3ZPLA 4AD9A 1I6XA 5G05C 2YX4A 3M8FA 1D3YA 1U2WA 2HKOA 1KQ8A 4Q47A 2KIMA 2BV6A 3N4MA 2Y75A 2CW0F 2HWVA 5LEKA 4Y6WA 4NQWA 1USSA 5FO5A 1HSJA 1J9IA 4IPAA 2MA3A 3L7WA 3MWMA 2FOKA 4GCNA 3DPLC 4WXCA 3K9TA 3L00A 1OYWA 1L0OC 1J0RA 1P2FA 4GCVA 3JTHA 2GAUA 2ZNZA 3ZMUA 4Q48A 2ISYA 2LF8A 5ICFA 2STTA 2FE3A 2IA0A 3FWEA 4H7XA 2YX7A 4DQ2A 1Y0UA 3ULQB 4I17A 4BWRA 1MJBA 3VA4A 2XGSA 4I2WA 2LF7A 4OIRF 2AVPA 4N5CA 1FYLA 1BI2A 2H6BA 5FLXK 4J0UA 2PJPA 1I1SA 2P4WA 3GQSA 1NA3A 4U7BA 4U7DA 2QZ8A 3I59B 4G7ZF 1H9TA 1ZBPA 1KQ9A 2W3OA 1FYMA 1RNLA 4UUVA 4RB0A 2R7DA 1G4DA 3GVAA 2AXLA 5F6FA 3GZ1A 4Y17A 4UHTA 3KFWX 2CQKA 5LGUA 1OYYA 3E97A 1HBXG 2V1DA 3HX1A 1FHQA 3BEEA 4EM1A 5EEHA 3MQ0A 2M87A 2BYVE 4BT9A 3TOBA 3PE3A 1ZGJA 4R1HA 2B0LA 1BOAA 4MTEA 4OIPF 2L3DA 5CCMA 3IKTA 2J5PA 2PIEA 2P58C 5BT1A 2EV5A 3TO7A 3OUNA 2RDPA 1R1TA 2MC3A 1S29A 4GYGA 2E7WA 1P4XA 2G7HA 1ZRCA 4CZZA 3F8FA 4P9FA 2L02A 1D8JA 5LEJA 2W85A 1TTYA 5F64A 3WTTC 3JW4A 4FX4A 2GWRA 3CUQB 1ZG3A 3ECHA 3DFGA 1Z9CA 3WGIA 4QLCU 3VPYA 4ZH4F 2FMLA 4A12A 2HO1A 1BC7C 1ELRA 3GX4X 1K3NA 2M30A 2VBWA 3GWZA 5HOOA 1U6GA 5DEQA 4WK8F 2RKHA 4A0EA 4Z2YA 2FRHA 2BBYA 5EEGA 1R5HA 1EV7A 3R6SA 4HAMA 3FXUA 4WXDA 5HI7A 1IRGA 1S8NA 1WWXA 3S2WA 5L3BA 2JPBA 2HR2A 2HFHA 1ZLKA 4L5JA 1XSXA 1SFUA 4NRHB 2HQRA 2HOEA 5DUKA 4ENKA 2P8TA 1K2MA 4YVOA 3LY9A 1S7AA 1FNNA 5HQ8A 2MD5A 2QWWA 4M73A 1XGMA 4R8HA 3FF5A 2DBBA 1IN4A 5KVRA 4EJOA 5ARFA 5E1XA 3KZYA 3KS2A 3ECOA 5K5QA 4FX0A 1SD6A 3MFKA 5CVIA 5KJLA 2UY1B 5CVUA 1W5SA 1LDJA 3GUDA 3EYIA 1B9MA 3M8EA 3R0JA 3M1EA 3M7GA 1UFMA 1I1GA 4I7HA 3IL2A 4LLNA 4U0VA 3R61A 5E50A 2KIUA 2LSUA 2QQ9A 2W24A 3JSOA 5KJKA 5K5OA 4A5MA 1SAXA 3QP6A 2QUFA 3VFZA 4P9UA 5D6EA 1DUXC 3GEZA 2V79A 2HTJA 3TG4A 4ENJA 3NEUA 4U0SA 3MEXA 3MDBA 5BQTA 2EFWA 2UXNA 1REPC 4U0YA 4RG6A 4HA8A 5DD8A 4M72A 1LB2A 1NZNA 3KLOA 1MJAA 3HSEA 4UV9A 1WI9A 4AVPA 1QQIA 4G26A 2F5FA 2EA2A 2XGXA 3QOUA 2HKXA 1FYKA 1FP1D 2VBZA 3S7DA 2FSWA 2PQRA 3RO3A 4RAZA 5ARGA 4KYWA 1UB9A 1W7PB 2A6HF 1QO0D 4N0BA 1KU7A 1WKMA 1MJ9A 2HZTA 4LEUA 3HRSA 5ERIA 1TBXA 3HTUA 1J7KA 2BGCA 1UJXA 3UNNA 3IWZA 4BHPA 3C18A 4XI9A 1BN5A 5DDGA 1G3WA 2GZWA 3BROA 3NF1A 2XGOA 6PAXA 1RZ4A 1T2KA 1OR7A 2R7FA 2DK8A 1QNTA 3LCAA 3QU6A 2D2WA 2PZIA 1YTYA 1SD5A 4BYYA 3BDDA 5E18F 2NRAC 2W25A 5FD5A 1TQMA 2K86A 2CFXA 2PL2A 1LEBA 2L54A 3BY6A 3HHGA 2JRTA 3ZN1A 2O3FA 2QVOA 2M5WA 2O0YA 4A6DA 3HHHA 3WGGA 1DPRA 4G7OF 2DK5A 5L3FA 2MH2A 3ABTA 1DDNA 3SXYA 5FB2A 1OMIA 2L4MA 4IJAA 2RC4A 1VTNC 2A5YB 2FNAA 3MCZA 2IVMA 2PN6A 3GFJA 3S7BA 1EH6A 3CKBA 5HLGA 4UXNA 3HRUA 2ESNA 5ICEA 3COAC 1JGSA 2RN7A 4RGUA 1MDMA 3E5XA 3GFIA 2GQQA 3POAA 4U0WA 3G73A 5D8KB 3RDIA 2XKPA 4Y6CA 5LHGA 1ZG1A 4IRHA 4I1AA 4UVBA 3WE3A 4AIJA 2KATA 2FEZA 4GPKA 4HOTA 4ZYEA 3HRMA 4NB5A 5BPIA 3I0TA 4I01A 1KA8A 4EQFA 3LPZA 3TG5A 3C7JA 2OQRA 3GO5A 3PE4A 3RKXA 4KIGA 4GA0A 1F4KA 2FMYA 1JE8A 1LDDA 2DTRA 5HLIA 3ZQ7A 3VB2A 2WPVA 3MZHA 4KMFA 4N2SA 4YFKF 2K4BA 4HQMA 2CO5A 3TO6A 5LGTA 1USTA 2P5VA 1BBYA 3I4PA 2OZUA 2KKOA 4KXKB 3EQLF 4HX7A 5L3EA 5CHEE 2Y48A 5L3CA 4WNGA 4YFNF 4YG2F 5C1DA 3URZA 4CGWA 2ZFWA 5JFRA 1RIOH 4JONA 4LGWA 2FF4A 2LSOA 1XSDA 3FZVA 4U07A 1YIOA 1A17A 1ZG5A 3WTVC 2V9VA 5BOXA 4PDKA 2XV4S 3DXJF 3RIRA 3IWFA 4PGGA 1FSHA 4EGXA 4LMYA 4M6XA 2A0TA 3JAMZ 5JR3A 3KETA 4KN4X 3RTRA 5FZSA 5JJ6A 3FWVA 2KIFA 3ESKA 1P4WA 4WNFA 4M9SA 1I27A 1YLFA 4JA7A 3PO8A 5IT9Z 3JYSA 1YS7A 1OYIA 3JSPA 1PDNC 3GW4A 1X3UA 3T0YA 2IPQX 3LWFA 1R00A 2XUBA 1U5TA 3ASHA 2WV0A 3E6BA 4EM2A 4CGVA 4G9YA 2ADUA 3ZHEB 3F21A 3BJAA 3RYPA 5J8FA 2RGVA 2L01A 5DUIA 2JQJA 1KU2A 1SD7A 5G04C 5BW8C 4OIQF 4LK1F 2P6TA 4M71A 2KFUA 1MD0A 1YW8A 4G1TA 1BIAA 4IHTA 4G2SA 3K1NA 1D5VA 3HRTA 1XD7A 1R1VA 4EMSA 5D5XB 5ILUA 1G3YA 2NS0A 2MH9A 4XLPF 3P9KA 5DCMA 2RV8A 3LFKA 3M9AA 3HYMB 4HQEA 1ZGAA 3RJPA 3QRFF 2FO7A 2IRFG 1BJAA 4YVQC 4LLLA 2E2EA 1P6RA 4EJTA 3KP5A 2KKLA 3V7RA 5JVTA 1XMKA 1FP2A 2M8EA 3G3ZA 3WGHA 2K27A 1K6OA 4LK0F 1IRFA 4KDPA 1K7AA 4H0EA 3KP2A 4O5VA 3QOPA 4KFCA 3CK8A 3Q9SA 1IN6A 5FD6A 3F23A 3FXRA 1D8KA 4LLGF 5AIPA 1FHRA 2EFOA 2EV0A 3O48A 4HZFA 2HYGD 1JHHA 3CUOA 1ZN2A 1T38A 3HUGA 3T1BA 3ISPA 1FY7A 3JAMK 3MAJA 3C1DA 2XRNA 4QCJA 3KCCA 4UI9C 3F8BA 2Y4UA 2F5DA 4HLYA 2XCBA 5HS8A 2O61A 3UPVA 2C0LA 4KT5C 4YIIA 5IT9K 2UZKA 2STWA 2A69F 1XGSA 2XPIA 1HKTA 4EQQA 2CGPA 1P4AA 4RB2C 2WWYA 3KD7A 1O3RA 5ED4A 3F3XA 1U3EM 2PQNA 3K2ZA 4LB6B 1B1BA 2QLZA 2P5KA 4A0XA 1FWZA 3ZGQA 4F7ZA 5FZRA 1R5GA 1ZH5A 2COMA 2VXZA 3CTAA 3K0LA 5HDGA 4A0ZA 3EETA 1GXQA 3ZPJA 1RUOA 2O8XA 4WUYA 1A04A 2VGXA 4CGZA 5K1YA 2LSVA 4MEYF 4G7HF 3ZFWA 2DW4A 3F8MA 1RUNA 2XASA 5HLHA 3NQOA 4OMZA 2M1BA 2PQ8A 3K9IA 3GLXA 3ELVA 5D5VB 4KMUX 5KJNA 1P92A 2PG4A 1KU9A 4P96A 4A2UA 3CEQA 4A0YA 3LY7A 2IF4A 2YU3A 1LGQA 1K3QA 2EFQA 1QBJA 1ULYA 5LGNA 4KICA 2Y4TA 5CLSA 2V1XA 5E1ZB 3R9AB 1B9NA 1E17A 4G6QA 2VN2A 3LSTA 4LFUA 3SZ7A 4HYEA 3WTYC 1XDUA 2OU2A 4E70A 2Q7FA 1KYZA 3Q15A 2TDXA 4WNEA 5D4RA 2MLKA 4GYWA 1EH7A 5G05J 