2FEZA

Mycobacterium tuberculosis embr
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
373
structure length
373
Chain Sequence
RLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable regulatory protein embR
total genus 129
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2005-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fezA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fezA02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2fezA03
3IRQA 2G9WA 3C3WA 2V1UA 3BJ6A 3CK9A 2DBBA 3E3VA 3CKCA 1FYLA 1RUOA 3F21A 1P4AA 3K69A 1USSA 2HQRA 2MC3A 1J4LA 1P4WA 1MDMA 3ECOA 1CF7A 5HS9A 1ELRA 3UOTA 2RKHA 1F4KA 3CVQA 2E7WA 5CYVA 2CW0F 3KP7A 2BE5F 3ASHA 1IZ1A 4N9HA 3JYSA 3UPVA 1B9NA 1RUNA 4PGGA 4UQZA 1HW5A 2FU4A 1R58A 1CF7B 1R1UA 2GIVA 5JJ6A 4J8FA 4AM9A 1FCHA 3ELVA 1J2XA 1YW9A 2PI0A 2L54A 1T6SA 2LF8A 5E50A 4LG0A 4ETSA 1ZREA 3F3XA 2O3FA 2QQBA 3C7JA 3N97A 3BWGA 3V8JA 1G3GA 4U0VA 4HX7A 2VE9A 1R00A 4EVIA 4ESBA 2GA1A 2GZWA 3GYHX 1FC3A 4L0ZB 1S8NA 2RVCA 2KCLA 5LHIA 3NRVA 5LEJA 2HWVA 3LY8A 1WWXA 2JTVA 1J4KA 3Q4AB 1SD5A 2A5YB 4L9NA 1S6LA 5HI7A 3H92A 1YLFA 3CKBA 3E97A 2HOEA 4B09A 1P5QA 2ZO4A 3RKWA 4ASNA 4U7DA 2XKOA 2Z5UA 3WU0A 2YU3A 1DDNA 4U0SA 2HYGD 2G7UA 2L6JA 4G1TA 1XSXA 2EV6A 1ON2A 3ECHA 4CO8A 3WTYC 1EV7A 5HOOA 1J0RA 2A07F 2KIFA 4I9EA 2AVPA 4EJOA 4UQXA 5L3GA 4KMFA 1OYWA 5G05J 3J81Z 1MJAA 4S05A 5DD8A 1IN4A 2A69F 3LA3A 2DPDA 2UXXA 3GYZA 1HW2A 3GXOA 4BH9A 3ML6A 3RYRA 3Q5FA 4G9YA 4KIGA 3T0YA 2ESNA 3I0NA 1IHGA 2WC2A 3CO7C 3WTSC 3TO9A 4HZFA 1YFHA 4Z2YA 4RGRA 4JK1X 2MH9A 2P5VA 3J80Z 4UI9C 1R1VA 2LKPA 2K4BA 2F5FA 3TKYA 5D8LB 2A6HF 1ZHFA 1TBXA 3GEZA 3E5XA 3SZTA 5ERIA 4LK0F 2CGPA 3QDNA 1XDUA 5G04J 2NNNA 3ULQA 2L01A 2UWMA 5D6FA 4ENKA 1K6OA 2BYVE 2OU2A 3OUNA 1JGSA 5CVUA 4G25A 1BJAA 5M72A 2IW5A 2EFNA 2XAQA 4OMZA 3KCCA 2OQGA 1ZG5A 2XV4S 4YFKF 5A8IA 3P9IA 2ZBKA 3RKVA 2V9VA 1UB9A 2P6SA 3AS4A 1IF1A 5FLXZ 4JL0A 1S7AA 3CUQC 4YFXF 5DEQA 4MTEA 3MAJA 2EB7A 4M6YA 4ME2A 5D0QD 3BY6A 4NQ0A 3MWMA 1Z91A 3WXXA 2XKPA 1FBUA 5FO5A 4LFUA 1RIOH 4I2ZA 1O57A 3POAA 5FB2A 2QUFA 3LAJA 2ACJA 5ICGA 4FX4A 1J7KA 1WV3A 2NRAC 2C0MA 5E1ZB 1AOYA 1MJBA 5C1DA 5DIZA 4LB6B 1P92A 2WQHA 2P5KA 3RPQA 1LGQA 2LDUA 3TOAA 1IYGA 4ZYDA 5JVTA 2LNIA 1B9MA 3ESKA 1Y0UA 1G4DA 2H09A 3I0MA 2O03A 4P96A 4G23A 4N0BA 4AD9A 2VBZA 2PZIA 2OZ6A 2RDPA 2BUGA 3HSRA 3W6JB 4NRHB 5JFRA 1DMZA 1B6AA 1DUXC 4O5VA 2PEXA 3RJPA 2HYFA 2KB3A 3BJOA 4GA0A 4EM0B 5FTPA 3JTGA 4CXFA 2VC0A 4RS8A 2EA4A 3F6OA 2VBYA 4M74A 2ISZA 4G8XA 3MFKA 2JZYA 3GFMA 4Q4ZF 1W5SA 1BI3A 2FI7A 3HRSA 3I64A 2LSUA 4ENMA 3DQVC 2HYZA 2QYOA 2M45A 2ETHA 4P55A 4WNGA 1XN7A 4OIQF 4WF2A 2R7FA 1USTA 2P7VB 3DEUA 4GXOA 1STZA 4ZYEA 2DLLA 5BNWA 2IA0A 2G1LA 3QPHA 5E17F 4N39A 4IRGA 4S04A 5D4SA 5IT3A 4HX8A 2EJRA 3W6KB 4LLLA 2DAOA 2GQQA 2JRTA 3K1NA 1U5TC 4A5NA 2BEOA 3ELKA 1FWZA 5JHUA 2UXNA 4YIIA 1T98A 3GQSA 4BT9A 3ZGQA 1PDNC 2FO7A 4EMSA 1XSVA 5D5WB 3OXGA 2M87A 1ZGJA 2TDXA 4LG0B 2YSRA 2ZKZA 2MH2A 2RC4A 4I1AA 4G7HF 1G3SA 2RV8A 1XGNA 1MGTA 3RU0A 1Z05A 2PG4A 1QBJA 1QQEA 3K9IA 3GFJA 4I0BA 3EDPA 4ZH4F 4XBFA 1CGPA 2ZNYA 3MV2B 4D0PA 4U0WA 3PQKA 1WKMA 4JA9A 1WQ2A 2JPBA 2JPEA 4LGWA 5HLGA 4KUMA 1S3JA 2XGXA 5DV5A 1TNSA 5F64A 1XSDA 3IWFA 5H6QA 1L0OC 3TDZC 3LA2A 1OR7A 4HYEA 5HDKA 1BC7C 2BBYA 3DV8A 2L02A 1GHCA 5DYMA 1FPQA 3SF4A 4UI9K 4RG6A 1H0MA 2RQPA 2IPQX 2OZUA 3F8CA 3ZHEB 2G7HA 1XGOA 2QQAA 1OMIA 1U3EM 2HTJA 3FF5A 2XGOA 4MTDA 2O8XA 4KIBA 2Y4TA 1HSJA 2QENA 1IN7A 1JHHA 1ZARA 4LLGF 1YA0A 3WG9A 1P4XA 3KZYA 4U07A 2FBHA 3KFWX 3IC7A 1OYIA 2OD5A 2COMA 3G3ZA 2CFXA 3MEXA 3QRFF 4QLCU 2QFCA 3MEKA 5HDNA 4M6XA 1R1TA 3T8RA 1JHFA 5HVQC 1IRFA 1RNLA 3EYIA 4LD5A 5JR3A 1Z9CA 4IHTA 5FFXA 3TGNA 2VN2A 1DPUA 5ICFA 3Q15A 1KQ9A 2A0TA 2ZFWA 2DTRA 2Z33A 1WLNA 2HEOA 1PP7U 4HOTA 2FQ3A 1SMYF 4PGHA 1R23A 3FWEA 3KLOA 1F9NA 1KU7A 3F72A 2FF4A 2C2LA 2YHCA 5FLXK 4BWRA 3K1PA 1HZ4A 1I1GA 1W5TA 4H0EA 4L18B 4GCVA 3I6WA 4ABNA 4KXKB 1SFXA 2R5SA 2EA2A 2FSWA 1IUYA 1K7AA 3PE3A 1VTNC 1UHMA 1G6NA 2MLKA 3GZ6A 2QQ9A 4L9VA 1J5YA 1U5TB 5E1WA 1Z6TA 3I4PA 1J59A 2Q7FA 2VE8A 4BQAA 3OXLA 3JSPA 3D5LA 4HA8A 4MHGA 3P9CA 2Y0MA 1ULYA 2V5FA 2Q8KA 5LRSA 1HH8A 4GYYA 3L7WA 2PJPA 2VYIA 2P8TA 3Q9SA 1I5ZA 2IRFG 3CV0A 5LEKA 3RKYA 4JQFA 2DBAA 1U5TA 4U0ZA 3DP7A 2L4AA 1E2XA 2KCKA 3SZ7A 3KP3A 4XLNF 4PCQA 1I6XA 2HS5A 4UNOA 1ZRFA 5AIQA 3LQRA 3HTUA 2ZCWA 4UUVA 3BROA 1QZ2A 3F22A 2VSYA 3CEQA 2XPIA 3QKYA 4HBLA 1Q1HA 2D1HA 5LGNA 3R0JA 4L0YB 2P6TA 5DCMA 4AIHA 1ZLKA 3HOTA 5FZSA 3RPUA 2O0YA 4YNDA 4G2SA 1ZH5A 2FA5A 4GCNA 3UQ3A 4GA1A 1BI0A 2GWRA 3QU3A 2D2WA 3QP5A 1KQ0A 1ZAOA 1WAO1 4XLPF 1BBYA 5J6XA 3LY9A 4Y17A 1WM5A 5DCMB 1Y8MA 3AAFA 3HUFA 3JW4A 3KE2A 1K3NA 2KJBA 2VBXA 2K27A 5F6FA 3QAHA 1J4QA 1U78A 1MZBA 2WTEA 1FP1D 3U1DA 5HLHA 1R5HA 3RKXA 3GF2A 4KDPA 2F5DA 1J75A 3TAXA 3GZ5A 3WTZA 4W9RA 5DUIA 3D0SA 2EV5A 3HYIA 2HKOA 5DJOA 2QM3A 3GX4X 3FMQA 2W57A 3CUQB 4XRFA 3GUDA 4YFNF 5BPIA 3KP6A 2FEZA 2BGCA 1FY7A 2PLYA 4RAZA 2KJCA 2XT9B 3J81K 3EDTB 2PQ8A 3HUGA 1MZKA 4KFCA 2VBWA 1W7PB 4OINF 4NB5A 2X4HA 4RB2C 3VPYA 1GXCA 3Q49B 2M5WA 1R21A 1BIAA 3E6CC 1JE8A 