2FEZA

Mycobacterium tuberculosis embr
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
373
structure length
373
Chain Sequence
RLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable regulatory protein embR
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 129
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2005-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fezA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fezA02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2fezA03
4JA7A 1SFXA 2QBYA 2NNYA 3MA5A 3HRMA 4OMYA 4YNDA 5KVRA 3ZN1A 4CGZA 4Y13A 2LSOA 1WM5A 2ZMEA 2CQKA 2Y4TA 1J4PA 2FBHA 2ZNZA 5H20A 1LNWA 2VOOA 2RN7A 4MGRA 2KJBA 4LLGF 4R79A 3ZMSA 3R0AA 2V6CA 4HOBA 5KJNA 3QWPA 5CJ9A 3L00A 4KIFA 2XGSA 2F5DA 2XAHA 3NQOA 4M6YA 1S7OA 4YG2F 1KT0A 1Y0UA 1XD7A 5HVQC 5HS9A 2PI0A 3I5UA 4LD5A 1FBQA 4U7DA 5HLIA 2ETHA 2Z99A 2OZUA 4UVBA 3M1EA 4FX4A 3GFIA 1SAXA 1USTA 4RG6A 3LQQA 5BW8C 2O8XA 5HI7A 1IZ1A 4I2WA 1AOYA 2VC1A 4LLNA 1TLHB 1FY7A 3Q9SA 1K78B 2A69F 1OYIA 2HEOA 1ZN2A 4KIGA 4RGUA 3ELKA 3CUQA 1PUEE 1IUYA 3I59A 5DEQA 2HYZA 2VBWA 4PGHA 2BUGA 2VSYA 2GIVA 3TQNA 2GWRA 1A17A 3C7JA 2F2EA 3JTHA 1Y8MA 3ABUA 2A5YB 4KFCA 3OXLA 1O3RA 3BJAA 1IN8A 2R7FA 2EV6A 3GYHX 3WTSC 2YHCA 2FO7A 1BJAA 3RJPA 1V3FA 3SFZA 3MV3B 3ZHEA 2FBKA 3C1DA 1FBUA 4KYOB 2MLKA 3M9AA 1P5QA 3E4BA 2DQLA 3K1PA 5K1YA 1TJCA 3KE2A 5ICGA 2KCLA 4HYEA 2P7CB 2MH9A 1D8JA 2P6SA 4EJQA 1FZPB 3HHGA 3RKYA 3V8KA 4Z2YA 4U0SA 1B89A 5HDGA 3LPZA 3J80Z 2KCVA 3HSFA 1XN7A 1IXRC 1ON1A 1TQMA 5HS7A 5BOXA 3TAXA 2LNBA 4KICA 2DK5A 1P6RA 4EGXA 3QAHA 2EA2A 3E6DA 1UHMA 4OU0A 2JQLA 1UCRA 3QPHA 2DT5A 5HQ8A 3M8FA 2HQRA 3KD7A 2JPCA 5FZSA 3I0MA 3BY6A 1PC2A 4GXOA 3CK7A 4KT5C 1KYWA 2XUBA 2HTSA 3O2PE 1IN5A 1J4KA 3W6KB 4P96A 4BXUA 1LDDA 4LMYA 1IRGA 2L3DA 2VXZA 4CICA 3QKYA 4RS8A 4G8XA 3GEZA 4UXNA 1B1BA 4G6DA 3WU1B 4N9IA 2KC7A 3F8FA 3CUQC 1T0FA 2R3SA 3FMSA 2BEOA 3KFWX 3V7RA 4LB5A 2LSUA 4CO8A 2MHKA 5LRRA 5D4RA 4G23A 3G73A 1W3BA 4XI9A 3UUXA 5D5WB 1KA8A 1ZYRF 1REPC 1ZBPA 2XCBA 2FI7A 1Z6RA 3D5LA 1P4WA 1FP2A 3FXUA 4IPAA 4HV5A 3HRUA 1SD5A 5KK1A 4N3CA 3VPYA 4S04A 2VGXB 3ELSA 2H09A 3QPTA 2XEVA 1TTYA 2QLZA 1FWZA 3HUGA 1OMIA 1RUNA 2KRFA 3AS5A 4YFNF 5FJYA 5JFRA 5ARFA 1K7AA 4FT8A 3GXOA 4L0YB 1CF7B 5LLQA 1ZH5A 1LGPA 2QQAA 3ULQB 3TGOA 3F8BA 2PLYA 4HORA 2FE3A 3CVPA 1MJ9A 4HDUA 4KBQA 2FSWA 4GZ3A 5BNWA 3H92A 4K2EA 2Q7FA 4EQQA 5G05C 1W7PB 2EFWA 4CGVA 1MZKA 2OQRA 3Q9VA 1P4XA 4LLLA 4MNUA 2RV8A 3LA2A 1P2FA 4WUYA 3S7DA 2W25A 4Q4ZF 2M5WA 3HRTA 1B6AA 4G2SA 1O3QA 2K4JA 3RPQA 3VTYA 2KKOA 3KZZA 4RGRA 4L5IA 1B59A 4N3BA 2HYGD 2FU4A 1FSHA 3GWZA 3WTZA 4XI0A 4O5VA 2H6BA 1SFEA 1XSXA 2EH0A 5AIQA 1H9TA 3PQKA 2G7HA 4OIRF 1J5YA 3ROUA 2VSNA 2Y48A 2IA1A 4GA0A 2FNAA 1E2XA 4UV9A 4R1HA 3I64A 3CKCA 1YA0A 2IW5A 2WQHA 3MWMA 5FD5A 3U4TA 3UNNA 1K3NA 1ZRCA 2A6EF 1W5TA 5D6EA 1HW1A 1EH8A 4AVPA 1G3TA 1ZG1A 4WWCA 1QPMA 4J8DA 4G7HF 5LCWJ 1KU2A 2UWMA 2DBBA 5DCFA 1XGOA 3IKVA 5G04C 1EV7A 4LK0F 4HX4A 1BI0A 1U3EM 3LCAA 2L02A 4EJWA 3GYZA 3HHHA 4QWQA 4D9VA 1K2MA 1KGSA 4OIOF 5FTPA 2L4AA 2CWEA 2JSCA 3ZMZA 3CO6C 5ICFA 2KIUA 4HOTA 3K69A 1HQCA 3HRSA 2GW1A 1XCVA 1FSEA 4P9UA 2NAZA 1UHWA 3J81K 4N3AA 4CDRA 1D8KA 3FMQA 1ODDA 4UI9J 3HUFA 4ABNA 3KZYA 5LHHA 5FZQA 1I5ZA 3DKWA 5CVIA 2IPQX 5DCMB 3MKRA 5CLSA 5A6CA 4EGZA 1RI7A 4M74A 1YQAA 5L3FA 4O6FA 5HDNA 5FLXZ 5A2QZ 1NA0A 2WC2A 4BHCA 3TDZC 3U1DA 2Z3YA 4Y6CA 2E1NA 3TO7A 3L2CA 3ZMUA 2IA2A 2QYOA 4ZYEA 2IP2A 1PP7U 1BI3A 2QZ8A 5JHUA 2W57A 2HO1A 5E50A 4WX9A 3BJOA 1T6SA 3EQLF 1R36A 1DUXC 2EA4A 1XGMA 5D0QD 2DK8A 1SD6A 3LWFA 3I4PA 1ZHFA 5FGMA 3H3UA 4XLNF 1U6GA 2HFHA 3K1NA 4YFKF 4LK1F 4I2ZA 1FYLA 2UY1B 2FRHA 3GZ6A 5JJ7A 5D8KB 2UZKA 1BOAA 1L0OC 2PBIA 1BN5A 1XMAA 5J6XA 3CVLA 2I6HA 2K02A 2Y0MA 1RZ4A 4HQMA 1FC3A 1XCBA 2OU2A 3ML6A 5E8GA 1ONVA 3TGNA 2DBAA 1D5VA 3CEQA 4H87A 4A6DA 4I9CA 4HF0A 2VBXA 1AWCA 4BT8A 1QU5A 5HOOA 1J4LA 4IRIA 1Z05A 3ZMTA 2KB4A 4N2SA 2ELHA 3GF2A 5D6FA 3K9TA 2ADUA 2XAJA 1G4DA 5A8IA 1D3YA 2VE8A 4I01A 1KU7A 4Q5SF 4HF1A 3SZTA 3UN0A 4IRHA 4JK1X 4FX0A 1FYKA 2IJLA 3KP7A 2GXGA 4KMUX 2XKPA 1ZG5A 3BPVA 4GPKA 1SFUA 3Q5MA 2JQIA 1S29A 4GCOA 2O61A 1J2XA 3E97A 2QWWA 3TO6A 3Q5FA 3WG9A 3Q47B 2OQGA 3F8NA 3RPUA 2IT0A 2E7WA 2HTJA 4ZH4F 3F6OA 4JQFA 4XBFA 5L3EA 1BM9A 2WV0A 2P5LC 4KDPA 4EJVA 3ECOA 2V79A 2V1XA 3FM5A 3QP6A 5DYMA 4XIFA 2ZKZA 4ON0A 2XCCA 1FNNA 3I53A 2C0MA 3FX3A 1U2WA 3BPXA 3DEUA 4HF2A 5FFZA 1RIOH 2ZFWA 2EV5A 3ISPA 3KP5A 2CW0F 1QQIA 2XGXA 4U04A 1WLNA 4RGSA 1KYZA 1BC8C 5IT9Z 5K5QA 1WKMA 1JXSA 2FXAA 2A68F 2D1VA 2QBYB 1IRFA 3VFZA 2GZWA 2K7LA 3LY7A 2ZMEB 1SMYF 3CO7C 5BMZA 3R6SA 2EFPA 4BAYA 4ESBA 2QM3A 1SD7A 3KAEA 4JL0A 1XDSA 2OD5A 1ZAOA 1XDUA 1K78A 2A07F 3UQ3A 2F5FA 3P7NA 2BV6A 2GA2A 3HYMB 5FZRA 2OAZA 2XGMA 5BQTA 2YX4A 1R00A 4PGGA 5C1DA 4L9JA 5LEJA 1OR7A 3KCCA 3PE3A 5KJMA 2BE5F 2PJPA 1ZLKA 3PDNA 2M8EA 2Q2EA 4BWRA 4CXFA 1XSDA 4YVOA 3BOQA 3E5UA 3L7WA 2V1DA 3FWVA 4Y6WA 3OUNA 3PE4A 5DUKA 1KU9A 4KYWA 4GA2A 4OMZA 2DPDA 1ZG3A 2V9VA 4MQ9F 1UHTA 1KQ9A 1U5TB 4FHTA 3ZQ7A 3GX4X 1NZNA 2OZ6A 2FEZA 2IFUA 1T39A 4PDKA 3I59B 4GYWA 3TG5A 