3WTSC 3VTYA 5CJ9A 4BHCA 5DJOA 1J4OA 4JA9A 4G23A 3DKWA 5LBQA 2PFBA 3U9GA 2C2LA 2HEOA 2E1CA 1K2NA 4BTAA 3Q5FA 2EV6A 4GCOA 1PP7U 2MLGA 2H27A 5FJYA 3ZN0A 2VC0A 2IFUA 3P7NA 3FMRA 1GHCA 4YFXF 4Q5SF 1HH8A 4UQXA 4IXAA 1MDMB 4HV5A 3FHZA 2OBPA 3ML6A 4ENNA 5FZQA 5EX0A 2DU9A 5JJTA 2MHKA 1FCHA 3CLOA 3ABUA 3DV8A 3ASFA 4I02A 2JQIA 1BI1A 1TJCA 3V7CA 5BS6A 4BQAA 2BRFA 4O6JA 4UNOA 3DQVC 2GXGA 4G24A 4F3VA 3K1PA 4UQYA 4IHSA 2KB4A 1O3SA 4HW0A 3F6VA 2L4AA 3PFIA 3LQRA 4OOIA 1E2XA 2PMHA 4JK1X 2ACJA 3WE2A 1LGPA 2GIVA 4O6FA 2VE8A 4OINF 3S7JA 1G3SA 3ZP5A 4GYIA 4M6YA 2WTEA 4KN7X 1LNWA 5HVQC 4UQZA 4IRGA 4PZJA 2JTVA 3HSFA 3E5UA 3WTXC 2QM3A 2NAZA 5TRDA 3OOPA 4A1SA 1ZREA 3KP3A 2VT2A 3OXFA 1YYVA 3I6UA 1QU5A 1CF7A 2ZCWA 1B89A 2K02A 3P9IA 1ZLJA 4CXFA 4U0ZA 1KU3A 1ZYRF 2KCKA 3IKVA 2DQLA 1HSTA 2F5EA 3WTZA 2JQLA 4RG9A 1H9GA 1IAWA 2A07F 2A68F 2Z33A 3HUEA 1HW2A 1S3JA 2VBYA 3IEGA 1K79A 3TDUC 4IF4A 1QPMA 2ZXJA 3FM5A 2P5LC 1TW3A 4R79A 1LDKB 1L3LA 4KIFA 2CSWA 2OZ6A 2ZBKA 1IN5A 1FBUA 4RB3C 2JZYA 3I64A 2C0MA 3FFLA 3RPUA 2YHCA 2UWJG 2KJCA 3HTSB 4Y15A 3CO7C 4AY5A 2XT9B 3Q47B 4TV7A 2EJRA 2KJBA 2GA2A 1NA0A 2G9WA 4UVAA 2E7XA 3FMQA 3EDTB 2JPCA 3BJOA 1J4LA 3BZ6A 1UHWA 1U5TB 4HDVA 2EH0A 3V7SA 3ASDA 3UUXA 4MGRA 4HOSA 4CDGA 4G2VA 3GZ2A 2EK5A 4N3CA 2LDUA 1SFXA 1V3FA 3H3UA 1HKQA 5AONA 3GYZA 1U8RA 4GZ3A 4L0YB 2NNYA 2J5OA 4HOBA 3V8LA 2QQBA 3ASGA 5KK1A 1E96B 4CDRA 1K78A 3KZZA 5ICCA 5HDKA 3WU1B 3HSRA 3ZMSA 4LB5A 2G1LA 4MQ9F 5HDNA 2FBKA 3EUHA 4KA4A 3CKCA 1J5YA 2O6GE 2LC1A 1AWCA 3MEKA 1Q1HA 1W4MA 1ZRFA 2ESHA 5BMZA 2C6YA 1UCRA 4WF2A 2ZKZA 3I54A 2CWEA 3BWGA 1PP8F 3KAEA 1RI7A 2W57A 2ZO4A 4EJVA 5EKQD 3GZ5A 1H0MA 4ME2A 1XCBA 4CHUA 4J8FA 1Z05A 3BOQA 1STZA 4M9XA 1HZ4A 4NHJA 3MA5A 1O7FA 2OQGA 1QZ2A 2QFCA 1G3TA 1IW7F 2Z9OA 4KNYA 4M9ZA 3TGOA 2CYYA 1KT0A 4B94A 1KT1A 4RGRA 3ERED 4BHBA 4EJWA 4L9VA 3ZMVA 3CVPA 1YJ5C 5CCLA 3ROUA 1XSVA 2AFFA 4Y13A 4L18B 4KIBA 2K4JA 4EV0A 3F8NA 2KB3A 5EX3A 1J75A 4I2ZA 4ZZDA 1TNSA 2EFNA 2DPDA 1IN8A 2JT1A 5DIZA 2OD5A 2V5FA 2QYOA 5E8IA 2FQ3A 2F2EA 3KE2A 4S05A 3RO2A 3IC7A 4L5IA 1FZPB 4WCGA 3CVQA 3CVNA 3RKYA 1FBSA 1XN7A 3GFLA 4WX9A 5LRSA 1FX7A 3E6CC 5D6FA 4GGGA 5HS7A 1IF1A 2DI3A 3LAJA 3TKYA 2Q2EA 1MKMA 2Z3YA 2FNPA 5FGMA 3KP4A 3ELSA 5IT3A 1YW9A 5CVRA 1W5TA 2D1HA 4XI0A 2XAHA 1GXCA 1XDSA 4RGXA 2KRFA 4AY6A 4PGHA 4LJZF 1ZRDA 4OU0A 1HQCA 4BTBA 1BC8C 4NQ0A 2ZMEA 3F22A 2J9QA 2VGXB 2DQRA 5D5WB 3IRQA 3RI4A 3GF2A 2WC2A 5CYVA 3BP8A 3REOA 3LA2A 1DMZA 5ILSA 3MKRA 1HW5A 4HORA 1XGOA 3VTXA 5KJMA 1IN7A 3I71A 3AS5A 1JHFA 1LJ9A 2ONDA 2OA4A 5DV5A 3KLNA 2EFPA 4CO8A 1GVJA 3HIFA 4YIFA 4BXUA 4U88A 4MNUA 1YO5C 2JPEA 4LG0A 2IW5A 5E8GA 1U78A 3CUQC 5E17F 2XGMA 3RYRA 4MTDA 3R60A 3CO6C 4QWQA 4XBFA 3VA1A 1T0FA 2DAOA 3U1DA 1XCVA 1OPCA 4L9TA 4XLNF 1S7OA 1FBQA 1YFHA 4BNCA 1Z6TA 4RB1A 3F72A 2KCLA 5TJJA 3J81Z 1T39A 3FX3A 5E20A 1FOKA 1S6LA 3F8CA 5FT9A 1BI0A 3U2RA 1R7JA 3GFMA 4N9IA 5F1RA 1ON2A 1SMTA 2PLYA 2VODA 4N3AA 1SFEA 2MBFA 4M74A 4W9RA 2RVCA 4BT8A 4N9HA 5CVJA 3OXLA 5A7DB 3CK7A 2XROA 4EJQA 3VODA 3UNMA 2HR3A 3TDZC 4CICA 2HDCA 2XIGA 4G8XA 2YSRA 3TQNA 2O03A 2EWNA 2R5SA 2HQNA 2Q8KA 1XNFA 2FI7A 1FPQA 3RJVA 2JSCA 4L0ZB 1YW7A 3ZMDA 1KGSA 3EYYA 3OXGA 3VOEA 4WNDA 5JHUA 3CDHA 4HF0A 4K2EA 2LNIA 4B8XA 4GYOA 3O6BB 2KC7A 2KCVA 3T8TA 3FXQA 4IVNA 3ELKA 2D1VA 3FM8A 1J59A 1CF7B 1IYGA 3FM3A 1DPUA 3CV0A 2FBIA 4MQVA 2AS5F 4A6EA 2VYIA 4J8EA 3PQKA 1TLHB 1F1ZA 1YA0A 4IN3B 1B4AA 3LA7A 2VSNA 3FP3A 4XIFA 4UI9K 3QKYA 1TQIA 3U3WA 1FC3A 3ZMTA 2VC1A 1WAO1 2QENA 5DD4A 3Q4AB 4LD5A 1JXSA 1WV3A 5L3GA 1IZ1A 3LA3A 3MZYA 3E4BA 3SZPA 4ENMA 2BE5F 1TNTA 1R21A 1SMYF 2VOPA 3E3VA 3LKUA 3HUFA 1FSEA 1W7PD 3IRRA 3J81K 5ILVA 4FT8A 4N3BA 1W3BA 4ZYGA 2NYXA 5H6QA 2XAJA 2QBYA 2LKPA 3Q49B 4JQFA 4HOQA 4I0AA 3B73A 3CVLA 3DF8A 4L9JA 4HF2A 4L9NA 1U5TC 3E6MA 1HKSA 4WWCA 5G04J 2I6HA 3RIBA 2DPUA 2JKDA 1IXSB 2R3SA 2FXAA 2X4HA 1K78B 1TW2A 3I0MA 3O2PE 5K5RA 4KYOB 3ZMZA 1QZZA 1HW1A 2XCCA 4JBAA 4EVIA 2GXBA 2DO7A 4H7YA 1R1UA 3AS4A 3KP6A 4CYDA 2EB7A 1YQAA 4BAYA 3ZHEA 5M72A 2W84A 2VONA 2Y0MA 2PI0A 4I09A 3QAHA 2XAQA 2V6CA 3H92A 3L2CA 3E6DA 2UWMA 1B6AA 2CSOA 3D0SA 3V8KA 3I5UA 4B09A 5LLQA 3WXXA 4J8DA 2PEXA 1NHAA 2NC9A 3B02A 5AIQA 1O57A 3V4GA 3DP7A 4O3MA 3AS8A 4WXHA 4KUMA 3UV0A 4YNDA 2P7CB 2GW1A 3D5LA 1ELWA 5LHIA 1LEAA 4I0BA 5H20A 3W6KB 3C3WA 2RNJA 3H3ZA 4ZZLA 3J80Z 5ICGA 2FBNA 2A3SA 5D8LB 4ESJA 3UQ3A 4G94A 4HOUA 3AAFA 2VT3A 2VGYA 3RKVA 1G6GA 4EJUA 3J7AO 4UI9J 5CVVA 2DBAA 1ODDA 1UHMA 1F5TA 1ON1A 1Z91A 2ETHA 4EGZA 3HOTA 5D0QD 1XB4A 4ETSA 5FFZA 3Q5MA 1K3JA 1EH8A 1J4PA 1O3TA 3K69A 1GXPA 2LNBA 4HX8A 4G25A 4P5OA 3P9CA 1IUYA 1FT9A 3ULQA 3RPQA 3SZTA 2X0LA 4AIHA 1F9NA 1P5QA 2UXXA 3QDNA 2EA4A 1MZKA 1ZAOA 1LQ1A 2K7LA 1Z6RA 2G7UA 3GZ6A 4I9CA 4APOA 1DP7P 1TQPA 1T6SA 2H94A 3L09A 2DLLA 2Q0OA 4GA1A 3QWWA 1ONVA 3KEQA 1J4KA 5E1WA 4ZYDA 3I59A 2RQPA 2VOOA 4U0UA 2HYFA 4S04A 2ZMEB 4GO1A 3T8RA 1WLNA 2V1UA 5JJ7A 1R36A 1BIBA 