3KETA 4OIOF 4I7HA 3L9FA 5LBQA 3VODA 1UHWA 3K2ZA 4MEYF 3C1DA 3IKVA 3SZPA 5HQ8A 3OOPA 1ZYRF 3UN0A 3TG4A 4UI9J 5JJTA 5LHGA 5LHHA 4PZJA 5D8KB 2Z9OA 4B8XA 1V3FA 2Z99A 3TQNA 3V7CA 3RDIA 4GZ5A 1E96B 1HSTA 3JSOA 1HBXG 3KP5A 4LK1F 1FOKA 4OMYA 3O48A 5L3EA 3F8MA 3FFLA 3FX3A 5ICCA 1SAXA 1O3RA 3I71A 2IF4A 1R36A 2MBFA 3J7AO 5A2QK 1TW2A 4J8EA 1QZYA 2ZNZA 5E18F 4AIKA 2PQNA 1P6RA 1FHQA 4GZ3A 2M30A 3K9TA 4J8DA 5ARFA 3KAEA 4GZ6A 3J80K 4N3BA 3ZN1A 2KFUA 1O7LA 4BTAA 1OPCA 1F1ZA 4KYOB 4HV6A 3EUHA 3Q9VA 2V79A 2Y75A 3CDHA 1FSEA 1XGSA 1ZBPA 5BQTA 1NHAA 4DQ2A 2VSNA 1YIOA 3T8TA 4RGSA 1KYWA 1YG2A 2E7XA 5BS6A 2EK5A 3F8FA 1G3TA 3TDUC 3I54A 2KB4A 1QQIA 1IN8A 1ZGAA 4OOIA 3TOBA 2MD5A 2Q2EA 4IRHA 1PC2A 1U2WA 1HXIA 4ESFA 3LSTA 4EJWA 4I09A 4KMUX 1UFMA 2A68F 4M9ZA 2D45A 5EEGA 1NZNA 1LDKB 1YW8A 2H6BA 5EEHA 2I6HA 3RO3A 1LVAA 4M9XA 3RJVA 4P9UA 1XMAA 2JT1A 5D5VB 2EV0A 4H7YA 2XCBA 2V1XA 1O7FA 2HR2A 1ZLJA 3T5XA 1QO0D 2E2EA 2LSVA 5FD6A 4ESJA 3HTSB 2DO7A 1D8KA 5HS7A 2P58C 4APOA 3O3KA 1O3QA 3LYAA 2Q0OA 4G7ZF 4A12A 2EFOA 4L5IA 1K3JA 2VOPA 3QOPA 3E5QA 4RAYA 1ZN2A 5ILSA 4MEXF 2V1DA 2A3SA 5IT9K 5LGTA 3BZ6A 4Q47A 2DQLA 4TV7A 3ZMTA 3VTXA 2F5CA 3E6BA 4UVBA 4R1HA 3BP8A 3CUOA 3HHGA 2QZ8A 2YX7A 1B59A 1ZG3A 3HIFA 4KIFA 5LCWC 5LRRA 2KIMA 4XSZF 5A6CA 1MJ9A 3M8FA 3OXFA 1IXSB 1XB4A 4I02A 2AFFA 3HRMA 3F8NA 4ENJA 3I59A 3BPXA 3F23A 4WCGA 3FP3A 3LPZA 1OUVA 4KBQA 3I53A 1OYYA 3GVAA 1V4RA 4WX9A 3KD7A 2KCVA 4A0EA 2QWWA 3FXUA 2LNBA 4UXNA 1LJ9A 2CO5A 1T39A 2CWEA 1MKMA 1SD7A 2FBIA 2NS0A 1TQMA 1K78A 5ILVA 3BOQA 1D8JA 3F8BA 3SXYA 4R79A 4RB1A 4WNFA 1O3SA 3WTTC 4EGYA 4IHSA 4Y6WA 1XDSA 3I0TA 3FM3A 1W7PA 4IJAA 2XROA 2VGXB 1KT0A 2H6CA 2NAZA 2XEVA 2VT3A 3HUEA 5HS8A 1EH6A 2XASA 3C18A 5EX3A 3Q47B 4U7BA 3QU6A 4XIFA 4HQMA 3ZPLA 4UVCA 3WE3A 4HAMA 6PAXA 4P9FA 3KP4A 4UVAA 1ELWA 3R4KA 1FYKA 4HF0A 4N2SA 5F1RA 1ZG1A 3CLOA 4G26A 4Y15A 1I1SA 1IN5A 5TRDA 3KZZA 1G6GA 1JXSA 4H7XA 1TQPA 2OBPA 3V8KA 5FD5A 4I2WA 4F7ZA 4EQFA 4U88A 1Z7UA 5CVJA 4Q5SF 4GYGA 3VEPA 3FXQA 3QWVA 3QOUA 2IA2A 5EKQD 3CJNA 4RGUA 4IXAA 1LDDA 2XCCA 2J5PA 5HDGA 2IJLA 3CK7A 2J5OA 4A0XA 2OOEA 4CDRA 1UHTA 4BXUA 3JTHA 5H20A 1QGPA 1YO5C 3FM8A 3UNNA 4WNEA 2DK8A 4WXDA 3RIRA 2NNYA 3UNMA 2XHKA 2DK5A 4EJVA 3QWPA 3MCZA 4CICA 3BEEA 5KJMA 1YJ5C 4WNDA 3AS8A 4G2VA 3HSEA 4G6QA 2E1NA 3DKWA 4RG9A 2F2EA 4KNYA 5LCWJ 2GXGA 3P7NA 1BOAA 3FZVA 4EGZA 2J9QA 4JONA 3LFKA 5K5OA 1G3YA 3L2CA 1I27A 3S7DA 4BT8A 4RB0A 2JLBA 1WI9A 1HQCA 3N4MA 5BMZA 3TO6A 3I5UA 2ZMEA 4WK8F 2DW4A 2VODA 2AXLA 2JQLA 1S7OA 2DI3A 4CGVA 4BHCA 3GZ2A 2D1VA 2GA2A 4EV0A 4AIFA 2GXBA 4HF1A 3EQLF 3SQNA 4N2QA 3HRUA 4DNCA 5KJNA 4A0ZA 4EJTA 2XGSA 2XGMA 1FLIA 1TLHB 3UUXA 2STTA 1TQIA 2BV6A 4RB3C 5D6EA 5K5QA 4ZYGA 2ISYA 2IVMA 3GFLA 1GVJA 2FNAA 2QLZA 2K86A 4ON0A 2VONA 3E4BA 2DPUA 1T0FA 2GAUA 3DPTA 3EYYA 3RO2A 4IF4A 3IKTA 4WXCA 3M8EA 1B4AA 1P2FA 2ESHA 2ADUA 3BDDA 5JJ7A 5IT9Z 2CG4A 3SFZA 5E8IA 5AONA 2DU9A 5FFZA 4QCJA 1GXPA 4A6DA 4JBAA 4O6FA 4BYYA 3ZHEA 3MDBA 2ZJ2A 1HKSA 4A5MA 1A17A 3H3UA 1ON1A 3U4TA 1MD0A 4E70A 5JI6A 2DT5A 4N9IA 3DPLC 3KEOA 4O3MA 5G05C 1BI1A 3ISPA 2CSOA 5BOXA 1XD7A 3S2WA 2YX4A 2WV0A 3PE4A 1HW1A 2R7DA 4BHPA 1O3TA 1K3QA 5FGMA 1YJMA 3MZYA 2H94A 3L00A 2XAFA 5G04C 4WXHA 4BTBA 3I58A 5KVRA 2VXZA 3R9AB 4L9TA 3ERED 3I59B 3ULQB 4UHTA 4I01A 4A0YA 4HORA 4I17A 4HQEA 1KQ8A 2FNPA 3PDNA 2PQRA 1DPRA 3CVNA 3ROUA 3LAPA 3ZMUA 4I0AA 2ZMEB 3ELSA 5A7DB 3CVPA 1BIBA 3KT9A 4H87A 3LCAA 4ENNA 1D3YA 2HFHA 4UV8A 4CZZA 2UY1A 2PN6A 3QWWA 3P9KA 2OA4A 4KYWA 4Y13A 1ODDA 5FZRA 3BJAA 1QZZA 4CHUA 2M1BA 3GZ1A 3S7BA 4UQYA 3WE2A 4Y6CA 4K2EA 3WTVC 4OU0A 2MHKA 3L09A 4MQ9F 3ASGA 3FMSA 4P5OA 4M71A 1YQAA 2K7LA 1NA3A 2VQ2A 5CCMA 5E20A 2UY1B 2FBNA 1QNTA 5BW8C 3ZMDA 3E6MA 5DCFA 2XAJA 4WWCA 3ZP5A 1YTYA 3WTWC 1J4OA 4LB5A 2K4JA 4G94A 3H3ZA 3HRTA 4KA4A 2W85A 5AYWD 4L9JA 2XRNA 2RNJA 5LLQA 3MKRA 4I98B 5CVRA 3F6VA 3ASFA 2L3DA 4GA2A 3AS5A 1IXCA 3URZA 4KT5C 2LSOA 4L5JA 4AY6A 1R7JA 3FXRA 4FX0A 4KICA 4HLYA 3GO5A 3WGIA 4BNCA 1LGPA 2O6GE 3R61A 3WGHA 2KRFA 3ZPJA 1FZPB 2W24A 4YG2F 3GFIA 2R3SA 1UCRA 4D9VA 3DF8A 5ICEA 3M9AA 4GGGA 3HHHA 2STWA 3E5UA 2XIGA 1FBQA 3WTUC 2E1CA 3O2PE 3O6BB 2QBYB 2M8EA 3NF1A 3V7SA 1H9TA 4M9SA 3U2RA 2JKDA 4LMYA 4IRIA 4FT8A 3IEGA 1NA0A 2YQ8A 2PL2A 3JAMZ 1BC8C 5KJLA 5DDGA 1KT1A 1DP7P 1Z1DA 3PO8A 2UWJG 2QBYA 1B1BA 5A2QZ 2UZKA 3GW4A 3PQJA 4CYDA 3UMZA 1E17A 5H6RA 2C0LA 4U0YA 1ONVA 3WU1B 1XMKA 2EWNA 1F5TA 3LY7A 2O61A 4ZZLA 3M1EA 1WRJA 1K79A 3DFGA 2Y4UA 3LKUA 4JHRA 1HXDA 2VT2A 2P7CB 5FJYA 2RGVA 3ZMZA 2VC1A 2W25A 2FMYA 1REPC 4G24A 1LDJA 1UJXA 1Z6RA 3T1BA 4BHBA 4YIFA 1B89A 5BT1A 3S7JA 2Y48A 5ILUA 2IA1A 5LGUA 1HKTA 3N71A 1LEBA 4AVPA 1U6GA 1MDMB 4MGRA 3COAC 3TG5A 4N5CA 4HW0A 2DQRA 2HO1A 4N3CA 1SD4A 3V4GA 3KP2A 2PBIA 5E8GA 4LJZF 1FHRA 1BM9A 4FHTA 1K2MA 2V6CA 2BRFA 4UV9A 4G7OF 3CTAA 1TJCA 3CK8A 3JAMK 2PFBA 3VTYA 5D0OD 4CGWA 2A6EF 1FYMA 3RIBA 4RGXA 2MLGA 2Z3YA 3ZQ7A 1XCVA 4OIPF 5EX0A 2JQJA 2NYXA 2W3OA 2IFUA 1KGSA 4Q48A 3QP6A 1W4MA 5AIPA 2ONDA 1ZU2A 5DBKA 4AY5A 5ED4A 1W7PD 4GYWA 2L4MA 4KN7X 2VGXA 2PMUA 3WGGA 5CHEE 3V8LA 4GYOA 1KYZA 4CDGA 4HDUA 5D5UB 