3FFLA 1T2KA 4NHJA 1YS6A 4RB2C 1IW7F 2BGCA 4GCNA 3KETA 2VQ2A 2FBIA 2W85A 3I6WA 2JKDA 1FP1D 3QDNA 3DPLC 5DJOA 2AVPA 5JR3A 4WXDA 3ZHEB 3KS2A 3BJ6A 3C18A 4KIBA 1FOKA 3TKYA 2NRAC 1YW8A 2J5PA 1TW3A 3JW4A 4PZJA 4GYYA 1WI9A 2XAGA 1JHHA 3I54A 1Z9CA 3F6VA 4GGGA 2ZCWA 2CO5A 2OBPA 1QBJA 4U0UA 3FF5A 2J5OA 2X4HA 3T8RA 2OA4A 3QWWA 1K6OA 1R22A 3KEQA 3JTGA 1IN7A 5LHGA 4IHTA 1HKTA 5L3DA 3LY9A 2QQ9A 4UNOA 1R1VA 2P6TA 4HA8A 1YW7A 4A0YA 2G9WA 1WV3A 1NA3A 3NF1A 3C3WA 5IT3A 4ZYGA 4N39A 4HBLA 4HLXA 1JHFA 2JRTA 2P4WA 4EM0B 2RVCA 3IRQA 1USSA 4GA1A 2VBZA 4HW0A 3N97A 2PEXA 3UOTA 4LEUA 1XGSA 1OYWA 5H6RA 3E3VA 5LGUA 1DMZA 5FB2A 4KN4X 2DFIA 2DLLA 3T8TA 3MQ0A 4F7ZA 4DNCA 2HS5A 1KQ0A 4HV6A 1SMTA 4UVCA 1R1TA 5LHIA 4EM1A 1OUVA 3UMZA 2VGXA 1IXSB 3V8JA 3ZPLA 2ZNYA 1XSVA 5H6QA 1K79A 3LFKA 3UV0A 4KA4A 5ILUA 3GFMA 2ZXJA 4MTEA 4AIJA 4HQEA 4HOQA 2DQRA 3RO2A 1Z91A 4ESJA 5HDKA 2CSWA 3CDHA 4N5CA 4B09A 3I0TA 3CTAA 4L18B 2FMLA 1J59A 1I27A 1R7JA 3F72A 3WGHA 5ILVA 3AS4A 4S05A 1W7PA 4RAZA 4AIFA 2PN6A 3TOBA 1XMKA 4BNCA 5DIZA 1PDNC 2X0LA 2VONA 4EGYA 2VOPA 5M72A 3KP4A 4J0UA 3PO8A 1ZRFA 2GXBA 3VOEA 2R7DA 1MJBA 2A6HF 2VC0A 4KNYA 5E1ZB 1FHQA 3HIFA 3WODF 3J7AO 3SQNA 2STTA 1QO0D 4A1SA 1R5GA 3DF8A 1ELWA 1SD4A 1O3SA 5F1RA 4L5JA 1W4MA 2UXNA 2O3FA 1R1UA 1YYVA 3FWEA 3I6UA 2XVCA 1FLIA 4GYGA 5K5RA 1XB4A 4HX7A 1I6XA 4I02A 2J9QA 3KP6A 2XASA 4YFXF 4W9RA 2VGYA 1A04A 4KXKB 2RKHA 2UWJG 1QZZA 1T98A 3CVNA 4HOSA 2YQ8A 3O48A 1TNSA 4OOIA 4MEXF 2RQPA 3GVAA 5CHEE 3G3ZA 3LA3A 3T5XA 2JZYA 1GHCA 3FXRA 3TO9A 1BI2A 1G6NA 4U0VA 3EUHA 5CVUA 3HTUA 3LYAA 4A0XA 1W7PD 2XT9B 3I71A 3OXFA 5E20A 4RGXA 4G9YA 3WGIA 2Z5UA 3SF4A 2XHKA 4ENKA 2BRFA 3V4GA 4B94A 4G7ZF 6PAXA 4ZYDA 1G3GA 1YJMA 5CVRA 2KJCA 2V5FA 1Z7UA 1FBSA 3FZVA 1QZ2A 3MZYA 3EETA 2FF4A 2L6JA 3ASFA 3E6CC 4GO1A 3HYIA 5TJJA 1O57A 2QENA 3IC7A 1ULYA 2DO7A 1YG2A 2VT2A 2MLGA 3P9CA 4G26A 3DP7A 3CK9A 3JSPA 3ELVA 2KFUA 1J0RA 3QWVA 4EJTA 3REOA 1WRJA 2LC1A 2XGOA 5CVJA 4UVAA 5AONA 1TNTA 3HX1A 4R8HA 5HLGA 3RIBA 2DTRA 1LEBA 3J81Z 3O3KA 2PL2A 2NNNA 3WGGA 2PQ8A 3E5XA 2PZIA 2JPEA 4G94A 2FNPA 2XAQA 2KB3A 4HAMA 3QOUA 4ASNA 4M71A 3RYRA 1ZARA 3IKTA 5D0OD 1ZU2A 4BYYA 3CK8A 2FMYA 4I1AA 3FXQA 3WTUC 4N2QA 5EEGA 4CDGA 5FFXA 3POAA 3QRFF 4OIQF 2JPBA 1DPUA 1L3LA 1Z6TA 3V8LA 2HR3A 2RDPA 3QOPA 1LDJA 1HSTA 4L9VA 3VODA 4A2UA 1S6LA 1K3QA 1R23A 2EFQA 1FPQA 5D4SA 2AXLA 4P5OA 3MEKA 5JJ6A 4LG0A 4XSXF 3ASDA 3JSOA 1G3SA 5LGNA 1OKRA 2K4BA 4M9XA 2COMA 3V7SA 4KMFA 4UI9K 3NEUA 4A5MA 4AIKA 2FA5A 5DDGA 3GZ2A 2W84A 5D5UB 3DQVC 2Q8KA 1HBXG 3TDUC 4TV7A 1MDMA 2E7XA 2M87A 3OXGA 2CG4A 3HSRA 3MFKA 3LA7A 2RNJA 5D5VB 3L09A 3WTVC 4G1TA 4LGWA 3GO5A 4NRHB 1HXIA 5G05J 3VA4A 3WTTC 3URZA 1IF1A 4MQVA 1R5HA 2Y75A 4EV0A 4QCJA 2JQJA 5L3BA 1P92A 4IJAA 3CLOA 4HOUA 2VYIA 5AYWD 3E6BA 3BWGA 2AS5F 1WQ2A 2L4MA 2FOKA 3S7FA 2M30A 3DV8A 3R0JA 3CVQA 2IA0A 4YVQC 2JTVA 3M7GA 2YX7A 3ESKA 2NYXA 5E1WA 3R4KA 1ZGJA 4HX8A 4GCVA 2LF7A 3ECHA 1GVJA 3B73A 4EJOA 2Z9OA 3PQJA 2PMUA 5BPDA 1T38A 4BTAA 3F8MA 5FO5A 1JE8A 4WNDA 2KKLA 2CSOA 4D0PA 3RTRA 2ZO4A 4J8EA 5L3GA 1DP7P 1KT1A 4E70A 4P9FA 1WWXA 4UUVA 3RIRA 4CGWA 1EH6A 1I1SA 1MJAA 3E6MA 3GUDA 3K0LA 2ACJA 2E1CA 3HTSB 3V7CA 4A12A 5AIPA 5E17F 2F5EA 2DI3A 1G3WA 5E8IA 1ZLJA 5G04J 4I2OA 5LRSA 2LF8A 3FM3A 3RKWA 2RGVA 5ARGA 4PCQA 1S3JA 3SHFA 3RKXA 3F3XA 1Z1DA 4LB6B 2OOEA 1QZYA 4M73A 3U2RA 4RAYA 1CGPA 4U0YA 5CYVA 4P55A 2H27A 2JLBA 2Q0OA 2W24A 2ZBKA 4KN7X 2PQNA 4GZ5A 4UQYA 2LKPA 3ZPJA 3KT9A 2CGPA 1E96B 4BHBA 3LAPA 1U5TA 3T0YA 3WTYC 4NQ0A 2O03A 4IF4A 1Q1HA 1B4AA 3P9KA 3IWFA 1LQ1A 1IN4A 4H7XA 2GQQA 3GZ1A 5A7DB 2GAUA 4M6XA 4A5NA 3CUQB 4LFUA 1I1GA 2P5KA 3EYYA 2E2EA 3ASHA 4A0ZA 2NC9A 4O3MA 3HOSA 4U07A 3ZN3A 2L01A 2UXXA 2MBFA 5KJKA 2MC3A 2W3OA 1MD0A 1P4AA 3J80K 4M9ZA 4QLCU 4G6QA 2HKXA 3DFGA 4U0WA 3JAMK 2XROA 2XIGA 4B8XA 1ZREA 3F8CA 5LCWC 1U8RA 4U7BA 4JHRA 2HOEA 2RC4A 4XRFA 1GXQA 3GZ5A 5LGTA 5F6FA 2P5VA 1IN6A 3F21A 1K2NA 2MH2A 2PMHA 4HZFA 3S7JA 1ZRDA 4EJUA 5JVTA 2HKOA 4IXAA 3BROA 3JAMZ 4M9SA 5DV5A 1F1ZA 1X3UA 2YR2A 3U9GA 2BBYA 3MEXA 3RKVA 1S7AA 5L3CA 4F3VA 2QQBA 2P7VB 2VBYA 3Q4AB 3FMRA 3TG4A 5D8LB 2HZTA 4UI9C 3KLNA 4BHPA 3LY8A 4AWXB 1YLFA 1LVAA 5HLHA 2BYVE 3ERED 4A6EA 1G3YA 5CCMA 3F23A 5EX0A 4DQ2A 3GW2A 3KP3A 1GXPA 1BIAA 5KJLA 2QVOA 1XNFA 1GXCA 1J4OA 3ZFWA 1IAWA 5FT9A 1MKMA 5FD6A 4RB1A 3W6JB 1U5TC 3AAFA 5K5OA 4XSZF 3ZGQA 5CCLA 2PG4A 1QNTA 1UFMA 4J8FA 3RI4A 1VTNC 1HSJA 2MA3A 3VEPA 1NHAA 1E17A 3RYPA 1HW2A 1F5TA 4ZYHA 4I0AA 2VE9A 2K86A 4LJZF 2WPVA 2DU9A 4NB5A 3Q49B 2WTEA 4JONA 1HZ4A 4ENJA 1STZA 5ED4A 2FQ3A 3VB2A 1CF7A 4ESFA 2STWA 2Y4UA 3HOTA 3ULQA 1IXCA 1ZGAA 3L9FA 3GLXA 4WK8F 4AY5A 5D5XB 4AIHA 1FYMA 3FHZA 3RJVA 1JGSA 3ZN0A 2XAFA 3IWZA 5EX3A 1B9NA 1RUOA 3FM8A 2C2LA 1O7FA 2LNIA 3IEGA 3K9IA 4AY6A 3WE2A 4AD9A 1LJ9A 3MZHA 1G6GA 4BT9A 2ZJ2A 5HS8A 3KEOA 4Y15A 1QGPA 2VODA 2C0LA 3ASGA 2ISZA 3AS8A 2D2WA 1TQPA 1H0MA 4L9NA 1HXDA 4ZZDA 4WCGA 2M45A 4RG9A 4EVIA 1BC7C 4GYOA 2O6GE 1TW2A 4JA9A 2EK5A 5TRDA 4EQFA 4UV8A 3O6BB 4BQAA 1R58A 2H94A 1IHGA 2EV0A 2MD5A 4UHTA 2DAOA 3COAC 1R21A 3MCZA 4I7HA 2YPRA 3GW4A 3IRRA 1IYGA 3BDDA 3EYIA 