5J8CA 1WRJA 4PCQA 5A2QZ 3E5QA 1O7LA 4P55A 2L6JA 2HYZA 2BEOA 4H87A 1BI3A 3T5XA 2ELHA 5D4SA 3HOSA 5DBKA 4EGYA 1WSUA 3U4TA 3EDPA 1YJMA 3MV2B 2IA1A 4RS8A 1Z1DA 2XAGA 3GW2A 5JI6A 1ZARA 3I0NA 5LCWC 1BM9A 2HS5A 4MHGA 2D45A 4I2OA 1XGNA 3V8JA 4GXOA 1PUEE 2OOEA 5A8IA 4LG0B 2XAFA 2H09A 2YQ8A 5D0OD 2DFIA 4OMYA 3BJ6A 1IHGA 2FBHA 4MEXF 3MV3B 3S7FA 4HF1A 2GA1A 2PMUA 4GA2A 3RKWA 3CJNA 1Z7UA 3J80K 5DCMB 3CUQA 1R23A 3I6WA 1UHTA 1MGTA 3LQQA 3UMZA 1QZYA 2WQHA 3PDNA 3N97A 2IP2A 1KLXA 4ASNA 1XMAA 5AYWD 2CG4A 4JL0A 2H6CA 2ZNYA 1SD4A 2M45A 5D5UB 3DEUA 4A5NA 4GZ6A 2IT0A 3WG9A 3KT9A 1FLIA 3K1MA 3QWVA 1WQ2A 3GXOA 4RGSA 4XRFA 4ON0A 4IRIA 1YS6A 2NNNA 2FU4A 1MZBA 5BNWA 1J4QA 4AM9A 2VSYA 4AIKA 3UOTA 2P6SA 4UV8A 3SFZA 3TOAA 2QQAA 3KEOA 2XKOA 3F6OA 1CGPA 4ZYHA 3Q9VA 3FMSA 4HX4A 5DCFA 1IXRC 1G6NA 3UN0A
chains in the Genus database with same CATH superfamily
3V30A 3IHUA 3TL4X 3OYJA 2BKGA 3H36A 3Q78A 4AIFA 4DZJA 2ETBA 4LUNU 3HB9A 4LSZE 5A2QK 2IJLA 3CK9A 2Y69H 4XSZF 1JTYA 2ISZA 1KQ0A 1BPOA 1WFXA 3H1CA 2VE9A 3OV8A 4ZTFA 3RZDJ 4BERA 1T98A 4W97A 4CCKA 3CGHA 4A3MJ 5J6XA 3GYHX 2IU1A 3LYAA 4GZCA 5CMYA 2ZIRA 5M5XJ 2Z99A 4BGDA 3SO8A 3AG2E 3AL0C 4O60A 2LTPA 1JJ6C 5CRUA 2HTSA 3HYIA 4KT6A 1FTTA 1A5EA 3I58A 2UY1A 2YPRA 2VBXA 3C3QA 5LRRA 1JUPA 1HXDA 4DNCA 3LAPA 1RC9A 2LO6A 3SQNA 3M3YJ 3ZYQA 4AXHA 2R7WA 3HRAA 3RU0A 4ILIA 3QU3A 3W9FA 2DT5A 1PY1A 2ZJ2A 1C0WA 3QPHA 4JHRA 4BJTA 4ITVA 4RAYA 5BPDA 1OKRA 3FIWA 1HFAA 3ESLA 4N4OB 3QPTA 3J5QB 3BCAA 5A6CA 4HDUA 3HOZJ 1WM5A 1O1RA 1KYWA 1JI8A 4A55A 4J19A 9ANTA 1HXIA 3UM0A 1O1SA 1FVHA 1OWMA 1SZAA 3O8GA 3D9PA 1UG0A 2PBIA 3G2UA 2ZXWH 2EZHA 4IL6C 2L0IA 1YG2A 3K4KA 3WTWC 2DT6A 1TJFA 2XENA 2XVCA 4CRWA 5JEMA 2E1NA 3TAXA 4B43A 1R49A 4K03A 4N39A 1TWCJ 1SVOA 2WMNA 3CCEI 1H8AC 2CUZA 1OISA 4HV6A 1SC7A 3TGNA 1JCQA 3WU0A 3DPTA 3QP5A 2CW8A 2F5CA 2MC4A 2MW8A 2CV1A 1SUWA 4D9VA 3DWLG 4KBQA 4FHTA 2MOWA 1J2XA 4I98B 1X1DA 1TYQG 3Q73A 1V54H 4PJ0C 2VQ2A 4G8KA 3KYCB 2FA5A 3I4MJ 2XHKA 4ESFA 5FFXA 2IA2A 5LHHA 4A3IJ 2XPZA 4WAFA 2YR2A 2XC7A 2XEVA 1MIJA 3QPSA 3IHYA 1U9OA 3DTEA 3BPXA 1ZELA 3CJRB 4XOPA 4ZJZA 1V4RA 3OOUA 5FTPA 4HLXA 2BUGA 5LCWJ 2X1CA 2QBYB 3NBNB 2DMTA 1E8YA 1OUVA 4LRZA 1IJWC 2HGCA 3H9QA 3QWPA 3RCOA 4ABNA 4JVSA 2LH9A 3VEPA 1ZHFA 4N2QA 2KZVA 4XQFA 2JLBA 3MD2A 5GTHC 5FLXZ 3NRVA 3M8JA 1Z3XA 4AWXB 3FUJA 4U04A 2A61A 4CCMA 3JXIA 5FQ6A 4HBLA 3MKLA 5HKPA 3I53A 2H6HA 2P7VB 1YX5A 3JTGA 2KL4A 1LVAA 3L9FA 1H89C 4FHJA 5DTDA 1HC8A 1R5ID 1UMQA 3V8PA 1QQEA 1W7PA 3CCMI 1Y8QB 3WTUC 3HIZA 2WAQN 3O3KA 1I5ZA 5HS9A 4EM0B 3T8MA 4B3AA 2PM6A 1X3WB 2AXUA 5AQAA 1IXCA 5ENOD 1R58A 2M0CA 4BEHA 5EG0A 4I6ZA 2XHEA 1ZU2A 2G0EA 3R4KA 3W6JB 4HRLA 2V9KA 5FKOA 2A6EF 4XSXF 3SHFA 2EQXA 4D0PA 1Y8MA 3P2BA 4GYYA 4AYBA 3TO9A 3PEVB 4UVCA 2DTZA 1U0JA 3LY8A 4XX5A 2VLAA 2R5ZB 1PC2A 4B8CB 4GZ5A 1NL4A 5H6RA 2M8GX 5GP9A 2B9SA 4I76A 4G8LA 4EZLA 4ESBA 3R0AA 1X2NA 1R22A 4Q4ZF 2WXFA 3B7RL 1X19A 3KP7A 4O6FA 3ZN3A 2LBFB 4IQ4A 1J09A 2L9RA 1OCTC 5L3DA 1MYOA 3N71A 3EUHC 4A3BJ 2KZTB 2BW3B 5DYMA 1G3GA 2OAZA 2ECBA 3WODF 4ZYAA 5G55A 1QGPA 4KVOA 4BH9A 4F91B 2CUFA 2I2FA 2R5YB 3SF4A 3VZCA 3ZYKA 3J7AY 4JX6A 4G6DA 4OIOF 1B59A 1AOYA 2HDWA 2W7NA 3FULA 5FKMA 3SFYA 2JA7J 1A36A 3EHNA 4GTRA 2H8WA 2Z5UA 3PVLA 4K5CA 1UOHA 3PQJA 5FQ8A 3BPVA 4CCLA 1O3QA 2YNQA 4I9EA 3ZPLA 4QSHA 3WU2C 1UJKA 4AD9A 4URKA 1I6XA 3SJMA 3ERMA 2NXPA 5G05C 2ID3A 1OWPA 1B72B 2LUHA 2XGEA 2YX4A 4DGWB 3A01A 1AKHB 3M8FA 1JWFA 3Q9NC 1OCRH 2F8YA 3ZRHA 2XSJC 4I6EA 1D3YA 3CHRA 1U2WA 2HKOA 1JT0A 4RAGA 2Y0BG 1KQ8A 4Q47A 2KIMA 2LC2A 1RRJA 1N0RA 2FD5A 3N4MA 3TEDA 2JVHA 3J7YJ 4ZC3A 1Z0XA 4QPOA 1SFKA 2Y75A 3L2VA 2B6CA 2CW0F 2ILRA 2HWVA 2H1KA 5LEKA 2ZISA 3FUHA 4Y6WA 3NAUA 2E2HJ 1U8BA 4NQWA 1USSA 2XRYA 3DSWA 5FO5A 3BTCA 1HSJA 1YX3A 1YIJI 4IPAA 1YRNB 2PMZN 1J9IA 3EHRA 2MA3A 5AJLA 3L7WA 3MWMA 3DSHA 2FOKA 2JSPA 4GCNA 2JA2A 3DPLC 2ME0A 1H6OA 4AOFA 1ZKGA 4WXCA 4E85A 4A3VA 4LIUA 4QTRA 3K9TA 3L00A 4TRQA 3K7AJ 3GZSA 4OAVB 5FLVA 1OYWA 4B1RA 5FROA 1S63A 4BE1A 1SQMA 1L0OC 1J0RA 4MLPA 1QNFA 1P2FA 4AUXA 4JPSA 3H5AA 5DM6F 3DKYA 3PM1A 2HZDA 4KITB 1UG3A 3A1YA 4GCVA 3JTHA 2GAUA 2FULA 4XNFA 2JK3A 2ZNZA 2XPWA 3ZMUA 4I6JA 3DU5A 1ETXA 3KSQA 1PVEA 4Q48A 2I5UA 4FCYA 1LE8B 4E6KG 3FK6A 3B6AA 2ISYA 5IP9J 1TNYA 4EBAG 3OYAA 2LF8A 4XK4A 3ABLE 5ICFA 2DA6A 2STTA 2JUCA 4QFVA 2FE3A 2KT0A 1Z77A 1SA5A 2IA0A 3DEWA 3FWEA 3CCSI 4JD2G 4CA0A 2X6JA 4H7XA 2YX7A 2CQXA 4DQ2A 5LFAA 3WHCA 1Y0UA 1ETYA 2K9MA 3ASOH 2A5EA 3ULQB 2X38A 3UR3C 4DLOA 2R7VA 1DNPA 4I17A 3E33A 2ZSIB 4HFGA 3H0DA 4BWRA 1MJBA 3L08A 3BG7A 5JHAA 4O1OA 3VA4A 2XGSA 1BW5A 1E7VA 2X6IA 3QNKA 4I2WA 3FUFA 4MS6A 5EGOA 5T8IA 3DLLF 1IV6A 1ZB1A 2LF7A 4OIRF 1RR8C 2AVPA 2DYRE 1WJAA 5GTIC 1TNOA 1FYLA 4N5CA 1BI2A 2H6BA 5FLXK 2A5WA 1JJ8C 4A3FJ 3ABKE 1V5GA 4YDYA 4J0UA 2PJPA 2Y2ZA 1YJNI 1I1SA 2P4WA 4BJ5C 3GQSA 2B63J 1NA3A 4U7BA 3A4CA 2QZ8A 4U7DA 3ISMC 3B6CA 3K10A 3I59B 4ZTJA 2ZSHB 5M3MJ 3D1NI 