4EM2A 3LQQA 3ABTA 2HR3A 3VA4A 5KK1A 1KU3A 2HQNA 3K1MA 5J8FA 5K5RA 1KU2A 1S29A 4NQWA 3B02A 1KA8A 3VFZA 4EQQA 1TTYA 4LLNA 2HKXA 1R22A 5K1YA 3FHZA 4GCOA 4IVNA 2HDCA 3TGOA 2GW1A 3SHFA 1L3LA 4PDKA 2EFWA 3DXJF 4AWXB 3ZMVA 1YYVA 3ZFWA 4HX4A 2PMHA 1T2KA 3KEQA 3R0AA 1H9GA 3GLXA 3EETA 2JSCA 3U3WA 1FBSA 3TO7A 2KIUA 3LA7A 4XI0A 4GO1A 3S7FA 4ZYHA 3I6UA 4U0UA 1BN5A 3CO6C 2F5EA 1KU9A 4BAYA 4J0UA 2B0LA 3IWZA 2FXAA 4IPAA 1EH8A 1IW7F 3BPVA 5E1XA 3MA5A 5KJKA 2JQIA 1QU5A 3WODF 4U04A 3ZN3A 3FM5A 5L3DA 4YVOA 2HGCA 4HOBA 2OQRA 4JA7A 4LEUA 1LNWA 1IAWA 2K02A 1XGMA 4HDVA 5D5XB 2LC1A 3ZMSA 4QWQA 1TNTA 2EFPA 2KATA 5J8CA 4EGXA 1SFEA 1WSUA 4WUYA 2ELHA 3WTXC 4R8HA 1IRGA 1RI7A 5CVVA 3R60A 1G3WA 2HZTA 3Q5MA 5CCLA 2CYYA 2OAZA 3CVLA 3U9GA 2WPVA 1QPMA 2XAHA 1XNFA 2A61A 5CVIA 2WWYA 2KKOA 3RTRA 3HYMB 4F3VA 3MQ0A 1J9IA 2NC9A 1LB2A 1FP2A 2W84A 4GYIA 4HOQA 2DFIA 5DD4A 2FE3A 2EH0A 3E6DA 1OKRA 4HV5A 5HLIA 2RN7A 4HLXA 2ZXJA 4HOUA 1IN6A 2KC7A 1GXQA 3R6SA 2FOKA 4G6DA 1LEAA 4CGZA 3KS2A 4YVQC 1A04A 4EM1A 2VGYA 1FSHA 3G73A 1W3BA 3VB2A 2P4WA 1XCBA 1U8RA 4XSXF 1EH7A 4KN4X 1RZ4A 1FX7A 3IL2A 4A6EA 3MV3B 1YS7A 4IN3B 2VOOA 3OV8A 2X0LA 2XVCA 1X3UA 2FRHA 3FMRA 5L3FA 3ABUA 1AWCA 2HTSA 1YS6A 1SFUA 2LF7A 5CLSA 1D5VA 1HKQA 3CUQA 2FMLA 3MZHA 3B73A 2PIEA 3QPTA 4B94A 2MA3A 3NEUA 5CJ9A 1IXRC 3IHUA 2P5LC 1KLXA 4MNUA 2FBKA 4AIJA 2KKLA 4EJQA 1PP8F 1SD6A 1BI2A 2AS5F 4O6JA 4N3AA 5DUKA 1ZRCA 1LQ1A 2JPCA 3GWZA 4HF2A 5ARGA 3VA1A 3ASDA 2YPRA 4I2OA 3M7GA 3UV0A 2CQKA 3RI4A 1ZRDA 3RYPA 5TJJA 3NQOA 4EJUA 2XUBA 4XI9A 1J4PA 1R5GA 5L3CA 1K2NA 3ZN0A 1FT9A 2YR2A 2IP2A 4M73A 2QVOA 3FWVA 5L3BA 3REOA 4ZZDA 1C0WA 3GW2A 2EFQA 3HSFA 4HOSA 1YW7A 3HX1A 5FT9A 1T38A 2H27A 4A2UA 1SMTA 2CSWA 5BPDA 4MQVA 3LWFA 1FNNA 2C6YA 1TW3A 4I9CA 3K0LA 5D4RA 2IT0A 3HOSA 3VOEA 4OIRF 3KLNA 3V7RA 4NHJA 2XAGA 4M72A 4A1SA 1K78B 3PFIA 4GPKA 5FZQA 3IRRA 1PUEE
chains in the Genus database with same CATH superfamily
3IRQA 5FKNA 2G9WA 1EJ9A 3C3WA 4IZZA 4BFRA 2WXMA 3HVEB 5C2YA 2V1UA 3BJ6A 2KZGA 3BU8A 3CK9A 3T8KA 2DBBA 3E3VA 4E7JA 1OCPA 3CKCA 1FYLA 3BTCA 3S3OA 1RUOA 2FOWA 1MIJA 3SDGA 3C5RA 3F21A 4XL9A 1P4AA 3K69A 1USSA 3HDDA 2HQRA 2MC3A 4A69C 4ANXA 1J4LA 1P4WA 3CCMI 3FTSA 5AQ7A 4G8LA 1MDMA 3ECOA 1CF7A 2V9KA 5HS9A 1ELRA 3UOTA 4I6ZA 2FQ4A 2R5YA 2GRNB 1S0PA 2RKHA 2BXYA 2VLAA 1V54E 1F4KA 3CHOA 1Y56A 3CVQA 1VNDA 3V31A 2E7WA 1OT8A 5CYVA 2CW0F 3DKYA 1SZAA 2ETCA 2DFEA 4JX5A 2N8GA 2BE5F 3KP7A 4IQJA 4KT6A 1IZ1A 4N9HA 2Y3AA 1OCCE 5J4YA 3ASHA 3FUKA 1B9NA 3JYSA 3UPVA 2F5VA 1IJWC 1MNMC 1RUNA 5KNGA 2XDVA 4PGGA 4UQZA 1XX5A 3T9KA 3GCMA 1TWAJ 4PJJA 5C44J 1HW5A 2FU4A 3A4CA 2XEEA 3MX3A 1R58A 3HEFA 5F08A 1CF7B 1A6QA 1R1UA 2COBA 2GIVA 5JJ6A 3ZQCA 3E30A 2FULA 2K5CA 3D9LA 4N5QA 4J8FA 4G11A 1FCHA 4AM9A 3L08A 1EPUA 3ELVA 1J2XA 2IEKA 3H35A 1YW9A 1N0RA 2AXUA 2PI0A 3S2HJ 2L54A 3NBNB 3BR2A 4A3GJ 3MMYB 1T6SA 2LF8A 2LY1A 3GBGA 4BGDA 1MMDA 4NC8A 2OCCE 4JC8A 3S2AA 4LG0A 4ETSA 1ZREA 4BERA 5E50A 3F3XA 2O3FA 3ASNH 2BTDA 3AKZA 1F43A 2QQBA 3C7JA 3N97A 5FRNA 3W9FA 3BWGA 3V8JA 4UUSA 4D7NA 1G3GA 5IOZA 2EBIA 4V2FA 4U0VA 2A5EA 2HVRA 4HX7A 3KIOA 4E6KG 2VE9A 3QNKA 4CDNA 4OVVA 2XXSA 2Y1LE 3GTLJ 3ENEA 1R00A 4N4OB 2E1MC 4EVIA 4CCOA 2GA1A 2GZWA 4ESBA 1FC3A 3GYHX 4L0ZB 4BJ6C 2NXPA 4HSRA 3OL4A 4B4CA 1S8NA 2RVCA 3B13A 2KCLA 4V2GA 1VQ8I 5LHIA 4L9PA 3NRVA 3ZQQA 5LEJA 2MD0A 4Q94A 2HWVA 2I8DA 3LY8A 1WWXA 5M5XJ 1T8IA 2JTVA 2XF7A 2J4DA 1Q2ZA 2MRIA 3Q4AB 4MRUA 1J4KA 1SD5A 2A5YB 3KPHA 4JP0A 4L9NA 5JHAA 2E34A 1S6LA 1NP7A 5HI7A 3H92A 2KFDA 1YLFA 3CKBA 3E97A 3GTPJ 1TNOA 2HOEA 3ML9A 2J08A 4B09A 1P5QA 2ZO4A 3RKWA 4ASNA 2AN1A 1Z5SC 2LXLA 2V1NA 4BJTA 2IS2A 4ANUA 2Q5FA 2H1KA 1D1CA 4U7DA 1VZ0A 2XKOA 2Z5UA 1HG5A 3K4JA 3WU0A 2YU3A 5EEAA 2R0QC 4BXXJ 4CCMA 1OWNA 1DDNA 1A35A 1EF1C 4U0SA 2HYGD 2G7UA 5FKOA 3MZ8A 2JA5J 2L6JA 4G1TA 1XSXA 2EV6A 1ON2A 3ECHA 2KZVA 1RESA 1EV7A 4CO8A 5HOOA 1J0RA 3WTYC 4HNVA 3NZUA 2A07F 5AQ9A 2KIFA 2JUCA 1JT6A 4K5CA 4I9EA 2AVPA 2LMDA 3PNVA 1P7JA 1IO2A 4EJOA 4UQXA 5ANRA 5L3GA 4KMFA 1OYWA 5G05J 5H7PA 1MQSA 3J81Z 3EIQC 1S9HA 1MJAA 2F37A 4S05A 5DD8A 2WM9A 3F0CA 1IN4A 1LFUP 2FD5A 4AEZC 5C4XJ 3GTJJ 2A69F 3LA3A 2BY0A 1K4SA 4K5BA 3SFYA 1TT5B 2DPDA 3CQCB 3BR3A 3DXMG 2ICWG 2UXXA 3GYZA 1HW2A 3GXOA 2WV1A 4CCNA 2ZC2A 4BH9A 5ENPD 5AQAA 4YIRX 3SFXA 3ML6A 1R49A 1UG2A 4HFGA 4NC6A 3RYRA 2XZTG 4RLYA 2ID3A 3PO3J 3Q5FA 4G9YA 1AP7A 5FIOA 3AG2H 4KIGA 3T0YA 3FH5A 5GAGJ 2ESNA 3I0NA 1IHGA 5EILA 2WC2A 2K9MA 3CO7C 3WTSC 3TO9A 3ISMC 5AENA 4DZJA 3UMVA 2R7RA 1ZQ3P 4J8YA 4HZFA 2J09A 5FQ8A 1OCZE 1YFHA 3HG9A 4Z2YA 3C98A 4RGRA 4JK1X 5CQGA 2MH9A 1FIAA 2P5VA 3J80Z 1JI8A 3Q0WA 4UI9C 1DQUA 5BXUA 1R1VA 2GOXB 2LKPA 4FASD 1DGWY 2F4OB 2K4BA 4BY1J 2F5FA 4XICA 1WG0A 2JGRA 1LKXA 3TKYA 4C3HJ 3WG7H 2L0KA 2NS7A 5D8LB 5JEMA 4HRIA 2A6HF 2IO3C 3R7QA 4GTOA 5E3OA 1I3AA 1ZHFA 2ZJQF 1TBXA 3GEZA 3E5XA 3KYDB 3SZTA 5IYCJ 3UKUG 5B5EC 5ERIA 1X3WB 2E19A 3BC8A 4LK0F 2CGPA 3QDNA 2EZHA 1QPIA 1GV5A 3PZ4A 1Y0NA 1XDUA 4IEJA 4CA0A 2F8YA 2P9UG 2NNNA 5G04J 4BBSJ 3ULQA 3AG4H 2L01A 2M7BA 2UWMA 1OLTA 1ORKA 3LSPA 4A3JJ 3SNXA 3UT4A 5D6FA 4ENKA 1K6OA 2BYVE 