1J9IA 2EJRA 4I17A 1FCHA 2KIMA 2Z33A 4ZZLA 4IVNA 2HDCA 3GQSA 1HKSA 3LKUA 1YO5C 3N4MA 1V4RA 3WXXA 1HKQA 4CYDA 2PQRA 1W5SA 1OYYA 4WNGA 3S2WA 3CUOA 4BTBA 4YIIA 4N0BA 2CYYA 3QU6A 4OINF 2C6YA 5ICCA 2K27A 2A61A 1FHRA 2HGCA 4H0EA 1H9GA 4ENMA 1C0WA 2YSRA 3D0SA 5JJTA 1LB2A 3F22A 5E18F 3Q15A 2EFNA 4WXHA 2XKOA 4WNEA 2PIEA 1HW5A 1XGNA 1UJXA 1KU3A 3MV2B 5J8CA 3LSTA 3R9AB 2P8TA 2LSVA 3EDTB 3U3WA 1TQIA 3CKBA 3LAJA 2IF4A 3P9IA 1F9NA 3R61A 2YU3A 1PP8F 4UQZA 4ETSA 3JYSA 3ZMVA 5J8FA 3UNMA 1DDNA 1QQEA 4U0ZA 2O0YA 2P58C 4O6JA 4N9HA 1U78A 5DD8A 2HR2A 2A3SA 5BT1A 2B0LA 5DBKA 3VA1A 4Q47A 2D1HA 3CV0A 2A0TA 3QU3A 1UB9A 5DCMA 2DPUA 1KQ8A 4M72A 1LEAA 4G2VA 3H3ZA 3OOPA 5BS6A 4WXCA 3WE3A 2WWYA 5F64A 2AFFA 5FLXK 5A2QK 3WTWC 3M8EA 2L54A 5LEKA 3S7BA 3QP5A 4CHUA 1TBXA 3VTXA 5DUIA 3K1MA 4MTDA 3BZ6A 2EB7A 1MGTA 4HDVA 4WF2A 2TDXA 2VT3A 1YIOA 4GZ6A 5LBQA 3BP8A 2QFCA 2IRFG 2R5SA 2KIFA 1BIBA 4Q48A 1HH8A 2KATA 4MEYF 4JBAA 3K2ZA 4L9TA 2H6CA 3ZMDA 4UQXA 2UY1A 1YJ5C 1YW9A 4A0EA 4CZZA 1DPRA 4RB0A 3B02A 4G24A 1LGQA 2QUFA 3PFIA 5CVVA 4MHGA 2GA1A 1S8NA 3IHUA 3T1BA 1WSUA 4EM2A 1YFHA 4G7OF 1EH7A 3RO3A 3MAJA 4AM9A 1FX7A 4YIFA 1O7LA 4I98B 5EKQD 4L0ZB 1KLXA 3NRVA 5E1XA 1OPCA 4Y17A 3MDBA 2HYFA 3BEEA 2XV4S 1K3JA 2VN2A 4ME2A 5BPIA 4I9EA 4LG0B 4I09A 4IHSA 3RDIA 3I58A 3KP2A 3R60A 1RNLA 4NQWA 2F5CA 4OIPF 2LDUA 1MZBA 2G7UA 4IRGA 3EDPA 3UPVA 2M1BA 3TOAA 4GYIA 3DXJF 3WTXC 3N71A 3WU0A 4KUMA 3RU0A 3SZ7A 2ESNA 1LDKB 2CFXA 3KLOA 2D45A 3HUEA 3CJNA 4RB3C 4IN3B 1MDMB 5ILSA 3GFLA 3GFJA 3ABTA 2DW4A 3LQRA 4G25A 2V1UA 1ON2A 2PFBA 3DPTA 2XRNA 1J75A 2HQNA 2JT1A 1WAO1 4ENNA 2EWNA 3E5QA 3IL2A 1YS7A 4H7YA 2ONDA 2ISYA 1BI1A 3SXYA 2KCKA 5ICEA 4XLPF 1BBYA 4I0BA 1ELRA 5ERIA 2FBNA 2NS0A 3ZP5A 1B9MA 2ESHA 2HWVA 5JI6A 4APOA 4BH9A 1J4QA 1FT9A 2G1LA 2IVMA 1F4KA 3FP3A 5EEHA 2XPIA 5DD4A 4U88A 3OV8A 4EMSA 3I0NA 3HSEA 1O3TA 4WNFA 3SZPA 5IT9K 1J7KA 4HLYA 2EFOA 1YTYA
chains in the Genus database with same CATH superfamily
4JA7A 5ENNA 1SFXA 3PO2J 2QBYA 2NNYA 4I6JA 3MA5A 3HRMA 3LS8A 4J8SA 2ETAA 4M7CA 4J7WA 4OMYA 4YNDA 1VDYA 5KVRA 2BKKB 2CUZA 3ZN1A 1TN8A 3TJPA 4CGZA 4Y13A 2XRYA 2LSOA 3U21A 1WM5A 2ZMEA 2CQKA 4UB8C 4XLEA 2KFDA 3C98A 3PNVA 4ITVA 3G2WA 1K4TA 2Y4TA 1J4PA 3ZQLA 3BR3A 2FBHA 3V42A 5C44J 2W00A 5M5WJ 2ZNZA 5H20A 1LNWA 4UUSB 2RKKA 4X8QA 2M4GA 3OTNA 2VOOA 3G1LA 5EJGA 2Y30A 5BNGA 2RN7A 4MGRA 2KJBA 3I56I 4LLGF 2PMZA 4R79A 3ZMSA 3R0AA 3P1UA 1NL4A 2GRRB 4XORA 1GVDA 1ORKA 2V6CA 4HOBA 5KJNA 3QWPA 2NOJB 1UG3A 4AVXA 1QU3A 4RLYA 1ETQA 5CJ9A 3L00A 2V9PA 4KIFA 4B4CA 2XGSA 2F5DA 2XAHA 3NQOA 4M6YA 5EGOB 1S7OA 1ZELA 3LDZA 4F1SA 4YG2F 1KT0A 2LMDA 4J19A 1U2VG 1Y0UA 1XD7A 2JJ7A 5HVQC 1YIJI 3B7TA 5HS9A 2PI0A 3HXCA 3L22A 3I5UA 1BW5A 3DSHA 1EA3A 2OPTA 5CECB 1K61A 3NAUA 4LD5A 1S63A 2FUG2 2QCOA 1FBQA 1P7JA 4U7DA 1YX5A 1TEZA 5HLIA 2ETHA 2LOOA 3SDBA 2Z99A 5DM7F 2DA1A 4BL0B 2KM4A 2VTBB 2OZUA 4UVBA 3OYIA 1UN9A 1RKTA 1ETVA 3M1EA 4FX4A 4F91B 3BCAA 3GFIA 2DCEA 1USTA 3S93A 1YHQI 1SAXA 3LQQA 1H88C 2HPMA 4KMOA 4RG6A 5BW8C 1NI1A 2O8XA 5HNFA 1EF1C 5HI7A 1IZ1A 4I2WA 3CF2A 3GBGA 4ANJA 4IHXA 1AOYA 1DP3A 3IHVA 1SVLA 3RPUD 2VC1A 3ZEFA 4LLNA 1TLHB 2EIKE 3LSPA 1FY7A 3Q9SA 3BLYA 1K78B 2A69F 4ZTFA 1N78A 1OYIA 2CRGA 1HX8A 2HEOA 1ZN2A 2X6JA 1IQUA 4KIGA 4RGUA 1RPWA 3OYCA 3ELKA 3DPDA 4BQOA 3JUEA 4E7LA 4RVBA 1BR4A 3CUQA 1HLVA 1HDDC 4CSWA 2CW7A 1WZ2A 4JB8P 4CA0A 1PUEE 1RC9A 1UZCA 2XHEA 1IUYA 4C2MJ 1X19A 3A02A 3I59A 5DEQA 3TW6A 2VBWA 3JRFA 2HYZA 3EHRA 3T5PA 4PGHA 2BUGA 5FIOA 1SVOA 1FPPA 2VSYA 2GIVA 4DX2A 3TQNA 4BQNA 4D7MA 1HO8A 1VQ7I 2GWRA 2X85A 3C7JA 1A17A 4BE2A 2F2EA 3JTHA 1OCTC 3ABUA 1Y8MA 5FQ7A 3FHEA 2A5YB 4KFCA 1N4RA 3OXLA 1O3RA 2XPYA 2XPUA 3H35A 4XKWA 3BJAA 1IN8A 1W36C 3KEZA 2F4IA 2R7FA 3O8HA 2EV6A 3GYHX 2K3PA 3WTSC 2FO7A 2YHCA 1BJAA 1VQ9I 3RJPA 1HE8A 3ENEA 4V3IA 2XPZA 3S2DJ 1V3FA 3SFZA 5BXUA 3I4MJ 3MV3B 1YRNB 3C3OA 2OJED 3ZHEA 2FBKA 3C1DA 1FBUA 3RRMB 1RKWA 4KYOB 2MLKA 1IUFA 1UW4B 3M9AA 3FKIJ 1P5QA 3OOUA 3V8NA 3E4BA 1FMWA 3H1CA 4E7HA 2DQLA 2VJ4A 2JSPA 3K1PA 2VKDA 5K1YA 3HOXJ 1N52A 2LKXA 2K9SA 3KE2A 2IGMA 5ICGA 1DCQA 1TJCA 1TR4A 2X6IA 2WXIA 3DPUA 2KCLA 3HG0D 4HYEA 2P7CB 2MH9A 1IDYA 2BY1A 1D8JA 3VA1A 2PJRB 3B13A 2Y0SN 5D2MC 2ZMEC 2E19A 2M34A 4YELA 2R5YA 1D8EA 1YCSB 4EBAG 2P6SA 3ASOH 4WERA 2FO1E 4EJQA 1FZPB 4JOMA 4MFDA 1NG6A 3HHGA 3RKYA 2ETBA 2E2HJ 3V8KA 3DWLG 4Z2YA 4I6EA 4U0SA 4HB5A 1W1WE 1B89A 5HDGA 3LPZA 3HXLA 3J80Z 2XPWA 2KRCA 3HSFA 2KCVA 1E8ZA 1XN7A 1IXRC 2YINA 5EYLA 3S2AA 1ON1A 1TQMA 5HS7A 3ZGKA 1OCZE 5BOXA 2R7UA 1G3NB 3TAXA 2LNBA 4HRIA 1EYHA 4KICA 3EHMA 2DK5A 3CP8A 5EZHA 1P6RA 1U7VA 3ZXPA 4EGXA 3QAHA 2EA2A 3E6DA 5B1BH 2PX9A 1UHMA 1YJNI 4OU0A 1HF8A 2V5QC 2JQLA 3VYTB 1UCRA 3QPHA 1Z3XA 2DT5A 4LNGA 2QF7A 1ENHA 3M8FA 5B1BE 5HQ8A 3K7AJ 4G12A 4KVOA 1UELB 2HQRA 3KD7A 1LE8B 3AFOA 2JPCA 3FK7A 4NACA 3BY6A 2K9NA 3MYVA 5FZSA 2HNHA 4F3QA 3S3MA 1PC2A 5ANRA 4DX1A 4GXOA 2ZIRA 4OWRB 3CK7A 2XSJC 3ULEG 2R7TA 4KT5C 1KYWA 5EJIA 2XUBA 4II2A 2HTSA 3OYMA 5CCLA 3AG3E 3A4CA 3O2PE 1IN5A 5HNHA 2WXHA 4C3JJ 1UJ8A 5JA4D 1H19A 5AQ9A 1J4KA 3W6KB 3BG6A 4BJ6C 2AWIA 4P96A 3CMAI 4ZDLA 