3KZIC 4G7ZF 3OIOA 4ATZD 1H9TA 2NVYJ 1TC3C 1ZBPA 1Z67A 3FTYA 1KQ9A 2W3OA 3SBSA 3CP8A 1FYMA 1OWNA 1RNLA 1TT5B 3FU0A 1Z0SA 4UUVA 2VASA 4RB0A 2WB1A 2R7DA 2ZGGA 1G4DA 2EINE 5CBNA 3GVAA 2AXLA 5F6FA 2M9HA 4GTMA 3GZ1A 1JUQA 1MNEA 4Y17A 1N25A 4PS3A 3LJ3A 4UHTA 3ABME 4OYSA 1MSFC 3PUFA 4C30A 1I6HJ 2P2CP 5AN8A 3V7WA 3KFWX 3TWVA 2CQKA 1JWGA 2P9UG 1G2HA 3RAUA 3TWRA 3UKUG 3HG9A 5LGUA 2ETAA 1OYYA 1YITI 3E97A 1HBXG 1BR1A 3RKQA 2OUMA 2V1DA 3ENEA 3HX1A 1FHQA 3JCUC 3BEEA 1K1AA 4EM1A 1R4MB 1D1BA 4CDNA 5EEHA 3MQ0A 2X6WA 5LD2C 1Z5SC 4GFBA 1MBKA 2M3AA 2BVMA 2M87A 3K6GA 2BYVE 3FXOA 3TOBA 1T8IA 3D9LA 1ZGJA 3PE3A 4BT9A 4DUIA 4R1HA 2B0LA 2E60A 5LX8A 1BOAA 2M34A 2R7UA 4MTEA 1E90A 3GTGJ 2M7AA 3LSHA 2L3DA 4RLFA 4OIPF 4Z6YA 5CCMA 3UT8A 3OYKA 2IS1A 3L22A 3ZUVB 3IKTA 3CC2I 1JTXA 3PO3J 2J5PA 3FTZA 2P58C 2PIEA 3EIJA 3UTMA 3UKGA 3HOVJ 2EV5A 5BT1A 1KHXA 5BNGA 4Z68A 3TO7A 3UM2A 5ENQD 5IY5H 2RDPA 4XRSG 3OUNA 1R1TA 2MC3A 1S29A 4K5AB 4GYGA 3CHSA 3CVWA 2E7WA 1P4XA 2G7HA 2WAEA 4DX7D 1IRZA 3OYFA 1ZRCA 3NB2A 4DZPA 1Z21A 2BXYA 2WBMA 4CZZA 3U66A 3F8FA 4P9FA 1QA6A 1XMXA 1UG2A 2I1KA 1GVDA 1MNMC 3L16A 3UXGA 4RSYA 2L02A 4ABZA 4IYPA 3L2UA 1D8JA 1T0FC 5J1UA 5LEJA 3Q75A 2P9LG 2V9PA 2W85A 1EYHA 1TTYA 4PK4A 5F64A 4U8VD 5AIJA 4B3XA 5GAHJ 3WTTC 2XZTG 4HS2A 3JW4A 5T4YA 4FX4A 1TNUA 1SVMA 3CMMA 2GWRA 4WWNA 2FJ1A 3CUQB 1ZG3A 2DDAA 4JW1A 3ECHA 3DFGA 1Z9CA 4AY6A 3GMJA 3WGIA 4QLCU 1UELB 3VPYA 4UB8C 3D9HA 4BXFA 3F9KA 4ZH4F 2X1DA 3L82A 2FMLA 4JX4A 4A12A 2HO1A 1MMGA 1BC7C 1ELRA 3GX4X 4BKXA 2M30A 2VBWA 3GWZA 5HOOA 1K3NA 1X58A 4C2TA 1U6GA 5DEQA 4WK8F 2JGRA 2RKHA 4HSRA 1IDYA 2LG4A 1JT6A 2CRGA 4A0EA 2RG8A 4Z2YA 5B1AH 2FRHA 3FISA 2QKMB 2BBYA 4XLFA 3PNYA 1MMAA 5EEGA 2HOAA 4AP2A 3C72A 1R5HA 1EV7A 5DHSA 3R6SA 4M7CA 1JKPC 4HAMA 2OTLI 4B48A 2J08A 5ITZF 4HQDA 3FXUA 3NOCD 4WXDA 5HI7A 4ANVA 4B8AA 1IRGA 2GIZA 4BE2A 1S8NA 3DSXA 1WWXA 3S2WA 4ZHBA 5L3BA 2JPBA 2Y69E 2HR2A 2HFHA 3A02A 2CUJA 4JEHA 3H0GJ 1ZLKA 3LFUA 4L5JA 3BTJA 1FPPA 3AG3H 4EBAA 1MH3A 1XSXA 1SFUA 4NRHB 2HQRA 1Y1VJ 3ZXSA 2HOEA 5J1RA 4BX8A 3K2AA 4FISA 5DUKA 2EZIA 2WAQA 3HBLA 4ENKA 2P8TA 3GTLJ 2J07A 1K2MA 4YVOA 3LY9A 3FTVA 2ZGDA 1S7AA 1FNNA 2E19A 4I1MA 4EZJA 1NFIE 4F3QA 2H1LA 4CYCA 5HQ8A 1U7VB 1X4PA 2MD5A 2VJ8A 1IC8A 4JHKA 1S0PA 2QWWA 2XF5A 4M73A 1XGMA 3VSKA 4R8HA 3SFIA 5GAGJ 3F0CA 5GADJ 3FF5A 3OYBA 2DBBA 1D5YA 1IN4A 3BR5A 5KVRA 4EJOA 4OVVA 5ARFA 1SVLA 5J08A 5AQBA 2Y30A 1MX4A 1N9AA 4II3A 5E1XA 2R92J 4YELA 3KZYA 1N4PA 3ECOA 3KS2A 5K5QA 4FX0A 5CEDB 2M63A 1SD6A 3MFKA 5CVIA 4E7KA 4M3DA 3TXNA 2DA4A 1T56A 5B66C 5JMND 2EIJH 2ZXWE 1K83J 5KJLA 4KT6B 2HXOA 2UY1B 4FA6A 5CVUA 4HLEA 3H35A 4U63A 1W5SA 1LDJA 2EILH 3GUDA 3EYIA 1XGWA 5B3SH 4UWHA 1B9MA 1NK3P 3M8EA 3R0JA 3HKZN 1G8XA 3M1EA 3W6VA 3M7GA 3Q7FA 4JIVD 2TCTA 1UFMA 1I1GA 3EUKL 4I7HA 5HRYA 1V54E 3IL2A 4LLNA 4B47A 3BZKA 4U0VA 3R61A 2JJ7A 4C0EA 5E50A 2Q2EB 2NXNB 2V6EA 2QKLB 2DMPA 1UN9A 2XGDA 2L9NA 3TJPA 2KIUA 2LSUA 2QQ9A 2W24A 3ZNGA 3JSOA 2NYJA 1JUSA 3FBIB 3C5RA 3D9IA 3ZEFA 4DI4A 1BL0A 1HX8A 5KJKA 5K5OA 4Y52J 4A5MA 1SAXA 3QP6A 2JQ7A 3U21A 2QUFA 3VFZA 4P9UA 5D6EA 1DUXC 2BKKB 4BY7J 1YYHA 3GEZA 2V79A 2HTJA 3KYLA 5EEAA 3TG4A 3TP3A 4ENJA 3NEUA 5K7FA 1N4SA 4U0SA 4M3EA 3X2QE 2IGMA 3MEXA 3MDBA 5KCMA 1A35A 1G3NB 4O1PA 5BQTA 4XIDA 2EFWA 4FHKA 2UXNA 1REPC 1OY3D 2NVTJ 4YDEA 3CDLA 1D1CA 4DIQA 4U0YA 4RG6A 1V5EA 4LNUD 3V8QA 4HA8A 5DD8A 4M72A 3L6AA 1LB2A 4E6HA 3PEUB 1NZNA 2DCEA 2NOJB 4NC7A 2QVLA 1FOWA 2DWZA 1Z0UA 3K4JA 3HOYJ 3GLLA 5B1BH 2VKEA 3KLOA 5IYDJ 1MJAA 4R9PA 3HSEA 4UV9A 3TMOA 1WI9A 3AFHA 1QQIA 4W1UA 4AVPA 2F5FA 2ZC2A 4RM3A 2DA7A 3PL8A 4G26A 3JR9A 3V7UA 1I39A 2EA2A 2OPTA 2HKXA 2XGXA 3CQGB 3QOUA 2DA1A 1FYKA 1FP1D 2VBZA 3B7UX 3S7DA 2E1MB 2JWTA 2FSWA 2EIMH 3CD6I 1QRYA 2PQRA 3RO3A 3IBEA 1JUMA 5HLTA 2XEEA 2M2EA 4P29A 3RRUA 2R0QC 4RAZA 5ARGA 4KYWA 4RAFA 1UB9A 2R7SA 3LXUX 2VQGA 1W7PB 5KNHD 1IO2A 2A6HF 3ZYLA 5FRNA 1QO0D 2NS8A 2NSZA 4N0BA 1KU7A 2GM4A 1OCZH 3FTUA 3UI2A 4BEHB 1WKMA 1WH5A 2LKSA 5EG0B 2X6HA 3CHQA 4KZCA 3MKZA 4BEPA 4MBGA 1ETQA 1MJ9A 2HZTA 4XKBA 4LEUA 3HRSA 5ERIA 1PUFA 3L13A 1TBXA 3HTUA 2X48A 1J7KA 2BGCA 4A3KJ 3ULYA 1UJXA 1D8EA 1Y0NA 1R4NB 4PSWA 3UNNA 3CHOA 3IWZA 4BHPA 3LEWA 3C18A 4XI9A 2I2BA 2K85A 1BN5A 5DDGA 1VQNI 1G3WA 2GZWA 3LSGA 1IV8A 1E3HA 1OCRE 3FTXA 3BROA 3NF1A 3CJTB 6PAXA 2IOLA 2XGOA 1RZ4A 1T2KA 4ILHB 5EIDA 1OR7A 2EZLA 1SVXA 2R7FA 5KNLA 4ATGA 2DK8A 2BZTA 4C3HJ 1MJSA 1QNTA 2K5CA 1HG2A 3LCAA 5EZHA 4EEFG 3RK6A 1U3CA 3EHQA 1VQ6I 3QU6A 2P9NG 2D2WA 4NBQA 2PZIA 2I10A 4RBOA 5FKKA 3HVEA 4CZ2D 5BUZA 1WI3A 4A3LJ 3IH3A 1YTYA 2ZJRF 3OYLA 2OTJI 1SD5A 4BYYA 1VQOI 3BDDA 5E18F 2NRAC 2W25A 4GTPA 4XN3A 4PH4B 1ENHA 1WJFA 5FD5A 2DJIA 1TQMA 2K86A 2CFXA 3A01B 1O4XA 2PL2A 4HEA2 1LEBA 2L54A 2MD0A 4E7IA 3APDA 5A23A 3BY6A 3VDXA 2KHMA 3HHGA 2BTDA 3FU6A 3PRZA 3T5PA 2JRTA 3ZN1A 2O3FA 2QVOA 3IUOA 3EJNA 2M5WA 2O0YA 1H19A 4A6DA 3HHHA 3WGGA 4JZYA 4IHWA 2JA5J 1DPRA 3VWBA 