2OU2A 1LE8B 5JMND 3K4LA 3OUNA 1JGSA 5CVUA 3U21A 4G25A 1BJAA 5M72A 2YUSA 1YJNI 2IW5A 2EFNA 2XAQA 4NDLA 4OMZA 3KCCA 1Q1VA 2CW8A 2OQGA 2XV4S 1ZG5A 2V8SE 3B6AA 2K40A 4YFKF 4BU2A 4A3KJ 4ABZA 2CH0A 5A8IA 3P9IA 3RCOA 2ZBKA 2W4SA 2E0IA 2PM6A 3RKVA 4AP2A 4IOAF 2V9VA 2HNHA 1UB9A 2P6SA 3AS4A 2DT7B 2NOGA 4EEFG 1IF1A 1MYOA 3FU0A 3VWBA 1S5LC 5FLXZ 4A1GA 4KJZA 4JL0A 1S72I 2JMWA 1S7AA 4C2UA 3CUQC 2WXPA 2UUZA 2LP0A 3OS0A 3FK7A 5KAFC 4YFXF 4FULA 2WADA 1ZELA 5DEQA 2BOLA 3MAJA 4MTEA 4JPSA 2EB7A 4M6YA 3I56I 3TEDA 2HE0A 4ME2A 5D0QD 3BY6A 4NQ0A 3V8RA 3MWMA 1Z91A 3QOEA 4RDUA 4LG6A 1PUEE 2P9SG 3WXXA 4PUSA 4W1UA 3JCKC 1H19A 5D2MC 1QVTA 1UMQA 2KHMA 2XKPA 1FBUA 5FO5A 2L9RA 4LFUA 4CCLA 4QSHA 1RIOH 5DHRA 4I2ZA 4ZDLA 1O57A 3CMEI 2X6XA 2X1DA 5FB2A 1MZCA 2HVQA 2QUFA 3LAJA 2ACJA 4HQDA 4WWNA 2F8XK 4M3GA 1UJ8A 5ICGA 1J7KA 2Z1DA 4FX4A 1HO8A 1WH5A 3CQZJ 3EPZA 5E1ZB 4PJMA 2NRAC 4A3DJ 2C0MA 1AOYA 1TC3C 4BBRJ 5GTHC 1OQYA 4A3EJ 1MJBA 3HDXA 2EPFA 1LE8A 3ZRGA 5C1DA 5DIZA 1SVMA 3BR6A 2XSJC 2R5YB 4NUBA 4LB6B 1U7FA 2A5UA 4J19A 5BUZA 2W1OA 1P92A 2LKXA 1OY3D 3PS6A 2WQHA 2P5KA 3K2AA 3RPQA 3HXBA 1LGQA 1T56A 1JUQA 2LDUA 4BESA 4W97A 3TWRA 3DSTA 1G2HA 1OCOH 4AYBA 3L2QA 5E79C 3TOAA 5C4JJ 4FQGA 1IYGA 4ZYDA 2M9HA 5LX8A 5JVTA 2LNIA 4MS6A 2XF5A 1O4XA 2JJ7A 2KQRA 1X1AA 1B9MA 3FXOA 3ESKA 1Y0UA 3DTEA 1G4DA 2H09A 3I0MA 4L02A 2O03A 2B9SA 4P96A 2H6HA 2HM8A 4LIVA 4XLAA 4N0BA 1VQPI 3FBNB 4AD9A 4G23A 4F1PA 2VBZA 2PZIA 3PEUB 3UM2A 2OZ6A 5M3MJ 2RDPA 2BUGA 3HSRA 3W6JB 1YJ9I 4NRHB 5JFRA 5IYBJ 1DMZA 1NFIE 2WXLA 1B6AA 2VKDA 3ZCOA 1DUXC 3KX2A 2KM4A 4O5VA 2IO2C 1D9SA 3OR2C 2I1KA 2PEXA 1SFOJ 2DA5A 3LL7A 2V4LA 3G2TA 3ZXPA 3RJPA 2HYFA 2KB3A 1K61A 3BJOA 4GA0A 2DODA 4X1EA 4EM0B 5ENRD 1V55H 5FTPA 3FTVA 4CXFA 3JTGA 2DA4A 5JLXA 4JHJA 5JHBA 2VC0A 4XM3A 5HNFA 4RS8A 5GAHJ 2ZMEC 1YMPA 1V5FA 3C2BA 2EA4A 3QYEA 2X6OA 3ZIMA 3F6OA 4ACKA 2VBYA 3D9NA 2P0WA 1MMNA 1TNBA 4G8KA 1PJRA 4M74A 2ISZA 4G8XA 3SYTA 3MFKA 4AIDA 2JZYA 3GFMA 3CCLI 4Q4ZF 3PREA 1W5SA 1BI3A 2DJIA 2FI7A 3HRSA 3FUJA 4HG2A 3I64A 4HSTA 3W9GA 5BV0A 2IQCA 1OR7C 2LSUA 3L17A 4ENMA 4BS9A 3DQVC 5HLTA 3PM1A 2WXRA 2MG4A 5JVGF 2HYZA 2QYOA 3B7TA 4M3OA 2M45A 2ETHA 4P55A 4DI3A 4WNGA 1XN7A 3T8MA 4OIQF 4WF2A 1E8YA 2R7FA 2XPVA 4MO7A 1N0QA 2EINH 3GTKJ 5EJIA 1USTA 2P7VB 3DEUA 1BI8B 4GXOA 1STZA 4ZYEA 3EUKL 2DLLA 4GB9A 5GP9A 2VQLA 2CG3A 1UZCA 2X6YA 2IA0A 4AUXA 2X38A 5BNWA 2G1LA 3QPHA 3F9KA 5E17F 1GT0C 4N39A 3TWVA 4WAFA 2X85A 3CMYA 4IRGA 4TXPA 4S04A 5D4SA 5IT3A 1TN6A 4HX8A 2EJRA 2IGKA 3Q73A 1DVPA 3W6KB 1W0TA 2DAOA 3BTIA 2GQQA 1U9OA 4LLLA 3I3NA 2JRTA 3K1NA 1U5TC 4A5NA 1ETWA 2AXTC 2BEOA 1JGGA 2BVMA 2ZJPF 3ELKA 2I2OA 1OCOE 3AU4A 2VUMJ 4FA6A 3K10A 1FWZA 1FTTA 5JHUA 2XGCA 2UXNA 1UJKA 5TGTA 4YIIA 1EYHA 1FVHA 4OWRB 2LC2A 1T98A 3GQSA 4XQFA 2XSDC 4BT9A 1MBJA 3OS1A 3ZGQA 3U66A 1WJBA 4ACLA 1H6KA 2IS4A 3D9MA 2WXIA 3BR1A 1PDNC 2FO7A 4EMSA 3PH0C 1XSVA 1RRJA 3UM0A 2VPRA 5D5WB 4BQOA 4E7IA 3OXGA 2M87A 1ZGJA 2TDXA 2Y69E 4LG0B 1Y8RB 1D1BA 2GRQB 3SD5A 5F0FA 2YSRA 2ZKZA 4CDMA 2MH2A 2RC4A 4I1AA 3X2QE 2V9PA 4E85A 2EILH 4G7HF 1UAAA 3HBLA 1G3SA 1DNPA 1FT1A 4EZKA 2RV8A 1TWGJ 4PSXA 1XGNA 3NWTA 1IQUA 2XQ0A 1MGTA 2Y9YA 3RU0A 1IXVA 4HRNA 1Z05A 2PG4A 3OYMA 1QBJA 5CEDB 1QQEA 3KYLA 3K9IA 3TWUA 2EZLA 3GFJA 5AIJA 4I0BA 3EDPA 4ZH4F 4XBFA 3S3MA 1CGPA 3RZOJ 2ZNYA 3MV2B 2JVHA 5FQ4A 4D0PA 4O1PA 4C0EA 4U0WA 3JQ1A 1LVKA 3PQKA 1WKMA 1I6HJ 1WQ2A 4JA9A 3TWXA 2R7QA 1VFCA 3CHPA 2JPBA 3CC4I 2JPEA 4LGWA 4RM3A 5HLGA 2CUZA 4ANWA 4KUMA 1S3JA 5J3LA 2XGXA 5E76A 2WXGA 4NBQA 5DV5A 3UIOC 3ZXSA 4UUCA 1TNSA 5F64A 1XSDA 3IWFA 5H6QA 1L0OC 3TDZC 1RETA 3LA2A 1MX4A 2H6GA 1OR7A 4HYEA 3MKYB 5HDKA 1MSFC 3K70D 3FUMA 1JWFA 1BC7C 5DM6F 2EIME 3QPSA 2IONA 4NURA 2BBYA 3DV8A 2ID6A 2L02A 2MFZA 2LY9A 5DYMA 1FPQA 1GHCA 2O5RA 3SF4A 4UI9K 4I6GA 2L6BA 4RG6A 2JA7J 1H0MA 2RQPA 3UI2A 2IPQX 2I2BA 2OZUA 3F8CA 1JUSA 3FKIJ 2E36A 3G2WA 3ZHEB 2G7HA 1XGOA 2Q1ZB 2QQAA 1MH4A 3CCSI 4XLCA 1OMIA 1U3EM 1NK3P 3DEOA 2HTJA 1OJLA 3FF5A 2XGOA 4BL0B 3FEXA 4P29A 4LOCA 4MTDA 2O8XA 5J1RA 2WMNA 1MBGA 4KIBA 4C9BB 1ACIA 3OYLA 2Y4TA 3V2XA 1HSJA 2QENA 1IN7A 1JHHA 1ZARA 4LLGF 3L82A 3UKGA 1YA0A 1OCRH 3WG9A 1P4XA 3KZYA 4U07A 2FBHA 2WAFA 3KFWX 3TW6A 3IC7A 2E35A 4RMNA 1OYIA 3CF5F 1OXJA 2OD5A 2COMA 2XRZA 2EZKA 2CFXA 3G3ZA 3MEXA 1P9QC 2CS3A 3QRFF 4AJWA 4QLCU 2QFCA 2PMZA 3FTUA 3MEKA 4XX5A 3R9MA 5HDNA 3HB9A 4M6XA 1E0EA 1R1TA 3T8RA 1JHFA 2WB1A 5HVQC 3PIOF 3A01B 1IRFA 1G8XA 1OFCX 5CECB 4XKCA 3ZQHA 3HZJA 1RNLA 3EYIA 4LD5A 5JR3A 2LAIA 4KISA 3TP0A 1Z9CA 4IHTA 5FFXA 2M63A 5BV1A 3TGNA 4JEUA 3Q78A 2Y0SA 3HPGA 1IDZA 3ZYKA 2WMOA 3K7AJ 1SA4A 5DHPA 2VN2A 1DPUA 4GRIA 5ICFA 5B1AE 1JTYA 3Q15A 4NQWB 1KQ9A 1J2FA 2A0TA 2ZFWA 3MJWA 3K4CA 2DTRA 5CMWA 2Z33A 3MCXA 3A01A 3JRDA 2R7ZJ 2HEOA 5KWDA 1WLNA 1MMAA 1PP7U 2AXZA 3Q9NC 4HOTA 2OEVA 2L9BA 4Y3OA 2KT0A 2FQ3A 4FE7A 1SMYF 2WAEA 4PGHA 4XRSG 3JRGA 5B1BE 3CVXA 1R23A 3DBRB 3FWEA 3K4MA 3KLOA 1F9NA 2GRLA 4RA2A 5E3MA 1I39A 2VQHA 2BY2A 3F72A 1KU7A 3BTLA 2GBYA 2KMUA 2LREA 2FF4A 1YI2I 2C2LA 1BW5A 2K9SA 2YHCA 5FLXK 1ELKA 4BWRA 3K1PA 1HZ4A 2B0OE 1I1GA 3FDYA 4BE1A 