2P2CP 1LDDA 4BXUA 4LMYA 2R02A 2DCPA 1BR2A 1IRGA 4CYCA 4MFEA 2KL4A 4M3OA 1WH7A 2L3DA 2VXZA 1V55H 4CCLA 2FJ1A 3G1MA 4CICA 4NDLA 1NH3A 1U3DA 4RS8A 4G8XA 3QKYA 3GEZA 2WXMA 3PEVB 2BF0X 4UXNA 1B1BA 4G6DA 3WU1B 2VXDA 4N9IA 4A3BJ 3S32A 1MX6A 2KC7A 3FTXA 3F8FA 3CUQC 1T0FA 2R3SA 2Y9YA 2BEOA 3FMSA 3KFWX 3B7RL 2DT7B 5BUZA 3IP4B 3V7RA 2KHMA 2IO2C 2CW8A 4LB5A 3MMYB 4B0ZA 2LSUA 4CO8A 4R7LA 4HLEA 2HVSA 2L6BA 4JIWD 2F6CA 1RRJA 1AKHA 4HQDA 1J09A 2MHKA 5LRRA 3EUAA 4O1PA 5D4RA 3BQOA 4G23A 1LD8A 3G73A 1W3BA 4M3EA 1MMSA 2MSYA 4XI9A 4B89A 2Y31A 3DLLF 2R7VA 2EILE 1Z77A 3UUXA 5D5WB 2R7XA 3ZQCA 2IGNA 1KA8A 3IH3A 1ZYRF 1REPC 2DTZA 1TWHJ 5EYRA 1ZBPA 4JX6A 3R7RA 2XCBA 2FI7A 1Z6RA 4PJMA 3CC7I 3D5LA 3D9OA 2VQHA 2JEKA 1P4WA 1FP2A 3FXUA 4IPAA 1X1DA 1VQOI 1MQSA 4HV5A 5GTIC 4GMLA 3HRUA 1SD5A 4FASD 4A3JJ 1QBQA 5KK1A 3FY4A 4N3CA 3VPYA 4S04A 3E34A 3BR6A 3UMVA 2VGXB 4GTQA 3T9KA 5ITZF 4P29A 3QODA 4HRLA 2I1WA 1ETYA 2EIJE 3EUKL 4B47A 3U64A 2HOTA 1SZ9A 3QB2A 2H09A 1B8IA 4FHJA 3QPTA 2XEVA 3SD5A 5IP6A 5A23A 1TTYA 1JCQA 5CMYA 4A93J 3NOCD 2QLZA 4D5FA 1OT8A 1FWZA 4HVBA 3HUGA 1OMIA 1RUNA 2KRFA 3AS5A 4YFNF 3EU5A 4PS3A 5JFRA 4YDEA 5FJYA 1DVPA 4KZ0A 5ARFA 4L5EA 1K7AA 4FT8A 3GXOA 4L0YB 1FTTA 1CF7B 5LLQA 1ZH5A 3C3QA 1LGPA 4NC6A 5ENPD 1U0TA 1U9OA 3AL0B 2QQAA 3ULQB 4E6KG 2I2AA 2AQEA 3HM5A 2IS2A 3TGOA 4HS2A 4FJYA 3F8BA 2PLYA 4HORA 2FE3A 5KHDA 3CVPA 1MJ9A 4HDUA 3I4GA 4JHKA 4Y4RA 2J09A 4KBQA 4O60A 1BW6A 3A03A 2HDDA 1X1PA 2RFAA 3H5NA 4K5AB 1TC3C 4HSRA 2FSWA 4L9PA 5EG0A 4HXIA 4FTHA 4GZ3A 5BNWA 3H92A 4K2EA 2Q7FA 1S9HA 4EQQA 2W48A 1VQPI 4XK4A 1LFPA 1T8IA 5FQ8A 5G05C 3K6GA 3BZCA 3PUFA 2HI3A 3U1KA 1W7PB 3HXEA 3KPHA 3GMEA 3FUEA 4L1BA 2EFWA 1MZCA 4CGVA 3RQIA 1T56A 1YX3A 2OQRA 3Q9VA 1P4XA 3HJEA 3PZ2A 4LLLA 4NC8A 3VLEA 4MNUA 2M8GX 2V6EA 4U8YD 3K2AA 2RV8A 3AG2H 4DZJA 4A3FJ 3HXDA 3LA2A 1P2FA 5FKKA 3IKOB 2X6KA 3HGYA 4WUYA 3I0MA 3S7DA 2W25A 4YIRX 3CCMI 4Q4ZF 2M5WA 2N8GA 3HRTA 1B6AA 1JI8A 2I2DA 4FC8A 4G2SA 3V80A 3C2GA 1O3QA 2K40A 3SI5A 2K4JA 2QQ8A 1QA6A 2L9VA 2BKGA 1UG0A 1P7IA 2DA4A 3RPQA 4XICA 3SDGA 1V54E 3VTYA 3GMJA 5B5EC 1MBFA 2KKOA 3KZZA 3PSFA 1IV6A 4RGRA 1UJKA 3O4ZA 4L5IA 1B59A 4C2TA 4N3BA 3CQZJ 3JRCA 2HYGD 3PNTB 2FU4A 1FSHA 3U9WA 2E60A 3GWZA 5GAEJ 3WTZA 4XI0A 1DGWY 2AXTC 4O5VA 2JA6J 2M63A 2H6BA 1SFEA 1XSXA 2XF7A 1PAQA 2EH0A 2LBFB 1VQ5I 5AIQA 4DUIA 3VZCA 2DYSE 1H9TA 4OAUC 3PQKA 3LVRE 2G7HA 3OL4A 5K7HA 2NVUB 1YJ9I 2KXPC 3F9KA 1SUWA 4OIRF 3FISA 2LP0A 1J5YA 1MNDA 3ROUA 3S1NJ 3MKYB 2VSNA 2Y48A 1Z7LA 5F1JA 2IA1A 5M3FJ 4GA0A 3APCA 4D10C 5B3SE 4PJLA 2FNAA 3ZU7B 2BONA 1E2XA 1X5BA 3LSGA 2IY0C 4WWOA 2D5VA 4UV9A 5TISC 2NYJA 4R1HA 5EILA 1JT6A 3FTSA 3IAS2 2IGKA 4M6VA 3I64A 2A05A 3OR2C 3CKCA 1YA0A 3APFA 5G2NA 1IQRA 1QYMA 2IW5A 2WQHA 3CR3A 1YT5A 3MWMA 3AG4E 3G2TA 5FD5A 1OCRE 3U4TA 3UNNA 1K3NA 1ZRCA 2A6EF 4HNVA 2EQXA 1W5TA 4A69C 2VGEA 5D6EA 4I43A 4YDYA 2ZJQF 3HC7A 1HW1A 1EH8A 4Z6YA 2K85A 4FULA 4AVPA 1G3TA 1X3ZB 1ZG1A 1N9AA 4WWCA 2LREA 2F37A 3CVUA 3TBIA 3ELSA 3H36A 2V8SE 1QPMA 4J8DA 4G7HF 5LCWJ 1KU2A 1GDTA 2UWMA 2DBBA 5DCFA 3ABMH 3EIQC 1XGOA 1MX2A 3C5RA 3IKVA 5G04C 1EV7A 4LK0F 1U9NA 4HX4A 1UMQA 1MBHA 1BI0A 5C4XJ 1U3EM 3LCAA 4PUCA 2L02A 4EJWA 5C4JJ 4BE0A 2EIME 3GYZA 1TWCJ 3RCOA 1K83J 4ZC3A 3Q75A 3HHHA 2CUJA 4QWQA 3WHCA 4D9VA 1KGSA 5AAOA 4OIOF 1K2MA 3RSNA 1W5CC 5FTPA 4AU7A 5J4VA 2WXLA 5G55A 2L4AA 2CWEA 4GU5A 2JSCA 3ZMZA 3QOEA 3CO6C 5ICFA 2KIUA 2TRTA 4HOTA 4FU3A 2F5VA 3K69A 4U8HA 3ABLE 1SA4A 1HQCA 3HRSA 2XRZA 2GW1A 1XCVA 2DT6A 1FSEA 4P9UA 2NAZA 1RR8C 1UHWA 3HGGA 3J81K 4N3AA 2CFZA 3RSEG 1D8KA 1HF0A 4CDRA 3OYNA 3FMQA 1ODDA 1XC5A 1UAAA 1P9QC 3DBLB 2P9IG 4UI9J 3HUFA 4ABNA 3BT9A 3KZYA 2BY3A 5LHHA 5FZQA 2E34A 1I5ZA 3DKWA 1N54A 1V5GA 4CDMA 4RM3A 5CVIA 2IPQX 5DCMB 2P9LG 3KSQA 3MKRA 5CLSA 2A5WA 3DBRB 1MH3A 5A6CA 4EGZA 1RI7A 3OR1C 4M74A 1YQAA 4FP7A 1QVTA 5L3FA 4O6FA 2Y0BG 2P0WA 5HDNA 2HQ5A 5JEMA 5FLXZ 5A2QZ 1T95A 1OY3D 2ZXWH 4A1GA 2E1OA 1NA0A 2L5QA 1F36A 2WC2A 3TDZC 3U1DA 4BHCA 4C3IJ 1MX4A 1OCOE 1S70B 2QC9A 2Z3YA 2DA7A 2E1NA 2WAQN 4Y6CA 5ANLA 3TO7A 2I10A 3L2CA 3ZMUA 2IA2A 3L17A 2QSFX 2NS8A 1A5EA 1WFXA 2XB0X 1BA5A 1NK2P 1RESA 2EZKA 5K7ZA 2JA2A 4JW1A 4JPSA 2QYOA 4DYRA 2CHWA 4ZYEA 3Q0WA 2HXIA 2IP2A 1PP7U 3ML8A 1BI3A 1MJ0A 3I6UA 1SEUA 2EINE 2BW3A 2QZ8A 2W57A 3A1YA 5JHUA 5AQ7A 2HO1A 2MGQA 4HNUA 3B7UX 3UM0A 5E50A 3ZW3A 4WX9A 3BJOA 1T6SA 1E7VA 3EQLF 1R36A 1DUXC 3D3MA 4EECA 2EA4A 3CHQA 3BTLA 3DWLE 1XGMA 5D0QD 2M4KA 2DK8A 2LK2A 3FUHA 1SD6A 2OV7A 2VQGA 3LWFA 3D9HA 2KPMA 3I4PA 1ZHFA 5FGMA 2V4HC 3H3UA 4XLNF 5ENSD 4MLOA 4GAAA 1U6GA 4BY6A 5EZGA 1WGXA 2HFHA 3JXJA 5CEAA 1T08B 2LY2A 3K1NA 4YFKF 4LK1F 3CIAA 3W6VA 4I2ZA 3MKZA 3ULYA 5J1RA 2LKSA 1FYLA 1IHBA 2UY1B 2FRHA 3GZ6A 1U3CA 5JJ7A 4N4NB 5D8KB 2UZKA 1BOAA 1L0OC 2DJNA 4BDZA 1O1SA 4FE7A 2PBIA 3CC2I 1EDUA 3HXFA 1BN5A 4B43A 2X48A 3FH8A 2L0TB 3V2XA 1XMAA 5J6XA 4GZCA 3CVLA 1Q1VA 2K02A 2Y0MA 2I6HA 1RZ4A 4BY7J 1Y8RB 4H4KC 4HQMA 5IP7J 4HRMB 5ENOD 5DS9A 2DA6A 2PMZN 1YTYA 3PFNA 3I3LA 2M0MA 3IXEA 1FC3A 2V1NA 1XCBA 2DMPA 4KVMA 2OU2A 3LOCA 3ML6A 5E8GA 1ONVA 3TGNA 5ENTD 2DBAA 3CCJI 1X1AA 1D5VA 