2DK5A 3OWTA 5L3FA 4G7OF 2MH2A 3ABTA 2M7BA 1DDNA 1Z7LA 1YT5A 3DITA 3SXYA 5FB2A 2XPVA 1OMIA 3UKRG 1MX6A 4CT0A 2L4MA 4IJAA 1RR7A 4NQWB 1MJ0A 2RC4A 3C2BA 1Z3YA 2A5YB 2FNAA 4JYKA 1VTNC 3E37A 2AWIA 3FEXA 4QIWN 2MABA 3MCZA 1OCCH 3F6QA 2IVMA 3G1MA 2O8KA 2EH3A 5IPAA 2PN6A 3ASOE 3GFJA 1D0ZA 1EH6A 3CKBA 5HLGA 4UXNA 2AJAA 3S7BA 3HRUA 2ESNA 5ICEA 3COAC 1JGSA 2RN7A 4RGUA 1MDMA 2IEJA 3E5XA 3NQPA 3GFIA 2YS9A 2GQQA 3POAA 4U0WA 3G73A 2CH0A 2MFZA 4F1SA 3S7JA 5D8KB 3RDIA 3D9OA 2XKPA 3ZVVA 3DXKG 4Y6CA 3H5NA 2WXMA 2H6FA 3SYTA 5LHGA 3GCMA 2KM4A 5EILA 2J09A 2IQCA 1ZG1A 1K4TA 3E34A 4IRHA 2VTBA 4I1AA 4UVBA 3WE3A 1R71A 4UWLA 2H6GA 4LG6A 4M3FA 2ZJQF 4AIJA 2KATA 1KONA 2FEZA 3E7LA 4GPKA 1VQ9I 2P9SG 3CF2A 4RLQA 4HOTA 5C3EJ 2JABA 4EECA 4ZYEA 3HRMA 4NB5A 3SNXA 5BPIA 3I0TA 4IO9F 4I01A 1HO8A 1KA8A 1HU3A 4EQFA 4UY8I 3LPZA 3TG5A 1K4SA 3C7JA 2OQRA 3GO5A 3PE4A 3RKXA 4KIGA 4GA0A 1F4KA 4J8SA 2FMYA 4TXPA 5EGOB 1JE8A 3L17A 1LDDA 2DTRA 2X9DA 1TNZA 3SDBA 1TNBA 5HLIA 4KU0D 3QPLA 3ZQ7A 3TW7A 3VB2A 1HLVA 2WPVA 3MZHA 4KMFA 3S1NJ 3Q79A 1LFPA 4HNAD 3D9NA 3VLEA 4YFKF 4N2SA 2K4BA 4HQMA 4J00A 2CO5A 1BW6A 5JHFA 3TO6A 3S1RJ 3OY9A 2OC6A 5LGTA 1USTA 2LVSA 5FKLA 2CFOA 2P5VA 4RDUA 1JCRA 1H2TC 1FT2A 1BBYA 3I4PA 2OZUA 3S2AA 3HDXA 4CT4A 1NK2P 2ECCA 2KKOA 2LY9A 3ONQA 3S3NA 4KXKB 4U8YD 3EQLF 4HX7A 5L3EA 3DEOA 5CHEE 2Y48A 3EPZA 3OSGA 3T8KA 3PIOF 5L3CA 4DLQA 3V8NA 2MSYA 4WNGA 4HPQA 4YFNF 4YG2F 4BY6A 4LCTA 2F6CA 3URZA 5C1DA 4CGWA 5J3LA 3Q0VA 2ZFWA 4PUSA 5JFRA 1RIOH 3TP0A 2WXOA 1LKXA 3K4LA 1UAAA 4IQJA 1HDDC 5M3FJ 1AP7A 4JONA 3UMVA 1N94A 4J01A 4LGWA 3DXMG 2FF4A 2LSOA 1XSDA 4YEJA 3BTLA 3FZVA 5IY5E 2L7FP 2W82A 2LY2A 4U07A 3RPUD 4L2YA 1YIOA 1A17A 1ZG5A 2JVGA 3KEYA 5B5EC 3WTVC 2V9VA 3APCA 2CUEA 5BOXA 4PDKA 1BI8B 2XV4S 3DXJF 2BONA 2LFBA 3RIRA 5ENSD 2CQ7A 2J49A 1MH4A 3SI5A 1HDPA 3IWFA 4PGGA 3CCRI 4Y3OA 1FSHA 4EGXA 4LMYA 4M6XA 4RVBA 5ENRD 2A0TA 5HS0A 4TV3A 3JAMZ 5JR3A 3CCYA 3FUKA 3KETA 3LVRE 3GBGA 3L54A 2YHEA 1DCQA 4KN4X 3RTRA 2OCCH 3OYIA 2V4JC 2K40A 4HRIA 2YU9J 5EJCA 2V0PA 3LS8A 5FZSA 4D5CA 4FADA 2VJ4A 2UV1A 2XPUA 5JJ6A 3FWVA 3S2DJ 2KIFA 1WVRA 1V55H 3ESKA 1P4WA 1FMVA 4WNFA 4M9SA 5EYRA 3DBHB 3CCLI 1I27A 1YLFA 4JA7A 3PO8A 3K4NA 2I1WA 5IT9Z 3BUAA 3JYSA 2WXJA 1MR1A 1YS7A 1OYIA 4BQOA 3JSPA 1AHDP 1PDNC 3GW4A 3QJZA 5HNFA 2R7OA 5B1AE 1X3UA 1U7FA 3UM3A 1MBJA 2WY7Q 3CZ6A 4M6VA 2QC9A 3T0YA 4BY1J 2IPQX 3LWFA 4HRMB 1R00A 2EZKA 3MKYB 3JRCA 4UWGA 4UUTA 2XUBA 3CLJA 1U5TA 3ASHA 3DSUA 1GUUA 4C2UA 3ZCOA 3CJQB 2WV0A 3E6BA 3S1MJ 4EM2A 2L0KA 4CGVA 4G9YA 1VQ7I 2ADUA 1P7IA 3ZHEB 4JP0A 3F21A 3BJAA 2KISA 3RYPA 5J8FA 2RGVA 1WHUA 1A6IA 2L01A 3A03A 5DUIA 3AG3E 5CERB 2JQJA 1KU2A 1SD7A 5G04C 2I9CA 3IHVA 5ENTD 4A69C 4OIQF 5BW8C 1EKEA 2P6TA 4LK1F 4M71A 4MO7A 1MD0A 1YW8A 3GTQJ 1ELKA 4G1TA 2KFUA 1BIAA 2GXAA 1VI0A 2HNHA 2ELJA 5K7HA 4IHTA 1LFUP 2WXPA 3K1NA 3SD5A 1GV5A 3FY4A 4J8YA 2DOEA 1W0UA 1D5VA 1WCMJ 3HRTA 1D8DA 5IYCJ 4WWPA 1O5MA 2CHXA 3HGGA 2XDVA 1XD7A 4AC0A 4ILGA 1R1VA 3U9WA 4EMSA 5D5XB 1IGNA 2VSOE 2E35A 1G3YA 5ILUA 2NS0A 5KAIC 2MH9A 3OL4A 4PSXA 4XLPF 1QYMA 3P9KA 5DCMA 2RV8A 2L7ZA 3LFKA 3M9AA 3HYMB 3BG6A 4HQEA 1ZGAA 2F5VA 3RJPA 3QRFF 2FO7A 4E7JA 2IRFG 2BY2A 2LKXA 5AENA 5G2NA 4UUSA 1BJAA 4PFOA 4YVQC 4LLLA 5E3LA 3W2WA 3BG9A 2E2EA 2EIJE 1P6RA 3KPHA 3PIPF 1X1BA 1OWLA 4EJTA 4L1BA 3KP5A 3JRGA 4FASD 2KKLA 2EILE 3H3VK 5B3SE 3V7RA 5JVTA 2LYCA 2HDDA 1LTXA 1XMKA 1FP2A 2M8EA 4QPQA 2AXTC 1QVUA 3KEAA 1YE9A 3G3ZA 1HS6A 4JB8P 1DQUA 3WGHA 2K27A 4BJ6C 4KMOA 4FC8A 1K6OA 4LK0F 5C4VA 1IRFA 4KDPA 3P1UA 1K7AA 1OJLA 2X51A 4HSTA 4H0EA 4PFPA 3KP2A 4O5VA 5T3RA 2ZXIA 3QOPA 3G71I 4KFCA 3PO2J 3CK8A 3Q9SA 4TUMA 3P5JA 1IN6A 4N4NB 5KNGA 1UW4B 1XC5A 3LVQE 4GMJA 5FD6A 3F23A 2VQLA 3FXRA 3BG5A 1D8KA 4LLGF 2FO1E 5AIPA 1VNDA 4Q69A 1FHRA 2LAIA 3V8MA 2EFOA 2BHZA 4B0ZA 2EV0A 3ASNH 4XORA 5FKNA 4HZFA 2HYGD 1JHHA 1S64A 2L9BA 3CUOA 1ZN2A 4G12A 5F08A 1T38A 3Q0WA 2CG3A 3HUGA 4ANUA 3T1BA 3ISPA 1FY7A 4DW6A 1VQ5I 3JAMK 2VSXE 3PZ1A 1F36A 4HNUA 2V7FA 3MAJA 3CHPA 4DRXE 3C1DA 2XRNA 3DWLE 4QCJA 3KCCA 2XZDG 3QARA 3BT9A 2FQ4A 3O48A 4UI9C 2Y0SN 1JGGA 3C98A 3F8BA 3AL0B 2Y4UA 2GRNB 3PREA 5CMWA 2K9QA 5GPCA 2F5DA 4M3BA 2VGEA 4A1GA 4HLYA 2XCBA 5B1BE 1UJ8A 2RNGA 2DFFA 2X6OA 3LMMA 5HS8A 2O61A 2Q5FA 5EDSA 3UPVA 2C0LA 4GZDA 1KZPA 3TL5A 1G6NA 3VYSB 4DY6A 2AO9A 4KT5C 4YIIA 4HXIA 4A3JJ 5IT9K 3CDIA 2UZKA 1K61A 2STWA 5DHPA 1XGSA 2A69F 2XPIA 3BR0A 4FQGA 1HKTA 2VKDA 2EIME 2FOWA 4EQQA 2VUMJ 4OAYA 2CGPA 2ZMEC 1RESA 4XKCA 3T5VA 4CDMA 1MMSA 3GTMJ 1FT1A 1P4AA 3NARA 4RB2C 2WWYA 3GTKJ 3KD7A 1OCZE 1O3RA 5ED4A 3F3XA 2VKHA 1U3EM 1X1CA 2PQNA 2VJJA 4XLHA 3E0JB 2L5QA 3K2ZA 4LB6B 4BS9A 1TWHJ 3AKZA 4M3GA 1XS9A 1B1BA 2QLZA 3KYDB 2KIQA 2R7QA 3BTIA 2P5KA 4A0XA 5EZGA 1FWZA 3ZGQA 4F7ZA 1N4QA 5FZRA 1FTZA 2VL8A 2VIXA 3OYGA 3IH2A 1H0AA 3ONLA 1GDTA 1RPWA 1R5GA 1ZH5A 2COMA 2L0TB 3VSLA 2VXZA 1FIPA 3CTAA 1D0XA 3K0LA 5HDGA 1BOBA 3SQVA 3AG4H 4A0ZA 4DYQA 