4OAYA 1W5TA 4DBRA 3DU5A 3O8HA 3HXDA 4DY6A 5CQEA 4H0EA 4L18B 3HHMA 4GCVA 3I6WA 1X58A 1BR1A 4ABNA 1QVUA 2LR8A 2GIZA 1SFXA 2JWTA 1OCRE 2K85A 2R5SA 4KXKB 5EIDA 5ENNA 1B8IB 2EA2A 2HU9A 4D5CA 2FSWA 1IUYA 1K7AA 1ETXA 3PE3A 1VTNC 1UHMA 4KMOA 1G6NA 5FJ8J 4JHKA 2HI3A 3DEPA 2MLKA 3GZ6A 2QQ9A 4L9VA 1NG6A 3PZ2A 3V8MA 1J5YA 1U5TB 1X1DA 5E1WA 1Z6TA 3I4PA 1J59A 4HI8A 1A36A 2Q7FA 4I1MA 2VE8A 4BQAA 4AVZA 3JSPA 3D5LA 4HA8A 3OXLA 2YNQA 3CHSA 4MHGA 3APCA 4I6EA 3P9CA 1A5EA 2Y0MA 1INZA 2E2IJ 1ULYA 2E60A 2V5FA 2CUFA 2Q8KA 5LRSA 1HH8A 3CLQA 4GYYA 3LOCA 1YRNA 5EJGA 2JSPA 3L7WA 2PJPA 2VYIA 2M3AA 2P8TA 1RKWA 3I9V2 3Q9SA 5F0HA 4YDYA 4BX8A 1I5ZA 3VDXA 2VL8A 2IRFG 4IOCF 5LEKA 3RKYA 3CV0A 3FUNA 2OCCH 3C3RA 4ATGA 4JQFA 3VZDA 3UIPC 2DBAA 1U5TA 1N94A 3D5SC 4U0ZA 4XOTA 3DP7A 2L4AA 2NVUB 3LS8A 5AN8A 3RAUA 5FROA 4FTHA 1E2XA 2GRRB 2KCKA 4YDOA 3SZ7A 5JEJA 3BG6A 3FXJA 3KP3A 3CD6I 4XLNF 1FIPA 3AG3H 4PCQA 1I6XA 2RD0A 2HS5A 4E7KA 4UNOA 2VSOE 4FLHA 1ZRFA 5AIQA 5EG0A 4BACA 3LQRA 4B0ZA 3HTUA 2ZCWA 4C2MJ 4UUVA 1BJZA 3BROA 4MKTA 4DIQA 1SZ9A 2DCPA 4II3A 2VJ8A 1U7VB 4V19K 4C0MA 1QZ2A 3F22A 2VSYA 3CEQA 1HCRA 2EIKE 5B1BH 3A02A 3GTOJ 2XPIA 3OYFA 4ILIA 1QA6A 3QKYA 4HBLA 1Q1HA 2DJNA 1YT5A 1OWPA 2D1HA 2DA6A 2OUMA 4YELA 5LGNA 2AJAA 2GRPB 4PFOA 3R0JA 3CCRI 4L0YB 2P6TA 5DCMA 3PNYA 4AIHA 1ZLKA 3TBIA 2LOOA 3HOTA 1HS6A 3ASOE 5FZSA 3RPUA 2O0YA 4YNDA 2MGQA 4G2SA 2DZOA 1ZH5A 2FA5A 4GCNA 4GMJA 3UQ3A 4CYMD 4GA1A 2TRTA 4PJLA 1BI0A 4XLFA 2GWRA 1GV2A 3B6CA 4S0HB 2ELKA 4F52A 4CT0A 4JD2G 3QU3A 1Z3YA 2ME6A 1VQLI 2WA0A 1BL0A 1LD8A 4PJNA 2D2WA 4DJAA 3I4NJ 3QP5A 1KQ0A 1ZOQA 2CSWA 1ZAOA 2J07A 3TJPA 5EZGA 1IV6A 5CBNA 3PZDA 3WU2C 3OYCA 3NQPA 1WAO1 3RRMB 4XLPF 3L6AA 2LAHA 1BBYA 3EU9A 2WAQN 5J6XA 3LY9A 2V4HC 4Y17A 4BE2A 2GRMA 1WM5A 1YE9A 5DCMB 2VGEA 4EBAA 4E7LA 1Y8MA 1MMGA 4CYCB 3AAFA 3BZKA 4JVSA 1WGXA 3SDBA 3HUFA 3JW4A 3KE2A 1K3NA 1JUMA 2KJBA 2VBXA 2K27A 5F6FA 3QQAA 3QAHA 2I29A 3MZLB 3P1UA 1J4QA 1TR4A 3D9PA 4WRRA 1U78A 1X2MA 1HOMA 1Y1WJ 2P81A 1MZBA 2WTEA 5BVIA 3A03A 1FP1D 1PYVA 3U1DA 5HLHA 1R5HA 5LP0A 3DEEA 1B72A 4D5FA 3VYRB 3AG1E 3RKXA 3AFHA 1OWLA 3GF2A 3LMMA 4FLBA 4KDPA 4XONA 2F5DA 1J75A 1ZR4A 3TAXA 4LITA 3GZ5A 3WTZA 2QQ8A 4M3EA 1APLC 1QRYA 4W9RA 5DUIA 3VYTB 1IQRA 3D0SA 2V4JC 2ELJA 2AQFA 2QKLB 3X2QH 2EV5A 3G2VA 1X19A 3HYIA 5FINA 2HKOA 5DS9A 5DJOA 2QM3A 4ILGA 4B89A 3GX4X 3T5VA 3DCFA 3FMQA 2ZXIA 2W57A 1YCSB 3CUQB 4DLOA 3JRIA 2XGDA 3GTQJ 2W00A 3E0JB 4XRFA 4LNGA 4MBGA 5J40A 3GUDA 4YFNF 5BPIA 5FWQA 3KP6A 2QYUA 4XLHA 2FEZA 2BGCA 1FY7A 3DBHB 2PLYA 1LF8A 3TXNA 4AVXA 2ZXHA 2DN0A 4RAZA 1UJXA 2R03A 2KJCA 3GZNB 3MN2A 2XZDG 1TL8A 3J81K 2R7VA 3EDTB 2VTBB 4NC7A 2PQ8A 2XT9B 3ESLA 3HUGA 1MZKA 3HKZA 3QARA 4KFCA 2CUEA 2VBWA 1W7PB 3OYJA 2O7OA 4XN3A 4GTTA 4APFA 2IS1A 1SQMA 4OINF 4NB5A 2R17C 2ZSHB 2X4HA 1KZHA 4RB2C 1A5JA 3VPYA 1W36C 1WJEA 1GXCA 4RAFA 1IV8A 1G3NB 4G12A 5B3SH 3GTGJ 1N78A 3PSIA 3EHQA 4GAAA 3Q49B 3ULYA 2M5WA 1R21A 1BIAA 5HODA 2EINE 3E6CC 4KZ0A 1X5BA 1E7UA 4HPQA 1LUJB 1K4TA 4CZ2D 1JE8A 3KETA 4OIOF 2ZGGA 3FTWA 4I7HA 4X0GA 3K4BA 3L9FA 5LBQA 1K1AA 2YS9A 1I50J 1UHSA 3VODA 3L54A 3E33A 2A6TA 1UHWA 4JOMA 2RFAA 3K2ZA 4MEYF 3C1DA 2P9LG 3IKVA 5EGOB 3SZPA 5HQ8A 4M3BA 3OOPA 3C2GA 5J47A 2I9CA 3ZRHA 1ZYRF 3QPLA 1BA5A 2ZB9A 3TMOA 4OAVB 2GM4A 3UN0A 3TG4A 3JCUC 4UI9J 1FOXA 1N4SA 3TL5A 5LHGA 5JJTA 3CESA 1N75A 1BOBA 5LHHA 4PZJA 3H1CA 5D8KB 4CH7A 2Z9OA 3G2SA 4B8XA 4CT4A 3CVVA 1V3FA 2Z99A 3AG1H 3TQNA 4GFBA 2IY0C 3V7CA 1WCMJ 3GLLA 3RDIA 4GZ5A 2CQNA 3OYHA 1E8WA 1E96B 4WWOA 1HSTA 4A3BJ 4II2A 1FMVA 1Z0ZA 2QVLA 3JSOA 1HBXG 3BCAA 3QYFA 3KP5A 4LK1F 3RQIA 3HOUJ 1FOKA 4OMYA 1UG0A 3H5AA 4A3LJ 3O48A 4UWLA 4Y4RA 5L3EA 2NYJA 1QU3A 4UUSB 2CHXA 3F8MA 3NAWA 4RSYA 3FFLA 3KSQA 3ESWB 3FX3A 1Y6IA 2VQCA 2X3MA 4QTRA 4YEJA 5KBAA 3RKQA 4PJ0C 5ICCA 3KYCB 1SAXA 1O3RA 4IX7A 3I71A 5CPRB 3UT7A 3R7RA 4BQNA 3GTMJ 2IF4A 3Q3SA 1R36A 2MBFA 4HVBA 2EH3A 4PS7A 3HOZJ 3J7AO 3MKQA 2X6IA 5A2QK 1TW2A 2WQ6A 4XNFA 4J8EA 5EDSA 1QZYA 4ZYAA 2ZNZA 5E18F 4AIKA 2PQNA 3FU5A 1FMWA 2BXZA 1P6RA 1RR7A 2R92J 3FTYA 1FHQA 3IH4A 4GZ3A 2M30A 3K9TA 4J8DA 1G59A 1W36D 5LFAA 3S1QJ 5JELA 2XPYA 1YRNB 5ARFA 3LSMA 3BTJA 4EHMA 3KAEA 4GZ6A 3J80K 3DSXA 1UOHA 4N3BA 3ZN1A 2KFUA 1O7LA 4BTAA 1OPCA 3K4NA 3IRRA 1F1ZA 3GZSA 3CSFA 3ML8A 3HJEA 4KYOB 2IAIA 3ONLA 4HV6A 1GUUA 3EUHA 3Q9VA 5BNGA 2W7NA 2V79A 2Y75A 3CDHA 1FSEA 3FUHA 2YHEA 1XGSA 4QPOA 1D5YA 1NHAA 5BQTA 1ZBPA 4DQ2A 2VSNA 3DPYA 1YIOA 1TWCJ 1Z67A 4RGSA 3T8TA 1KYWA 4C3JJ 2QZAA 2R5ZA 1YG2A 1R71A 3J7YJ 3IXEA 3ZUVB 2R7XA 1HU3A 3J5PA 4F53A 4UWGA 1QZEA 2E7XA 5BS6A 2FJ1A 1MNDA 4GMRA 2EK5A 2ZFUA 2IGNA 3F8FA 4C9YA 1G3TA 3TDUC 3I54A 2DA1A 2KB4A 2MYSA 3RQ4A 1N54A 4LSZE 5JLWA 1H8AC 4HB5A 1QQIA 1IN8A 1ZGAA 4OOIA 3TOBA 1E90A 4Q96A 4FHKA 2MD5A 2Q2EA 3ASOH 3DBLB 4IRHA 2IGMA 1PC2A 1EKEA 3PNLB 5ITZF 1U2WA 1HXIA 4GDFA 4ESFA 3LSTA 4EJWA 3HUGB 4I09A 4KMUX 4NNJA 3JREA 1UFMA 2A68F 2Y2ZA 3G1OA 3K6GA 3FU3A 4KZCA 2OVBA 2QV7A 4M9ZA 1Z3XA 2D45A 2DWZA 2J49A 4E6HA 1BR2A 5EEGA 1NZNA 5G2NA 3POAA 1ZK8A 1LDKB 2XAUA 1V5GA 1WVRA 1YW8A 4A3IJ 2H6BA 5EEHA 4QIWN 2H6IA 4LCTA 2I6HA 