4QIWN 5K7FA 3CEQA 4DRXE 4APFA 3FTUA 4XE0A 4H87A 4A6DA 3LJNA 4I9CA 1ZTRA 1Z0SA 2DIWA 1ETWA 4HF0A 3OYEA 1U0JA 2VBXA 1AWCA 3PH0C 4BT8A 1WJ5A 4K03A 1QU5A 5HOOA 3CCRI 5KNHD 3S40A 3H3VK 2VB6A 3H9GA 1J4LA 4IRIA 1Z05A 3ZMTA 2KB4A 2VJ5A 4N2SA 1OWLA 1BL0A 3DSWA 2ELHA 1SZAA 3GF2A 3CCYA 5D6FA 1R49A 3K9TA 4LRZA 2ADUA 2XAJA 1MBKA 3Q3SA 1G4DA 4XNFA 1JPLA 4XN0A 4QPQA 2WXNA 2FQ4A 2NVQJ 5GAHJ 3TXNA 5A8IA 1D3YA 4GB9A 4DJAA 2MOWA 2VE8A 4I01A 1KU7A 4Q5SF 3CSFA 3SO8A 1PUFA 2NS7A 4NQWB 3SZTA 2E2JJ 4HF1A 4IRHA 1H89C 3UN0A 2NXPA 5HRYA 2ELKA 3K4BA 4JK1X 1POGA 4FX0A 4I6ZA 1FYKA 3KYDB 2IJLA 3KP7A 1HCRA 4PK4A 4MKTA 1H2UA 2F4OB 3E32A 2H6GA 4RDUA 1FMVA 2GXGA 1WJAA 4KMUX 3WU2C 1MBGA 2XKPA 3DRAA 2BXYA 4PS8A 1ZG5A 3BPVA 3JRIA 3Q73A 1X4PA 2RNGA 4IL6C 3Q7FA 4GMJA 4JD2G 4GPKA 1SFUA 1SC7A 2GRPB 3Q5MA 2JQIA 3GTJJ 1S29A 3K70C 3S17J 4GCOA 2O61A 4L23A 2AXUA 1J2XA 2IXSA 3OYKA 3E97A 1IKND 1SFKA 2QWWA 4XN3A 5FKOA 3TO6A 3Q5FA 3WG9A 3BUAA 2XEHA 3Q47B 2OQGA 3F8NA 3RPUA 2IT0A 2E7WA 3HOVJ 3JQ0A 3M8JA 3OYGA 3NOGD 2HTJA 4DI4A 4ZH4F 3F6OA 4JQFA 3A77A 1B72B 1E3PA 3FTWA 3OSGA 4XBFA 2LY9A 5L3EA 3DSTA 5FINA 1Z0ZA 3PZDA 1BM9A 2WV0A 4XLHA 2P5LC 4EJVA 3OYDA 3ECOA 4KDPA 3ZIMA 2V79A 2WV1A 4WWNA 5H2FC 1NG7A 3VYRB 3V8PA 2V1XA 3FM5A 4DPRA 2KQRA 3QYFA 3QP6A 5DYMA 3MX3A 4XIFA 2R5ZB 3M07A 3OIQA 4BKXA 1XS9A 2R0QC 1BI8B 2ZKZA 4ON0A 2XCCA 1FNNA 1Y1WJ 3DSXA 3I53A 2C0MA 2XENA 3FX3A 1U2WA 2VKEA 3BPXA 3DEUA 1R71A 5FFZA 4HF2A 5CERB 4UUSA 2V7FA 1RIOH 2ZFWA 5F27A 4IOCF 4EZLA 2EV5A 3BR2A 1N94A 5LX8A 3ISPA 3KP5A 2CW0F 5CEDB 4CDNA 5FWQA 1QQIA 3ZRHA 2XGXA 4U04A 5AQAA 2DA2A 4M3BA 1WLNA 4RGSA 1KYZA 3P2BA 3ASNH 1BC8C 5J08A 3GTKJ 5IT9Z 2B9SA 5EGOA 5K5QA 4QQIA 1WKMA 1JXSA 2FXAA 3DBHB 2A68F 5J4YA 2B0OE 3ASNE 3PM1A 3TP3A 2D1VA 2QBYB 1Q2ZA 1IRFA 2LH9A 3VFZA 3QNKA 1VNDA 3FBNB 2GZWA 4XKBA 3G1OA 3L16A 3SNXA 2RQQA 2AW6A 5JEKA 2K7LA 1MH4A 2LD5A 3LY7A 2JVHA 2ZMEB 2R7QA 2G0EA 1SMYF 3SYTA 3CO7C 5AARA 4C2UA 5BMZA 3SGHA 2VTBA 3QARA 3R6SA 3Q7AA 2EFPA 4XIDA 4BAYA 4ESBA 3GTOJ 1DCEA 1L5JA 4FHKA 5EYPF 2JRMA 2QM3A 2DJIA 1SD7A 3KAEA 1OQYA 2NOGA 5AJDA 2J4BA 2KDZA 3KSLA 2XPVA 4JL0A 1Y56A 1XDSA 3G71I 3CVWA 1TWAJ 2OD5A 3RQ4A 4XX5A 1ZAOA 4C0MA 1XDUA 1D0YA 2CQNA 1K78A 1O4XA 2A07F 3UQ3A 2WADA 4QTRA 2EIKH 2F5FA 3P7NA 2BV6A 2GA2A 1A5JA 1X1BA 3HYMB 5FZRA 3N71A 2OAZA 2XGMA 5BQTA 2YX4A 1R00A 4PGGA 1A6QA 5C1DA 4L9JA 3CLQA 5LEJA 2OCCE 4IZZA 1OR7A 3KCCA 2Z16A 4II3A 2EH3A 3PE3A 2BE5F 5KJMA 2HVQA 1Y1VJ 2PJPA 1ZLKA 2VUMJ 3PDNA 2M8EA 1ITYA 2ZJPF 2LYCA 1D8DA 4LSZE 2Q2EA 5AQBA 3DLAA 3VYUB 5J1YA 4BWRA 5KBAA 3T5VA 4CXFA 5JLWA 5FLMJ 3SJMA 1XSDA 2IO3C 4YVOA 4U87A 1SQMA 1D0XA 1WH5A 3BOQA 2DOFA 3E5UA 3L7WA 4O1OA 4A55A 2V1DA 1O5MA 3FWVA 4Y6WA 3OUNA 3PE4A 5DUKA 1YJWI 1KU9A 2P9KG 3HPHA 1JUQA 2Z2SB 4UUCA 2DZOA 2ECBA 4V2GA 4KYWA 4E7SA 1BI7B 1FVFA 3DEOA 4GA2A 3TWQA 4XM3A 4OMZA 1U7FA 4MO7A 3KIOA 1ZG3A 2DPDA 3MD2A 3JCKC 4BFRA 2V9VA 4MQ9F 2OVBA 2LG4A 1UHTA 2CQQA 1HG2A 3SBTB 2BY2A 2ME0A 4E7IA 1KQ9A 1U5TB 3DTEA 4FHTA 3DCFA 4X0GA 1H2VC 1BU9A 2VJIA 3ZQ7A 4CUGA 3GX4X 4IO9F 3PSIA 1NZNA 5ENQD 2OZ6A 5JERA 2FEZA 3HXBA 3NQPA 4M3DA 5JLXA 3L2QA 1Z5SC 3GTPJ 2IFUA 1T39A 5KWDA 4PDKA 3C2BA 4GZDA 3I59B 4GYWA 1TJFA 4BEHA 3TG5A 3V30A 2EZLA 3FFLA 1T2KA 4NHJA 1MJSA 3BCBA 1YS6A 4IEJA 2YHEA 4RB2C 1IW7F 2BGCA 3ESLA 1NFIE 4FJZA 4GCNA 4E4HA 3KETA 2MYOA 4DLQA 2VQ2A 2FBIA 2K9LA 4U7EB 4A3DJ 2W85A 3I6WA 2JKDA 1FP1D 2XB5A 4RLFA 4CZCA 3QDNA 4U95D 2CH0A 3DPLC 2LTPA 4DY6A 1OCZH 5DJOA 4A3MJ 2AVPA 4UY8I 5JR3A 4WXDA 5IY5E 3ZHEB 3CDIA 1J2FA 3KS2A 2E36A 4I1OB 3BJ6A 3C18A 3FIWA 4KIBA 1FOKA 1WVRA 2MW8A 3TKYA 2XGEA 1YW8A 2NRAC 2O8KA 3UT4A 2J5PA 2GOXB 3FXKA 4DX7D 2E1MB 2AQFA 4BGDA 1U0RA 4XEIG 1TW3A 4BESA 2A5UA 4XRSG 4Z68A 2R5YB 3ML9A 1NP7A 1DEVA 4RM2A 3JW4A 4PZJA 4RAFA 1AU7A 3CQCB 4BUPA 3CSTA 4GTOA 3NB2A 4GYYA 5J90A 5JEOA 1WI9A 2XAGA 4QPOA 1JHHA 3I54A 1Z9CA 2IU1A 3F6VA 4GGGA 2ZCWA 3HOWJ 3FXJA 4BQQA 1MW7A 2CO5A 3PZ3A 1VI0A 2OBPA 3D9MA 3HDDA 3AG3H 1QBJA 4U0UA 3FF5A 2J5OA 2X4HA 4XKVA 3T8RA 4E6HA 2M3AA 2OA4A 2WVIA 3OYFA 1K6OA 1R22A 3KEQA 3JTGA 3QWWA 5E76A 2XEEA 1LVKA 2X1DA 1IN7A 2K9QA 2M9HA 3BTJA 4W1UA 5LHGA 3L6AA 2GOMA 4IHTA 1HKTA 3OYLA 2E71A 3GTMJ 5L3DA 3FU5A 3LY9A 2QQ9A 4UNOA 2J07A 3IV0A 1R1VA 4I1AA 4TRQA 2P6TA 4HA8A 1YW7A 4A0YA 2G9WA 1WV3A 5ENRD 3CGHA 1RETA 1NA3A 3NF1A 1QZEA 3ESWB 4PH4B 3TWXA 3C3WA 5IT3A 2LC2A 1KZOA 2A4ZA 4ZYGA 4N39A 4URKA 4HBLA 4HLXA 1JHFA 1Y8QB 3MZ8A 1JKPC 1QNFA 4F93B 2JRTA 4EZJA 2EPFA 3ZQFA 2P4WA 4EM0B 2RVCA 3IRQA 3JRHA 1V5FA 1USSA 5FROA 4GA1A 2VBZA 2RG8A 5JMND 3TWWA 4HW0A 5DHPA 2XC7A 3N97A 1VF9A 4A3EJ 4JEUA 1PVEA 2PEXA 3BG1B 3EHNA 4XONA 3HIZA 1XGSA 2Z1DA 4LEUA 3VDXA 1D9SA 2AN1A 1OYWA 3CD6I 1WJFA 2EILH 5H6RA 1Y39A 2AJAA 3BR5A 3E3VA 5IYBJ 5LGUA 1QHHD 1YI2I 3FU3A 1KHXA 1DMZA 2L2OA 4KN4X 3M1CA 5FB2A 2DFIA 1LFUP 2DLLA 3SZGA 3H5RA 3T8TA 3MQ0A 1W0UA 2JVGA 2Q1ZB 3SEZA 4F7ZA 2LAHA 2V4LA 4BBRJ 2CHZA 3O8GA 4CCJA 4CYCB 4DOZA 4DNCA 2HS5A 1MSEC 2KZTB 3DTKA 5GP9A 4LIVA 3CHRA 5CMWA 1KQ0A 4HV6A 4LG3A 1SMTA 4UVCA 4AC0A 2V0PA 1OWOA 2JK3A 1R1TA 3H9JA 5LHIA 4EM1A 2UUZA 3M3YJ 2ETCA 3L54A 3DEPA 2DMTA 