3EETA 3CC7I 3L2RA 1GXQA 3ZPJA 2LD5A 1RUOA 3UM1A 2O8XA 4U96D 4WUYA 1N4RA 1A04A 3OS1A 2VGXA 4CGZA 2WXHA 3MZLB 2HI3A 5K1YA 2IY0C 2LSVA 4U95D 2P9KG 4HB5A 4MEYF 1TZLA 2LR8A 4G7HF 1I3QJ 2A4ZA 2IOSA 3ZFWA 1HF0A 2I8DA 2DW4A 4I6GA 3FK7A 1PUFB 2K3PA 3F8MA 1RUNA 3TXMA 2COBA 2HPIA 2XASA 3NQOA 5HLHA 4D10C 1ZK8A 1LF8A 3OR1C 4OMZA 2M1BA 1WG0A 2XRZA 3DTIA 2PQ8A 1DGRM 3K9IA 3GLXA 3A77A 3W2AA 1IHBA 1SFOJ 1GT0C 3ELVA 3OIQA 4KMUX 5D5VB 3AAAC 1P92A 2PG4A 1KU9A 1OCOH 4P96A 4A2UA 4A0YA 5IP6A 1AA7A 3JRAA 3CEQA 3LY7A 2IF4A 4MKTA 2YU3A 3SY2A 1LGQA 3PUKA 2GRMA 1K3QA 2EFQA 1QBJA 2CHZA 1ULYA 1TWGJ 2KLOA 3ZQQA 3DEEA 4FLHA 1MQSA 3G1LA 5LGNA 4KICA 3CCJI 4BDZA 5CLSA 4ZDOA 2Y4TA 3NOGD 3DPUA 4ZDLA 2V1XA 3CESA 1YGSA 5E1ZB 2R7TA 1B9NA 3R9AB 1E17A 4PJNA 1LD8A 4G6QA 2VN2A 1WH7A 3IAS2 3S14J 2IJGX 3LSTA 4LFUA 2JEKA 3SZ7A 4HYEA 1OFCX 3WTYC 2X6FA 1XDUA 3HVEB 2OU2A 3FXJA 2RAEA 4E70A 3DCFA 3I4RB 2Q7FA 2L9SA 5FJ8J 1DU0A 1H88C 1BJZA 3H9JA 1KYZA 2PJRA 2TDXA 2CFZA 2HE0A 2E36A 5D4RA 1OCCE 3KEZA 3Q15A 3HXCA 3GTPJ 1W1WE 2MLKA 3PZ2A 1VQ4I 1G88A 4GYWA 1EH7A 5G05J 3WTSC 2KRHA 3VTYA 5CJ9A 4BHCA 5E76A 1YHQI 4NIKA 3R7QA 5DJOA 1J4OA 4BQQA 4JA9A 4TXRA 2KZGA 4G23A 3DKWA 5LBQA 2PFBA 2R03A 3U9GA 2C2LA 2HEOA 2OF7A 2E1CA 4CEMA 1K2NA 3ZQLA 4BTAA 3Q5FA 2EV6A 3CVUA 5J4YA 5TGTA 5J4VA 3BQYA 4GCOA 3HJEA 2BF0X 1PP7U 1NP7A 2IXSA 2MLGA 2IS6A 2H27A 5FJYA 4I43A 1ZTRA 2IGKA 3ZN0A 4GRIA 2VC0A 2IFUA 3P7NA 2EQRA 3FMRA 4L23A 1GHCA 3SDGA 2F0YA 4XE0A 4YFXF 4Q5SF 3M07A 1HH8A 2DVWA 2WMOA 5LOZA 3V8RA 4UQXA 4IXAA 1MDMB 4HV5A 3FHZA 2XS8A 2OBPA 1UJJA 3ML6A 3KIOA 1OLTA 4L2LA 4ENNA 5FZQA 3WHBA 5EX0A 5HODA 1UHSA 2DU9A 2QSFX 5JJTA 3ZYMA 3CMAI 2MHKA 1FCHA 1VDYA 3MGBA 4FETA 3CLOA 1AKHA 2WXGA 5EN5D 3ABUA 3DV8A 3ASFA 1MBGA 2W00A 3JRDA 4I02A 2JQIA 1BI1A 1TJCA 2BY1A 4CCNA 4GTQA 3ZQGA 2VTBB 3GZNB 3SZGA 3V7CA 1VQLI 5BS6A 2E0IA 4KVMA 2LXLA 4BQAA 1WZ2A 1NG6A 2AN1A 2BRFA 4O6JA 4UNOA 3DQVC 2GXGA 4G24A 3OYMA 1ERDA 4HI9A 4F3VA 5C44J 3RSNA 1S70B 3K1PA 4UQYA 2KDOA 4HAOA 2WXKA 2E34A 3GTOJ 4IHSA 2DIWA 2MYOA 3JCKC 1EJ9A 2KB4A 4JEUA 1O3SA 4HW0A 3F6VA 1QPIA 2L4AA 4CYMD 3PFIA 4BBRJ 3BR6A 3VPRA 3IH4A 3LQRA 4OOIA 3J7ZI 1OXJA 3HOXJ 3O4ZA 3CCUI 5CEAA 1E2XA 1D1AA 3RQIA 2PMHA 4JK1X 2ACJA 3WE2A 1LGPA 5M5WJ 5BV1A 2JN6A 2GIVA 2DA3A 2VE8A 3IAM2 2WY8Q 4OINF 4A3GJ 2A05A 1MSEC 1G3SA 1POGA 3ZP5A 4GYIA 4M6YA 2WTEA 4KN7X 1LNWA 1DCEA 5HVQC 4UQZA 2WVIA 4IRGA 5F1JA 4FU3A 4PZJA 2VPRA 2LP0A 4RM2A 3U1KA 3MVPA 5JELA 1FEXA 1RKTA 2JTVA 3HSFA 4RLYA 4AM3A 3E5UA 2MYSA 1Y39A 2HPMA 5EYLA 3WTXC 2QM3A 2VXDA 2NAZA 4XKWA 5TRDA 5F0CA 4LIVA 3OOPA 3SFXA 4A1SA 1ZREA 3KP3A 1WGXA 2RD0A 4LERA 2OVBA 2O9LA 2VT2A 2IGOA 2DA2A 1XTAA 1GW6A 3OXFA 3N05A 1YYVA 4S0HB 3MX3A 3I6UA 3LOCA 1QU5A 5HNHA 2XEHA 1RETA 3D9KA 5E3OA 2ZCWA 1CF7A 1B89A 4IEJA 2K02A 3P9IA 4PS7A 4G6TB 4HNTA 2PMZA 3BLYA 4HLLA 1ZLJA 2K9LA 4KJZA 3LL7A 4CXFA 2OEWA 1VFCA 2OCCE 3B95A 4U0ZA 1KU3A 4V24A 2R05A 1EDUA 1ZYRF 4BSXA 2KCKA 1J2FA 3IKVA 2DQLA 1HSTA 4A3CJ 3AJIA 3DEPA 2F5EA 3WTZA 5EDNA 4UWKA 1A31A 4RG9A 2JQLA 1H9GA 1V55E 1IAWA 2A07F 4JXTA 3U64A 3RRMB 2A68F 2Z33A 3FH8A 3UIOC 4F52A 4XRSA 3FTSA 2LMDA 1HW2A 3HUEA 1JKQC 1S3JA 2VBYA 3DSSA 3IEGA 1K79A 3FH5A 3TDUC 4C9YA 4IF4A 1QPMA 1IQUA 1PJRA 2ZXJA 3FM5A 2QEXI 2YUSA 4MLOA 3S32A 2P5LC 1TW3A 4IX7A 4A93J 4R79A 4DPRA 1LDKB 1L3LA 4KIFA 2CSWA 4L02A 2OZ6A 3LSPA 3CHMA 2ZBKA 1IN5A 1FBUA 4RB3C 2JZYA 3I64A 4IOAF 5J90A 1TN6A 2C0MA 3FFLA 1TWFJ 3RPUA 1KZOA 2YHCA 4E7LA 1ORKA 1K8KG 4CCOA 1EF1C 5E3NA 2UWJG 2KJCA 2X1EA 4Y15A 3HTSB 3W9GA 3CO7C 2NS7A 4AY5A 2DXIA 3G2TA 5CRVA 4X1EA 2XT9B 2HVQA 2F37A 2K9NA 1QHHD 4TV7A 3Q47B 1N95A 2ELKA 2EJRA 2KJBA 4A4YA 1QWTA 3BCBA 1U7FB 2GA2A 1NA0A 2G9WA 3FDHA 4UVAA 3ZXPA 1DD1A 2E7XA 1H2UA 3FMQA 3ZOBA 3ZW3A 3EDTB 5GAEJ 2JPCA 1WJEA 3BJOA 3DKXA 3BZ6A 1J4LA 3VZDA 1N0QA 1UHWA 1U5TB 3RSEG 4HDVA 2EH0A 5DM7F 1ETWA 3R9MA 3OMYA 3V7SA 3ASDA 3UUXA 4MGRA 4HOSA 3ZR8X 3I4GA 3CVVA 3DTKA 1SEUA 3HGYA 2HU9A 4CDGA 4G2VA 3GZ2A 1U0TA 2EK5A 2QSHX 4BX9A 5BXUA 5CPRB 1EA3A 2LDUA 5J40A 1I50J 1TL8A 4N3CA 3D3MA 1SFXA 1V3FA 2DYSH 3G2BA 3H3UA 3JUIA 2ZFUA 1HKQA 5AONA 4ZDPA 3FUEA 3HOWJ 2RKKA 3GYZA 4XN0A 1U8RA 4GZ3A 4YDOA 4L0YB 4NDLA 2NNYA 2J5OA 1JCSA 1W36C 3DSVA 3L9TA 4HOBA 3ZU7B 3V8LA 2XAUA 2QQBA 3QOEA 3HEFA 2IO2C 3ASGA 5KK1A 1E96B 4CDRA 2V4LA 1K78A 3KZZA 2L7MP 4MIMA 1XG1A 3CVYA 5ICCA 3FUDA 3OR2C 3EUVA 2NVQJ 5HDKA 5E3MA 3WU1B 3HSRA 3ZMSA 2HXIA 4C3JJ 4E7ZA 1VQ8I 4LB5A 2G1LA 4MQ9F 1Y8RB 5HDNA 1YMPA 4DYRA 2FBKA 4UB6C 3EUHA 5F0HA 4XRMA 1J5YA 4KA4A 3CKCA 2O6GE 3CQCB 2LC1A 1WDYA 3JRBA 2IBDA 1AWCA 1Q1HA 1W4MA 3MEKA 1ZRFA 2ESHA 3HL2A 4UUSB 5BMZA 2LK2A 4DX5D 4NC6A 4BL0B 1UCRA 2C6YA 1IXVA 4WF2A 2ZKZA 1NH3A 2Y31A 5AARA 1LFBA 3I54A 3EIQC 4WRRA 2GRPB 4GB9A 3L2QA 2LAHA 3V31A 4H4KC 1X5BA 4M3OA 2CV2A 2CWEA 2GLOA 3BWGA 1PP8F 3KAEA 4NACA 3S40A 1RI7A 2W57A 2ZO4A 5DS9A 2R7XA 1T33A 4EJVA 5EKQD 3Q3SA 1QU3A 2Y3AA 3GZ5A 1H0MA 5GPAA 3ASNE 1U2VG 4ME2A 