4Y7NJ 1R4MB 3RO3A 1LVAA 4M9XA 2M0CA 1XTAA 4P9UA 3RJVA 2K9QA 4Y52J 1XMAA 1BI7B 3PEVB 2JT1A 5D5VB 5IYDJ 4TRQA 2BW3B 3SFIA 1TNUA 3EHNA 2OEWA 2EV0A 4H7YA 2XCBA 3CGHA 2WVIA 5HS0A 5EJHA 2V1XA 4D10C 4XKBA 1O7FA 4BJ5C 5AQBA 2HR2A 1ZLJA 3T5XA 1TYQG 1JCRA 2XC7A 1DC2A 3TWTA 1QO0D 3OIPA 1HDDC 5FD6A 5EGOA 4ESJA 2V7FA 4UY8I 2E2EA 2LSVA 1H2TC 2WB2A 3H9GA 3HTSB 2BY3A 3D3MA 1OISA 2DO7A 1D8KA 5HS7A 1Y39A 2P58C 4APOA 2RREA 1H88C 3OS2A 2L7ZA 3O3KA 1A6IA 4BQQA 1O3QA 4YDWA 4IRUA 1SUWA 3LYAA 2PM7A 1ITYA 4GU5A 3H0GJ 4ZTJA 2Q0OA 3DWLG 1X1BA 1ZR2A 2GLOA 3PO2J 4G7ZF 1YJWI 3FDHA 4A12A 2EFOA 4L5IA 1K3JA 4I76A 5HNHA 2WAQA 3LVRE 3NOGD 4O1OA 3V79K 2A05A 3DTKA 3QOPA 2VOPA 1Y3HA 2P9NG 1Z21A 3E5QA 1S70B 4RAYA 1PUFA 2CG2A 3ZOBA 1ZN2A 3IV5A 2LG4A 5IP6A 3IHVA 3DU6A 4OAUC 1U0JA 2E5ZA 2HXOA 5ILSA 1N52A 4TUUA 4MEXF 1L5JA 4F55A 2V1DA 4GMLA 2A3SA 5IT9K 4IQ4A 5LGTA 4L23A 3UX4A 1NG7A 3BZ6A 2MOWA 4Q47A 2DQLA 3I4MJ 3BG0B 4TV7A 3ZMTA 5DHUA 3VTXA 2F5CA 4PS3A 2KLOA 3E6BA 3A77A 4UVBA 5EYRA 1HX8A 4J01A 4JIVD 2BKKB 4R1HA 3BP8A 2FO1E 2E1OA 3CUOA 3HHGA 3RPUD 9ANTA 2QZ8A 3HXEA 4BX9A 2J4BA 2JA2A 4K5AB 1FEXA 3H9JA 2YX7A 5CERB 2L7FP 2IOSA 1B59A 1ZG3A 3HIFA 4NACA 4KIFA 1H2UA 3AG3E 1YX3A 5LRRA 3DLAA 4I6JA 5LCWC 2KIMA 3D9JA 3UKRG 1OWOA 3AG2E 3CJTB 3W2VA 2GOMA 4XSZF 2JVGA 2KL4A 5A6CA 3G2UA 3CCJI 1MJ9A 3M8FA 1CQTA 3OXFA 1IXSB 1XB4A 4I02A 2AFFA 5TISC 3HRMA 4WWPA 1GDTA 2MYOA 1WFXA 5EN5D 3F8NA 1ETKA 3V42A 2LRDA 1IRZA 1PAQA 3VSKA 4ENJA 3I59A 3BPXA 1R4NB 3F23A 3CVYA 4JYKA 1X4PA 4WCGA 2K9NA 4A3FJ 2WXJA 3FP3A 1OUVA 3LPZA 3ZYQA 2JN6A 4KBQA 3LSKA 3I53A 3B7BA 1OYYA 3DPUA 1V4RA 3GVAA 4WX9A 2I1JA 3DSSA 3KD7A 3LJ3A 2KCVA 4A0EA 4DZPA 1JT0A 1N11A 2QWWA 2DZNA 1BR4A 4Z6YA 3FXUA 3D1NI 2E2HJ 1JPLA 2TCTA 4TXRA 3Q0UA 1HFAA 4UB6C 2DFFA 2LNBA 4UXNA 3NZSA 1TWHJ 2KISA 1LJ9A 2CO5A 2AHQA 3IH3A 2FX0A 4DI4A 4HNTA 3OSFA 2CWEA 1T39A 1WDYA 2L0IA 2OPTA 3HGGA 1IRXA 3FUDA 3BR0A 1MKMA 1SD7A 4XR6A 3ZR8X 2FBIA 2NS0A 4LIUA 5F04A 3Q7FA 1TQMA 5AJLA 1K78A 2Z16A 5ILVA 2L0TB 3VZCA 3BOQA 3FIWA 5KAIC 3JXJA 4A63B 1D8JA 3F8BA 3SXYA 4R79A 4RB1A 4WNFA 4GTQA 1O3SA 3WTTC 1NL4A 4DW6A 2DOAA 3DITA 2V26A 3NAUA 5T4YA 4EGYA 4MFDA 5CCMA 1O1SA 5E3LA 4IHSA 4Y6WA 1XDSA 4BETA 2XB0X 3I0TA 3WHBA 1YYHA 4XKVA 1QHGA 2WBMA 3FK6A 3FM3A 1W7PA 1IGNA 4IJAA 2OF7A 3BG9A 3SJMA 2XROA 5ANLA 5EJFA 3DSHA 2PMZN 2VGXB 1TJFA 5J4VA 3FUFA 5ENQD 2MSYA 1KT0A 2EILE 3CQGB 1T33A 3N05A 2EQRA 2EIMH 3QAQA 2H6CA 1V54H 1KHUA 2NAZA 3E1SA 2XEVA 3MYVA 2VT3A 4EZJA 4B3XA 3HUEA 5M5YJ 1TEZA 2JUGA 4HRLA 5HS8A 2A5WA 1EH6A 3DSVA 2XASA 3HL2A 1LTXA 3V8PA 3C18A 1SVLA 1ZB1A 5EX3A 3UT8A 3Q47B 3P5JA 3QU6A 4U7BA 3JRAA 4XIFA 4HQMA 3ZPLA 3FTXA 3H36A 4UVCA 3WE3A 2ZISA 2ECCA 4HAMA 3FBIB 1XG1A 3NWSA 6PAXA 4P9FA 2AWIA 3W6VA 3KP4A 4UVAA 4D7MA 1ELWA 3BQYA 3R4KA 1FYKA 4HF0A 5BPPA 4CRWA 4N2SA 5F1RA 3IAS2 3CLOA 1ZG1A 2IOLA 4G26A 4Y15A 1I1SA 2RAEA 3I5PA 3JQ0A 1IN5A 2VKHA 4LRZA 5TRDA 3UR3C 3KZZA 1G6GA 4DGWB 1JXSA 3AL0C 1JWGA 4H7XA 1TQPA 2VJJA 2OBPA 4WERA 2WB1N 2VASA 3V8KA 5FD5A 1GVDA 1UG3A 4I2WA 4LUNU 3CIAA 3BCBA 2XB5A 4F7ZA 2CW7A 4EQFA 4U88A 3L9TA 1Z7UA 2M7AA 5CVJA 4Q5SF 4EZLA 4GYGA 2LBFB 3VEPA 3FXQA 3QWVA 4DK5A 1WPKA 3GMJA 3OY9A 3QOUA 2IA2A 3G71I 5EKQD 3CJNA 2BHYA 4RGUA 2VKVA 1AA7A 3BG5A 1N25A 2P9IG 3ZQIA 2V0PA 3V7UA 4IXAA 2K9LA 1LDDA 4I43A 4DPRA 1DU0A 2XCCA 3EJNA 1QWTA 2J5PA 5HDGA 2IJLA 3O8GA 5IP9J 3AAAC 1UW4B 1D0XA 2J5OA 3CK7A 4A0XA 1IHBA 4HLEA 2OOEA 1LD7A 4CDRA 3K4KA 1UHTA 1GLNA 4QQIA 4BXUA 3JTHA 5H20A 1QGPA 4HNUA 2QY7A 1AKHA 1YO5C 3FM8A 3G1MA 4XN0A 4F6RD 4WNEA 2DK8A 2W48A 2V6EA 3B7RL 3UNNA 2F4IA 4WXDA 3MGBA 3RIRA 2NNYA 2BW3A 3CDIA 3UNMA 2XHKA 2DK5A 4EJVA 1EDUA 3QWPA 3MCZA 4CICA 5K7ZA 1V55E 3EUHC 2DXIA 3BEEA 5KJMA 1YJ5C 4UWFA 4WNDA 4U95D 3AS8A 4EPZA 5EZHA 1SAUA 4G2VA 2M34A 2D5VA 4L5EA 4FP7A 2R7UA 1R6RA 5FQ6A 4ZDOA 3D9OA 2QEXI 2I2CA 3HSEA 4G6QA 2XPZA 2E1NA 3HC7A 3DKWA 3DKXA 1WJFA 5GPCA 4RG9A 2F2EA 2MC4A 4KNYA 5LCWJ 3QK0A 2GXGA 3BLYA 3P7NA 1BOAA 1W1WE 2ZJRF 3FZVA 4EGZA 1JKQC 3H3VK 2J9QA 4JONA 3LFKA 5K5OA 1T0FC 1AHDP 1G3YA 2ETBA 3L2CA 4C2TA 2ZIRA 5A23A 1YHQI 4CCAA 2WXFA 1I27A 4A3CJ 3S7DA 2IU1A 4BT8A 4RB0A 1WJAA 4RVBA 2XS8A 2JLBA 1WI9A 2VQGA 3FU6A 2DDBA 2VXDA 3JXIA 1SC7A 1UJJA 1HQCA 2KIQA 3N4MA 5BMZA 4U96D 3TO6A 3I5UA 2ZMEA 3DTIA 3TW7A 2EIJE 4WK8F 2DW4A 2VODA 1TNZA 1KONA 2AXLA 2DA2A 2MABA 3C2HA 1FPPA 2JQLA 1S7OA 1U3DA 2DI3A 2F4MB 3A0HC 2B6CA 1Z0SA 4CGVA 1X81A 4BHCA 1DD1A 2JEKA 3GZ2A 2CMPA 2D1VA 2GA2A 4XMYA 4EV0A 1PUFB 2CV0A 4AIFA 4LG3A 3TWSA 5G55A 1TT0A 2GXBA 5M5WJ 1H0AA 4HF1A 3EQLF 3S40A 3SQNA 3FH8A 3JRBA 2VB6A 4GTPA 4N2QA 3UXGA 4AXHA 5J08A 3UTMA 3HRUA 3SI5A 4DNCA 5KJNA 4A0ZA 4EJTA 2XGSA 2XGMA 3JRHA 4CYCA 1FLIA 3UNGC 1TLHB 3UUXA 4B8AA 2I2AA 1V5EA 2STTA 1TQIA 1WH7A 2BV6A 4RB3C 5D6EA 5K5QA 1XGWA 4ZYGA 4DUIA 2R02A 2X6FA 3GFLA 2ISYA 2IVMA 1GVJA 2X51A 4RBOA 2FNAA 2DT6A 2JA6J 3FTZA 3LNQA 1FT2A 4TXQA 2QLZA 1IG7A 1E8ZA 3CZ6A 1F36A 1SANA 3PUBA 1U0TA 2K86A 3L1PA 3HVEA 4XE0A 2X6WA 4ON0A 2VONA 3E4BA 3OIQA 3M1CA 2DPUA 1T0FA 3A2KA 2GAUA 3DPTA 3EYYA 2IEJA 3OYEA 4IF4A 3SEZA 4F91B 2H8RA 3IKTA 2BKGA 3CF2A 2ZXWE 2VJ4A 