1H2TC 1OUVA 3UMZA 1GV2A 1ELKA 2VGXA 4LNBA 3JRAA 3HZJA 2R7OA 1IXSB 3L9TA 2KZVA 1ETXA 5E75A 3ZYMA 4ACLA 3V8JA 3ZPLA 2ZNYA 3LL7A 1XSVA 2EIJH 5H6QA 3CF5F 1Z21A 2P81A 4D7NA 1JT0A 1K79A 3LFKA 1R5ID 5DHTA 1HOMA 1X3WB 4KA4A 2J08A 5ILUA 3GFMA 3UV0A 1MNMC 4HG2A 2ZXJA 4MTEA 3EUVA 3JREA 2CV0A 4ATZD 3G2UA 4AIJA 2B6CA 4HQEA 4HOQA 2DQRA 1I39A 4MBGA 3RO2A 5HLTA 1Z91A 3IHYA 4ESJA 5HDKA 2XDVA 2CSWA 3CDHA 2W4SA 4N5CA 2X6FA 2VJJA 1ZR2A 1A6IA 3P5JA 3BG3A 3QYBA 2I1KA 4B09A 2QYUA 4PUSA 1OXJA 3SFYA 3L2UA 2A5EA 4ANUA 5CPRB 4MS6A 3I0TA 3CTAA 5JELA 1T33A 4L18B 2FMLA 2DWZA 4FQGA 1J59A 1I27A 1QWTA 4MIMA 1R7JA 3F72A 3WGHA 4B3AA 4DX5D 5ILVA 3AS4A 4S05A 3MN2A 2MRIA 1W7PA 4RAZA 3EHQA 2P9SG 1UN8A 2PN6A 3TOBA 3CLJA 1XMKA 4AIFA 4BNCA 1E8WA 5DIZA 1WJDA 3ABKE 1PDNC 1JCSA 2L7KA 4Q94A 1E8YA 2X0LA 4BJ5C 4B93B 4ACKA 2VONA 4EGYA 2VOPA 5E3OA 5M72A 3KP4A 4J0UA 3PO8A 1ZRFA 2GXBA 3VOEA 2R7DA 2ZFUA 1A35A 2I2OA 4J00A 1MJBA 2A6HF 4U8VD 3UIPC 1OWPA 4DI3A 2WB1A 2VC0A 3IAM2 5E1ZB 4KNYA 3J5QB 4HI9A 4AOFA 1FHQA 3HIFA 1SAUA 4ZYAA 2VPRA 1JWFA 3VLFA 3WODF 3S15J 3U66A 4DGWB 3J7AO 2WAEA 3SQNA 2STTA 2BY0A 4A4YA 1QO0D 1UG2A 4OVVA 1R5GA 2R7WA 5IP9J 4A1SA 1D0ZA 3DF8A 1ELWA 1V54H 1SD4A 1O3SA 5FQ6A 5EG0B 2CQXA 3G2SA 2XAUA 4CCKA 5F1RA 4L5JA 2ZSHB 4UWHA 3FTVA 1W4MA 2UXNA 3V2OA 2O3FA 1QVUA 3DXMG 1R1UA 5M3MJ 1YYVA 1T0FC 2DODA 3FWEA 2LBFA 2XVCA 3KEYA 3HKZA 2IS4A 3DPYA 2BEDA 2F8XK 1FTZA 1FLIA 4GYGA 5K5RA 1XGWA 1XB4A 2DYSH 4HX7A 1ERDA 4C9BB 3E1SA 1I6XA 4I02A 2J9QA 3A0BC 3KP6A 3HVEB 3NAWA 3H5AA 2XASA 5E3MA 4YFXF 4BSXA 1BD8A 4BE1A 1SVXA 3TWVA 3N05A 3AJIA 4C3HJ 4W9RA 5B3SH 2VGYA 1A04A 4KXKB 2RKHA 2UWJG 1QZZA 1JTYA 3R7QA 5FRNA 1T98A 1ZR4A 3CVNA 1NTCA 2L0KA 1ACIA 2YQ8A 3O48A 4HOSA 2V26A 3V7WA 1TNSA 4F7AA 3JCUC 4OOIA 5J1UA 1TYQG 4GTMA 4F52A 5DTDA 3B6AA 3AFHA 4MEXF 3FUKA 2RQPA 3GVAA 2DDBA 3AG4H 2R2LA 1AKHB 3G3ZA 3LA3A 5CHEE 1OCRH 3T5XA 3PREA 4GTTA 5F0HA 2W82A 2JZYA 1GHCA 4ANVA 3FXRA 1FOWA 2W1OA 3TO9A 1BI2A 1G6NA 4U0VA 2QEXI 3EUHA 3K4CA 2MYSA 1FOXA 5CVUA 1RW2A 3HTUA 3LYAA 4A0XA 1U8BA 1W7PD 2XT9B 3I71A 2VPLA 1N4PA 3MCXA 3OXFA 5E20A 3PS6A 2CMPA 4RGXA 3EJNA 4G9YA 5LOZA 5M5YJ 3LSIA 5JHFA 2Z5UA 3WGIA 4GFBA 2WXKA 3B95A 3LXUX 4PDXA 3F0CA 4F53A 3SF4A 2XHKA 3DKXA 4ENKA 3VPRA 2R7ZJ 2BRFA 3A01A 3V4GA 3OS1A 3FEXA 2ZISA 2R4GA 5EEAA 4G7ZF 6PAXA 3IBEA 2L9NA 4B94A 5EDSA 4ZYDA 1G3GA 4KT6B 1X81A 1YJMA 2EIMH 2HM8A 3S8PA 3W3CA 2HXOA 5CVRA 2KJCA 5FRMA 2X1EA 2JA7J 1UJJA 1Z7UA 2I1JA 2V5FA 4I6GA 1FBSA 2DZNA 2GM4A 2E35A 4PSXA 4Q69A 3FZVA 1QZ2A 3MZYA 3EETA 1R9TJ 2FF4A 2L6JA 3ASFA 3E6CC 3TW7A 3QPSA 2XGDA 4CCNA 4GO1A 2DA5A 3OYAA 1TZLA 4XOPA 2R17C 1ZGWA 3HYIA 1OFCX 3ABLH 4RA2A 4E7JA 4GDFA 1LD7A 5TJJA 1O57A 2QENA 3IC7A 3HL2A 2JQ7A 1ULYA 1X2MA 2QGUA 2DO7A 1BLXB 2B63J 1DU6A 5CBOA 1OWNA 1YG2A 2GLOA 2QA4I 4IHVA 2GRLA 3PEUB 3CCVI 1WY6A 2ZC2A 2VT2A 2XS8A 2MLGA 4UWKA 3CCLI 4BX8A 3P9CA 3ZRGA 1TNOA 3UKGA 1G59A 1SVMA 1H8AC 4CH7A 2ZXIA 1VQ4I 4G26A 3BTCA 3DP7A 3CK9A 4EEFG 4C0EA 3JSPA 3ELVA 2KFUA 2O7OA 3ONQA 1G8XA 5DHUA 3J7AY 2CJJA 1J0RA 1VQ6I 4BXXJ 5B66C 3AU5A 3QWVA 1OCOH 4K5BA 1VQLI 4EJTA 4R9PA 5GPAA 1OISA 1WRJA 3REOA 3PZ1A 2LC1A 2XGOA 2H8WA 1GLNA 5CVJA 2HDWA 4ANWA 3D9IA 3PUJA 4UVAA 4XZ4A 2IBDA 5AONA 1TNTA 3HX1A 1X4OA 4R8HA 5HLGA 3IV5A 3LNQA 3RIBA 4XKCA 4I1MA 2DTRA 2X6OA 1LEBA 4J8YA 5JHAA 3J81Z 3O3KA 2PL2A 2NNNA 3L2RA 2F48A 3WGGA 5FJ8J 3G6EI 4DLOA 2ZSIB 2EINH 2PQ8A 3PIOF 2IJGX 3E5XA 2PZIA 2IGOA 4G94A 2FNPA 2JPEA 2XAQA 2P9UG 2PM7A 2KB3A 2E5ZA 4CCAA 3UKRG 1MHQA 5JEJA 2MD0A 4HAMA 3QOUA 4UB6C 3ZXSA 4ASNA 3MJWA 4M71A 3RYRA 1ZARA 3IKTA 4JEHA 5D0OD 1H0AA 3B7BA 4YDWA 3DSVA 3BTIA 2CFUA 2R59A 1ZU2A 4BYYA 4BXFA 1FJLA 3CK8A 4HFGA 2FMYA 2AHQA 3FXQA 3EPZA 1OCCE 3WTUC 1MSFC 5EEGA 4CDGA 5FFXA 2F4MB 3Q79A 4N2QA 3POAA 1I3AA 3QRFF 4OIQF 1XX5A 4L02A 2JPBA 5EIBE 3ERMA 3MKQA 3UXGA 1DPUA 3NZUA 5BVIA 3OIPA 1L3LA 2QZAA 2JGRA 3KX2A 1Z6TA 3K10A 2CUEA 3V8LA 2HR3A 2RDPA 2XGCA 3K4NA 3CCQI 3UT7A 3QOPA 3NARA 1LDJA 1HSTA 2RREA 4L9VA 2YS9A 4P1WA 3VODA 4A2UA 1S6LA 5EJHA 3EUHC 4DIQA 1K1AA 2WXGA 3TP0A 2X38A 1K1BA 1R23A 2EFQA 1FPQA 4ILIA 5D4SA 3DKYA 2AXLA 2BW3B 4P5OA 2PIEA 1JUPA 2VLAA 4E85A 3MEKA 1K4SA 5JJ6A 4LG0A 2J49A 4XSXF 4BS9A 3S14J 2QVLA 4RMNA 2O5RA 3LSRA 4HLLA 3ASDA 2ID3A 1MBJA 3VWBA 4DBRA 3JSOA 2XS1A 1G3SA 2X6WA 1OKRA 2K4BA 4M9XA 5LGNA 2COMA 4FLHA 3D5RC 4JVSA 4BEPA 3V7SA 4KMFA 2J4DA 4KISA 3FUNA 4UI9K 3NEUA 4A5MA 4N5QA 5HS0A 2JABA 4AIKA 3LEWA 2ZJRF 2FA5A 4ZDOA 3CJRB 5E3LA 5DDGA 3GZ2A 2W84A 2IONA 2H6FA 3MGBA 5D5UB 1JJ8C 2DFFA 3DQVC 4Y7NJ 5T8IA 4ZHBA 2KISA 2KT0A 2Q8KA 2RFMA 1HBXG 3L82A 3TDUC 4I76A 4TV7A 1H6PA 3HPGA 2EZHA 3BQZA 2W7NA 3QAQA 1MDMA 2F0YA 3FUJA 2E7XA 4FCYA 3PUKA 2M87A 1GV5A 3TMOA 3JRDA 3A2KA 4IX7A 4FLBA 1I3QJ 2DMQA 1VQKI 2QSHX 4NIKA 3OXGA 2CG4A 3HSRA 4JXTA 1JJ6C 4S0HB 4BJTA 3CCSI 3B6CA 3LA7A 2RNJA 3MFKA 5D5VB 3RZOJ 1Y3IA 2XF5A 3VLDA 3L09A 3WTVC 4ZTJA 1HG5A 3UM2A 2LR8A 3IUOA 4JX5A 1QPIA 4G1TA 2WQ6A 3JR9A 4C30A 2P1RA 4LGWA 1KHUA 3FU0A 3GO5A 3FXLA 4NRHB 2WAFA 1IO2A 2COBA 1HXIA 5IOZA 3OMYA 5G05J 3VA4A 2BOLA 3X2QE 1AWCB 3WTTC 4XMYA 3URZA 2GBYA 2LY1A 1IF1A 4MQVA 