1XCBA 4CHUA 1T95A 4J8FA 1Z05A 3BOQA 1STZA 3WG7H 2XQ0A 3DPYA 4M9XA 3I55I 1HZ4A 5IP7J 4NHJA 1QZEA 3MA5A 2XXSA 4ANJA 1O7FA 3FDYA 4KISA 2OQGA 2M0MA 1X81A 3ML9A 4FE4A 5F27A 3NWTA 2QGUA 1QZ2A 3G6EI 2V26A 4XKVA 2QFCA 1G3TA 2WB1N 3H9GA 3LSKA 3M1CA 2CQQA 1IW7F 2Z9OA 2X6KA 4DOZA 3K70C 1K6YA 1VQKI 2HQ5A 4P1WA 3MN2A 3G2WA 3JRIA 5FQ4A 4KNYA 5BVIA 4M9ZA 1YJWI 1X1PA 3TGOA 2CYYA 1KT0A 3Q7AA 1LVKA 1KT1A 4B94A 2P1RA 4RGRA 2ZJPF 2EIKH 3ERED 4BHBA 5EIBE 2I2OA 4TXQA 3HUGB 2GBYA 4EJWA 2E2IJ 1MBEA 4CH7A 4L9VA 1F43A 1H6KA 2F8XK 4XONA 1OQYA 1Q2ZA 1OWOA 3CSTA 5EJFA 2R4GA 3ZMVA 3PUJA 1MX2A 2BY3A 4AU7A 2V4HC 3CVPA 1YJ5C 5CCLA 3ROUA 1XSVA 4AIDA 4XEIG 2AFFA 4Y13A 4L18B 4KIBA 2K4JA 4EV0A 2E5ZA 3F8NA 2WM9A 2KB3A 5EX3A 1J75A 4XICA 4I2ZA 3QQAA 2V8SE 3PNTA 3HOUJ 4ZZDA 1TNSA 2EFNA 3HM5A 3BG3A 1B8IA 2DPDA 1IN8A 2XB5A 2JT1A 5DIZA 2DT7B 4HVBA 2HM8A 1DGWY 2OD5A 4PUCA 3S1QJ 2I29A 1U0RA 2V5FA 2OV7A 2QYOA 5E8IA 1A5JA 2FQ3A 2F2EA 3KE2A 4S05A 3DRAA 2FX0A 2WADA 5H2FC 3DPDA 3PZ4A 3ZQIA 3ZKJA 4N5QA 3QWLA 3RO2A 3IC7A 4L5IA 3V80A 2GRRB 4IZZA 1S72I 1VQPI 5BXOA 3AG4E 1FZPB 4WCGA 2DMUA 3JQ1A 3CVQA 2LXMA 4C9BB 3CVNA 3RKYA 3PJRA 1FBSA 1XN7A 3GFLA 4AJWA 2LOOA 4WX9A 5LRSA 1FX7A 3E6CC 3M4OJ 2WXLA 3Q0UA 5D6FA 4GGGA 5HS7A 1IF1A 2DI3A 2DOAA 3LAJA 3TKYA 2QCOA 2Q2EA 3VLFA 3DBSA 1MKMA 2Z3YA 2FNPA 5FGMA 2L7KA 3KP4A 3MJWA 3ELSA 5IT3A 1MMDA 2WXIA 3LDZA 4PJMA 1YW9A 2DFHA 5CVRA 1ZOQA 1W5TA 2D1HA 4XI0A 2XAHA 1HF8A 2QYUA 1MMNA 1GXCA 3PFNA 3OYEA 1XDSA 2DA5A 4RGXA 2J4DA 3PFYA 4E4HA 2KRFA 3S15J 2DJNA 2RREA 4PGHA 1OCOE 1NTCA 4LJZF 3MCXA 4Q94A 4U8HA 1ZRDA 3PNVA 4V2FA 1JKOC 2TRTA 4OU0A 1HQCA 4BTBA 1BC8C 3BQZA 2ZMEA 1UN8A 3ZQFA 4NQ0A 3IKOB 4Y4RA 4DBQA 3F22A 2CV0A 1W0TA 2J9QA 5JERA 4F7AA 4UWFA 1TWAJ 2A6TA 3HPHA 2W1OA 2R17C 2VGXB 1T08B 2DQRA 4JX5A 5D5WB 3IRQA 2EPFA 5JVGF 3RI4A 2PM7A 3GF2A 3MKQA 3HKZA 3RZOJ 2WC2A 2W4SA 5CYVA 3A0BC 2B0OE 1WJCA 3BP8A 3ZRGA 2R93J 3H5RA 2VJ5A 3REOA 5J47A 3LA2A 1TR4A 4GTVA 1DMZA 1ITYA 5ILSA 3BU8A 3CIAA 2QV7A 5AQ9A 3DSTA 4HRNA 2N8GA 3MKRA 3VLDA 1HW5A 4K0RA 4GTTA 2PNNA 1N52A 3S93A 3LSIA 4HORA 1XGOA 4D7NA 2LRDA 1H6PA 4EATA 3BR3A 1XPXA 3Q9UC 2NOGA 3VTXA 3AG1H 5EJHA 5KJMA 1IN7A 3TWWA 1P7JA 3I71A 3AS5A 1JHFA 1LJ9A 2ONDA 2DMNA 3X2QH 3CLQA 1APLC 2OA4A 3HC7A 5DV5A 3KLNA 2EFPA 2A5UA 4CO8A 2GRLA 1GVJA 2FUG2 3HIFA 3C3RA 4IULA 1E8XA 1WJBA 4YIFA 4BXUA 3ULEG 3CR3A 4OAUC 1DC2A 5CQGA 4U88A 1OR7C 5LP0A 1IKND 3QC1A 4MNUA 1WJDA 2CW7A 2WV1A 1YO5C 5E79C 1FJLA 3OTNA 5FLMJ 2R7RA 2JPEA 2PJRB 2DCPA 2KQRA 4LG0A 2IW5A 2BXZA 5E8GA 4DYCA 1U78A 3CUQC 5E17F 2X3MA 2XGMA 4DK5A 3A0HC 5EJIA 3RYRA 3PNLB 2DN0A 4MTDA 3U4TA 3BG0B 2DOFA 2E71A 3R60A 1K1BA 4NUBA 3CO6C 4QWQA 4XBFA 4B44A 1LPQA 1T0FA 3VA1A 3HXBA 1O1TA 2XS1A 2DAOA 2GRQB 1FOXA 3FHEA 5KBAA 3U1DA 1XCVA 4DI3A 5DHUA 1OPCA 4L9TA 1Z0ZA 4XLNF 1Q1VA 1S7OA 2P9PG 4EPZA 1U9NA 1UZCA 3QYFA 2H8RA 1FBQA 1YFHA 4BNCA 1HG5A 4E7HA 2WQ7A 1R6RA 2J8SD 1Z6TA 4RB1A 2CFUA 2CQNA 3F72A 3G2VA 5C4JJ 2KCLA 3QK0A 5TJJA 3J81Z 4C0MA 1T39A 3FX3A 5E20A 1X2MA 1S6LA 1FOKA 5IYBJ 3F8CA 3UT7A 3C2GA 3AU4A 3ML8A 3DBRB 1BI0A 4II2A 5KAFC 5FT9A 2L9VA 1GV2A 3U2RA 2XGCA 1R7JA 2H6IA 2OCEA 4U7EB 3GFMA 2RFAA 2XF7A 4ACLA 1NI1A 3FXLA 4N9IA 5F1RA 1ON2A 1SMTA 3G2SA 5JLWA 4CYCB 2BHYA 2PLYA 3BC8A 2R02A 3FH7A 2VODA 4N3AA 1SFEA 2MBFA 3FKIJ 2VJIA 4M74A 2WXNA 2HQAA 5E75A 3NAWA 4W9RA 2RVCA 3D5SC 4BT8A 3CP2A 3B13A 1A6QA 3FUIA 3FXKA 5JEJA 2CMPA 4N9HA 2GOMA 5CVJA 3OXLA 3V79K 4BXXJ 2E2JJ 2CS3A 4DBRA 1TN7A 5A7DB 3CK7A 2XROA 1MBFA 2WXQA 3VODA 3UNMA 4EJQA 3KSLA 1DEVA 2HR3A 3TDZC 4CICA 3FKJA 2HDCA 1N78A 1HA8A 2XIGA 1U3DA 2K3FA 3TBIA 4L9PA 4G8XA 2YSRA 3TQNA 2CJJA 2O03A 2ZXHA 3I4NJ 2EWNA 5M5YJ 2HQNA 2F48A 2R5SA 3AFOA 2Q8KA 1XNFA 2FI7A 1FPQA 3PSFA 2VB6A 2OJED 4V19K 3RJVA 3V2OA 2E5NA 5FINA 4WERA 2JSCA 3D9JA 4D9JA 4L0ZB 3S16J 1YW7A 5JHBA 3ZMDA 1X4OA 1KGSA 3UT4A 3VYTB 3EYYA 3TW6A 1SA4A 1TN8A 3OYDA 3HDDA 3OXGA 3VOEA 4WNDA 2KP6A 4LOCA 5JHUA 4GMLA 2Q1ZB 3CDHA 4HF0A 4PJLA 4K2EA 1Y6IA 2LNIA 4B8XA 1S7EA 4BDYA 3UX4A 4FE7A 5ENPD 1WY6A 4GYOA 3O6BB 2KC7A 2KCVA 3QYEA 3ZGKA 2Y9YA 4A3DJ 3T8TA 3FXQA 2RQQA 4U87A 3HPGA 3ELKA 2D1VA 4IVNA 2QSGX 3EUAA 1KPSB 4GU5A 3FM8A 3JQ0A 1J59A 4LNBA 1CF7B 4QQIA 2AW6A 3FHNA 3S8PA 4NNJA 1IYGA 2E1OA 3FM3A 1DPUA 2P81A 4HBDA 3IXEA 4YRVA 3CV0A 3OL3A 2VKVA 1YJ9I 2FBIA 3DBLB 4MQVA 2AS5F 1P9QC 5F04A 4HI8A 3UIPC 2DZNA 5JA4D 4A6EA 2WA0A 2ME6A 1G59A 2LY1A 2VYIA 4J8EA 5CBOA 3PQKA 3AU5A 1TLHB 3FEYA 3SBTB 1PYVA 1F1ZA 4A3EJ 1YA0A 3I5PA 2AQEA 4LITA 4IN3B 3TWQA 1B4AA 3LA7A 2VSNA 3FP3A 4XIFA 1D0YA 3IV0A 4BBSJ 4RQIA 3NZUA 4UI9K 1MHQA 2IO3C 3K4CA 2IS2A 3QKYA 4CUGA 5KHDA 3AG2H 3PZ3A 5ANLA 1TQIA 3I56I 1D9SA 3U3WA 2KRCA 1FC3A 1ETOA 3ZMTA 1E7UA 2VC1A 3OAWA 1WAO1 4I1OB 2QENA 5DD4A 3Q4AB 4LD5A 1JXSA 1WV3A 5L3GA 4F93B 2F4OB 1IZ1A 2NVUB 3S3MA 1BI7B 4G2SA 3LA3A 4BQNA 3MZYA 1OT8A 3E4BA 4KZ0A 2R7ZJ 3SZPA 4ENMA 1MBHA 3HXFA 5BPPA 2BE5F 1TNTA 2DYSE 2ZU6B 3CCVI 1R21A 