4WXCA 3S14J 5KNHD 3M8EA 4DX7D 1B4AA 1E3OC 2BZTA 2L7KA 1HF8A 4QPQA 2GXAA 3CC7I 4PH4B 1P2FA 3IH2A 2ESHA 4JZYA 3V7YA 2ADUA 4ANJA 5JEOA 3RK6A 1X3ZB 3BDDA 3FUEA 5JJ7A 3HXLA 3I4GA 5IT9Z 5IY5H 1JKPC 5EG0B 5DM7F 2MW8A 1NTCA 2CG4A 4XZ4A 2RKKA 3SFZA 5E8IA 1D8DA 5AONA 3Q7AA 2DU9A 2HOAA 1VQOI 2DTZA 3ZNGA 1MW7A 5FFZA 1G88A 3VLDA 4QCJA 3IHYA 4J6IA 1GXPA 2LBFA 2QC9A 4A6DA 5IP7J 4JBAA 4O6FA 3CCYA 4BYYA 2NVTJ 4DX5D 3MKLA 4DBQA 5C3EJ 3ZHEA 2DDAA 1HLVA 4U8YD 2ZJ2A 3MDBA 1DCQA 1LFBA 1YOVB 1W5CC 4DLQA 1TWFJ 4A5MA 4HBDA 1A17A 3WG7E 3SBTB 5AAOA 3H3UA 1ON1A 3E37A 4XIDA 3U4TA 2ZU6B 3BG7A 4CEMA 1MD0A 4E70A 3I4RB 4GZDA 5JI6A 2DT5A 4BEHA 2WY7Q 4N9IA 3DPLC 1O1RA 3LFUA 3KEOA 4O3MA 1AKHB 5G05C 1BI1A 3ISPA 3FEYA 2CSOA 5BOXA 1YITI 1XD7A 3S2WA 2YX4A 2H1LA 1YGSA 2LD5A 2WV0A 4O60A 4JIWD 2KXPC 1PY1A 3PE4A 5F1JA 3CCVI 1HW1A 3HKZN 2R7DA 3PUKA 2Q2EB 4J8SA 1U7FB 4RAGA 3HIZA 1D0ZA 3KEZA 3CLJA 4BHPA 1O3TA 3OOUA 3LXUX 1K3QA 3HOVJ 5FGMA 1XPXA 3H5NA 4R7LA 1YJMA 3L22A 4PUCA 3MZYA 4FE4A 3B7UX 2H94A 1HF0A 4U8VD 3AG4E 3L00A 4U7EB 1I3QJ 2GROB 3CHMA 3DLLF 3CMMA 5LD2C 2K3PA 2XAFA 2CHWA 3CC2I 4BEHB 2BEDA 3IKOB 4Y33A 4BY6A 5G04C 4WXHA 2BF0X 2KRHA 4BTBA 3I58A 5KVRA 2JQ7A 3E34A 2VXZA 3JR9A 3R9AB 4A3TA 4L9TA 4DYCA 3ERED 3I59B 4ZTFA 4HS2A 3ULQB 5J1UA 3SGHA 3ZVVA 4UHTA 4I01A 2EIKH 4XRMA 4A0YA 1E7VA 1WZ2A 3TWWA 4HORA 2DYSE 3VLFA 3MKQB 3V8NA 4I17A 2M0MA 4HQEA 1BD8A 4CUGA 1KQ8A 2HYJA 2LLKA 2FNPA 3L13A 1MBFA 3PDNA 2PQRA 3VYSB 1DPRA 3CVNA 3H5RA 1Y8QB 3ROUA 3LAPA 4I0AA 3ZMUA 2ZMEB 2LK2A 4P1WA 1UN9A 4DX1A 3ELSA 3LJNA 5A7DB 4K03A 3CVPA 1BIBA 1VQ6I 3KT9A 3LCAA 4ENNA 1D3YA 3JRFA 1JJ8C 1MX6A 1ZGWA 2OV8A 3DSWA 5IY5E 2HFHA 4UV8A 3LSRA 1WJ5A 4CZZA 2VSXE 2DCEA 2UY1A 2PN6A 3QWWA 2XPUA 1MHQA 1VQ9I 3P9KA 5BXOA 2LTPA 2OA4A 2QSFX 2W82A 1VQKI 2YU9J 3T5PA 4KYWA 2WXNA 3PNTA 2CV1A 2VI6A 2VJ5A 1VQNI 4Y13A 1U8BA 1ODDA 4LERA 5FZRA 4JW1A 3Q9UC 4ANVA 3BJAA 3KEYA 1QZZA 2Y0BG 3LSJA 3OMYA 4CHUA 2NS8A 2K3FA 2M1BA 5M3FJ 1X1CA 3GZ1A 4UQYA 3S7BA 3WE2A 1SEUA 2EQXA 2NSZA 2PNNA 4K2EA 4AC0A 3WTVC 4Y6CA 3PUJA 4OU0A 3L2WA 3LSGA 2MHKA 4DOZA 3ONKA 1X2NA 3L09A 4MQ9F 1N77A 3ASGA 3FMSA 4P5OA 1MBEA 1YQAA 2K7LA 4M71A 4RLFA 2OTLI 1NA3A 5E20A 2VQ2A 2UY1B 3JUEA 2OJED 2FBNA 1QNTA 2X1EA 5BW8C 3ZMDA 3E6MA 5DCFA 1S7EA 4BUPA 4UB8C 5KHDA 5JHFA 4IL6C 1P7IA 2XAJA 2AO9A 4WWCA 3ZP5A 1YTYA 1NH3A 3TP3A 5EDNA 3WTWC 5K7HA 3OYGA 4HEA2 3QYBA 1U3CA 4YDEA 1J4OA 4LB5A 2DMTA 2K4JA 3RZDJ 3JUIA 1FVFA 4ZHBA 2CUJA 1H2VC 3B7SA 4G94A 3HXFA 3E32A 3EUAA 2NVQJ 5ENSD 4URKA 5FLMJ 3H3ZA 3OSGA 4IKFA 3HRTA 4KA4A 2RQQA 3P2BA 3Q79A 3FH7A 2W85A 5AYWD 4L9JA 1WJDA 4XEIG 2XRNA 3LSIA 2RNJA 5LLQA 4C30A 3MKRA 4I98B 4I1OB 4XKWA 5CVRA 3F6VA 1DCEA 1FTZA 1HC8A 2H8WA 3ASFA 2L3DA 4GA2A 2L5QA 3AS5A 1IXCA 2XPWA 2IS6A 3URZA 4DRXE 3IUOA 4KT5C 3KZIC 2LSOA 1Z0XA 4L5JA 4M3FA 3SO8A 1R7JA 2LH9A 3FXRA 4AY6A 4FX0A 4KICA 1QYMA 4HLYA 4E4HA 3GO5A 3D5RC 3WGIA 1TN8A 3F6QA 3V80A 1POGA 1IC8A 4BNCA 3VSLA 1LGPA 2O6GE 4B93B 3APFA 3R61A 3WGHA 2KRFA 5FKLA 2QYJA 3ZPJA 1FZPB 2X9DA 2W24A 1QNFA 4YG2F 3PRZA 3S93A 3GFIA 2DMQA 2R3SA 1UCRA 2HQAA 3HOXJ 3HOWJ 4U63A 4LNUD 2LY2A 3QODA 5B1AH 2VTBA 1KZPA 5JEKA 4FJZA 1M1EB 2X48A 3LDZA 4D9VA 3DF8A 5ICEA 2AW6A 4C3IJ 1SVXA 3M9AA 4GGGA 1MSEC 3EHRA 5H2FC 2B7EA 3HHHA 2STWA 3KSLA 4ZFHA 5GPAA 2R7OA 3E5UA 5DTDA 4JB8P 2XIGA 1FBQA 3A0BC 3WTUC 1HA8A 2E1CA 3O2PE 3O6BB 2R93J 3RSEG 2QBYB 1XMXA 3FY4A 2M8EA 1ZKGA 3CJRB 2HVSA 5GTIC 3AU5A 1RPWA 3NARA 4ZJZA 2Y31A 3MVPA 2M4GA 3S8PA 2LVSA 1SA5A 3NF1A 2P9KG 3V7SA 1OCCH 1LPQA 5T8IA 5CMYA 1H9TA 4M9SA 3HG0D 3FHNA 4V3IA 2CU7A 3U2RA 2JKDA 4LMYA 4IHYA 3U64A 3HPHA 3D9HA 5CRUA 4IRIA 4FT8A 1MR1A 4DX2A 3IEGA 1NA0A 2YQ8A 2PL2A 3S17J 3JAMZ 1OCTC 1BC8C 3AJIA 5KJLA 5DDGA 1KT1A 1DP7P 2LKSA 1Z1DA 5DHSA 2HOSA 3PO8A 2UWJG 3L2RA 4ILHB 2QBYA 3S3NA 1O1TA 1B1BA 1VDYA 4R9PA 1VQMI 3DWLE 3PVLA 2LYCA 4XRSA 3CCEI 5A2QZ 2UZKA 2IGOA 2CFZA 1FOWA 1YX5A 1VI0A 3FULA 3PQJA 3GW4A 4CYDA 2AXVA 5C4VA 1DU6A 4C48B 3UMZA 2WXHA 2HZDA 2OVFA 1E17A 2I10A 5F0CA 4A3MJ 4FJYA 5H6RA 2C0LA 4HNAD 4U0YA 1ONVA 1R9TJ 2GGFA 3WU1B 2FUG2 4FETA 3MKZA 3ZYMA 2QSGX 5DHTA 3WHCA 2KZTB 1XMKA 2EWNA 1F5TA 3ASNE 3LY7A 2O61A 4PS8A 4ZZLA 4DYRA 3M1EA 2QA4I 1WRJA 3LEWA 3MKWB 1N4RA 2G0EA 1K79A 2BHZA 1N9AA 4EECA 3DFGA 1Z7LA 4ZC3A 3BR5A 2Y4UA 3LKUA 4JHRA 3ZQGA 4L7TA 2DOFA 1HXDA 2VT2A 3HM5A 2P7CB 1IKND 1KPSB 3ABLE 4A55A 3QB2A 4U87A 1ETOA 4F3QA 5FJYA 1WHUA 1E3HA 4J00A 2RGVA 3ZMZA 3PZ1A 2VC1A 2W25A 2I2FA 2I5UA 2ETAA 2AQEA 2FMYA 1REPC 4G24A 1LDJA 4IHXA 3ABKE 1Z6RA 3T1BA 4BHBA 4YIFA 1B89A 3D9IA 3DRAA 3S7JA 5BT1A 1A31A 2HDDA 2Y48A 4CSWA 2IA1A 5LGUA 5ILUA 1HKTA 3N71A 1LEBA 1KHXA 4AVPA 1QHHD 1IDYA 1U6GA 4FU3A 1MDMB 4MGRA 3DEWA 3COAC 2VIXA 3FISA 4F92B 3TG5A 4N5CA 3SBSA 4Z68A 2KPMA 4HW0A 2DQRA 2Y69H 2HO1A 3ABKH 4N3CA 4V24A 1SD4A 3V4GA 4B8CB 1VF9A 3KP2A 2DA7A 4U8HA 1Y3IA 2PBIA 5E8GA 3BG3A 4LJZF 2E2JJ 2CQ7A 2XEHA 4Q69A 1FHRA 3CDLA 1BM9A 2P1RA 4FHTA 1K2MA 2IBDA 2V6CA 1BPOA 1TNYA 2BRFA 4UV9A 2VPLA 4G7OF 3CTAA 2LUHA 4X8QA 1TJCA 1IUFA 1DP3A 3G2BA 3CK8A 3JAMK 2PFBA 1K1BA 2ME0A 3C72A 2CJJA 3VTYA 5D0OD 4CGWA 2A6EF 1N4QA 