4AYBA 3M4OJ 1R5HA 2Y75A 4EV0A 2GGFA 4QCJA 5J47A 3CMEI 2JN6A 2JQJA 5L3BA 1P92A 1IRXA 1FEXA 4IJAA 3MZLB 3SFIA 4CYMD 2I5UA 3CLOA 4HOUA 1IC8A 2VYIA 5AYWD 2AO9A 2NXNB 4AV7A 3BQYA 4AEZC 3PRZA 3E6BA 4AJWA 3BWGA 4GPMA 2LO6A 2AS5F 1WQ2A 2L4MA 4NURA 2FOKA 2X9DA 4G6TB 3S7FA 2M30A 2OTLI 1XPXA 3ONKA 3DV8A 3R0JA 3TL4X 3CVQA 3MVPA 3GLLA 3WG7E 4F6RD 3K4JA 3V31A 2IA0A 4YVQC 4WWPA 2JTVA 3M7GA 3C3RA 2YX7A 3OSFA 3I4NJ 2HVRA 3ESKA 2NYXA 5FLVA 5E1WA 3R4KA 1ZGJA 4HX8A 4GCVA 2LF7A 3ECHA 4AP2A 3AKZA 1GVJA 3B73A 4EJOA 2Z9OA 2CUFA 4ILGA 3LMMA 3PQJA 3FKJA 3APDA 3ZNGA 3IH4A 2PMUA 4KITB 3OAWA 5CKTA 5M5XJ 2L7FP 5HODA 1IV8A 5BPDA 1T38A 4Y3OA 5IYCJ 4HBDA 5F08A 1MMAA 4BTAA 4Y33A 3F8MA 5FO5A 4PJJA 1YOVB 4ABZA 1N0QA 1GUUA 1JE8A 4GTSA 1KPSB 2XQ0A 2FX0A 3V8MA 2ME6A 4WNDA 2KKLA 1MYOA 4AUXA 2CSOA 3KZIC 3G2VA 4D0PA 4OAZA 1I50J 4FETA 3RTRA 2JWTA 3PIPF 3OS0A 5JVGF 3S1QJ 1FT1A 2ZO4A 5F04A 4J8EA 5L3GA 1DP7P 4MLPA 1KT1A 4E70A 4CT0A 2DDAA 5GADJ 2DYRE 4P9FA 1WWXA 3L1PA 4UUVA 1MMNA 2JMWA 3RIRA 2DXIA 2JUCA 4LCTA 2EZIA 4CGWA 1EH6A 1I1SA 1MJAA 5LP0A 5DHSA 5TGTA 3E6MA 1IGNA 3FUDA 3FHNA 4M3FA 2BZTA 3GUDA 3K0LA 3OS2A 4A3KJ 3HDXA 3DSUA 5CRUA 2ACJA 1F43A 2E1CA 3MKQB 3QYEA 4JP0A 1DGRM 2P9PG 5EDNA 1N25A 3HTSB 1E0EA 3V7CA 2IAIA 4A12A 5AIPA 2OUMA 2BVMA 5E17F 2F5EA 3FBIB 2DI3A 2L9BA 1G3WA 5E8IA 1ZLJA 3E7LA 5G04J 4I2OA 5CRVA 5LRSA 1N0RA 2MG4A 2LF8A 3LSJA 4OAYA 1O1RA 2BVLA 4IULA 3W9FA 1BPOA 1R4MB 2DOAA 3FM3A 3RKWA 3UTMA 4HNAD 5IYDJ 2RGVA 1HDPA 5ARGA 4L7TA 4PCQA 4V2FA 1S3JA 3SHFA 1VZ0A 3RKXA 4HPQA 3F3XA 2DVWA 1Z1DA 4LB6B 5FKLA 2OOEA 1QZYA 4M73A 3U2RA 4RAYA 2OCCH 1CGPA 4U0YA 3ZYKA 4NBQA 2I2CA 3DBSA 4WAFA 3UT8A 2M7BA 1G88A 3ZYLA 2YUSA 5CYVA 2F8YA 2LFBA 4P55A 3GTQJ 3Q78A 3TWSA 4A3CJ 3CHPA 3C72A 3RRNB 2H27A 2JLBA 2HQAA 2Q0OA 1EPUA 2W24A 2ZBKA 4D5CA 5KNLA 4KN7X 2LXMA 2PQNA 3FH7A 3DU6A 4GZ5A 1TNBA 4DZPA 2LKPA 4UQYA 2L0IA 4FA6A 2Q5FA 2GRNB 1TP4A 2KBXA 3W2AA 4BDYA 2OC6A 3I55I 1H6KA 1EF4A 3ZPJA 2NVTJ 2LVSA 3KT9A 3CZ6A 2GRQB 1W36D 2CGPA 2KDOA 4F92B 1E96B 4G8LA 1QHGA 4F1PA 4BHBA 3V7YA 1K3ZD 1BR1A 4UUTA 4LOCA 1U5TA 3LAPA 3BG7A 3CCUI 3T0YA 3WTYC 4IHWA 4BU2A 3BZKA 2NVXJ 2O03A 1WCMJ 4NQ0A 3CVYA 4IF4A 1Q1HA 3V8QA 1B4AA 1WJCA 3P9KA 3IWFA 4IQ4A 3OYHA 3KEAA 4BACA 5KAIC 1YRNA 2CQ7A 1LQ1A 1IN4A 2VSOE 4GTVA 3VZBA 2IOSA 3V7UA 3UOTA 4H7XA 2R7RA 2GQQA 3GZ1A 3RAUA 4HSTA 4PJNA 2WXQA 1IDZA 5A7DB 2GAUA 2VL8A 4Y52J 4M6XA 3S1MJ 1K8KG 3FH5A 3TXMA 3S2HJ 3D9LA 4A5NA 1JGGA 3CUQB 4LFUA 2AXZA 2K5CA 4EPZA 1I1GA 2Q2EB 2FOWA 2P5KA 3EYYA 2E2EA 3ASHA 2PJRA 5E79C 3K4KA 2R93J 4A0ZA 2NC9A 4O3MA 3HOSA 4U07A 2CS3A 3ZN3A 1DNPA 5FQ4A 1S0PA 2X6HA 2CFOA 2L01A 2UXXA 2MBFA 4CT4A 4B3XA 2OEVA 1N95A 5KJKA 1U7FB 2MC3A 3SBSA 2W3OA 1MD0A 3UKUG 3UX4A 3GCMA 1P4AA 2QSGX 3J80K 2WXJA 1Z0XA 4M9ZA 2MFZA 4G6QA 2HKXA 4QLCU 3CP2A 1N4SA 3DFGA 5IY5H 3UI2A 4GTPA 4YEJA 4U0WA 3JAMK 1JKQC 4ZFHA 2XROA 2K3FA 2XIGA 4B8XA 3W2VA 2Y9ZA 1ZREA 2BHZA 3F8CA 5BV1A 5LCWC 4E7ZA 1U8RA 5EJFA 3ZOBA 1I6HJ 4U7BA 3R9MA 2B7EA 4C9YA 4JHRA 2I8DA 2L9RA 1TL8A 2WB2A 2HOEA 2RC4A 5EN5D 2JUGA 4XRFA 2OVFA 1GXQA 3GZ5A 5LGTA 1QRYA 5H7PA 1DQUA 1S72I 4XLFA 3BR1A 1TT5B 4BEHB 5F6FA 2P5VA 5E3NA 1IN6A 1GT0C 1LE8A 3F21A 2IQCA 1K2NA 2MH2A 1TN6A 2TCTA 3ASOE 2PMHA 5EIDA 3CVXA 2ZU6B 2WY8Q 3HEFA 4HZFA 3S7JA 1ZRDA 2YU9J 4TXQA 5F0CA 4EJUA 4TUUA 3TWRA 3GZNB 4EZKA 2ZXHA 4KU0D 1WI3A 2RD0A 5JVTA 3RZDJ 4BBSJ 2HKOA 4IXAA 2R03A 5B1AH 2X6XA 3BROA 3JAMZ 4M9SA 2QKMB 5DV5A 1F1ZA 4BX9A 1X3UA 2YR2A 3U9GA 2BBYA 5B1AE 1TWGJ 3I9V2 3FK6A 3MEXA 3RKVA 1S7AA 5IOYA 3CESA 2QQBA 2P7VB 5L3CA 4ANXA 4F3VA 2VBYA 5GPCA 3Q4AB 4ZJZA 2WXFA 3FMRA 3TG4A 3PFYA 1EKEA 3ZYQA 2WB1N 1U7VB 5D8LB 4BERA 1JKOC 2HZTA 3DU5A 3KLNA 1K6YA 4BHPA 3LY8A 4UI9C 4AVZA 4E7KA 4AWXB 3TEDA 4LNUD 3E33A 1D1AA 1WHUA 3FDYA 2H1KA 2IOLA 3HHMA 1YLFA 1LVAA 5HLHA 2BYVE 3ERED 2E0IA 3JQ1A 4MRUA 4A6EA 1SA5A 2QYJA 3TWTA 4D9JA 1G3YA 2HOAA 3QQAA 1OR7C 5CCMA 3GZSA 3FXOA 1X2NA 3F23A 2IS1A 4DQ2A 3QPLA 1PY1A 5EX0A 3T8KA 2ZGGA 3GW2A 3KP3A 1GXPA 5AIJA 3NZSA 3H0DA 1BIAA 5KJLA 3HKZN 2QVOA 1XNFA 1GXCA 1J4OA 1A36A 3DEEA 1IAWA 5FT9A 3ZFWA 1MKMA 1MMDA 4GTRA 1YE9A 5FD6A 4RB1A 3W6JB 2CHXA 1OWMA 2KZTA 2VJ8A 1U5TC 3LJ3A 4ZDPA 1Z67A 4PSWA 2BTDA 2XZDG 4FADA 5DHQA 4A3LJ 2ELJA 3AAFA 1W0TA 5K5OA 4WRRA 1N4QA 4UWGA 4XSZF 2LUHA 1V55E 3ZGQA 2PG4A 1QNTA 3Q0VA 4I99C 1UFMA 3OL3A 5CQGA 4F55A 3RI4A 1VFCA 2JA8J 5FKNA 2Y3AA 4J8FA 3KYCB 1VTNC 1NK3P 2YNQA 4Q96A 1HSJA 1BOBA 4CRWA 2MA3A 3VEPA 1V5EA 1NHAA 1MBEA 1EJ9A 1E17A 3RYPA 4B44A 2M0CA 3ZR8X 3V8RA 3ZQQA 1HW2A 5DHRA 1G2HA 1F5TA 4ZYHA 1OCPA 4I0AA 1LUJB 2VE9A 5C4VA 4CCMA 3FUIA 5T4YA 2K86A 1HC8A 3Q0UA 4LJZF 2DU9A 1AHDP 2WPVA 3FU6A 2WA0A 4NB5A 3LSKA 4XLAA 3Q49B 2ZGDA 3BC8A 4TUMA 1YGSA 2WTEA 4JONA 4L2YA 4DYCA 1HZ4A 4ENJA 1ZOQA 1STZA 5ED4A 1APLC 3BU8A 2FQ3A 3FULA 1DD1A 2LLKA 3VB2A 1CF7A 1S5LC 4ESFA 5GAGJ 4ATGA 2STWA 3D9KA 2Y4UA 1HFAA 3HOTA 3ULQA 1IXCA 1ZGAA 3L9FA 3GLXA 4JIVD 3CQGB 4RLQA 4WK8F 2XRLA 3UIOC 2CU7A 2QV7A 5BV0A 4FE4A 5D5XB 4AY5A 3MKLA 4AIHA 3FHZA 1FYMA 1JGSA 2OTJI 3RJVA 2H1LA 3ZN0A 1A31A 3FUMA 4B8AA 2XAFA 3IWZA 3ZQIA 3QJZA 5EX3A 1B9NA 2E1MC 2Y0SA 