3ZQCA 4LG3A 1WJ5A 2QYJA 5AAOA 1RKWA 2E1MC 4DX1A 1TEZA 1SMYF 3GTJJ 2CHWA 2VOPA 3E3VA 3LKUA 3HUFA 1FSEA 1W7PD 4MFEA 3IRRA 1SZ9A 3B7BA 3CVXA 3J81K 3LJNA 5ILVA 4FT8A 4N3BA 3E30A 4K5BA 1W3BA 1HCRA 4ZYGA 2NYXA 5H6QA 2XAJA 5TISC 3EHMA 3FTWA 2QBYA 2LKPA 3Q49B 1ACIA 5EYPF 4JQFA 1E8WA 3K4BA 4FJYA 4ANWA 4HOQA 4ZFHA 4I0AA 4XMYA 1WPKA 3PUBA 5F0FA 2KDZA 3B73A 3CVLA 1FOYA 3DF8A 4L9JA 4HF2A 3V2XA 5FWQA 1V5FA 1FVFA 2IS4A 2R59A 2Y1LE 3LNQA 5KJNA 3MZ8A 4L9NA 1U5TC 2LREA 3E6MA 4E7SA 2NVXJ 1BR4A 1HKSA 1S9HA 4XOTA 4WWCA 1HE8A 1R9TJ 4APFA 4XM3A 3NWSA 5G04J 3TWTA 5CECB 2I6HA 4XR6A 2KPMA 3RIBA 2DPUA 2BEDA 3QB2A 3BG1B 2JKDA 2AXVA 1IXSB 2R3SA 4LNGA 5H7PA 3FU3A 5JEKA 2FXAA 2X4HA 2CU7A 1K78B 1TW2A 1GLNA 1H2VC 1QHGA 3I0MA 3O2PE 4HNVA 2HOSA 1DVPA 4WNEA 2P0WA 2WAFA 5K5RA 4KYOB 4WWOA 3ZMZA 4D7MA 1QZZA 2KXPC 1HW1A 3VZBA 4BETA 2XCCA 4JBAA 1RW2A 3LSJA 2YINA 1BU9A 4EVIA 2GXBA 5JEOA 1W5CC 2DO7A 3CCQI 2R5ZA 4H7YA 3WG7E 1AWCB 4IHYA 5EJGA 1X1AA 5IOYA 1R1UA 3AS4A 3KP6A 1VF9A 1E8ZA 4CYDA 2EB7A 1IUFA 1YQAA 2LBFA 4GDFA 2ETCA 4BAYA 3I3NA 4J7WA 3ZHEA 5M72A 2W84A 3UNGC 2VONA 1XX5A 2KZTA 2BW3A 2Y0MA 3G1OA 2PI0A 3NZSA 4I09A 5JLXA 3QAHA 2XAQA 3APFA 2V6CA 3H92A 2WXRA 5IOZA 3L2CA 4BACA 4XLEA 1Y1WJ 2R5YA 4Y7NJ 3E6DA 2UWMA 4CSWA 3PH0C 5J1YA 1B6AA 2CSOA 4AVXA 2DDBA 3D0SA 1HOMA 3V8KA 1Y56A 3I5UA 2XF6A 4B09A 3HHMA 5LLQA 3WXXA 2Z16A 5C4XJ 4J8DA 2EIKE 3IP4B 4OVUA 3VYUB 3TWUA 2PEXA 2BY0A 3L2WA 1NHAA 1B72A 2JA8J 1Y3HA 2DMQA 3OYCA 2NC9A 2UUZA 3OSFA 3B02A 5AIQA 1O57A 3SEQA 2JUGA 3V4GA 2GGFA 3DP7A 2MG4A 4O3MA 3AS8A 4WXHA 1E3PA 3QODA 4KUMA 4GPMA 2MGQA 2O5RA 3VYRB 3MKWB 1TP4A 3UV0A 4YNDA 3KX2A 2P7CB 2P9IG 2GW1A 4AVZA 3D5LA 1ELWA 3B7TA 5LHIA 4YDWA 1QBQA 1LEAA 3OYHA 2OV8A 1OCPA 4I0BA 5H20A 3W6KB 1Y3IA 2RFMA 3C3WA 3UINC 1ETVA 2IGNA 2RNJA 1N11A 4F55A 4JHJA 3H3ZA 4ZZLA 3HXEA 3OS2A 1YRNA 1M1EB 3J80Z 5ICGA 2FBNA 2DODA 2IAIA 2A3SA 3ONKA 5D8LB 4ESJA 3UQ3A 4G94A 4HOUA 1TT0A 3CQZJ 3AAFA 4CCAA 2B7EA 2VT3A 3ESWB 4C3IJ 3OYNA 4EJUA 2VGYA 3RKVA 1G6GA 3J7AO 3G4SI 4ANXA 3CSFA 1KHUA 4UI9J 4HG2A 5CVVA 4X0GA 1LD7A 2DBAA 1ODDA 1YCSB 3HXDA 4FULA 3PNTB 2AHQA 1UHMA 1B8IB 2JA6J 4Q96A 1F5TA 1ON1A 1Z91A 2KBXA 2HVRA 2ETHA 4EGZA 4BU2A 3HOTA 5DHQA 5D0QD 2KFDA 1XB4A 1FIAA 1LE8A 4ETSA 5FFZA 3OS0A 3CC4I 3Q5MA 1K3JA 2BOLA 1IRXA 4GAAA 3K4MA 2EBIA 3W3CA 3D9MA 4ACKA 1EH8A 4B93B 2MRIA 1O3TA 2WQ6A 3K69A 1GXPA 1J4PA 1BR2A 2LNBA 3MMYB 4HX8A 1E0EA 4F92B 1FMWA 4G25A 4P5OA 3SGHA 2JRMA 4FTHA 3P9CA 4PJJA 4B4CA 1IUYA 1FT9A 1BD8A 3ULQA 2HOTA 3RPQA 1N77A 1JPLA 3SZTA 2X0LA 5BV0A 4AIHA 4UUCA 3T9KA 2AQFA 1F9NA 1P5QA 2VPLA 2UXXA 4CCJA 3QDNA 2EA4A 1MZKA 4XLCA 1ZAOA 1LQ1A 2K7LA 1Z6RA 2K9SA 3CF5F 2G7UA 3ZIMA 3GZ6A 2OEVA 2LLKA 4I9CA 3DU6A 2GOXB 4APOA 1DP7P 1TQPA 1T6SA 2H94A 5ENNA 3L09A 2DLLA 2Q0OA 3BQOA 3OIPA 4GA1A 3QWWA 3ABLH 1ONVA 3KEQA 3JRHA 1J4KA 4AYBN 4CZCA 5E1WA 4ZYDA 3I59A 4IKFA 2JMWA 2RQPA 3RQ4A 3EU9A 2VOOA 4U0UA 4F1PA 2HYFA 4S04A 2ZMEB 4GO1A 2QA4I 1NG7A 4BESA 2ID6A 3T8RA 3AG1E 4EZKA 2I2DA 3LSMA 2Z2SB 1WLNA 2V1UA 5JJ7A 1R36A 3FBNB 3CMEI 2HVSA 1BIBA 5J8CA 1DP3A 4I99C 1WRJA 2X85A 2DYRH 3MYVA 2XRLA 1ETKA 4PCQA 4DJAA 3MKQB 5A2QZ 3E5QA 4IHVA 3RRNB 4RA2A 1O7LA 4P55A 1JKRC 2V5QC 1LUJB 3LSRA 3ABKH 4MFDA 2L6JA 3V7YA 2HYZA 2BEOA 4IOCF 4H87A 1BI3A 5C2YA 3PZDA 3T5XA 2QY7A 2ELHA 1YI2I 1IDZA 4FJZA 5DHRA 2I1JA 3A2KA 5D4SA 3HOSA 3SEZA 5DBKA 5ANRA 4EGYA 1WSUA 2IONA 3EDPA 3C3OA 3E32A 3MV2B 4XZ4A 5AJDA 2IA1A 2CG2A 5FIOA 1YJMA 2DFEA 4RS8A 2Y0SA 2HYJA 1Z1DA 2VQCA 4YIRX 2ICWG 1MK2A 3J5PA 1I3AA 2XAGA 3GW2A 4RMNA 1ZARA 5JI6A 3I0NA 4D5FA 5D2MC 5LCWC 1AU7A 4L7TA 1N75A 2EINH 4V3IA 5CKTA 2QQ8A 3BR2A 3E1SA 3I3LA 1BM9A 2HS5A 4MHGA 2D45A 4C2MJ 3S2HJ 4I2OA 4JOMA 1IQRA 4R7LA 2QF7A 1XGNA 2X6YA 3V8JA 1N54A 1KZHA 4GXOA 1PUEE 3ABMH 2OOEA 3CMYA 4PDXA 4X8QA 5A8IA 1ZQ3P 4LG0B 2XAFA 2H09A 2YQ8A 4A63B 2XB0X 1K3ZD 3EU5A 5AQ7A 5D0OD 3HXLA 1MW7A 2DFIA 3FXMA 3BJ6A 4OWRB 4OMYA 1EF4A 5KWDA 4BE0A 4F53A 1SANA 1ZGWA 3S3OA 3B7SA 1IHGA 1ZR4A 1W36D 1CQTA 2FBHA 4GTSA 1X3ZB 4MEXF 3MV3B 4C48B 1VQMI 3S7FA 1VZ0A 4NC8A 1ZR2A 4HF1A 2Z1DA 4DX2A 4JIWD 1L5JA 1PAQA 2GA1A 2PMUA 3FUNA 4GA2A 1YOVB 3PSIA 5DHTA 3RKWA 4A3TA 4FP7A 4NURA 4GTOA 2X6XA 4MRUA 2W48A 2GROB 3CJNA 5FQ7A 1Z7UA 3J80K 1QVTA 4IRUA 1S5LC 2D5VA 5D66A 3FUMA 2QZAA 3JRFA 5FRMA 3HZJA 2O7OA 3ZQHA 1MNDA 2DZOA 5DCMB 3JUEA 2IEKA 3CUQA 3W2VA 1R23A 2BVLA 2L6BA 4TUUA 3I6WA 1UHTA 1MGTA 3LQQA 3UMZA 1QZYA 2WQHA 4BFRA 3PDNA 3QYBA 4AV7A 1BA5A 4XLAA 5CQEA 5K7ZA 3JXJA 3N97A 2IP2A 1KLXA 4ASNA 4D1QA 1XMAA 1DU6A 3JREA 5AYWD 2KMUA 2CG4A 4JL0A 2F4IA 4DX6D 2H6CA 1BLXB 2ZNYA 1SD4A 2M45A 2ZB9A 5D5UB 1E3OC 3DEUA 3BR1A 4G11A 4A5NA 3S17J 2IT0A 4GZ6A 2I2AA 1SAUA 3WG9A 3L1PA 4OAZA 4JC8A 4BSZB 4F6RD 2PX9A 4L5EA 1FLIA 3KT9A 3K1MA 3PS6A 4B89A 3C2HA 3QWVA 1WQ2A 4V2GA 2VI6A 4BUPA 3GXOA 4RGSA 4Y33A 4XRFA 3O8HA 4IHXA 3TWSA 4ON0A 4J6IA 3V42A 4IRIA 4XL9A 2V1NA 2L2OA 1YS6A 3HG0D 2NNNA 2R2LA 2FU4A 3D5RC 1MZBA