1TZLA 1FYMA 3RIBA 4RGXA 3S1MJ 1RR8C 2MLGA 5CEAA 2Z3YA 3ZQ7A 2E1MB 3L16A 3RRNB 3HXCA 2B63J 1XCVA 4IO9F 4OIPF 2Y9ZA 3J7ZI 2NYXA 2CHZA 5EX0A 2WQ7A 2CFOA 4E7ZA 3BUAA 2JQJA 1ZTRA 3I3LA 2IFUA 2BONA 5EYPF 2W3OA 1U9NA 1KGSA 2IJGX 4Q48A 3HGYA 1X4OA 3QP6A 3EUVA 1K3ZD 1D1AA 1W4MA 5AIPA 2YINA 3S32A 2ONDA 5GADJ 3QWLA 1ENHA 1ZU2A 4A4YA 5DBKA 4AY5A 5ED4A 1W7PD 3IAM2 4GYWA 2L4MA 5EJCA 1E8XA 4KN7X 1O5MA 3H0DA 2VGXA 3PIPF 4H87A 2R05A 2OCEA 5EYLA 3BG1B 2OC6A 4UUTA 2PMUA 3PL8A 1U0RA 3UM3A 3VPRA 3CP2A 3L2VA 3OYDA 2X6KA 1W0UA 3WGGA 5HKPA 1YIJI 2R7SA 5CHEE 1GW6A 4XOPA 3V8LA 5CBOA 4GYOA 3CHQA 1KYZA 2DYRE 2R4GA 5IOYA 1N95A 4TV3A 4CDGA 5ENTD 4J7WA 4HDUA 5DHQA 1ETQA 3ZGKA 1U2VG 2HOTA 3V8QA 4BDYA 5D5UB 4EM2A 1H6OA 1NK2P 1E3PA 2QGUA 3LQQA 4XORA 3ABTA 5JERA 2HR3A 1RW2A 3VA4A 2R2LA 5KK1A 5E3NA 3FXLA 1KU3A 2DYSH 2HQNA 2Y0SN 3K1MA 1XC5A 1KU2A 5J8FA 4B48A 5K5RA 2R7TA 1S29A 4KVOA 1ETVA 2O9LA 1JCQA 3OAWA 4GTRA 1DGRM 5KCMA 1MBKA 4UWKA 5LOZA 3TWQA 4KU0D 5CKTA 4NQWA 3B02A 1KA8A 3VFZA 1T08B 3M4OJ 1UELB 4EQQA 4E7SA 5HRYA 4CCKA 1EA3A 2ZGDA 1TTYA 4LLNA 2L9VA 2HKXA 3FXMA 1R22A 5K1YA 4GPMA 4F93B 1MK2A 3FHZA 4MIMA 4TUMA 3IV0A 1UN8A 4GCOA 3SY2A 4IVNA 3ULEG 1MBHA 2DMPA 2KP6A 3SEQA 3SHFA 3JRCA 1L3LA 2HDCA 2GW1A 3TGOA 3I55I 4PDKA 1H6PA 2EFWA 4UWHA 3OTNA 2HXIA 3DXJF 3ZMVA 4AWXB 1YYVA 3ZFWA 5KNLA 4HX4A 4AV7A 2PMHA 3KEQA 1T2KA 3R0AA 2KZTA 3MD2A 1XS9A 2PJRB 3DSUA 3ONQA 1H9GA 1VQ5I 3Q0VA 3GLXA 3EETA 3G6EI 2JSCA 3OYBA 3U3WA 1FBSA 3TO7A 4BEPA 2VKEA 4JX6A 2KIUA 5FKKA 2XHEA 3LA7A 2CQXA 4XI0A 4GO1A 1Z77A 2UV1A 4ZYHA 3S7FA 3I6UA 5EIBE 4U0UA 3V30A 1BN5A 3CO6C 1FOYA 1JUPA 2F5EA 4BKXA 3ABME 1KU9A 4BAYA 2XS1A 4J0UA 1LFPA 2B0LA 4KVMA 2R7WA 4LNBA 2LO6A 3IWZA 4ITVA 1OWMA 4AU7A 2FXAA 4IPAA 1EH8A 2JRMA 4QFVA 1IW7F 3BPVA 5E1XA 3HOYJ 4K0RA 5FQ7A 5E75A 4DYQA 5IPAA 4IHWA 2JA8J 3MA5A 5KJKA 2JQIA 3J7AY 2DIWA 3IBEA 1QU5A 4CZCA 2RNGA 3WODF 4U04A 3ZN3A 4PFPA 2H6FA 3FM5A 5L3DA 2NXNB 4YVOA 2HGCA 4HOBA 1TP4A 4G6TB 2OQRA 3EIJA 4JA7A 4LEUA 1LNWA 4OVUA 3W2AA 3U9WA 2CV2A 4BSZB 4H4KC 1IAWA 2K02A 1XGMA 4HDVA 1BLXB 5CRVA 5D5XB 4BY7J 2LC1A 3ZMSA 4QWQA 2M2EA 1TNTA 2EFPA 2Z2SB 2F6CA 3OL3A 2KATA 2P2CP 2M8GX 1QBQA 5J8CA 2ZXWH 4EGXA 2O8KA 3H9QA 1BW6A 3OR1C 1SFEA 2RG8A 1WSUA 2M4KA 4WUYA 2ELHA 3WTXC 4B3AA 3J5QB 1JKRC 2ILRA 4R8HA 4M3DA 3E7LA 3DPDA 1IRGA 1RI7A 3S1RJ 4M7CA 4FADA 4PSWA 4RLQA 1TN7A 3QC1A 5CVVA 3OYNA 3R60A 1G3WA 1WI3A 2HZTA 2XRLA 4I99C 4B43A 2CYYA 3Q5MA 4MFEA 5CCLA 3CP8A 2L2OA 2OAZA 3CVLA 2DOEA 1H89C 2F0YA 5GAEJ 3BT9A 2NOJB 2X1CA 3U9GA 2WPVA 3OYIA 1QPMA 3LSHA 1N4PA 1MMSA 2XAHA 2L9SA 3APDA 3ZEFA 1XNFA 2XENA 2A61A 1J09A 2BY1A 1K6YA 4M6VA 5CVIA 3OYKA 2R59A 2KRCA 2WWYA 3CR3A 4GTSA 2KKOA 3M8JA 3OYAA 3RTRA 1SVOA 4MLPA 3HYMB 3PJRA 4EBAG 3MQ0A 4F3VA 2WXOA 1J9IA 3D9KA 3TL4X 3RSNA 1S63A 4PDXA 1BU9A 3IP4B 1SW6A 2NC9A 1LB2A 1FP2A 2LFBA 3ABMH 2W84A 2V5QC 4GYIA 4HOQA 2DFIA 5DD4A 5K7FA 5AARA 2FE3A 2OTJI 1EF4A 4GZCA 4IYPA 2DA3A 3KEAA 2I1WA 3Q75A 2F48A 3BZCA 1VQ7I 2A4ZA 2EH0A 1DEVA 3VLEA 3PSFA 3E6DA 2KBXA 4L1BA 1OKRA 1R5ID 4HV5A 5HLIA 1OCZH 2RN7A 4HLXA 3DXKG 2ZXJA 2KDOA 1WY6A 3FKJA 1IN6A 1HG2A 2KC7A 4HOUA 1GXQA 3R6SA 2IXSA 2FOKA 3CVWA 4G6DA 1LEAA 2XGEA 2E71A 4CGZA 3HRAA 4IHVA 3EHMA 4HLLA 3AL0B 3KS2A 3A1YA 4YVQC 4DX6D 3L2UA 2WXQA 4HXIA 1A04A 4EM1A 3CJQB 3CCUI 2DVWA 3S16J 2VGYA 3OIOA 1Y1VJ 4BXFA 3G73A 1FSHA 2QKMB 3AFOA 1W3BA 4OYSA 4NIKA 1ERDA 3VB2A 2CQQA 3CMAI 3PFNA 2JABA 2P4WA 4D9JA 1XCBA 2QCOA 4N4NB 1K8KG 4ATZD 1U8RA 1KZOA 2QSHX 3M07A 3ZYLA 4XSXF 1EH7A 1RKTA 3M3YJ 4KN4X 3C3OA 5FKMA 1RZ4A 1FX7A 2EZIA 3IL2A 4A6EA 4EATA 4JXTA 3MV3B 1YS7A 4IN3B 2VOOA 3OV8A 4L2YA 2X0LA 2WY8Q 5F27A 3PUFA 3QJZA 3NB2A 2XVCA 1X3UA 2FRHA 1U7VA 3CVUA 3FMRA 5L3FA 3ABUA 1AWCA 1MJ0A 2HTSA 1YS6A 4BE0A 5JA4D 5J90A 2LF7A 1SFUA 3PZ3A 5CLSA 4A93J 2DYRH 1D5VA 3S2DJ 2CFUA 1HKQA 3CUQA 3ZU7B 5D66A 2FMLA 2DMNA 3OWTA 2HPMA 3MZHA 4X6AJ 3RO2A 1D8EA 3CSTA 3B73A 3CHRA 3FHEA 3ZQLA 3B95A 2PIEA 3QPTA 1ETYA 2MA3A 4B94A 3NEUA 5CJ9A 1IXRC 2HDWA 3IHUA 1JCSA 5T3RA 4MLOA 2P9PG 2NVXJ 2XRYA 2X6JA 3BQOA 2P5LC 1KLXA 1B8IA 1AU7A 2J8SD 4MNUA 4FC8A 1S64A 4BSXA 3ZKJA 2EIJH 2FBKA 4AIJA 2Y30A 3ERMA 1K83J 4KITB 2KKLA 4EJQA 1PP8F 1SD6A 1BI2A 4XLEA 2AS5F 5B3SE 3GMEA 4O6JA 1JTXA 1PVEA 4N3AA 5DUKA 4PK4A 3G4SI 1ZRCA 4CCJA 2L9NA 4RM2A 4FISA 1LQ1A 4FHJA 4FCYA 1Z0UA 2JPCA 3GWZA 4B44A 3FXKA 1SFKA 3VYUB 4HF2A 5ARGA 3VA1A 4L2LA 2WXKA 2LXMA 5FLVA 1WV3A 3ASDA 2YPRA 3K70C 2I2DA 1FJLA 4I2OA 3M7GA 3UV0A 2CQKA 3FUIA 3ABLH 3RI4A 3RYPA 1ZRDA 2NVYJ 5AJDA 3UINC 3V7WA 5TJJA 3NOCD 3NQOA 3TXMA 4JEHA 4EJUA 2XUBA 1AWCB 2DFHA 2XF6A 4AM3A 4XI9A 4A3VA 4B1RA 3EU5A 2HPIA 5FRMA 3U1KA 4GTMA 3RRUA 1J4PA 2R5ZB 3LVQE 1R5GA 5L3CA 3SQVA 3ZN0A 1K2NA 1X1PA 3W2WA 4GTVA 2JK3A 1FT9A 2YR2A 2IP2A 1T95A 4M73A 1D0YA 2QVOA 4B47A 2VJIA 3FWVA 3VZBA 4OAZA 5L3BA 1B72B 3CCQI 2ZSIB 3REOA 4ZZDA 4YRVA 3GW2A 2HQ5A 1C0WA 3W3CA 3UM1A 2EFQA 1NI1A 2X6HA 1MH3A 3HSFA 3PNTB 4HOSA 1JJ6C 3ZQFA 2RFMA 3DBSA 1RC9A 1YW7A 4HI9A 3V2OA 3HX1A 5FT9A 4F7AA 1MNEA 2PX9A 1T38A 2H27A 4A2UA 2CRGA 1SMTA 2OV7A 5BPDA 4JX4A 4BDZA 4MQVA 2PJRA 3S1NJ 2ECBA 2QF7A