3SFXA 4IKFA 1RUOA 3FM8A 1FVHA 1O7FA 3DEWA 2C2LA 4TXPA 5BXOA 1K3QA 3J5PA 2LNIA 3IEGA 3UINC 3F6QA 3K9IA 4AY6A 3WE2A 4AD9A 3JXIA 1LJ9A 3T8MA 3MZHA 2CG3A 3RK6A 2MC4A 3QC1A 3ABKH 1G6GA 1H6OA 2VQCA 1JTXA 4BT9A 2ZJ2A 5EF6A 1B8IB 3A0HC 5HS8A 1E90A 2KLOA 3BG0B 3KEOA 4Y15A 1QGPA 2VODA 3HUGB 4J6IA 4IQJA 4LIUA 2C0LA 3SEQA 1SW6A 3ASGA 4XOTA 2ISZA 1WJEA 2D2WA 3AS8A 3ZQHA 1TQPA 1XMXA 1H0MA 3OWTA 4L9NA 1HXDA 2OCEA 4ZZDA 4HEA2 4WCGA 3CCEI 5C2YA 2M45A 4RG9A 3V79K 2L9SA 4BY1J 2KP6A 4IHYA 4AM3A 3G4SI 4EVIA 1BC7C 4GYOA 2O6GE 3HOZJ 1TW2A 4JA9A 9ANTA 2EK5A 5TRDA 4EQFA 4UV8A 3AAAC 3L13A 3O6BB 4BQAA 2VSXE 3LVQE 1R58A 1GW6A 2H94A 5KNGA 4B8CB 2HU9A 1IHGA 4V24A 2EV0A 2MD5A 4TXRA 2Y2ZA 4UHTA 2DAOA 3COAC 1E7UA 1R21A 3MCZA 2CV1A 3HOUJ 2DOEA 4I7HA 2YPRA 2PNNA 3H0GJ 2E5NA 3PNTA 4D1QA 3IRRA 2PM6A 3BDDA 3GW4A 1IYGA 2DN0A 3FEYA 3HVEA 5F0FA 2X3MA 3EYIA 1J9IA 2H6HA 2EJRA 4I17A 1FCHA 2V9KA 2KIMA 2Z33A 2NSZA 4ZZLA 3AG2E 1VQMI 4IVNA 1SANA 2HDCA 4X1EA 3TL5A 5GTHC 5J40A 2GRMA 3GQSA 2XSDC 1HKSA 3LKUA 1YO5C 3ONLA 1KZHA 3N4MA 1V4RA 3WXXA 1HKQA 4N4OB 1IXVA 4CYDA 3GTGJ 2PQRA 1W5SA 1MNEA 1XTAA 3E30A 4A63B 3EIJA 3OYJA 1OYYA 1E3OC 3W9GA 3FXMA 4WNGA 1E3HA 3HBLA 4GMRA 3S2WA 4A3TA 2I2FA 3FDHA 2VQLA 3CUOA 4JX4A 4BTBA 4YIIA 1INZA 2OEWA 2BHYA 4N0BA 4CCOA 4HI8A 2CYYA 2X6YA 5IPAA 3QU6A 4OINF 2C6YA 5ICCA 2BXZA 1OLTA 2K27A 3PL8A 4YRVA 2A61A 4NC7A 4CZ2D 1FHRA 2HGCA 4H0EA 1H9GA 3I3NA 4ENMA 1LKXA 2QKLB 1LFBA 1UHSA 2HYJA 2YSRA 1C0WA 1LF8A 3S16J 3D0SA 2Y69H 2R05A 4DX6D 5JJTA 1LB2A 3F22A 5E18F 3Q15A 1O1TA 2EFNA 4WXHA 3JRBA 1HU3A 1AA7A 2XKOA 4WNEA 1Z0UA 2Y69E 1HW5A 1XGNA 3CDLA 3D9NA 1UJXA 1KU3A 2WXPA 2Y1LE 2RAEA 3MV2B 3SY2A 5J8CA 5C3EJ 1D5YA 4KT6A 4OYSA 3LSTA 1S64A 2WMOA 4QSHA 5LD2C 5AN8A 3AL0C 2A6TA 2DA3A 3R9AB 1ZB1A 2P8TA 2H6IA 4BETA 2LSVA 4GRIA 3DSSA 3EDTB 3U3WA 1TQIA 3Q9NC 1PYVA 3CKBA 2XXSA 3LAJA 3KYLA 2IF4A 3P9IA 1F9NA 1BJZA 3R61A 2YU3A 2GXAA 1M1EB 2ECCA 2ZB9A 3OIOA 3L2VA 1PP8F 2IEJA 4UQZA 2XF6A 4ETSA 3Q9UC 4B1RA 1MMGA 3JYSA 2I2BA 3MKWB 3ZMVA 5J8FA 3UNMA 1LPQA 1DDNA 1QQEA 4G8KA 1JUSA 4U0ZA 3UM1A 2O0YA 2P58C 3ZUVB 4O6JA 3VYSB 3L2WA 3GTLJ 3D1NI 1XG1A 2KMUA 3S3OA 4N9HA 4X6AJ 1U78A 5DD8A 4DW6A 1FT2A 2HR2A 2A3SA 1JKRC 5BT1A 4NUBA 1X58A 2VASA 3A01B 2LXLA 2B0LA 1X1CA 4OAVB 3HRAA 3ABME 2VKVA 3G2BA 1Y3HA 3PJRA 4DYQA 5DBKA 4Q47A 2ICWG 2D1HA 2EQRA 4J01A 3CV0A 2A0TA 3QU3A 1UB9A 2WM9A 3DITA 1KZPA 5DCMA 2DPUA 2HE0A 3CC4I 1KQ8A 4LITA 4M72A 3D9JA 1LEAA 4G2VA 3H3ZA 3OOPA 5BS6A 1R4NB 4WXCA 3WE3A 2WWYA 5F64A 3E37A 1AP7A 2AFFA 1ETOA 2O9LA 5A2QK 5FLXK 4HNTA 2I29A 3WTWC 3M8EA 3J7YJ 3LFUA 2H8RA 1MZKA 3ZQGA 2L54A 5LEKA 4RAGA 4RSYA 3QP5A 3CMMA 4AYBN 3S7BA 1ETKA 4CHUA 1MK2A 1TBXA 2HZDA 3VTXA 4QFVA 1JCRA 5DUIA 1IG7A 3K1MA 4MTDA 4PFOA 2WQ7A 1YITI 4TV3A 3BZ6A 2EB7A 1MGTA 4HDVA 2X51A 3VSKA 2WBMA 4KZCA 4U63A 4WF2A 4A3GJ 2TDXA 2VT3A 2OV8A 1YIOA 1ZK8A 3CMYA 4GZ6A 2DFEA 3FUFA 3JUIA 4C48B 4M3GA 5LBQA 4HRNA 2E2IJ 3UM3A 1TN7A 3BP8A 5BPPA 4PS7A 2QFCA 2KIQA 1D1BA 3PUBA 1ZKGA 2IRFG 2R5SA 1OCCH 1BIBA 2KIFA 2V4JC 3FTZA 2EBIA 3DTIA 3D9PA 2ILRA 4XR6A 4V19K 2AXVA 3BG9A 4LERA 3W2WA 1RR7A 4Q48A 4AIDA 3K4MA 1HH8A 3D5SC 1HA8A 2KATA 1JUMA 2ID6A 2ZXWE 2HPIA 4MEYF 4JBAA 3K2ZA 3FTYA 4L9TA 2H6CA 2HOSA 1MR1A 4JC8A 4RQIA 3ZMDA 4UQXA 2UY1A 1YMPA 2GROB 1YJ5C 1YW9A 4A0EA 3CVVA 4HAOA 1VQNI 5D66A 4CEMA 4CZZA 1DPRA 4RB0A 1N75A 3B02A 4G24A 2LAIA 4NNJA 1LGQA 2QUFA 3ZCOA 5T3RA 3PFIA 5CVVA 1CQTA 3RKQA 1HS6A 2IEKA 4MHGA 3I5PA 3H9QA 3VZDA 2GA1A 1S8NA 3IHUA 3T1BA 4JYKA 1FIAA 1WSUA 1VQ8I 3L08A 1IRZA 2CG2A 3EU9A 1E8XA 4L2LA 4EM2A 3CJQB 1YFHA 4G7OF 3BG5A 3ZVVA 1R6RA 1OJLA 1EH7A 5KCMA 3PZ4A 3MAJA 3RO3A 1TNZA 4LUNU 2OF7A 2VIXA 4AM9A 1TWFJ 2GIZA 1FX7A 4YIFA 1D1CA 5EJCA 3DXKG 3AU4A 3TWUA 1SFOJ 5AJLA 1O7LA 3NBNB 4I98B 2LRDA 3QWLA 5EKQD 1Y0NA 2NVYJ 5CBNA 5JHBA 4L0ZB 1KLXA 3NRVA 3CHSA 4YDOA 5E1XA 1OPCA 1TT0A 4Y17A 3MDBA 4ILHB 2HYFA 3S1RJ 3BEEA 2XV4S 4EHMA 3K4LA 1K3JA 2L7MP 3IH2A 2VN2A 4DBQA 3J7ZI 2P9NG 2XZTG 5BPIA 2QY7A 4I9EA 4ME2A 4XL9A 3HUEA 4LG0B 2CV2A 4I09A 2R7SA 4IHSA 3RDIA 4FISA 3I58A 3KP2A 3S3NA 2I9CA 3R60A 1RNLA 4NQWA 2WXRA 2F5CA 3ISMC 4IYPA 1N77A 5LFAA 4PJ0C 2LDUA 1MZBA 2G7UA 2KZGA 4IRGA 4RBOA 4OIPF 4EATA 3PNYA 3I4RB 3EDPA 3UPVA 3C2HA 3UR3C 3X2QH 1MIJA 2M1BA 3TOAA 1S7EA 4GYIA 3BR0A 2M7AA 3DXJF 3WTXC 5J3LA 3WU0A 2WXOA 4KUMA 2WY7Q 2DMNA 3UNGC 3JRGA 3CHMA 3RU0A 3PNLB 3SZ7A 4A3VA 2ESNA 1LDKB 2CFXA 3KLOA 3NWTA 3OY9A 2D45A 3HG9A 3PVLA 4IRUA 4AXHA 4EBAA 3AG1H 3CJNA 4KJZA 4RB3C 3K70D 1YYHA 2VI6A 1MDMB 2R92J 5ILSA 3GFLA 3CHOA 2IS6A 4IN3B 3GFJA 3SQVA 4IOAF 3ABTA 2JA5J 2DW4A 3AG1E 3LQRA 4XQFA 4XRMA 3PO3J 4K0RA 4G25A 2V1UA 4UWLA 1ON2A 2PFBA 4DK5A 3B7SA 2DFHA 3DPTA 2XRNA 3WG7H 1WG0A 1J75A 1Z3YA 5HKPA 4UWFA 5AENA 2HQNA 2JT1A 1TNUA 1WAO1 4G11A 4JZYA 3LSHA 4ENNA 2EWNA 1B72A 2DMUA 4JHJA 1PUFB 3E5QA 3IL2A 1WJBA 1YS7A 4H7YA 2ONDA 2ISYA 1Y6IA 1BI1A 2X1CA 3SXYA 2KRHA 2KCKA 4LG6A 2UV1A 1TNYA 5ICEA 3WHBA 1JWGA 1N11A 1FOYA 3VSLA 3NWSA 3RRUA 4XLPF 1WPKA 3CJTB 1BBYA 1PJRA 4I0BA 1IJWC 1ELRA 5ERIA 4XRSA 2WAQA 2NS0A 3ZP5A 1B9MA 2R5ZA 2FBNA 1KONA 4A3IJ 2ESHA 2HWVA 1UOHA 5JI6A